(data stored in SCRATCH3701 zone)

EMBL: CP001252

ID   CP001252; SV 1; circular; genomic DNA; STD; PRO; 5145902 BP.
AC   CP001252; ABAU01000000-ABAU01000145;
PR   Project:PRJNA17985;
DT   29-DEC-2008 (Rel. 98, Created)
DT   11-SEP-2019 (Rel. 142, Last updated, Version 7)
DE   Shewanella baltica OS223 chromosome, complete genome.
KW   .
OS   Shewanella baltica OS223
OC   Bacteria; Proteobacteria; Gammaproteobacteria; Alteromonadales;
OC   Shewanellaceae; Shewanella.
RN   [1]
RP   1-5145902
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Meincke L., Brettin T.,
RA   Detter J.C., Han C., Kuske C.R., Larimer F., Land M., Hauser L.,
RA   Kyrpides N., Ovchinnikova G., Brettar I., Rodrigues J., Konstantinidis K.,
RA   Tiedje J.;
RT   "Complete sequence of chromosome of Shewanella baltica OS223";
RL   Unpublished.
RN   [2]
RP   1-5145902
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Meincke L., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Brettar I., Rodrigues J., Konstantinidis K., Tiedje J.;
RT   ;
RL   Submitted (04-DEC-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
RN   [3]
RC   Protein update by submitter
RP   1-5145902
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Chertkov O., Meincke L., Brettin T., Detter J.C.,
RA   Han C., Kuske C.R., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ovchinnikova G., Brettar I., Rodrigues J., Konstantinidis K., Tiedje J.;
RT   ;
RL   Submitted (11-MAR-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
DR   MD5; 2f60b968521e0e28aee13d6583c4f14e.
DR   BioSample; SAMN00623062.
DR   EnsemblGenomes-Gn; EBG00001223439.
DR   EnsemblGenomes-Gn; EBG00001223440.
DR   EnsemblGenomes-Gn; EBG00001223441.
DR   EnsemblGenomes-Gn; EBG00001223442.
DR   EnsemblGenomes-Gn; EBG00001223443.
DR   EnsemblGenomes-Gn; EBG00001223444.
DR   EnsemblGenomes-Gn; EBG00001223445.
DR   EnsemblGenomes-Gn; EBG00001223446.
DR   EnsemblGenomes-Gn; EBG00001223447.
DR   EnsemblGenomes-Gn; EBG00001223448.
DR   EnsemblGenomes-Gn; EBG00001223449.
DR   EnsemblGenomes-Gn; EBG00001223450.
DR   EnsemblGenomes-Gn; EBG00001223451.
DR   EnsemblGenomes-Gn; EBG00001223452.
DR   EnsemblGenomes-Gn; EBG00001223453.
DR   EnsemblGenomes-Gn; EBG00001223454.
DR   EnsemblGenomes-Gn; EBG00001223455.
DR   EnsemblGenomes-Gn; EBG00001223456.
DR   EnsemblGenomes-Gn; EBG00001223457.
DR   EnsemblGenomes-Gn; EBG00001223458.
DR   EnsemblGenomes-Gn; EBG00001223459.
DR   EnsemblGenomes-Gn; EBG00001223460.
DR   EnsemblGenomes-Gn; EBG00001223461.
DR   EnsemblGenomes-Gn; EBG00001223462.
DR   EnsemblGenomes-Gn; EBG00001223463.
DR   EnsemblGenomes-Gn; EBG00001223464.
DR   EnsemblGenomes-Gn; EBG00001223465.
DR   EnsemblGenomes-Gn; EBG00001223466.
DR   EnsemblGenomes-Gn; EBG00001223467.
DR   EnsemblGenomes-Gn; EBG00001223468.
DR   EnsemblGenomes-Gn; EBG00001223469.
DR   EnsemblGenomes-Gn; EBG00001223470.
DR   EnsemblGenomes-Gn; EBG00001223471.
DR   EnsemblGenomes-Gn; EBG00001223472.
DR   EnsemblGenomes-Gn; EBG00001223473.
DR   EnsemblGenomes-Gn; EBG00001223474.
DR   EnsemblGenomes-Gn; EBG00001223475.
DR   EnsemblGenomes-Gn; EBG00001223476.
DR   EnsemblGenomes-Gn; EBG00001223477.
DR   EnsemblGenomes-Gn; EBG00001223478.
DR   EnsemblGenomes-Gn; EBG00001223479.
DR   EnsemblGenomes-Gn; EBG00001223480.
DR   EnsemblGenomes-Gn; EBG00001223481.
DR   EnsemblGenomes-Gn; EBG00001223482.
DR   EnsemblGenomes-Gn; EBG00001223483.
DR   EnsemblGenomes-Gn; EBG00001223484.
DR   EnsemblGenomes-Gn; EBG00001223485.
DR   EnsemblGenomes-Gn; EBG00001223486.
DR   EnsemblGenomes-Gn; EBG00001223487.
DR   EnsemblGenomes-Gn; EBG00001223488.
DR   EnsemblGenomes-Gn; EBG00001223489.
DR   EnsemblGenomes-Gn; EBG00001223490.
DR   EnsemblGenomes-Gn; EBG00001223491.
DR   EnsemblGenomes-Gn; EBG00001223492.
DR   EnsemblGenomes-Gn; EBG00001223493.
DR   EnsemblGenomes-Gn; EBG00001223494.
DR   EnsemblGenomes-Gn; EBG00001223495.
DR   EnsemblGenomes-Gn; EBG00001223496.
DR   EnsemblGenomes-Gn; EBG00001223497.
DR   EnsemblGenomes-Gn; EBG00001223498.
DR   EnsemblGenomes-Gn; EBG00001223499.
DR   EnsemblGenomes-Gn; EBG00001223500.
DR   EnsemblGenomes-Gn; EBG00001223501.
DR   EnsemblGenomes-Gn; EBG00001223502.
DR   EnsemblGenomes-Gn; EBG00001223503.
DR   EnsemblGenomes-Gn; EBG00001223504.
DR   EnsemblGenomes-Gn; EBG00001223505.
DR   EnsemblGenomes-Gn; EBG00001223506.
DR   EnsemblGenomes-Gn; EBG00001223507.
DR   EnsemblGenomes-Gn; EBG00001223508.
DR   EnsemblGenomes-Gn; EBG00001223509.
DR   EnsemblGenomes-Gn; EBG00001223510.
DR   EnsemblGenomes-Gn; EBG00001223511.
DR   EnsemblGenomes-Gn; EBG00001223512.
DR   EnsemblGenomes-Gn; EBG00001223513.
DR   EnsemblGenomes-Gn; EBG00001223514.
DR   EnsemblGenomes-Gn; EBG00001223515.
DR   EnsemblGenomes-Gn; EBG00001223516.
DR   EnsemblGenomes-Gn; EBG00001223517.
DR   EnsemblGenomes-Gn; EBG00001223518.
DR   EnsemblGenomes-Gn; EBG00001223519.
DR   EnsemblGenomes-Gn; EBG00001223520.
DR   EnsemblGenomes-Gn; EBG00001223521.
DR   EnsemblGenomes-Gn; EBG00001223522.
DR   EnsemblGenomes-Gn; EBG00001223523.
DR   EnsemblGenomes-Gn; EBG00001223524.
DR   EnsemblGenomes-Gn; EBG00001223525.
DR   EnsemblGenomes-Gn; EBG00001223526.
DR   EnsemblGenomes-Gn; EBG00001223527.
DR   EnsemblGenomes-Gn; EBG00001223528.
DR   EnsemblGenomes-Gn; EBG00001223529.
DR   EnsemblGenomes-Gn; EBG00001223530.
DR   EnsemblGenomes-Gn; EBG00001223531.
DR   EnsemblGenomes-Gn; EBG00001223532.
DR   EnsemblGenomes-Gn; EBG00001223533.
DR   EnsemblGenomes-Gn; EBG00001223534.
DR   EnsemblGenomes-Gn; EBG00001223535.
DR   EnsemblGenomes-Gn; EBG00001223536.
DR   EnsemblGenomes-Gn; EBG00001223537.
DR   EnsemblGenomes-Gn; EBG00001223538.
DR   EnsemblGenomes-Gn; EBG00001223539.
DR   EnsemblGenomes-Gn; EBG00001223540.
DR   EnsemblGenomes-Gn; EBG00001223541.
DR   EnsemblGenomes-Gn; EBG00001223542.
DR   EnsemblGenomes-Gn; EBG00001223543.
DR   EnsemblGenomes-Gn; EBG00001223544.
DR   EnsemblGenomes-Gn; EBG00001223545.
DR   EnsemblGenomes-Gn; EBG00001223546.
DR   EnsemblGenomes-Gn; EBG00001223547.
DR   EnsemblGenomes-Gn; EBG00001223548.
DR   EnsemblGenomes-Gn; EBG00001223549.
DR   EnsemblGenomes-Gn; EBG00001223550.
DR   EnsemblGenomes-Gn; EBG00001223551.
DR   EnsemblGenomes-Gn; EBG00001223552.
DR   EnsemblGenomes-Gn; EBG00001223553.
DR   EnsemblGenomes-Gn; EBG00001223554.
DR   EnsemblGenomes-Gn; EBG00001223555.
DR   EnsemblGenomes-Gn; EBG00001223556.
DR   EnsemblGenomes-Gn; EBG00001223557.
DR   EnsemblGenomes-Gn; EBG00001223558.
DR   EnsemblGenomes-Gn; EBG00001223559.
DR   EnsemblGenomes-Gn; EBG00001223560.
DR   EnsemblGenomes-Gn; EBG00001223561.
DR   EnsemblGenomes-Gn; EBG00001223562.
DR   EnsemblGenomes-Gn; EBG00001223563.
DR   EnsemblGenomes-Gn; EBG00001223564.
DR   EnsemblGenomes-Gn; EBG00001223565.
DR   EnsemblGenomes-Gn; EBG00001223566.
DR   EnsemblGenomes-Gn; EBG00001223567.
DR   EnsemblGenomes-Gn; EBG00001223568.
DR   EnsemblGenomes-Gn; EBG00001223569.
DR   EnsemblGenomes-Gn; EBG00001223570.
DR   EnsemblGenomes-Gn; EBG00001223571.
DR   EnsemblGenomes-Gn; EBG00001223572.
DR   EnsemblGenomes-Gn; EBG00001223573.
DR   EnsemblGenomes-Gn; EBG00001223574.
DR   EnsemblGenomes-Gn; EBG00001223575.
DR   EnsemblGenomes-Gn; EBG00001223576.
DR   EnsemblGenomes-Gn; EBG00001223577.
DR   EnsemblGenomes-Gn; EBG00001223578.
DR   EnsemblGenomes-Gn; EBG00001223579.
DR   EnsemblGenomes-Gn; EBG00001223580.
DR   EnsemblGenomes-Gn; EBG00001223581.
DR   EnsemblGenomes-Gn; EBG00001223582.
DR   EnsemblGenomes-Gn; EBG00001223583.
DR   EnsemblGenomes-Gn; EBG00001223584.
DR   EnsemblGenomes-Gn; EBG00001223585.
DR   EnsemblGenomes-Gn; EBG00001223586.
DR   EnsemblGenomes-Gn; EBG00001223587.
DR   EnsemblGenomes-Gn; EBG00001223588.
DR   EnsemblGenomes-Gn; EBG00001223589.
DR   EnsemblGenomes-Gn; EBG00001223590.
DR   EnsemblGenomes-Gn; EBG00001223591.
DR   EnsemblGenomes-Gn; EBG00001223592.
DR   EnsemblGenomes-Gn; EBG00001223593.
DR   EnsemblGenomes-Gn; EBG00001223594.
DR   EnsemblGenomes-Gn; EBG00001223595.
DR   EnsemblGenomes-Gn; EBG00001223596.
DR   EnsemblGenomes-Gn; EBG00001223597.
DR   EnsemblGenomes-Gn; Sbal223_R0001.
DR   EnsemblGenomes-Gn; Sbal223_R0002.
DR   EnsemblGenomes-Gn; Sbal223_R0003.
DR   EnsemblGenomes-Gn; Sbal223_R0004.
DR   EnsemblGenomes-Gn; Sbal223_R0005.
DR   EnsemblGenomes-Gn; Sbal223_R0006.
DR   EnsemblGenomes-Gn; Sbal223_R0007.
DR   EnsemblGenomes-Gn; Sbal223_R0008.
DR   EnsemblGenomes-Gn; Sbal223_R0009.
DR   EnsemblGenomes-Gn; Sbal223_R0010.
DR   EnsemblGenomes-Gn; Sbal223_R0011.
DR   EnsemblGenomes-Gn; Sbal223_R0012.
DR   EnsemblGenomes-Gn; Sbal223_R0013.
DR   EnsemblGenomes-Gn; Sbal223_R0014.
DR   EnsemblGenomes-Gn; Sbal223_R0015.
DR   EnsemblGenomes-Gn; Sbal223_R0016.
DR   EnsemblGenomes-Gn; Sbal223_R0017.
DR   EnsemblGenomes-Gn; Sbal223_R0018.
DR   EnsemblGenomes-Gn; Sbal223_R0019.
DR   EnsemblGenomes-Gn; Sbal223_R0020.
DR   EnsemblGenomes-Gn; Sbal223_R0021.
DR   EnsemblGenomes-Gn; Sbal223_R0022.
DR   EnsemblGenomes-Gn; Sbal223_R0023.
DR   EnsemblGenomes-Gn; Sbal223_R0024.
DR   EnsemblGenomes-Gn; Sbal223_R0025.
DR   EnsemblGenomes-Gn; Sbal223_R0026.
DR   EnsemblGenomes-Gn; Sbal223_R0027.
DR   EnsemblGenomes-Gn; Sbal223_R0028.
DR   EnsemblGenomes-Gn; Sbal223_R0029.
DR   EnsemblGenomes-Gn; Sbal223_R0030.
DR   EnsemblGenomes-Gn; Sbal223_R0031.
DR   EnsemblGenomes-Gn; Sbal223_R0032.
DR   EnsemblGenomes-Gn; Sbal223_R0033.
DR   EnsemblGenomes-Gn; Sbal223_R0034.
DR   EnsemblGenomes-Gn; Sbal223_R0035.
DR   EnsemblGenomes-Gn; Sbal223_R0036.
DR   EnsemblGenomes-Gn; Sbal223_R0037.
DR   EnsemblGenomes-Gn; Sbal223_R0038.
DR   EnsemblGenomes-Gn; Sbal223_R0039.
DR   EnsemblGenomes-Gn; Sbal223_R0040.
DR   EnsemblGenomes-Gn; Sbal223_R0041.
DR   EnsemblGenomes-Gn; Sbal223_R0042.
DR   EnsemblGenomes-Gn; Sbal223_R0043.
DR   EnsemblGenomes-Gn; Sbal223_R0044.
DR   EnsemblGenomes-Gn; Sbal223_R0045.
DR   EnsemblGenomes-Gn; Sbal223_R0046.
DR   EnsemblGenomes-Gn; Sbal223_R0047.
DR   EnsemblGenomes-Gn; Sbal223_R0048.
DR   EnsemblGenomes-Gn; Sbal223_R0049.
DR   EnsemblGenomes-Gn; Sbal223_R0050.
DR   EnsemblGenomes-Gn; Sbal223_R0051.
DR   EnsemblGenomes-Gn; Sbal223_R0052.
DR   EnsemblGenomes-Gn; Sbal223_R0053.
DR   EnsemblGenomes-Gn; Sbal223_R0054.
DR   EnsemblGenomes-Gn; Sbal223_R0055.
DR   EnsemblGenomes-Gn; Sbal223_R0056.
DR   EnsemblGenomes-Gn; Sbal223_R0057.
DR   EnsemblGenomes-Gn; Sbal223_R0058.
DR   EnsemblGenomes-Gn; Sbal223_R0059.
DR   EnsemblGenomes-Gn; Sbal223_R0060.
DR   EnsemblGenomes-Gn; Sbal223_R0061.
DR   EnsemblGenomes-Gn; Sbal223_R0062.
DR   EnsemblGenomes-Gn; Sbal223_R0063.
DR   EnsemblGenomes-Gn; Sbal223_R0064.
DR   EnsemblGenomes-Gn; Sbal223_R0065.
DR   EnsemblGenomes-Gn; Sbal223_R0066.
DR   EnsemblGenomes-Gn; Sbal223_R0067.
DR   EnsemblGenomes-Gn; Sbal223_R0068.
DR   EnsemblGenomes-Gn; Sbal223_R0069.
DR   EnsemblGenomes-Gn; Sbal223_R0070.
DR   EnsemblGenomes-Gn; Sbal223_R0071.
DR   EnsemblGenomes-Gn; Sbal223_R0072.
DR   EnsemblGenomes-Gn; Sbal223_R0073.
DR   EnsemblGenomes-Gn; Sbal223_R0074.
DR   EnsemblGenomes-Gn; Sbal223_R0075.
DR   EnsemblGenomes-Gn; Sbal223_R0076.
DR   EnsemblGenomes-Gn; Sbal223_R0077.
DR   EnsemblGenomes-Gn; Sbal223_R0078.
DR   EnsemblGenomes-Gn; Sbal223_R0079.
DR   EnsemblGenomes-Gn; Sbal223_R0080.
DR   EnsemblGenomes-Gn; Sbal223_R0081.
DR   EnsemblGenomes-Gn; Sbal223_R0082.
DR   EnsemblGenomes-Gn; Sbal223_R0083.
DR   EnsemblGenomes-Gn; Sbal223_R0084.
DR   EnsemblGenomes-Gn; Sbal223_R0085.
DR   EnsemblGenomes-Gn; Sbal223_R0086.
DR   EnsemblGenomes-Gn; Sbal223_R0087.
DR   EnsemblGenomes-Gn; Sbal223_R0088.
DR   EnsemblGenomes-Gn; Sbal223_R0089.
DR   EnsemblGenomes-Gn; Sbal223_R0090.
DR   EnsemblGenomes-Gn; Sbal223_R0091.
DR   EnsemblGenomes-Gn; Sbal223_R0092.
DR   EnsemblGenomes-Gn; Sbal223_R0093.
DR   EnsemblGenomes-Gn; Sbal223_R0094.
DR   EnsemblGenomes-Gn; Sbal223_R0095.
DR   EnsemblGenomes-Gn; Sbal223_R0096.
DR   EnsemblGenomes-Gn; Sbal223_R0097.
DR   EnsemblGenomes-Gn; Sbal223_R0098.
DR   EnsemblGenomes-Gn; Sbal223_R0099.
DR   EnsemblGenomes-Gn; Sbal223_R0100.
DR   EnsemblGenomes-Gn; Sbal223_R0101.
DR   EnsemblGenomes-Gn; Sbal223_R0102.
DR   EnsemblGenomes-Gn; Sbal223_R0103.
DR   EnsemblGenomes-Gn; Sbal223_R0104.
DR   EnsemblGenomes-Gn; Sbal223_R0105.
DR   EnsemblGenomes-Gn; Sbal223_R0106.
DR   EnsemblGenomes-Gn; Sbal223_R0107.
DR   EnsemblGenomes-Gn; Sbal223_R0108.
DR   EnsemblGenomes-Gn; Sbal223_R0109.
DR   EnsemblGenomes-Gn; Sbal223_R0110.
DR   EnsemblGenomes-Gn; Sbal223_R0111.
DR   EnsemblGenomes-Gn; Sbal223_R0112.
DR   EnsemblGenomes-Gn; Sbal223_R0113.
DR   EnsemblGenomes-Gn; Sbal223_R0114.
DR   EnsemblGenomes-Gn; Sbal223_R0115.
DR   EnsemblGenomes-Gn; Sbal223_R0116.
DR   EnsemblGenomes-Gn; Sbal223_R0117.
DR   EnsemblGenomes-Gn; Sbal223_R0118.
DR   EnsemblGenomes-Gn; Sbal223_R0119.
DR   EnsemblGenomes-Gn; Sbal223_R0120.
DR   EnsemblGenomes-Gn; Sbal223_R0121.
DR   EnsemblGenomes-Gn; Sbal223_R0122.
DR   EnsemblGenomes-Gn; Sbal223_R0123.
DR   EnsemblGenomes-Gn; Sbal223_R0124.
DR   EnsemblGenomes-Gn; Sbal223_R0125.
DR   EnsemblGenomes-Gn; Sbal223_R0126.
DR   EnsemblGenomes-Gn; Sbal223_R0127.
DR   EnsemblGenomes-Gn; Sbal223_R0128.
DR   EnsemblGenomes-Gn; Sbal223_R0129.
DR   EnsemblGenomes-Gn; Sbal223_R0130.
DR   EnsemblGenomes-Gn; Sbal223_R0131.
DR   EnsemblGenomes-Gn; Sbal223_R0132.
DR   EnsemblGenomes-Gn; Sbal223_R0133.
DR   EnsemblGenomes-Gn; Sbal223_R0134.
DR   EnsemblGenomes-Gn; Sbal223_R0135.
DR   EnsemblGenomes-Gn; Sbal223_R0136.
DR   EnsemblGenomes-Gn; Sbal223_R0137.
DR   EnsemblGenomes-Gn; Sbal223_R0138.
DR   EnsemblGenomes-Gn; Sbal223_R0139.
DR   EnsemblGenomes-Gn; Sbal223_R0140.
DR   EnsemblGenomes-Gn; Sbal223_R0141.
DR   EnsemblGenomes-Gn; Sbal223_R0142.
DR   EnsemblGenomes-Gn; Sbal223_R0143.
DR   EnsemblGenomes-Tr; EBT00001792212.
DR   EnsemblGenomes-Tr; EBT00001792213.
DR   EnsemblGenomes-Tr; EBT00001792214.
DR   EnsemblGenomes-Tr; EBT00001792215.
DR   EnsemblGenomes-Tr; EBT00001792216.
DR   EnsemblGenomes-Tr; EBT00001792217.
DR   EnsemblGenomes-Tr; EBT00001792218.
DR   EnsemblGenomes-Tr; EBT00001792219.
DR   EnsemblGenomes-Tr; EBT00001792220.
DR   EnsemblGenomes-Tr; EBT00001792221.
DR   EnsemblGenomes-Tr; EBT00001792222.
DR   EnsemblGenomes-Tr; EBT00001792223.
DR   EnsemblGenomes-Tr; EBT00001792224.
DR   EnsemblGenomes-Tr; EBT00001792225.
DR   EnsemblGenomes-Tr; EBT00001792226.
DR   EnsemblGenomes-Tr; EBT00001792227.
DR   EnsemblGenomes-Tr; EBT00001792228.
DR   EnsemblGenomes-Tr; EBT00001792229.
DR   EnsemblGenomes-Tr; EBT00001792230.
DR   EnsemblGenomes-Tr; EBT00001792231.
DR   EnsemblGenomes-Tr; EBT00001792232.
DR   EnsemblGenomes-Tr; EBT00001792233.
DR   EnsemblGenomes-Tr; EBT00001792234.
DR   EnsemblGenomes-Tr; EBT00001792235.
DR   EnsemblGenomes-Tr; EBT00001792236.
DR   EnsemblGenomes-Tr; EBT00001792237.
DR   EnsemblGenomes-Tr; EBT00001792238.
DR   EnsemblGenomes-Tr; EBT00001792239.
DR   EnsemblGenomes-Tr; EBT00001792240.
DR   EnsemblGenomes-Tr; EBT00001792241.
DR   EnsemblGenomes-Tr; EBT00001792242.
DR   EnsemblGenomes-Tr; EBT00001792243.
DR   EnsemblGenomes-Tr; EBT00001792244.
DR   EnsemblGenomes-Tr; EBT00001792245.
DR   EnsemblGenomes-Tr; EBT00001792246.
DR   EnsemblGenomes-Tr; EBT00001792247.
DR   EnsemblGenomes-Tr; EBT00001792248.
DR   EnsemblGenomes-Tr; EBT00001792249.
DR   EnsemblGenomes-Tr; EBT00001792250.
DR   EnsemblGenomes-Tr; EBT00001792251.
DR   EnsemblGenomes-Tr; EBT00001792252.
DR   EnsemblGenomes-Tr; EBT00001792253.
DR   EnsemblGenomes-Tr; EBT00001792254.
DR   EnsemblGenomes-Tr; EBT00001792255.
DR   EnsemblGenomes-Tr; EBT00001792256.
DR   EnsemblGenomes-Tr; EBT00001792257.
DR   EnsemblGenomes-Tr; EBT00001792258.
DR   EnsemblGenomes-Tr; EBT00001792259.
DR   EnsemblGenomes-Tr; EBT00001792260.
DR   EnsemblGenomes-Tr; EBT00001792261.
DR   EnsemblGenomes-Tr; EBT00001792262.
DR   EnsemblGenomes-Tr; EBT00001792263.
DR   EnsemblGenomes-Tr; EBT00001792264.
DR   EnsemblGenomes-Tr; EBT00001792265.
DR   EnsemblGenomes-Tr; EBT00001792266.
DR   EnsemblGenomes-Tr; EBT00001792267.
DR   EnsemblGenomes-Tr; EBT00001792268.
DR   EnsemblGenomes-Tr; EBT00001792269.
DR   EnsemblGenomes-Tr; EBT00001792270.
DR   EnsemblGenomes-Tr; EBT00001792271.
DR   EnsemblGenomes-Tr; EBT00001792272.
DR   EnsemblGenomes-Tr; EBT00001792273.
DR   EnsemblGenomes-Tr; EBT00001792274.
DR   EnsemblGenomes-Tr; EBT00001792275.
DR   EnsemblGenomes-Tr; EBT00001792276.
DR   EnsemblGenomes-Tr; EBT00001792277.
DR   EnsemblGenomes-Tr; EBT00001792278.
DR   EnsemblGenomes-Tr; EBT00001792279.
DR   EnsemblGenomes-Tr; EBT00001792280.
DR   EnsemblGenomes-Tr; EBT00001792281.
DR   EnsemblGenomes-Tr; EBT00001792282.
DR   EnsemblGenomes-Tr; EBT00001792283.
DR   EnsemblGenomes-Tr; EBT00001792284.
DR   EnsemblGenomes-Tr; EBT00001792285.
DR   EnsemblGenomes-Tr; EBT00001792286.
DR   EnsemblGenomes-Tr; EBT00001792287.
DR   EnsemblGenomes-Tr; EBT00001792288.
DR   EnsemblGenomes-Tr; EBT00001792289.
DR   EnsemblGenomes-Tr; EBT00001792290.
DR   EnsemblGenomes-Tr; EBT00001792291.
DR   EnsemblGenomes-Tr; EBT00001792292.
DR   EnsemblGenomes-Tr; EBT00001792293.
DR   EnsemblGenomes-Tr; EBT00001792294.
DR   EnsemblGenomes-Tr; EBT00001792295.
DR   EnsemblGenomes-Tr; EBT00001792296.
DR   EnsemblGenomes-Tr; EBT00001792297.
DR   EnsemblGenomes-Tr; EBT00001792298.
DR   EnsemblGenomes-Tr; EBT00001792299.
DR   EnsemblGenomes-Tr; EBT00001792300.
DR   EnsemblGenomes-Tr; EBT00001792301.
DR   EnsemblGenomes-Tr; EBT00001792302.
DR   EnsemblGenomes-Tr; EBT00001792303.
DR   EnsemblGenomes-Tr; EBT00001792304.
DR   EnsemblGenomes-Tr; EBT00001792305.
DR   EnsemblGenomes-Tr; EBT00001792306.
DR   EnsemblGenomes-Tr; EBT00001792307.
DR   EnsemblGenomes-Tr; EBT00001792308.
DR   EnsemblGenomes-Tr; EBT00001792309.
DR   EnsemblGenomes-Tr; EBT00001792310.
DR   EnsemblGenomes-Tr; EBT00001792311.
DR   EnsemblGenomes-Tr; EBT00001792312.
DR   EnsemblGenomes-Tr; EBT00001792313.
DR   EnsemblGenomes-Tr; EBT00001792314.
DR   EnsemblGenomes-Tr; EBT00001792315.
DR   EnsemblGenomes-Tr; EBT00001792316.
DR   EnsemblGenomes-Tr; EBT00001792317.
DR   EnsemblGenomes-Tr; EBT00001792318.
DR   EnsemblGenomes-Tr; EBT00001792319.
DR   EnsemblGenomes-Tr; EBT00001792320.
DR   EnsemblGenomes-Tr; EBT00001792321.
DR   EnsemblGenomes-Tr; EBT00001792322.
DR   EnsemblGenomes-Tr; EBT00001792323.
DR   EnsemblGenomes-Tr; EBT00001792324.
DR   EnsemblGenomes-Tr; EBT00001792325.
DR   EnsemblGenomes-Tr; EBT00001792326.
DR   EnsemblGenomes-Tr; EBT00001792327.
DR   EnsemblGenomes-Tr; EBT00001792328.
DR   EnsemblGenomes-Tr; EBT00001792329.
DR   EnsemblGenomes-Tr; EBT00001792330.
DR   EnsemblGenomes-Tr; EBT00001792331.
DR   EnsemblGenomes-Tr; EBT00001792332.
DR   EnsemblGenomes-Tr; EBT00001792333.
DR   EnsemblGenomes-Tr; EBT00001792334.
DR   EnsemblGenomes-Tr; EBT00001792335.
DR   EnsemblGenomes-Tr; EBT00001792336.
DR   EnsemblGenomes-Tr; EBT00001792337.
DR   EnsemblGenomes-Tr; EBT00001792338.
DR   EnsemblGenomes-Tr; EBT00001792339.
DR   EnsemblGenomes-Tr; EBT00001792340.
DR   EnsemblGenomes-Tr; EBT00001792341.
DR   EnsemblGenomes-Tr; EBT00001792342.
DR   EnsemblGenomes-Tr; EBT00001792343.
DR   EnsemblGenomes-Tr; EBT00001792344.
DR   EnsemblGenomes-Tr; EBT00001792345.
DR   EnsemblGenomes-Tr; EBT00001792346.
DR   EnsemblGenomes-Tr; EBT00001792347.
DR   EnsemblGenomes-Tr; EBT00001792348.
DR   EnsemblGenomes-Tr; EBT00001792349.
DR   EnsemblGenomes-Tr; EBT00001792350.
DR   EnsemblGenomes-Tr; EBT00001792351.
DR   EnsemblGenomes-Tr; EBT00001792352.
DR   EnsemblGenomes-Tr; EBT00001792353.
DR   EnsemblGenomes-Tr; EBT00001792354.
DR   EnsemblGenomes-Tr; EBT00001792355.
DR   EnsemblGenomes-Tr; EBT00001792356.
DR   EnsemblGenomes-Tr; EBT00001792357.
DR   EnsemblGenomes-Tr; EBT00001792358.
DR   EnsemblGenomes-Tr; EBT00001792359.
DR   EnsemblGenomes-Tr; EBT00001792360.
DR   EnsemblGenomes-Tr; EBT00001792361.
DR   EnsemblGenomes-Tr; EBT00001792362.
DR   EnsemblGenomes-Tr; EBT00001792363.
DR   EnsemblGenomes-Tr; EBT00001792364.
DR   EnsemblGenomes-Tr; EBT00001792365.
DR   EnsemblGenomes-Tr; EBT00001792366.
DR   EnsemblGenomes-Tr; EBT00001792367.
DR   EnsemblGenomes-Tr; EBT00001792368.
DR   EnsemblGenomes-Tr; EBT00001792369.
DR   EnsemblGenomes-Tr; EBT00001792370.
DR   EnsemblGenomes-Tr; Sbal223_R0001-1.
DR   EnsemblGenomes-Tr; Sbal223_R0002-1.
DR   EnsemblGenomes-Tr; Sbal223_R0003-1.
DR   EnsemblGenomes-Tr; Sbal223_R0004-1.
DR   EnsemblGenomes-Tr; Sbal223_R0005-1.
DR   EnsemblGenomes-Tr; Sbal223_R0006-1.
DR   EnsemblGenomes-Tr; Sbal223_R0007-1.
DR   EnsemblGenomes-Tr; Sbal223_R0008-1.
DR   EnsemblGenomes-Tr; Sbal223_R0009-1.
DR   EnsemblGenomes-Tr; Sbal223_R0010-1.
DR   EnsemblGenomes-Tr; Sbal223_R0011-1.
DR   EnsemblGenomes-Tr; Sbal223_R0012-1.
DR   EnsemblGenomes-Tr; Sbal223_R0013-1.
DR   EnsemblGenomes-Tr; Sbal223_R0014-1.
DR   EnsemblGenomes-Tr; Sbal223_R0015-1.
DR   EnsemblGenomes-Tr; Sbal223_R0016-1.
DR   EnsemblGenomes-Tr; Sbal223_R0017-1.
DR   EnsemblGenomes-Tr; Sbal223_R0018-1.
DR   EnsemblGenomes-Tr; Sbal223_R0019-1.
DR   EnsemblGenomes-Tr; Sbal223_R0020-1.
DR   EnsemblGenomes-Tr; Sbal223_R0021-1.
DR   EnsemblGenomes-Tr; Sbal223_R0022-1.
DR   EnsemblGenomes-Tr; Sbal223_R0023-1.
DR   EnsemblGenomes-Tr; Sbal223_R0024-1.
DR   EnsemblGenomes-Tr; Sbal223_R0025-1.
DR   EnsemblGenomes-Tr; Sbal223_R0026-1.
DR   EnsemblGenomes-Tr; Sbal223_R0027-1.
DR   EnsemblGenomes-Tr; Sbal223_R0028-1.
DR   EnsemblGenomes-Tr; Sbal223_R0029-1.
DR   EnsemblGenomes-Tr; Sbal223_R0030-1.
DR   EnsemblGenomes-Tr; Sbal223_R0031-1.
DR   EnsemblGenomes-Tr; Sbal223_R0032-1.
DR   EnsemblGenomes-Tr; Sbal223_R0033-1.
DR   EnsemblGenomes-Tr; Sbal223_R0034-1.
DR   EnsemblGenomes-Tr; Sbal223_R0035-1.
DR   EnsemblGenomes-Tr; Sbal223_R0036-1.
DR   EnsemblGenomes-Tr; Sbal223_R0037-1.
DR   EnsemblGenomes-Tr; Sbal223_R0038-1.
DR   EnsemblGenomes-Tr; Sbal223_R0039-1.
DR   EnsemblGenomes-Tr; Sbal223_R0040-1.
DR   EnsemblGenomes-Tr; Sbal223_R0041-1.
DR   EnsemblGenomes-Tr; Sbal223_R0042-1.
DR   EnsemblGenomes-Tr; Sbal223_R0043-1.
DR   EnsemblGenomes-Tr; Sbal223_R0044-1.
DR   EnsemblGenomes-Tr; Sbal223_R0045-1.
DR   EnsemblGenomes-Tr; Sbal223_R0046-1.
DR   EnsemblGenomes-Tr; Sbal223_R0047-1.
DR   EnsemblGenomes-Tr; Sbal223_R0048-1.
DR   EnsemblGenomes-Tr; Sbal223_R0049-1.
DR   EnsemblGenomes-Tr; Sbal223_R0050-1.
DR   EnsemblGenomes-Tr; Sbal223_R0051-1.
DR   EnsemblGenomes-Tr; Sbal223_R0052-1.
DR   EnsemblGenomes-Tr; Sbal223_R0053-1.
DR   EnsemblGenomes-Tr; Sbal223_R0054-1.
DR   EnsemblGenomes-Tr; Sbal223_R0055-1.
DR   EnsemblGenomes-Tr; Sbal223_R0056-1.
DR   EnsemblGenomes-Tr; Sbal223_R0057-1.
DR   EnsemblGenomes-Tr; Sbal223_R0058-1.
DR   EnsemblGenomes-Tr; Sbal223_R0059-1.
DR   EnsemblGenomes-Tr; Sbal223_R0060-1.
DR   EnsemblGenomes-Tr; Sbal223_R0061-1.
DR   EnsemblGenomes-Tr; Sbal223_R0062-1.
DR   EnsemblGenomes-Tr; Sbal223_R0063-1.
DR   EnsemblGenomes-Tr; Sbal223_R0064-1.
DR   EnsemblGenomes-Tr; Sbal223_R0065-1.
DR   EnsemblGenomes-Tr; Sbal223_R0066-1.
DR   EnsemblGenomes-Tr; Sbal223_R0067-1.
DR   EnsemblGenomes-Tr; Sbal223_R0068-1.
DR   EnsemblGenomes-Tr; Sbal223_R0069-1.
DR   EnsemblGenomes-Tr; Sbal223_R0070-1.
DR   EnsemblGenomes-Tr; Sbal223_R0071-1.
DR   EnsemblGenomes-Tr; Sbal223_R0072-1.
DR   EnsemblGenomes-Tr; Sbal223_R0073-1.
DR   EnsemblGenomes-Tr; Sbal223_R0074-1.
DR   EnsemblGenomes-Tr; Sbal223_R0075-1.
DR   EnsemblGenomes-Tr; Sbal223_R0076-1.
DR   EnsemblGenomes-Tr; Sbal223_R0077-1.
DR   EnsemblGenomes-Tr; Sbal223_R0078-1.
DR   EnsemblGenomes-Tr; Sbal223_R0079-1.
DR   EnsemblGenomes-Tr; Sbal223_R0080-1.
DR   EnsemblGenomes-Tr; Sbal223_R0081-1.
DR   EnsemblGenomes-Tr; Sbal223_R0082-1.
DR   EnsemblGenomes-Tr; Sbal223_R0083-1.
DR   EnsemblGenomes-Tr; Sbal223_R0084-1.
DR   EnsemblGenomes-Tr; Sbal223_R0085-1.
DR   EnsemblGenomes-Tr; Sbal223_R0086-1.
DR   EnsemblGenomes-Tr; Sbal223_R0087-1.
DR   EnsemblGenomes-Tr; Sbal223_R0088-1.
DR   EnsemblGenomes-Tr; Sbal223_R0089-1.
DR   EnsemblGenomes-Tr; Sbal223_R0090-1.
DR   EnsemblGenomes-Tr; Sbal223_R0091-1.
DR   EnsemblGenomes-Tr; Sbal223_R0092-1.
DR   EnsemblGenomes-Tr; Sbal223_R0093-1.
DR   EnsemblGenomes-Tr; Sbal223_R0094-1.
DR   EnsemblGenomes-Tr; Sbal223_R0095-1.
DR   EnsemblGenomes-Tr; Sbal223_R0096-1.
DR   EnsemblGenomes-Tr; Sbal223_R0097-1.
DR   EnsemblGenomes-Tr; Sbal223_R0098-1.
DR   EnsemblGenomes-Tr; Sbal223_R0099-1.
DR   EnsemblGenomes-Tr; Sbal223_R0100-1.
DR   EnsemblGenomes-Tr; Sbal223_R0101-1.
DR   EnsemblGenomes-Tr; Sbal223_R0102-1.
DR   EnsemblGenomes-Tr; Sbal223_R0103-1.
DR   EnsemblGenomes-Tr; Sbal223_R0104-1.
DR   EnsemblGenomes-Tr; Sbal223_R0105-1.
DR   EnsemblGenomes-Tr; Sbal223_R0106-1.
DR   EnsemblGenomes-Tr; Sbal223_R0107-1.
DR   EnsemblGenomes-Tr; Sbal223_R0108-1.
DR   EnsemblGenomes-Tr; Sbal223_R0109-1.
DR   EnsemblGenomes-Tr; Sbal223_R0110-1.
DR   EnsemblGenomes-Tr; Sbal223_R0111-1.
DR   EnsemblGenomes-Tr; Sbal223_R0112-1.
DR   EnsemblGenomes-Tr; Sbal223_R0113-1.
DR   EnsemblGenomes-Tr; Sbal223_R0114-1.
DR   EnsemblGenomes-Tr; Sbal223_R0115-1.
DR   EnsemblGenomes-Tr; Sbal223_R0116-1.
DR   EnsemblGenomes-Tr; Sbal223_R0117-1.
DR   EnsemblGenomes-Tr; Sbal223_R0118-1.
DR   EnsemblGenomes-Tr; Sbal223_R0119-1.
DR   EnsemblGenomes-Tr; Sbal223_R0120-1.
DR   EnsemblGenomes-Tr; Sbal223_R0121-1.
DR   EnsemblGenomes-Tr; Sbal223_R0122-1.
DR   EnsemblGenomes-Tr; Sbal223_R0123-1.
DR   EnsemblGenomes-Tr; Sbal223_R0124-1.
DR   EnsemblGenomes-Tr; Sbal223_R0125-1.
DR   EnsemblGenomes-Tr; Sbal223_R0126-1.
DR   EnsemblGenomes-Tr; Sbal223_R0127-1.
DR   EnsemblGenomes-Tr; Sbal223_R0128-1.
DR   EnsemblGenomes-Tr; Sbal223_R0129-1.
DR   EnsemblGenomes-Tr; Sbal223_R0130-1.
DR   EnsemblGenomes-Tr; Sbal223_R0131-1.
DR   EnsemblGenomes-Tr; Sbal223_R0132-1.
DR   EnsemblGenomes-Tr; Sbal223_R0133-1.
DR   EnsemblGenomes-Tr; Sbal223_R0134-1.
DR   EnsemblGenomes-Tr; Sbal223_R0135-1.
DR   EnsemblGenomes-Tr; Sbal223_R0136-1.
DR   EnsemblGenomes-Tr; Sbal223_R0137-1.
DR   EnsemblGenomes-Tr; Sbal223_R0138-1.
DR   EnsemblGenomes-Tr; Sbal223_R0139-1.
DR   EnsemblGenomes-Tr; Sbal223_R0140-1.
DR   EnsemblGenomes-Tr; Sbal223_R0141-1.
DR   EnsemblGenomes-Tr; Sbal223_R0142-1.
DR   EnsemblGenomes-Tr; Sbal223_R0143-1.
DR   EuropePMC; PMC3256676; 22081398.
DR   EuropePMC; PMC3480492; 23110226.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00018; CsrB.
DR   RFAM; RF00021; Spot_42.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00033; MicF.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00101; SraC_RyeA.
DR   RFAM; RF00111; RyeB.
DR   RFAM; RF00114; S15.
DR   RFAM; RF00127; t44.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00506; Thr_leader.
DR   RFAM; RF00513; Trp_leader.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01055; MOCO_RNA_motif.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01707; JUMPstart.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01859; Phe_leader.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   RFAM; RF02194; HPnc0260.
DR   SILVA-LSU; CP001252.
DR   SILVA-SSU; CP001252.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003209
CC   Source DNA and bacteria available from James Tiedje
CC   (tiedjej@msu.edu)
CC   Contacts: James Tiedje (tiedjej@msu.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
FH   Key             Location/Qualifiers
FT   source          1..5145902
FT                   /organism="Shewanella baltica OS223"
FT                   /strain="OS223"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:407976"
FT   gene            77..1465
FT                   /locus_tag="Sbal223_0001"
FT   CDS_pept        77..1465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: shw:Sputw3181_0001 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44545"
FT                   /db_xref="GOA:B8E3P4"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3P4"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACK44545.1"
FT                   TLSS"
FT   gene            1485..2585
FT                   /locus_tag="Sbal223_0002"
FT   CDS_pept        1485..2585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44546"
FT                   /db_xref="GOA:B8E3P5"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P5"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACK44546.1"
FT   gene            2787..3869
FT                   /locus_tag="Sbal223_0003"
FT   CDS_pept        2787..3869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: shw:Sputw3181_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44547"
FT                   /db_xref="GOA:B8E3P6"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3P6"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACK44547.1"
FT   gene            3886..6303
FT                   /locus_tag="Sbal223_0004"
FT   CDS_pept        3886..6303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0004"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0004 DNA gyrase, B subunit;
FT                   TIGRFAM: DNA gyrase, B subunit; PFAM: DNA gyrase subunit B
FT                   domain protein; ATP-binding region ATPase domain protein;
FT                   TOPRIM domain protein; DNA topoisomerase type IIA subunit B
FT                   region 2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44548"
FT                   /db_xref="GOA:B8E3P7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P7"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACK44548.1"
FT   gene            complement(6418..7080)
FT                   /locus_tag="Sbal223_0005"
FT   CDS_pept        complement(6418..7080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0005"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   son:SO_0012 glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44549"
FT                   /db_xref="GOA:B8E3P8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P8"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACK44549.1"
FT   gene            7321..7623
FT                   /locus_tag="Sbal223_0006"
FT   CDS_pept        7321..7623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0006"
FT                   /product="monoheme cytochrome c"
FT                   /note="KEGG: son:SO_0714 monoheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44550"
FT                   /db_xref="GOA:B8E3P9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P9"
FT                   /inference="similar to AA sequence:KEGG:SO_0714"
FT                   /protein_id="ACK44550.1"
FT   sig_peptide     7321..7389
FT                   /locus_tag="Sbal223_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            7625..8851
FT                   /locus_tag="Sbal223_0007"
FT   CDS_pept        7625..8851
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0007"
FT                   /product="oxidoreductase molybdopterin binding protein"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: son:SO_0715
FT                   oxidoreductase, molybdopterin-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44551"
FT                   /db_xref="GOA:B8E3Q0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q0"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACK44551.1"
FT                   CNRIAVRVV"
FT   gene            8851..9234
FT                   /locus_tag="Sbal223_0008"
FT   CDS_pept        8851..9234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0008"
FT                   /product="monoheme cytochrome c, putative"
FT                   /note="KEGG: son:SO_0716 monoheme cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44552"
FT                   /db_xref="GOA:B8E3Q1"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q1"
FT                   /inference="similar to AA sequence:KEGG:SO_0716"
FT                   /protein_id="ACK44552.1"
FT   sig_peptide     8851..8916
FT                   /locus_tag="Sbal223_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            9231..9566
FT                   /locus_tag="Sbal223_0009"
FT   CDS_pept        9231..9566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0009"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: son:SO_0717
FT                   monoheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44553"
FT                   /db_xref="GOA:B8E3Q2"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q2"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACK44553.1"
FT                   TPNLSAN"
FT   sig_peptide     9231..9293
FT                   /locus_tag="Sbal223_0009"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.942) with cleavage site probability 0.928 at
FT                   residue 21"
FT   gene            complement(9657..10577)
FT                   /locus_tag="Sbal223_0010"
FT   CDS_pept        complement(9657..10577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0010"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; KEGG: saz:Sama_0022 UreA
FT                   carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44554"
FT                   /db_xref="GOA:B8E3Q3"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q3"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ACK44554.1"
FT   gene            10911..11951
FT                   /locus_tag="Sbal223_0011"
FT   CDS_pept        10911..11951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0011"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   spc:Sputcn32_0005 putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44555"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q4"
FT                   /inference="protein motif:PFAM:PF08668"
FT                   /protein_id="ACK44555.1"
FT                   QKLTQF"
FT   gene            complement(12039..14108)
FT                   /locus_tag="Sbal223_0012"
FT   CDS_pept        complement(12039..14108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0012"
FT                   /product="glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0006 glycyl-tRNA synthetase
FT                   subunit beta; TIGRFAM: glycyl-tRNA synthetase, beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44556"
FT                   /db_xref="GOA:B8E3Q5"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3Q5"
FT                   /inference="protein motif:TFAM:TIGR00211"
FT                   /protein_id="ACK44556.1"
FT   gene            complement(14119..15024)
FT                   /locus_tag="Sbal223_0013"
FT   CDS_pept        complement(14119..15024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0013"
FT                   /product="glycyl-tRNA synthetase, alpha subunit"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0007 glycyl-tRNA synthetase
FT                   subunit alpha; TIGRFAM: glycyl-tRNA synthetase, alpha
FT                   subunit; PFAM: glycyl-tRNA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44557"
FT                   /db_xref="GOA:B8E3Q6"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3Q6"
FT                   /inference="protein motif:TFAM:TIGR00388"
FT                   /protein_id="ACK44557.1"
FT   gene            15142..15744
FT                   /locus_tag="Sbal223_0014"
FT   CDS_pept        15142..15744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0014"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number=""
FT                   /note="KEGG: spc:Sputcn32_0008 DNA-3-methyladenine
FT                   glycosylase I; TIGRFAM: DNA-3-methyladenine glycosylase I;
FT                   PFAM: methyladenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44558"
FT                   /db_xref="GOA:B8E3Q7"
FT                   /db_xref="InterPro:IPR004597"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q7"
FT                   /inference="protein motif:TFAM:TIGR00624"
FT                   /protein_id="ACK44558.1"
FT   gene            complement(15944..19132)
FT                   /locus_tag="Sbal223_0015"
FT   CDS_pept        complement(15944..19132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0015"
FT                   /product="amidohydrolase"
FT                   /note="PFAM: peptidase S9B dipeptidylpeptidase IV domain
FT                   protein; amidohydrolase; WD40 domain protein beta
FT                   Propeller; KEGG: shw:Sputw3181_0009 amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44559"
FT                   /db_xref="GOA:B8E3Q8"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q8"
FT                   /inference="protein motif:PFAM:PF01979"
FT                   /protein_id="ACK44559.1"
FT                   GDKEKRKPFFFEKI"
FT   sig_peptide     complement(19058..19132)
FT                   /locus_tag="Sbal223_0015"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 25"
FT   gene            complement(19396..19842)
FT                   /locus_tag="Sbal223_0016"
FT   CDS_pept        complement(19396..19842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0016"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44560"
FT                   /db_xref="GOA:B8E3Q9"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Q9"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0010"
FT                   /protein_id="ACK44560.1"
FT   gene            complement(19890..20135)
FT                   /locus_tag="Sbal223_0017"
FT   CDS_pept        complement(19890..20135)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0017"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: shw:Sputw3181_0011
FT                   SirA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44561"
FT                   /db_xref="GOA:B8E3R0"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR022931"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3R0"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACK44561.1"
FT   gene            complement(20306..21469)
FT                   /locus_tag="Sbal223_0018"
FT   CDS_pept        complement(20306..21469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0018"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: shn:Shewana3_0022 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44562"
FT                   /db_xref="GOA:B8E3R1"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3R1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK44562.1"
FT   gene            complement(21712..22875)
FT                   /locus_tag="Sbal223_0019"
FT   CDS_pept        complement(21712..22875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0019"
FT                   /product="acetyl-CoA C-acyltransferase FadA"
FT                   /EC_number=""
FT                   /note="KEGG: spc:Sputcn32_0012 3-ketoacyl-CoA thiolase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; acetyl-CoA
FT                   C-acyltransferase FadA; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44563"
FT                   /db_xref="GOA:B8E3R2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR012805"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3R2"
FT                   /inference="protein motif:TFAM:TIGR02445"
FT                   /protein_id="ACK44563.1"
FT   gene            complement(22898..25048)
FT                   /locus_tag="Sbal223_0020"
FT   CDS_pept        complement(22898..25048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0020"
FT                   /product="fatty oxidation complex, alpha subunit FadB"
FT                   /note="TIGRFAM: fatty oxidation complex, alpha subunit
FT                   FadB; PFAM: Enoyl-CoA hydratase/isomerase;
FT                   3-hydroxyacyl-CoA dehydrogenase domain protein;
FT                   3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   shw:Sputw3181_0013 multifunctional fatty acid oxidation
FT                   complex subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44564"
FT                   /db_xref="GOA:B8E3R3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR012799"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3R3"
FT                   /inference="protein motif:TFAM:TIGR02437"
FT                   /protein_id="ACK44564.1"
FT   gene            25539..26861
FT                   /locus_tag="Sbal223_0021"
FT   CDS_pept        25539..26861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0021"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: shw:Sputw3181_0014
FT                   Xaa-Pro dipeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44565"
FT                   /db_xref="GOA:B8E3R4"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR022846"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3R4"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACK44565.1"
FT   gene            26889..27503
FT                   /locus_tag="Sbal223_0022"
FT   CDS_pept        26889..27503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0022"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: shm:Shewmr7_0018 protein of
FT                   unknown function UPF0029"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44566"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020569"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3R5"
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /protein_id="ACK44566.1"
FT   gene            27581..29038
FT                   /locus_tag="Sbal223_0023"
FT   CDS_pept        27581..29038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0023"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: shn:Shewana3_0027 TrkH
FT                   family potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44567"
FT                   /db_xref="GOA:B8E3R6"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3R6"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ACK44567.1"
FT   sig_peptide     27581..27667
FT                   /locus_tag="Sbal223_0023"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.985) with cleavage site probability 0.984 at
FT                   residue 29"
FT   gene            29041..29565
FT                   /locus_tag="Sbal223_0024"
FT   CDS_pept        29041..29565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0024"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number=""
FT                   /note="KEGG: shn:Shewana3_0028 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44568"
FT                   /db_xref="GOA:B8E3R7"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3R7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44568.1"
FT                   VDAFGNHFSQH"
FT   gene            complement(29629..29937)
FT                   /locus_tag="Sbal223_0025"
FT   CDS_pept        complement(29629..29937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0025"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   shn:Shewana3_0029 ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44569"
FT                   /db_xref="GOA:B8E3R8"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3R8"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACK44569.1"
FT   gene            30138..30689
FT                   /locus_tag="Sbal223_0026"
FT   CDS_pept        30138..30689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0026"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number=""
FT                   /note="KEGG: shn:Shewana3_0030 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44570"
FT                   /db_xref="GOA:B8E3R9"
FT                   /db_xref="InterPro:IPR001226"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3R9"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44570.1"
FT   gene            complement(30760..32202)
FT                   /locus_tag="Sbal223_0027"
FT   CDS_pept        complement(30760..32202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0027"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: shm:Shewmr7_0023 potassium
FT                   uptake protein, TrkH family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44571"
FT                   /db_xref="GOA:B8E3S0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S0"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ACK44571.1"
FT   sig_peptide     complement(32104..32202)
FT                   /locus_tag="Sbal223_0027"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.655 at
FT                   residue 33"
FT   gene            complement(32223..33632)
FT                   /locus_tag="Sbal223_0028"
FT   CDS_pept        complement(32223..33632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0028"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: shw:Sputw3181_0021 potassium transporter peripheral
FT                   membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44572"
FT                   /db_xref="GOA:B8E3S1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACK44572.1"
FT                   EKLFQPSAFFF"
FT   gene            complement(33648..34934)
FT                   /locus_tag="Sbal223_0029"
FT   CDS_pept        complement(33648..34934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0029"
FT                   /product="sun protein"
FT                   /note="TIGRFAM: sun protein; PFAM: Fmu (Sun) domain
FT                   protein; NusB/RsmB/TIM44; KEGG: shw:Sputw3181_0022 sun
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44573"
FT                   /db_xref="GOA:B8E3S2"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR004573"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S2"
FT                   /inference="protein motif:TFAM:TIGR00563"
FT                   /protein_id="ACK44573.1"
FT   gene            complement(34936..35892)
FT                   /locus_tag="Sbal223_0030"
FT   CDS_pept        complement(34936..35892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0030"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: shw:Sputw3181_0023
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44574"
FT                   /db_xref="GOA:B8E3S3"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3S3"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACK44574.1"
FT   gene            complement(35901..36413)
FT                   /locus_tag="Sbal223_0031"
FT   CDS_pept        complement(35901..36413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0031"
FT                   /product="peptide deformylase"
FT                   /EC_number=""
FT                   /note="KEGG: son:SO_0032 polypeptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44575"
FT                   /db_xref="GOA:B8E3S4"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S4"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACK44575.1"
FT                   RLDAKEA"
FT   gene            36539..37669
FT                   /locus_tag="Sbal223_0032"
FT   CDS_pept        36539..37669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0032"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   shm:Shewmr7_0028 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44576"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3K2"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACK44576.1"
FT   sig_peptide     36539..36610
FT                   /locus_tag="Sbal223_0032"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            37753..38769
FT                   /locus_tag="Sbal223_0033"
FT   CDS_pept        37753..38769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0033"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: shw:Sputw3181_0026 DNA protecting
FT                   protein DprA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44577"
FT                   /db_xref="GOA:B8E3K3"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3K3"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ACK44577.1"
FT   gene            38772..39245
FT                   /locus_tag="Sbal223_0034"
FT   CDS_pept        38772..39245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0034"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   shw:Sputw3181_0027 protein of unknown function DUF494"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44578"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3K4"
FT                   /inference="protein motif:PFAM:PF04361"
FT                   /protein_id="ACK44578.1"
FT   gene            39365..39928
FT                   /locus_tag="Sbal223_0035"
FT   CDS_pept        39365..39928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0035"
FT                   /product="DNA topoisomerase type IA zn finger domain
FT                   protein"
FT                   /note="PFAM: DNA topoisomerase type IA zn finger domain
FT                   protein; KEGG: shw:Sputw3181_0028 DNA topoisomerase, type
FT                   IA, zn finger domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44579"
FT                   /db_xref="GOA:B8E3K5"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3K5"
FT                   /inference="protein motif:PFAM:PF01396"
FT                   /protein_id="ACK44579.1"
FT   gene            40055..40621
FT                   /locus_tag="Sbal223_0036"
FT   CDS_pept        40055..40621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0036"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5/yciO/yrdC domain; KEGG: shw:Sputw3181_0029
FT                   SUA5/YciO/YrdC/YwlC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44580"
FT                   /db_xref="GOA:B8E3K6"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR023535"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3K6"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ACK44580.1"
FT   gene            40647..41555
FT                   /locus_tag="Sbal223_0037"
FT   CDS_pept        40647..41555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0037"
FT                   /product="Coproporphyrinogen oxidase"
FT                   /EC_number=""
FT                   /note="PFAM: coproporphyrinogen III oxidase; KEGG:
FT                   shw:Sputw3181_0030 coproporphyrinogen III oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44581"
FT                   /db_xref="GOA:B8E3K7"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3K7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44581.1"
FT   gene            complement(41590..42027)
FT                   /locus_tag="Sbal223_0038"
FT   CDS_pept        complement(41590..42027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0038"
FT                   /product="globin"
FT                   /note="PFAM: globin; KEGG: shw:Sputw3181_0031 globin"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44582"
FT                   /db_xref="GOA:B8E3K8"
FT                   /db_xref="InterPro:IPR001486"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3K8"
FT                   /inference="protein motif:PFAM:PF01152"
FT                   /protein_id="ACK44582.1"
FT   gene            42181..43029
FT                   /locus_tag="Sbal223_0039"
FT   CDS_pept        42181..43029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0039"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: shw:Sputw3181_0032
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44583"
FT                   /db_xref="GOA:B8E3K9"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3K9"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACK44583.1"
FT                   K"
FT   gene            43035..43310
FT                   /locus_tag="Sbal223_0040"
FT   CDS_pept        43035..43310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0040"
FT                   /product="protein of unknown function DUF1488"
FT                   /note="PFAM: protein of unknown function DUF1488; KEGG:
FT                   shw:Sputw3181_0033 protein of unknown function DUF1488"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44584"
FT                   /db_xref="InterPro:IPR009962"
FT                   /db_xref="InterPro:IPR036692"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L0"
FT                   /inference="protein motif:PFAM:PF07369"
FT                   /protein_id="ACK44584.1"
FT   gene            complement(43430..43978)
FT                   /locus_tag="Sbal223_0041"
FT   CDS_pept        complement(43430..43978)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0041"
FT                   /product="carbonic anhydrase, family 3"
FT                   /note="KEGG: shw:Sputw3181_0034 carbonic anhydrase, family
FT                   3"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44585"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L1"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0034"
FT                   /protein_id="ACK44585.1"
FT   gene            44573..46109
FT                   /locus_tag="Sbal223_R0001"
FT   rRNA            44573..46109
FT                   /locus_tag="Sbal223_R0001"
FT                   /product="16S ribosomal RNA"
FT   gene            46527..49429
FT                   /locus_tag="Sbal223_R0002"
FT   rRNA            46527..49429
FT                   /locus_tag="Sbal223_R0002"
FT                   /product="23S ribosomal RNA"
FT   gene            49570..49684
FT                   /locus_tag="Sbal223_R0003"
FT   rRNA            49570..49684
FT                   /locus_tag="Sbal223_R0003"
FT                   /product="5S ribosomal RNA"
FT   gene            49720..49796
FT                   /locus_tag="Sbal223_R0035"
FT                   /note="tRNA-Asp1"
FT   tRNA            49720..49796
FT                   /locus_tag="Sbal223_R0035"
FT                   /product="tRNA-Asp"
FT   gene            50105..50359
FT                   /locus_tag="Sbal223_0042"
FT   CDS_pept        50105..50359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0042"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   shn:Shewana3_0046 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44586"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L2"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACK44586.1"
FT   gene            50382..50837
FT                   /locus_tag="Sbal223_0043"
FT   CDS_pept        50382..50837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0043"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   shw:Sputw3181_4042 transcriptional regulator, BadM/Rrf2
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44587"
FT                   /db_xref="GOA:B8E3M6"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR030489"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M6"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACK44587.1"
FT   gene            complement(50812..51567)
FT                   /locus_tag="Sbal223_0044"
FT   CDS_pept        complement(50812..51567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0044"
FT                   /product="protein of unknown function DUF610 YibQ"
FT                   /note="PFAM: protein of unknown function DUF610 YibQ; KEGG:
FT                   shm:Shewmr7_0040 protein of unknown function DUF610, YibQ"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44588"
FT                   /db_xref="GOA:B8E3M7"
FT                   /db_xref="InterPro:IPR006837"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M7"
FT                   /inference="protein motif:PFAM:PF04748"
FT                   /protein_id="ACK44588.1"
FT   sig_peptide     complement(51508..51567)
FT                   /locus_tag="Sbal223_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            complement(51580..52785)
FT                   /locus_tag="Sbal223_0045"
FT   CDS_pept        complement(51580..52785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0045"
FT                   /product="carboxyl-terminal protease"
FT                   /EC_number=""
FT                   /note="KEGG: shn:Shewana3_0049 C-terminal processing
FT                   peptidase-3; TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; peptidase S41"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44589"
FT                   /db_xref="GOA:B8E3M8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M8"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACK44589.1"
FT                   HD"
FT   sig_peptide     complement(52708..52785)
FT                   /locus_tag="Sbal223_0045"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.441 at
FT                   residue 26"
FT   gene            complement(52818..53906)
FT                   /locus_tag="Sbal223_0046"
FT   CDS_pept        complement(52818..53906)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0046"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: shw:Sputw3181_4039
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44590"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M9"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACK44590.1"
FT   gene            complement(53962..55506)
FT                   /locus_tag="Sbal223_0047"
FT   CDS_pept        complement(53962..55506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0047"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="KEGG: spc:Sputcn32_0040 phosphoglyceromutase;
FT                   TIGRFAM: phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: metalloenzyme
FT                   domain protein; BPG-independent PGAM domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44591"
FT                   /db_xref="GOA:B8E3F4"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3F4"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ACK44591.1"
FT   gene            55774..56208
FT                   /locus_tag="Sbal223_0048"
FT   CDS_pept        55774..56208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0048"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   shw:Sputw3181_4037 rhodanese domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44592"
FT                   /db_xref="GOA:B8E3F5"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3F5"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACK44592.1"
FT   gene            56504..56989
FT                   /locus_tag="Sbal223_0049"
FT   CDS_pept        56504..56989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0049"
FT                   /product="protein-export protein SecB"
FT                   /note="TIGRFAM: protein-export protein SecB; PFAM: protein
FT                   export chaperone SecB; KEGG: shw:Sputw3181_4036 preprotein
FT                   translocase subunit SecB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44593"
FT                   /db_xref="GOA:B8E3F6"
FT                   /db_xref="InterPro:IPR003708"
FT                   /db_xref="InterPro:IPR035958"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3F6"
FT                   /inference="protein motif:TFAM:TIGR00809"
FT                   /protein_id="ACK44593.1"
FT   gene            56994..58010
FT                   /locus_tag="Sbal223_0050"
FT   CDS_pept        56994..58010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0050"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number=""
FT                   /note="PFAM: NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase domain protein; Ketopantoate reductase
FT                   ApbA/PanE domain protein; KEGG: shw:Sputw3181_4035
FT                   NAD(P)H-dependent glycerol-3-phosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44594"
FT                   /db_xref="GOA:B8E3F7"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3F7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44594.1"
FT   sig_peptide     56994..57077
FT                   /locus_tag="Sbal223_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.710) with cleavage site probability 0.407 at
FT                   residue 28"
FT   gene            58204..59388
FT                   /locus_tag="Sbal223_0051"
FT   CDS_pept        58204..59388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0051"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; HI0933 family protein; FAD
FT                   dependent oxidoreductase; KEGG: shw:Sputw3181_4034 HI0933
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44595"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR023166"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3F8"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACK44595.1"
FT   sig_peptide     58204..58272
FT                   /locus_tag="Sbal223_0051"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.575 at
FT                   residue 23"
FT   gene            complement(59501..61471)
FT                   /locus_tag="Sbal223_0052"
FT   CDS_pept        complement(59501..61471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0052"
FT                   /product="putative transcriptional regulator"
FT                   /note="PFAM: AAA-4 family protein; KEGG: ypy:YPK_4173
FT                   putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44596"
FT                   /db_xref="InterPro:IPR007421"
FT                   /db_xref="InterPro:IPR038461"
FT                   /db_xref="InterPro:IPR038475"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3F9"
FT                   /inference="protein motif:PFAM:PF04326"
FT                   /protein_id="ACK44596.1"
FT   gene            complement(62093..63457)
FT                   /locus_tag="Sbal223_0053"
FT   CDS_pept        complement(62093..63457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0053"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /EC_number=""
FT                   /note="KEGG: she:Shewmr4_0051 TrkH family potassium uptake
FT                   protein; TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44597"
FT                   /db_xref="GOA:B8E3G0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G0"
FT                   /inference="protein motif:TFAM:TIGR00933"
FT                   /protein_id="ACK44597.1"
FT   gene            complement(63459..64157)
FT                   /locus_tag="Sbal223_0054"
FT   CDS_pept        complement(63459..64157)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0054"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; KEGG:
FT                   shw:Sputw3181_4031 TrkA-N domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44598"
FT                   /db_xref="GOA:B8E3G1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACK44598.1"
FT                   ELQYLAPRLV"
FT   gene            complement(64208..64897)
FT                   /locus_tag="Sbal223_0055"
FT   CDS_pept        complement(64208..64897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0055"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: shw:Sputw3181_4030 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44599"
FT                   /db_xref="GOA:B8E3G2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G2"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44599.1"
FT                   LTDMSQK"
FT   gene            complement(64898..65944)
FT                   /locus_tag="Sbal223_0056"
FT   CDS_pept        complement(64898..65944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0056"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: shw:Sputw3181_4029
FT                   integral membrane sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44600"
FT                   /db_xref="GOA:B8E3G3"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G3"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK44600.1"
FT                   LPIKKGEQ"
FT   gene            complement(66246..67169)
FT                   /locus_tag="Sbal223_0057"
FT   CDS_pept        complement(66246..67169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0057"
FT                   /product="Pirin domain protein"
FT                   /note="PFAM: Pirin domain protein; KEGG: shw:Sputw3181_4028
FT                   pirin domain protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44601"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G4"
FT                   /inference="protein motif:PFAM:PF02678"
FT                   /protein_id="ACK44601.1"
FT   gene            67695..69368
FT                   /locus_tag="Sbal223_0058"
FT   CDS_pept        67695..69368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0058"
FT                   /product="signal transduction histidine kinase, LytS"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase internal region; 5TM Receptors of the
FT                   LytS-YhcK type transmembrane region; KEGG: shm:Shewmr7_0054
FT                   signal transduction histidine kinase, LytS"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44602"
FT                   /db_xref="GOA:B8E3G5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR011620"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G5"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACK44602.1"
FT   gene            69362..70093
FT                   /locus_tag="Sbal223_0059"
FT   CDS_pept        69362..70093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0059"
FT                   /product="two component transcriptional regulator, LytTR
FT                   family"
FT                   /note="PFAM: response regulator receiver; LytTr DNA-binding
FT                   region; KEGG: shm:Shewmr7_0055 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44603"
FT                   /db_xref="GOA:B8E3G6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G6"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44603.1"
FT   gene            70201..71445
FT                   /locus_tag="Sbal223_0060"
FT   CDS_pept        70201..71445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0060"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   shm:Shewmr7_0056 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44604"
FT                   /db_xref="GOA:B8E3G7"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G7"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACK44604.1"
FT                   TKSTPRLVNMTAESA"
FT   sig_peptide     70201..70275
FT                   /locus_tag="Sbal223_0060"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.657) with cleavage site probability 0.606 at
FT                   residue 25"
FT   gene            71580..72317
FT                   /locus_tag="Sbal223_0061"
FT   CDS_pept        71580..72317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0061"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   shm:Shewmr7_0058 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44605"
FT                   /db_xref="GOA:B8E3G8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G8"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACK44605.1"
FT   gene            72454..72918
FT                   /locus_tag="Sbal223_0062"
FT   CDS_pept        72454..72918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0062"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; KEGG: shn:Shewana3_0063
FT                   NLP/P60 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44606"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3G9"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACK44606.1"
FT   sig_peptide     72454..72507
FT                   /locus_tag="Sbal223_0062"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.575 at
FT                   residue 18"
FT   gene            72978..74441
FT                   /locus_tag="Sbal223_0063"
FT   CDS_pept        72978..74441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0063"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   shn:Shewana3_0064 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44607"
FT                   /db_xref="GOA:B8E3H0"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACK44607.1"
FT   gene            74534..75565
FT                   /locus_tag="Sbal223_0064"
FT   CDS_pept        74534..75565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0064"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="SMART: regulatory protein LacI; KEGG:
FT                   she:Shewmr4_0063 LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44608"
FT                   /db_xref="GOA:B8E3H1"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H1"
FT                   /inference="protein motif:SMART:SM00354"
FT                   /protein_id="ACK44608.1"
FT                   KSC"
FT   gene            complement(75680..77158)
FT                   /locus_tag="Sbal223_0065"
FT   CDS_pept        complement(75680..77158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0065"
FT                   /product="Sucrose phosphorylase"
FT                   /EC_number=""
FT                   /note="KEGG: shn:Shewana3_0066 alpha amylase, catalytic
FT                   region; PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44609"
FT                   /db_xref="GOA:B8E3H2"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR016377"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022527"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H2"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44609.1"
FT   gene            77419..78639
FT                   /locus_tag="Sbal223_0066"
FT   CDS_pept        77419..78639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0066"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   she:Shewmr4_0065 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44610"
FT                   /db_xref="GOA:B8E3H3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACK44610.1"
FT                   LLMAEAH"
FT   gene            78918..81314
FT                   /locus_tag="Sbal223_0067"
FT   CDS_pept        78918..81314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0067"
FT                   /product="outer membrane insertion C-terminal signal"
FT                   /note="TIGRFAM: outer membrane insertion C-terminal signal;
FT                   PFAM: TonB-dependent receptor; TonB-dependent receptor
FT                   plug; KEGG: shn:Shewana3_0068 TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44611"
FT                   /db_xref="GOA:B8E3H4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H4"
FT                   /inference="protein motif:TFAM:TIGR03304"
FT                   /protein_id="ACK44611.1"
FT   sig_peptide     78918..78992
FT                   /locus_tag="Sbal223_0067"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            81434..82393
FT                   /locus_tag="Sbal223_0068"
FT   CDS_pept        81434..82393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0068"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: she:Shewmr4_0067
FT                   ribokinase-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44612"
FT                   /db_xref="GOA:B8E3H5"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H5"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACK44612.1"
FT   gene            82649..83182
FT                   /locus_tag="Sbal223_0069"
FT   CDS_pept        82649..83182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0069"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; KEGG:
FT                   shw:Sputw3181_4025 molybdenum cofactor biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44613"
FT                   /db_xref="GOA:B8E3H6"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H6"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACK44613.1"
FT                   CNEAVIKPFRPKAK"
FT   gene            complement(83255..83503)
FT                   /locus_tag="Sbal223_0070"
FT   CDS_pept        complement(83255..83503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_4024 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44614"
FT                   /db_xref="GOA:B8E3H7"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H7"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_4024"
FT                   /protein_id="ACK44614.1"
FT   gene            complement(83583..84722)
FT                   /locus_tag="Sbal223_0071"
FT   CDS_pept        complement(83583..84722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0071"
FT                   /product="transport protein, putative"
FT                   /note="KEGG: spc:Sputcn32_0055 transport protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44615"
FT                   /db_xref="GOA:B8E3H8"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H8"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0055"
FT                   /protein_id="ACK44615.1"
FT   gene            complement(84817..85551)
FT                   /locus_tag="Sbal223_0072"
FT   CDS_pept        complement(84817..85551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0072"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: shw:Sputw3181_4022 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44616"
FT                   /db_xref="GOA:B8E3H9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3H9"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK44616.1"
FT   gene            complement(85555..87192)
FT                   /locus_tag="Sbal223_0073"
FT   CDS_pept        complement(85555..87192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0073"
FT                   /product="TAP domain protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; TAP domain protein;
FT                   KEGG: shw:Sputw3181_4021 TAP domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44617"
FT                   /db_xref="GOA:B8E3I0"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I0"
FT                   /inference="protein motif:PFAM:PF08386"
FT                   /protein_id="ACK44617.1"
FT   sig_peptide     complement(87034..87192)
FT                   /locus_tag="Sbal223_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 53"
FT   gene            87286..87657
FT                   /locus_tag="Sbal223_0074"
FT   CDS_pept        87286..87657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0074"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   shw:Sputw3181_4020 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44618"
FT                   /db_xref="GOA:B8E3I1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I1"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACK44618.1"
FT   gene            87711..88574
FT                   /locus_tag="Sbal223_0075"
FT   CDS_pept        87711..88574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0075"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: shw:Sputw3181_4019 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44619"
FT                   /db_xref="GOA:B8E3I2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK44619.1"
FT                   FMELHR"
FT   gene            88571..89881
FT                   /locus_tag="Sbal223_0076"
FT   CDS_pept        88571..89881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_4018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44620"
FT                   /db_xref="GOA:B8E3I3"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I3"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_4018"
FT                   /protein_id="ACK44620.1"
FT   gene            90010..91815
FT                   /locus_tag="Sbal223_0077"
FT   CDS_pept        90010..91815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0077"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   spc:Sputcn32_0061 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44621"
FT                   /db_xref="GOA:B8E3I4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACK44621.1"
FT   gene            91959..95782
FT                   /pseudo
FT                   /locus_tag="Sbal223_0078"
FT   mobile_element  92256..93628
FT                   /mobile_element_type="insertion sequence:ISSba19_1"
FT   gene            92345..93361
FT                   /locus_tag="Sbal223_0079"
FT   CDS_pept        92345..93361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0079"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: she:Shewmr4_1779
FT                   transposase IS116/IS110/IS902 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44622"
FT                   /db_xref="GOA:B8E3I5"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I5"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACK44622.1"
FT   gene            95911..96321
FT                   /locus_tag="Sbal223_0080"
FT   CDS_pept        95911..96321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0080"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   shn:Shewana3_0082 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44623"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I6"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACK44623.1"
FT   gene            96445..96993
FT                   /locus_tag="Sbal223_0081"
FT   CDS_pept        96445..96993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0081"
FT                   /product="HPP family protein"
FT                   /note="PFAM: HPP family protein; KEGG: spc:Sputcn32_0064
FT                   HPP family protein+B94"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44624"
FT                   /db_xref="GOA:B8E3I7"
FT                   /db_xref="InterPro:IPR007065"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I7"
FT                   /inference="protein motif:PFAM:PF04982"
FT                   /protein_id="ACK44624.1"
FT   gene            complement(97014..97277)
FT                   /locus_tag="Sbal223_0082"
FT   CDS_pept        complement(97014..97277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0082"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0065 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44625"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I8"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0065"
FT                   /protein_id="ACK44625.1"
FT   gene            complement(97340..97768)
FT                   /locus_tag="Sbal223_0083"
FT   CDS_pept        complement(97340..97768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0083"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   shw:Sputw3181_4011 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44626"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3I9"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACK44626.1"
FT   gene            97925..98320
FT                   /locus_tag="Sbal223_0084"
FT   CDS_pept        97925..98320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0084"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: spc:Sputcn32_0067 glutathione-dependent
FT                   formaldehyde-activating, GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44627"
FT                   /db_xref="GOA:B8E3J0"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J0"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACK44627.1"
FT   gene            98324..98680
FT                   /locus_tag="Sbal223_0085"
FT   CDS_pept        98324..98680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0085"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; Transcription
FT                   regulator MerR DNA binding; KEGG: son:SO_0082 MerR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44628"
FT                   /db_xref="GOA:B8E3J1"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J1"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACK44628.1"
FT                   LEQKIRYYQTHFSD"
FT   gene            98874..99260
FT                   /locus_tag="Sbal223_0086"
FT   CDS_pept        98874..99260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0086"
FT                   /product="Carboxymuconolactone decarboxylase"
FT                   /note="PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   son:SO_0083 carboxymuconolactone decarboxylase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44629"
FT                   /db_xref="GOA:B8E3J2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J2"
FT                   /inference="protein motif:PFAM:PF02627"
FT                   /protein_id="ACK44629.1"
FT   gene            99556..100638
FT                   /locus_tag="Sbal223_0087"
FT   CDS_pept        99556..100638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_4009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44630"
FT                   /db_xref="GOA:B8E3J3"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J3"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_4009"
FT                   /protein_id="ACK44630.1"
FT   gene            complement(100734..101414)
FT                   /locus_tag="Sbal223_0088"
FT   CDS_pept        complement(100734..101414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0088"
FT                   /product="2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; 2,3-diketo-5-methylthio-1-phosphopentane
FT                   phosphatase; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: shw:Sputw3181_4008
FT                   2,3-diketo-5-methylthio-1-phosphopentane phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44631"
FT                   /db_xref="GOA:B8E3J4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023943"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3J4"
FT                   /inference="protein motif:TFAM:TIGR01691"
FT                   /protein_id="ACK44631.1"
FT                   LLIE"
FT   gene            101798..102232
FT                   /locus_tag="Sbal223_0089"
FT   CDS_pept        101798..102232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0089"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_4007 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44632"
FT                   /db_xref="GOA:B8E3J5"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J5"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_4007"
FT                   /protein_id="ACK44632.1"
FT   sig_peptide     101798..101881
FT                   /locus_tag="Sbal223_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.525 at
FT                   residue 28"
FT   gene            102329..103342
FT                   /locus_tag="Sbal223_0090"
FT   CDS_pept        102329..103342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0090"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44633"
FT                   /db_xref="GOA:B8E3J6"
FT                   /db_xref="InterPro:IPR021484"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J6"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_0091"
FT                   /protein_id="ACK44633.1"
FT   gene            103535..103834
FT                   /locus_tag="Sbal223_4532"
FT   CDS_pept        103535..103834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_4532"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_4532"
FT                   /db_xref="EnsemblGenomes-Tr:ACN66791"
FT                   /db_xref="GOA:C0QV00"
FT                   /db_xref="UniProtKB/TrEMBL:C0QV00"
FT                   /protein_id="ACN66791.1"
FT   gene            complement(103847..105670)
FT                   /locus_tag="Sbal223_0091"
FT   CDS_pept        complement(103847..105670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0091"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: shw:Sputw3181_4006 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44634"
FT                   /db_xref="GOA:B8E3J7"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018476"
FT                   /db_xref="InterPro:IPR022324"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J7"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACK44634.1"
FT   gene            complement(105889..106506)
FT                   /locus_tag="Sbal223_0092"
FT   CDS_pept        complement(105889..106506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0092"
FT                   /product="FMN-binding negative transcriptional regulator"
FT                   /note="PFAM: Negative transcriptional regulator; KEGG:
FT                   pat:Patl_2431 negative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44635"
FT                   /db_xref="GOA:B8E3J8"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J8"
FT                   /inference="protein motif:PFAM:PF04299"
FT                   /protein_id="ACK44635.1"
FT   gene            complement(106578..106763)
FT                   /locus_tag="Sbal223_0093"
FT   CDS_pept        complement(106578..106763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0093"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO_0305 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44636"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3J9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44636.1"
FT                   VQAPTILILISHKLTF"
FT   gene            106984..107742
FT                   /locus_tag="Sbal223_0094"
FT   CDS_pept        106984..107742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0094"
FT                   /product="protein of unknown function DUF347"
FT                   /note="PFAM: protein of unknown function DUF347; KEGG:
FT                   bvi:Bcep1808_7223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44637"
FT                   /db_xref="GOA:B8E3K0"
FT                   /db_xref="InterPro:IPR007136"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3K0"
FT                   /inference="protein motif:PFAM:PF03988"
FT                   /protein_id="ACK44637.1"
FT   repeat_region   108032..108094
FT                   /note="MITE_102"
FT   gene            108204..108764
FT                   /locus_tag="Sbal223_0095"
FT   CDS_pept        108204..108764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0095"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   shw:Sputw3181_4002 transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44638"
FT                   /db_xref="GOA:B8E3K1"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3K1"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACK44638.1"
FT   gene            108757..109500
FT                   /locus_tag="Sbal223_0096"
FT   CDS_pept        108757..109500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0096"
FT                   /product="FAD-binding 9 siderophore-interacting domain
FT                   protein"
FT                   /note="PFAM: Siderophore-interacting protein; FAD-binding 9
FT                   siderophore-interacting domain protein; KEGG:
FT                   spc:Sputcn32_0076 siderophore-interacting protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44639"
FT                   /db_xref="GOA:B8E3L3"
FT                   /db_xref="InterPro:IPR007037"
FT                   /db_xref="InterPro:IPR013113"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="InterPro:IPR039374"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L3"
FT                   /inference="protein motif:PFAM:PF08021"
FT                   /protein_id="ACK44639.1"
FT   gene            109617..113981
FT                   /pseudo
FT                   /locus_tag="Sbal223_0097"
FT   mobile_element  complement(110806..112022)
FT                   /mobile_element_type="insertion sequence:ISSba2_1"
FT   gene            complement(110826..111935)
FT                   /locus_tag="Sbal223_0098"
FT   CDS_pept        complement(110826..111935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0098"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   asa:ASA_P4G164 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44640"
FT                   /db_xref="GOA:B8E3L4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK44640.1"
FT   gene            complement(114076..115308)
FT                   /locus_tag="Sbal223_0099"
FT   CDS_pept        complement(114076..115308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0099"
FT                   /product="imidazolonepropionase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_4000 imidazolonepropionase;
FT                   TIGRFAM: imidazolonepropionase; PFAM: amidohydrolase;
FT                   Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44641"
FT                   /db_xref="GOA:B8E3L5"
FT                   /db_xref="InterPro:IPR005920"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3L5"
FT                   /inference="protein motif:TFAM:TIGR01224"
FT                   /protein_id="ACK44641.1"
FT                   VKNGKLVHQHT"
FT   gene            115542..117476
FT                   /pseudo
FT                   /locus_tag="Sbal223_0100"
FT   mobile_element  115856..117072
FT                   /mobile_element_type="insertion sequence:ISSba2_2"
FT   gene            115943..117052
FT                   /locus_tag="Sbal223_0101"
FT   CDS_pept        115943..117052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0101"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   asa:ASA_P4G164 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44642"
FT                   /db_xref="GOA:B8E3L4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK44642.1"
FT   gene            117632..119299
FT                   /locus_tag="Sbal223_0102"
FT   CDS_pept        117632..119299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0102"
FT                   /product="urocanate hydratase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3998 urocanate hydratase;
FT                   TIGRFAM: urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44643"
FT                   /db_xref="GOA:B8E3L7"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3L7"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACK44643.1"
FT   gene            119354..120895
FT                   /locus_tag="Sbal223_0103"
FT   CDS_pept        119354..120895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0103"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3997 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44644"
FT                   /db_xref="GOA:B8E3L8"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L8"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ACK44644.1"
FT   gene            121577..124591
FT                   /locus_tag="Sbal223_0104"
FT   CDS_pept        121577..124591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /transl_except=(pos:122156..122158,aa:Sec)
FT                   /locus_tag="Sbal223_0104"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="Contains selenocysteine; TIGRFAM: formate
FT                   dehydrogenase, alpha subunit; PFAM: molybdopterin
FT                   oxidoreductase; molydopterin dinucleotide-binding region;
FT                   molybdopterin oxidoreductase Fe4S4 region; KEGG:
FT                   son:SO_0101 selenium-containing formate dehydrogenase,
FT                   nitrate inducible, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44645"
FT                   /db_xref="GOA:B8E3L9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006443"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L9"
FT                   /inference="protein motif:TFAM:TIGR01553"
FT                   /protein_id="ACK44645.1"
FT                   EFKAFLVNITKAKGL"
FT   sig_peptide     121577..121672
FT                   /locus_tag="Sbal223_0104"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 32"
FT   gene            124594..125505
FT                   /locus_tag="Sbal223_0105"
FT   CDS_pept        124594..125505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0105"
FT                   /product="formate dehydrogenase, beta subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, beta subunit; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Formate dehydrogenase transmembrane domain protein; KEGG:
FT                   shn:Shewana3_0103 formate dehydrogenase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44646"
FT                   /db_xref="GOA:B8E3M0"
FT                   /db_xref="InterPro:IPR006470"
FT                   /db_xref="InterPro:IPR014603"
FT                   /db_xref="InterPro:IPR015246"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M0"
FT                   /inference="protein motif:TFAM:TIGR01582"
FT                   /protein_id="ACK44646.1"
FT   gene            125502..126143
FT                   /locus_tag="Sbal223_0106"
FT   CDS_pept        125502..126143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0106"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   shn:Shewana3_0104 formate dehydrogenase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44647"
FT                   /db_xref="GOA:B8E3M1"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M1"
FT                   /inference="protein motif:TFAM:TIGR01583"
FT                   /protein_id="ACK44647.1"
FT   gene            126143..127048
FT                   /locus_tag="Sbal223_0107"
FT   CDS_pept        126143..127048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0107"
FT                   /product="formate dehydrogenase accessory protein FdhE"
FT                   /note="TIGRFAM: formate dehydrogenase accessory protein
FT                   FdhE; PFAM: formate dehydrogenase accessory protein; KEGG:
FT                   shn:Shewana3_0105 formate dehydrogenase accessory protein
FT                   FdhE"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44648"
FT                   /db_xref="GOA:B8E3M2"
FT                   /db_xref="InterPro:IPR006452"
FT                   /db_xref="InterPro:IPR024064"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3M2"
FT                   /inference="protein motif:TFAM:TIGR01562"
FT                   /protein_id="ACK44648.1"
FT   gene            127137..128567
FT                   /locus_tag="Sbal223_0108"
FT   CDS_pept        127137..128567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0108"
FT                   /product="L-seryl-tRNA(Sec) selenium transferase"
FT                   /EC_number=""
FT                   /note="PFAM: L-seryl-tRNA selenium transferase; KEGG:
FT                   she:Shewmr4_0106 selenocysteine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44649"
FT                   /db_xref="GOA:B8E3M3"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="InterPro:IPR025862"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M3"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44649.1"
FT                   LDSEAELLAELSTLGMQL"
FT   gene            128564..130609
FT                   /locus_tag="Sbal223_0109"
FT   CDS_pept        128564..130609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0109"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="TIGRFAM: selenocysteine-specific translation
FT                   elongation factor; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein;
FT                   Elongation factor SelB winged helix 2; Elongation factor
FT                   SelB winged helix 3; KEGG: shn:Shewana3_0107
FT                   selenocysteine-specific translation elongation factor SelB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44650"
FT                   /db_xref="GOA:B8E3M4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M4"
FT                   /inference="protein motif:TFAM:TIGR00475"
FT                   /protein_id="ACK44650.1"
FT   gene            complement(130485..130575)
FT                   /locus_tag="Sbal223_R0143"
FT                   /note="tRNA-SeC(p)1"
FT   tRNA            complement(130485..130575)
FT                   /locus_tag="Sbal223_R0143"
FT                   /product="tRNA-Sec"
FT   gene            130717..131553
FT                   /locus_tag="Sbal223_0110"
FT   CDS_pept        130717..131553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0110"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: shm:Shewmr7_0103 formate dehydrogenase family
FT                   accessory protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44651"
FT                   /db_xref="GOA:B8E3M5"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3M5"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACK44651.1"
FT   gene            131667..132881
FT                   /locus_tag="Sbal223_0111"
FT   CDS_pept        131667..132881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0111"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: she:Shewmr4_0109 putative inner membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44652"
FT                   /db_xref="GOA:B8E3N0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N0"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACK44652.1"
FT                   LAEAA"
FT   gene            132881..133114
FT                   /locus_tag="Sbal223_0112"
FT   CDS_pept        132881..133114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0112"
FT                   /product="SirA family protein"
FT                   /note="PFAM: SirA family protein; KEGG: shn:Shewana3_0110
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44653"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N1"
FT                   /inference="protein motif:PFAM:PF01206"
FT                   /protein_id="ACK44653.1"
FT   gene            complement(133253..134587)
FT                   /locus_tag="Sbal223_0113"
FT   CDS_pept        complement(133253..134587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0113"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: shw:Sputw3181_3963
FT                   peptidase M48, Ste24p"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44654"
FT                   /db_xref="GOA:B8E3N2"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N2"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACK44654.1"
FT   gene            complement(134803..135438)
FT                   /locus_tag="Sbal223_0114"
FT   CDS_pept        complement(134803..135438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0107 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44655"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N3"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0107"
FT                   /protein_id="ACK44655.1"
FT   sig_peptide     complement(135367..135438)
FT                   /locus_tag="Sbal223_0114"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.944) with cleavage site probability 0.385 at
FT                   residue 24"
FT   gene            135848..136486
FT                   /locus_tag="Sbal223_0115"
FT   CDS_pept        135848..136486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0115"
FT                   /product="protein of unknown function DUF1311"
FT                   /note="PFAM: protein of unknown function DUF1311; KEGG:
FT                   shw:Sputw3181_3962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44656"
FT                   /db_xref="InterPro:IPR009739"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N4"
FT                   /inference="protein motif:PFAM:PF07007"
FT                   /protein_id="ACK44656.1"
FT   sig_peptide     135848..135952
FT                   /locus_tag="Sbal223_0115"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 35"
FT   gene            136505..136957
FT                   /locus_tag="Sbal223_0116"
FT   CDS_pept        136505..136957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0116"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: spc:Sputcn32_0109
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44657"
FT                   /db_xref="GOA:B8E3N5"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N5"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACK44657.1"
FT   gene            complement(136940..137935)
FT                   /locus_tag="Sbal223_0117"
FT   CDS_pept        complement(136940..137935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0117"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0109 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44658"
FT                   /db_xref="InterPro:IPR007433"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N6"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0109"
FT                   /protein_id="ACK44658.1"
FT   sig_peptide     complement(137858..137935)
FT                   /locus_tag="Sbal223_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.994 at
FT                   residue 26"
FT   gene            complement(138074..138700)
FT                   /locus_tag="Sbal223_0118"
FT   CDS_pept        complement(138074..138700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0118"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0110 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44659"
FT                   /db_xref="InterPro:IPR021501"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N7"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0110"
FT                   /protein_id="ACK44659.1"
FT   sig_peptide     complement(138632..138700)
FT                   /locus_tag="Sbal223_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 23"
FT   gene            138934..139326
FT                   /locus_tag="Sbal223_0119"
FT   CDS_pept        138934..139326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0119"
FT                   /product="protein of unknown function DUF1090"
FT                   /note="PFAM: protein of unknown function DUF1090; KEGG:
FT                   son:SO_0119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44660"
FT                   /db_xref="InterPro:IPR009468"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N8"
FT                   /inference="protein motif:PFAM:PF06476"
FT                   /protein_id="ACK44660.1"
FT   sig_peptide     138934..139002
FT                   /locus_tag="Sbal223_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            complement(139458..140036)
FT                   /locus_tag="Sbal223_0120"
FT   CDS_pept        complement(139458..140036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_0120 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44661"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3N9"
FT                   /inference="similar to AA sequence:KEGG:SO_0120"
FT                   /protein_id="ACK44661.1"
FT   sig_peptide     complement(139962..140036)
FT                   /locus_tag="Sbal223_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            140245..141510
FT                   /locus_tag="Sbal223_0121"
FT   CDS_pept        140245..141510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0121"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   shw:Sputw3181_3954 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44662"
FT                   /db_xref="GOA:B8E3P0"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR030192"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P0"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACK44662.1"
FT   gene            complement(141538..142161)
FT                   /locus_tag="Sbal223_0122"
FT   CDS_pept        complement(141538..142161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0122"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   spc:Sputcn32_0119 lysine exporter protein LysE/YggA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44663"
FT                   /db_xref="GOA:B8E3P1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACK44663.1"
FT   gene            complement(142188..142751)
FT                   /locus_tag="Sbal223_0123"
FT   CDS_pept        complement(142188..142751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0123"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   shw:Sputw3181_3952 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44664"
FT                   /db_xref="GOA:B8E3P2"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P2"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACK44664.1"
FT   gene            142881..143333
FT                   /locus_tag="Sbal223_0124"
FT   CDS_pept        142881..143333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0124"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44665"
FT                   /db_xref="InterPro:IPR027843"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3P3"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3951"
FT                   /protein_id="ACK44665.1"
FT   sig_peptide     142881..142970
FT                   /locus_tag="Sbal223_0124"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 30"
FT   gene            complement(143407..144210)
FT                   /locus_tag="Sbal223_0125"
FT   CDS_pept        complement(143407..144210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0125"
FT                   /product="protein of unknown function DUF833"
FT                   /note="PFAM: protein of unknown function DUF833; KEGG:
FT                   shw:Sputw3181_3950 protein of unknown function DUF833"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44666"
FT                   /db_xref="InterPro:IPR008551"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V4"
FT                   /inference="protein motif:PFAM:PF05742"
FT                   /protein_id="ACK44666.1"
FT   gene            complement(144272..145930)
FT                   /locus_tag="Sbal223_0126"
FT   CDS_pept        complement(144272..145930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44667"
FT                   /db_xref="GOA:B8E3V5"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V5"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0117"
FT                   /protein_id="ACK44667.1"
FT   gene            146151..146744
FT                   /locus_tag="Sbal223_0127"
FT   CDS_pept        146151..146744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0127"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; Integral membrane protein TerC; KEGG:
FT                   shn:Shewana3_0123 multiple antibiotic resistance
FT                   (MarC)-related proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44668"
FT                   /db_xref="GOA:B8E3V6"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V6"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACK44668.1"
FT   gene            147061..149658
FT                   /locus_tag="Sbal223_0128"
FT   CDS_pept        147061..149658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0128"
FT                   /product="M6 family metalloprotease domain protein"
FT                   /note="TIGRFAM: M6 family metalloprotease domain protein;
FT                   PFAM: PKD domain containing protein; peptidase M6 immune
FT                   inhibitor A; KEGG: shw:Sputw3181_3947 peptidase M6, immune
FT                   inhibitor A"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44669"
FT                   /db_xref="GOA:B8E3V7"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR008757"
FT                   /db_xref="InterPro:IPR012300"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR020008"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V7"
FT                   /inference="protein motif:TFAM:TIGR03296"
FT                   /protein_id="ACK44669.1"
FT   sig_peptide     147061..147132
FT                   /locus_tag="Sbal223_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            complement(149754..150317)
FT                   /locus_tag="Sbal223_0129"
FT   CDS_pept        complement(149754..150317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0129"
FT                   /product="Chorismate lyase"
FT                   /note="PFAM: Chorismate lyase; KEGG: shw:Sputw3181_3946
FT                   chorismate lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44670"
FT                   /db_xref="GOA:B8E3V8"
FT                   /db_xref="InterPro:IPR007440"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V8"
FT                   /inference="protein motif:PFAM:PF04345"
FT                   /protein_id="ACK44670.1"
FT   gene            150489..150911
FT                   /locus_tag="Sbal223_0130"
FT   CDS_pept        150489..150911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0130"
FT                   /product="flagellar basal body-associated protein FliL"
FT                   /note="PFAM: flagellar basal body-associated protein FliL;
FT                   KEGG: son:SO_0132 flagellar basal body-associated protein
FT                   FliL-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44671"
FT                   /db_xref="GOA:B8E3V9"
FT                   /db_xref="InterPro:IPR005503"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V9"
FT                   /inference="protein motif:PFAM:PF03748"
FT                   /protein_id="ACK44671.1"
FT   sig_peptide     150489..150551
FT                   /locus_tag="Sbal223_0130"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            150970..152067
FT                   /locus_tag="Sbal223_0131"
FT   CDS_pept        150970..152067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0131"
FT                   /product="protein of unknown function DUF890"
FT                   /note="PFAM: protein of unknown function DUF890; KEGG:
FT                   shw:Sputw3181_3944 putative SAM-dependent
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44672"
FT                   /db_xref="GOA:B8E3W0"
FT                   /db_xref="InterPro:IPR010286"
FT                   /db_xref="InterPro:IPR016909"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3W0"
FT                   /inference="protein motif:PFAM:PF05971"
FT                   /protein_id="ACK44672.1"
FT   gene            complement(152142..152399)
FT                   /locus_tag="Sbal223_0132"
FT   CDS_pept        complement(152142..152399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0132"
FT                   /product="protein of unknown function DUF333"
FT                   /note="PFAM: protein of unknown function DUF333; KEGG:
FT                   shn:Shewana3_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44673"
FT                   /db_xref="InterPro:IPR005590"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W1"
FT                   /inference="protein motif:PFAM:PF03891"
FT                   /protein_id="ACK44673.1"
FT   sig_peptide     complement(152325..152399)
FT                   /locus_tag="Sbal223_0132"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.493 at
FT                   residue 25"
FT   gene            complement(152417..153079)
FT                   /locus_tag="Sbal223_0133"
FT   CDS_pept        complement(152417..153079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3943 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44674"
FT                   /db_xref="GOA:B8E3W2"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W2"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3943"
FT                   /protein_id="ACK44674.1"
FT   gene            complement(153179..153946)
FT                   /locus_tag="Sbal223_0134"
FT   CDS_pept        complement(153179..153946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0134"
FT                   /product="molybdopterin synthase sulfurylase MoeB"
FT                   /note="TIGRFAM: molybdopterin synthase sulfurylase MoeB;
FT                   PFAM: UBA/THIF-type NAD/FAD binding protein; MoeZ/MoeB
FT                   domain protein; KEGG: shw:Sputw3181_3942 molybdopterin
FT                   biosynthesis protein MoeB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44675"
FT                   /db_xref="GOA:B8E3W3"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR012730"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W3"
FT                   /inference="protein motif:TFAM:TIGR02355"
FT                   /protein_id="ACK44675.1"
FT   gene            complement(153957..155210)
FT                   /locus_tag="Sbal223_0135"
FT   CDS_pept        complement(153957..155210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0135"
FT                   /product="molybdenum cofactor synthesis domain protein"
FT                   /note="TIGRFAM: molybdenum cofactor synthesis domain
FT                   protein; PFAM: molybdopterin binding domain; MoeA domain
FT                   protein domain I and II; MoeA domain protein domain IV;
FT                   KEGG: shw:Sputw3181_3941 molybdenum cofactor synthesis
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44676"
FT                   /db_xref="GOA:B8E3W4"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W4"
FT                   /inference="protein motif:TFAM:TIGR00177"
FT                   /protein_id="ACK44676.1"
FT                   DTPAGTQVTVEPFNSVLC"
FT   gene            155560..156096
FT                   /locus_tag="Sbal223_0136"
FT   CDS_pept        155560..156096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0136"
FT                   /product="Ferroxidase"
FT                   /EC_number=""
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   shw:Sputw3181_3940 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44677"
FT                   /db_xref="GOA:B8E3W5"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W5"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44677.1"
FT                   KGGESIMNGQGQPQA"
FT   gene            complement(156191..159415)
FT                   /locus_tag="Sbal223_0137"
FT   CDS_pept        complement(156191..159415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0137"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: shn:Shewana3_0133 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; histidine kinase
FT                   HAMP region domain protein; PAS fold-3 domain protein; PAS
FT                   fold-4 domain protein; PAS fold domain protein; SMART: PAS
FT                   domain containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44678"
FT                   /db_xref="GOA:B8E3W6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR013587"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W6"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK44678.1"
FT   gene            complement(159858..160511)
FT                   /locus_tag="Sbal223_0138"
FT   CDS_pept        complement(159858..160511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0138"
FT                   /product="3,4-dihydroxy-2-butanone 4-phosphate synthase"
FT                   /note="TIGRFAM: 3,4-dihydroxy-2-butanone 4-phosphate
FT                   synthase; PFAM: 34-dihydroxy-2-butanone 4-phosphate
FT                   synthase; KEGG: shm:Shewmr7_0129 3,4-dihydroxy-2-butanone
FT                   4-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44679"
FT                   /db_xref="GOA:B8E3W7"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3W7"
FT                   /inference="protein motif:TFAM:TIGR00506"
FT                   /protein_id="ACK44679.1"
FT   misc_binding    complement(160704..160933)
FT                   /bound_moiety="flavin mononucleotide"
FT                   /note="FMN riboswitch (RFN element) as predicted by Rfam
FT                   (RF00050), score 72.37"
FT   gene            161114..163249
FT                   /locus_tag="Sbal223_0139"
FT   CDS_pept        161114..163249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0139"
FT                   /product="Oligopeptidase B"
FT                   /EC_number=""
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; peptidase S9A prolyl oligopeptidase domain
FT                   protein beta-propeller; KEGG: spc:Sputcn32_0135
FT                   oligopeptidase B"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44680"
FT                   /db_xref="GOA:B8E3W8"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR023302"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W8"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44680.1"
FT                   DTAQEYAFFLSLLGMAK"
FT   sig_peptide     161114..161182
FT                   /locus_tag="Sbal223_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.769 at
FT                   residue 23"
FT   gene            163261..163761
FT                   /locus_tag="Sbal223_0140"
FT   CDS_pept        163261..163761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0140"
FT                   /product="Excinuclease ABC C subunit domain protein"
FT                   /note="PFAM: Excinuclease ABC C subunit domain protein;
FT                   KEGG: shn:Shewana3_0136 excinuclease ABC subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44681"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3W9"
FT                   /inference="protein motif:PFAM:PF01541"
FT                   /protein_id="ACK44681.1"
FT                   SAI"
FT   gene            163965..164573
FT                   /locus_tag="Sbal223_0141"
FT   CDS_pept        163965..164573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0141"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   saz:Sama_3310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44682"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X0"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ACK44682.1"
FT   gene            164807..165328
FT                   /locus_tag="Sbal223_0142"
FT   CDS_pept        164807..165328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0142"
FT                   /product="phenylacetic acid degradation-related protein"
FT                   /note="KEGG: swd:Swoo_0681 phenylacetic acid
FT                   degradation-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44683"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X1"
FT                   /inference="similar to AA sequence:KEGG:Swoo_0681"
FT                   /protein_id="ACK44683.1"
FT                   MTSNASRNEW"
FT   gene            complement(165629..166414)
FT                   /locus_tag="Sbal223_0143"
FT   CDS_pept        complement(165629..166414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0143"
FT                   /product="lipoprotein, putative"
FT                   /note="KEGG: shw:Sputw3181_3928 lipoprotein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44684"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X2"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3928"
FT                   /protein_id="ACK44684.1"
FT   sig_peptide     complement(166319..166414)
FT                   /locus_tag="Sbal223_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.956 at
FT                   residue 32"
FT   gene            166692..167459
FT                   /locus_tag="Sbal223_0144"
FT   CDS_pept        166692..167459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0144"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: shw:Sputw3181_3927 methyltransferase type
FT                   12"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44685"
FT                   /db_xref="GOA:B8E3X3"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X3"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACK44685.1"
FT   gene            complement(167485..169536)
FT                   /locus_tag="Sbal223_0145"
FT   CDS_pept        complement(167485..169536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0145"
FT                   /product="peptidase M14 carboxypeptidase A"
FT                   /note="PFAM: peptidase M14 carboxypeptidase A; KEGG:
FT                   she:Shewmr4_0145 peptidase M14, carboxypeptidase A"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44686"
FT                   /db_xref="GOA:B8E3X4"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X4"
FT                   /inference="protein motif:PFAM:PF00246"
FT                   /protein_id="ACK44686.1"
FT   sig_peptide     complement(169471..169536)
FT                   /locus_tag="Sbal223_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.539 at
FT                   residue 22"
FT   gene            complement(169680..170849)
FT                   /locus_tag="Sbal223_0146"
FT   CDS_pept        complement(169680..170849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0146"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3925 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44687"
FT                   /db_xref="GOA:B8E3X5"
FT                   /db_xref="InterPro:IPR006726"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X5"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3925"
FT                   /protein_id="ACK44687.1"
FT   gene            complement(171144..172394)
FT                   /locus_tag="Sbal223_0147"
FT   CDS_pept        complement(171144..172394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0147"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   shw:Sputw3181_3924 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44688"
FT                   /db_xref="GOA:B8E3X6"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X6"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACK44688.1"
FT                   DKYTEVDVKADSERSLS"
FT   gene            complement(172974..174515)
FT                   /locus_tag="Sbal223_0148"
FT   CDS_pept        complement(172974..174515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0148"
FT                   /product="Phosphoenolpyruvate carboxykinase (ATP)"
FT                   /EC_number=""
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (ATP); KEGG:
FT                   shw:Sputw3181_3708 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44689"
FT                   /db_xref="GOA:B8E3X7"
FT                   /db_xref="InterPro:IPR001272"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR015994"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3X7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44689.1"
FT   gene            complement(174726..175586)
FT                   /locus_tag="Sbal223_0149"
FT   CDS_pept        complement(174726..175586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0149"
FT                   /product="Hsp33 protein"
FT                   /note="PFAM: Hsp33 protein; KEGG: shw:Sputw3181_3707
FT                   HSP33-like chaperonin"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44690"
FT                   /db_xref="GOA:B8E3S8"
FT                   /db_xref="InterPro:IPR000397"
FT                   /db_xref="InterPro:IPR016153"
FT                   /db_xref="InterPro:IPR016154"
FT                   /db_xref="InterPro:IPR023212"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E3S8"
FT                   /inference="protein motif:PFAM:PF01430"
FT                   /protein_id="ACK44690.1"
FT                   STTQQ"
FT   gene            complement(175601..175999)
FT                   /locus_tag="Sbal223_0150"
FT   CDS_pept        complement(175601..175999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0150"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   shw:Sputw3181_3706 RNA-binding S4 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44691"
FT                   /db_xref="GOA:B8E3S9"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR025708"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S9"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACK44691.1"
FT   gene            176032..176145
FT                   /locus_tag="Sbal223_0151"
FT   CDS_pept        176032..176145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44692"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44692.1"
FT   gene            176253..177182
FT                   /locus_tag="Sbal223_0152"
FT   CDS_pept        176253..177182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0152"
FT                   /product="general secretion pathway protein C"
FT                   /note="TIGRFAM: general secretion pathway protein C; KEGG:
FT                   she:Shewmr4_0155 general secretion pathway protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44693"
FT                   /db_xref="GOA:B8E3T1"
FT                   /db_xref="InterPro:IPR001639"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T1"
FT                   /inference="protein motif:TFAM:TIGR01713"
FT                   /protein_id="ACK44693.1"
FT   gene            177207..179327
FT                   /locus_tag="Sbal223_0153"
FT   CDS_pept        177207..179327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0153"
FT                   /product="general secretion pathway protein D"
FT                   /note="TIGRFAM: general secretion pathway protein D; PFAM:
FT                   type II and III secretion system protein; NolW domain
FT                   protein; KEGG: shw:Sputw3181_3704 general secretion pathway
FT                   protein D"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44694"
FT                   /db_xref="GOA:B8E3T2"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T2"
FT                   /inference="protein motif:TFAM:TIGR02517"
FT                   /protein_id="ACK44694.1"
FT                   LEENKNKDKTNE"
FT   sig_peptide     177207..177293
FT                   /locus_tag="Sbal223_0153"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.822 at
FT                   residue 29"
FT   gene            179320..180885
FT                   /locus_tag="Sbal223_0154"
FT   CDS_pept        179320..180885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0154"
FT                   /product="general secretory pathway protein E"
FT                   /note="KEGG: shw:Sputw3181_3703 general secretory pathway
FT                   protein E; TIGRFAM: general secretory pathway protein E;
FT                   PFAM: type II secretion system protein E; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44695"
FT                   /db_xref="GOA:B8E3U3"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U3"
FT                   /inference="protein motif:TFAM:TIGR02533"
FT                   /protein_id="ACK44695.1"
FT                   TREE"
FT   gene            180889..182112
FT                   /locus_tag="Sbal223_0155"
FT   CDS_pept        180889..182112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0155"
FT                   /product="general secretion pathway protein F"
FT                   /note="TIGRFAM: general secretion pathway protein F; PFAM:
FT                   type II secretion system protein; KEGG: shw:Sputw3181_3702
FT                   general secretion pathway protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44696"
FT                   /db_xref="GOA:B8E3U5"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U5"
FT                   /inference="protein motif:TFAM:TIGR02120"
FT                   /protein_id="ACK44696.1"
FT                   ALNNLISG"
FT   gene            182175..182609
FT                   /locus_tag="Sbal223_0156"
FT   CDS_pept        182175..182609
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0156"
FT                   /product="general secretion pathway protein G"
FT                   /note="TIGRFAM: general secretion pathway protein G; PFAM:
FT                   type II secretion system protein G; KEGG: shn:Shewana3_0154
FT                   general secretion pathway protein G"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44697"
FT                   /db_xref="GOA:B8E3U6"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U6"
FT                   /inference="protein motif:TFAM:TIGR01710"
FT                   /protein_id="ACK44697.1"
FT   gene            182611..183186
FT                   /locus_tag="Sbal223_0157"
FT   CDS_pept        182611..183186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0157"
FT                   /product="general secretion pathway protein H"
FT                   /note="TIGRFAM: general secretion pathway protein H; KEGG:
FT                   son:SO_0170 general secretion pathway protein H"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44698"
FT                   /db_xref="GOA:B8E3U7"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U7"
FT                   /inference="protein motif:TFAM:TIGR01708"
FT                   /protein_id="ACK44698.1"
FT   sig_peptide     182611..182733
FT                   /locus_tag="Sbal223_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.556 at
FT                   residue 41"
FT   gene            183173..183541
FT                   /locus_tag="Sbal223_0158"
FT   CDS_pept        183173..183541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0158"
FT                   /product="general secretion pathway protein I"
FT                   /note="TIGRFAM: general secretion pathway protein I; PFAM:
FT                   type II secretion system protein I/J; KEGG:
FT                   shm:Shewmr7_0156 general secretion pathway protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44699"
FT                   /db_xref="GOA:B8E3U8"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U8"
FT                   /inference="protein motif:TFAM:TIGR01707"
FT                   /protein_id="ACK44699.1"
FT                   ERYQRIAAQVSSYVLKTD"
FT   sig_peptide     183173..183268
FT                   /locus_tag="Sbal223_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.741) with cleavage site probability 0.430 at
FT                   residue 32"
FT   gene            183522..184301
FT                   /locus_tag="Sbal223_0159"
FT   CDS_pept        183522..184301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0159"
FT                   /product="general secretion pathway protein J"
FT                   /note="TIGRFAM: general secretion pathway protein J; KEGG:
FT                   shm:Shewmr7_0157 general secretion pathway protein J"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44700"
FT                   /db_xref="GOA:B8E3S5"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S5"
FT                   /inference="protein motif:TFAM:TIGR01711"
FT                   /protein_id="ACK44700.1"
FT   sig_peptide     183522..183623
FT                   /locus_tag="Sbal223_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.513 at
FT                   residue 34"
FT   gene            184298..185296
FT                   /locus_tag="Sbal223_0160"
FT   CDS_pept        184298..185296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0160"
FT                   /product="General secretion pathway protein K"
FT                   /note="PFAM: General secretion pathway protein K; KEGG:
FT                   shn:Shewana3_0158 general secretion pathway protein K"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44701"
FT                   /db_xref="GOA:B8E3S6"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S6"
FT                   /inference="protein motif:PFAM:PF03934"
FT                   /protein_id="ACK44701.1"
FT   sig_peptide     184298..184384
FT                   /locus_tag="Sbal223_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.867 at
FT                   residue 29"
FT   gene            185296..185397
FT                   /locus_tag="Sbal223_0161"
FT   CDS_pept        185296..185397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0161"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44702"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3S7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44702.1"
FT   gene            185394..186584
FT                   /locus_tag="Sbal223_0162"
FT   CDS_pept        185394..186584
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0162"
FT                   /product="general secretion pathway protein L"
FT                   /note="TIGRFAM: general secretion pathway protein L; PFAM:
FT                   General secretion pathway L; KEGG: shm:Shewmr7_0159 general
FT                   secretion pathway protein L"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44703"
FT                   /db_xref="GOA:B8E3T3"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T3"
FT                   /inference="protein motif:TFAM:TIGR01709"
FT                   /protein_id="ACK44703.1"
FT   gene            186586..187062
FT                   /locus_tag="Sbal223_0163"
FT   CDS_pept        186586..187062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0163"
FT                   /product="General secretion pathway M protein"
FT                   /note="PFAM: General secretion pathway M protein; KEGG:
FT                   spc:Sputcn32_3558 general secretion pathway M protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44704"
FT                   /db_xref="GOA:B8E3T4"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T4"
FT                   /inference="protein motif:PFAM:PF04612"
FT                   /protein_id="ACK44704.1"
FT   gene            187077..187838
FT                   /locus_tag="Sbal223_0164"
FT   CDS_pept        187077..187838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0164"
FT                   /product="type II secretion system protein N"
FT                   /note="PFAM: type II secretion system protein N; KEGG:
FT                   shn:Shewana3_0161 type II secretion system protein N"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44705"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T5"
FT                   /inference="protein motif:PFAM:PF01203"
FT                   /protein_id="ACK44705.1"
FT   gene            complement(187916..188185)
FT                   /pseudo
FT                   /locus_tag="Sbal223_0165"
FT   gene            188198..188563
FT                   /pseudo
FT                   /locus_tag="Sbal223_0166"
FT   gene            188632..189378
FT                   /locus_tag="Sbal223_0167"
FT   CDS_pept        188632..189378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0167"
FT                   /product="Pili assembly chaperone, N-terminal"
FT                   /note="PFAM: Pili assembly chaperone, N-terminal; KEGG:
FT                   shw:Sputw3181_3908 pili assembly chaperone"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44706"
FT                   /db_xref="GOA:B8E3T6"
FT                   /db_xref="InterPro:IPR001829"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016147"
FT                   /db_xref="InterPro:IPR016148"
FT                   /db_xref="InterPro:IPR036316"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T6"
FT                   /inference="protein motif:PFAM:PF00345"
FT                   /protein_id="ACK44706.1"
FT   sig_peptide     188632..188706
FT                   /locus_tag="Sbal223_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.923 at
FT                   residue 25"
FT   gene            189393..191987
FT                   /locus_tag="Sbal223_0168"
FT   CDS_pept        189393..191987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0168"
FT                   /product="fimbrial biogenesis outer membrane usher protein"
FT                   /note="PFAM: fimbrial biogenesis outer membrane usher
FT                   protein; KEGG: shw:Sputw3181_3907 fimbrial biogenesis outer
FT                   membrane usher protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44707"
FT                   /db_xref="GOA:B8E3T7"
FT                   /db_xref="InterPro:IPR000015"
FT                   /db_xref="InterPro:IPR018030"
FT                   /db_xref="InterPro:IPR025885"
FT                   /db_xref="InterPro:IPR025949"
FT                   /db_xref="InterPro:IPR037224"
FT                   /db_xref="InterPro:IPR042186"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3T7"
FT                   /inference="protein motif:PFAM:PF00577"
FT                   /protein_id="ACK44707.1"
FT   sig_peptide     189393..189482
FT                   /locus_tag="Sbal223_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.981 at
FT                   residue 30"
FT   gene            191998..194508
FT                   /pseudo
FT                   /locus_tag="Sbal223_0169"
FT   mobile_element  complement(192766..193982)
FT                   /mobile_element_type="insertion sequence:ISSba2_3"
FT   gene            complement(192786..193895)
FT                   /locus_tag="Sbal223_0170"
FT   CDS_pept        complement(192786..193895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0170"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   asa:ASA_P4G164 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44708"
FT                   /db_xref="GOA:B8E3L4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK44708.1"
FT   gene            194474..196435
FT                   /pseudo
FT                   /locus_tag="Sbal223_0171"
FT   mobile_element  complement(195119..196335)
FT                   /mobile_element_type="insertion sequence:ISSba2_4"
FT   gene            complement(195139..196248)
FT                   /locus_tag="Sbal223_0172"
FT   CDS_pept        complement(195139..196248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0172"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   asa:ASA_P4G164 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44709"
FT                   /db_xref="GOA:B8E3L4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK44709.1"
FT   gene            complement(196480..200055)
FT                   /locus_tag="Sbal223_0173"
FT   CDS_pept        complement(196480..200055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0173"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3904 multi-sensor hybrid
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   extracellular solute-binding protein family 3; response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; Hpt domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44710"
FT                   /db_xref="GOA:B8E3U0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U0"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACK44710.1"
FT   sig_peptide     complement(199999..200055)
FT                   /locus_tag="Sbal223_0173"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.986 at
FT                   residue 19"
FT   gene            complement(200052..200678)
FT                   /locus_tag="Sbal223_0174"
FT   CDS_pept        complement(200052..200678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0174"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: shw:Sputw3181_3903 two component
FT                   transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44711"
FT                   /db_xref="GOA:B8E3U1"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44711.1"
FT   gene            201018..202256
FT                   /locus_tag="Sbal223_0175"
FT   CDS_pept        201018..202256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0175"
FT                   /product="response regulator receiver modulated diguanylate
FT                   phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; response regulator
FT                   receiver; KEGG: shw:Sputw3181_3902 response regulator
FT                   receiver modulated diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44712"
FT                   /db_xref="GOA:B8E3U2"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U2"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACK44712.1"
FT                   LYSDSSKEISLEL"
FT   gene            complement(202240..203676)
FT                   /locus_tag="Sbal223_0176"
FT   CDS_pept        complement(202240..203676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0176"
FT                   /product="O-succinylbenzoate-CoA ligase"
FT                   /note="TIGRFAM: O-succinylbenzoate-CoA ligase; PFAM:
FT                   AMP-dependent synthetase and ligase; KEGG:
FT                   shw:Sputw3181_3901 O-succinylbenzoate-CoA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44713"
FT                   /db_xref="GOA:B8E3U4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR010192"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U4"
FT                   /inference="protein motif:TFAM:TIGR01923"
FT                   /protein_id="ACK44713.1"
FT   sig_peptide     complement(203611..203676)
FT                   /locus_tag="Sbal223_0176"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.644) with cleavage site probability 0.637 at
FT                   residue 22"
FT   gene            complement(203678..204778)
FT                   /locus_tag="Sbal223_0177"
FT   CDS_pept        complement(203678..204778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0177"
FT                   /product="O-succinylbenzoate synthase"
FT                   /note="KEGG: spc:Sputcn32_0308 O-succinylbenzoate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44714"
FT                   /db_xref="GOA:B8E3U9"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3U9"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0308"
FT                   /protein_id="ACK44714.1"
FT   gene            complement(204806..205600)
FT                   /locus_tag="Sbal223_0178"
FT   CDS_pept        complement(204806..205600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0178"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   shw:Sputw3181_3899 alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44715"
FT                   /db_xref="GOA:B8E3V0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022485"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V0"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACK44715.1"
FT   gene            complement(205600..207321)
FT                   /locus_tag="Sbal223_0179"
FT   CDS_pept        complement(205600..207321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0179"
FT                   /product="2-succinyl-6-hydroxy-2,
FT                   4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate
FT                   decarboxylase"
FT                   /note="TIGRFAM:
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase; PFAM: thiamine
FT                   pyrophosphate protein TPP binding domain protein; KEGG:
FT                   spc:Sputcn32_0310
FT                   2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid
FT                   synthase/2-oxoglutarate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44716"
FT                   /db_xref="GOA:B8E3V1"
FT                   /db_xref="InterPro:IPR004433"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR032264"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V1"
FT                   /inference="protein motif:TFAM:TIGR00173"
FT                   /protein_id="ACK44716.1"
FT   gene            complement(207503..208471)
FT                   /locus_tag="Sbal223_0180"
FT   CDS_pept        complement(207503..208471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0180"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG:
FT                   shn:Shewana3_3964 LysR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44717"
FT                   /db_xref="GOA:B8E3V2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V2"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACK44717.1"
FT   gene            208881..209357
FT                   /locus_tag="Sbal223_0181"
FT   CDS_pept        208881..209357
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0181"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3896 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44718"
FT                   /db_xref="GOA:B8E3V3"
FT                   /db_xref="InterPro:IPR024402"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3V3"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3896"
FT                   /protein_id="ACK44718.1"
FT   gene            209435..209896
FT                   /locus_tag="Sbal223_0182"
FT   CDS_pept        209435..209896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0182"
FT                   /product="formate-dependent nitrite reductase"
FT                   /note="KEGG: she:Shewmr4_3764 formate-dependent nitrite
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44719"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X8"
FT                   /inference="similar to AA sequence:KEGG:Shewmr4_3764"
FT                   /protein_id="ACK44719.1"
FT   sig_peptide     209435..209512
FT                   /locus_tag="Sbal223_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.453 at
FT                   residue 26"
FT   gene            209906..210592
FT                   /locus_tag="Sbal223_0183"
FT   CDS_pept        209906..210592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0183"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: she:Shewmr4_3763 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44720"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3X9"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK44720.1"
FT                   SGEVIL"
FT   sig_peptide     209906..209998
FT                   /locus_tag="Sbal223_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 31"
FT   gene            210589..211530
FT                   /locus_tag="Sbal223_0184"
FT   CDS_pept        210589..211530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0184"
FT                   /product="cytochrome c nitrite reductase, NrfD subunit"
FT                   /note="TIGRFAM: cytochrome c nitrite reductase, NrfD
FT                   subunit; PFAM: Polysulphide reductase NrfD; KEGG:
FT                   shw:Sputw3181_3893 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44721"
FT                   /db_xref="GOA:B8E3Y0"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="InterPro:IPR017566"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y0"
FT                   /inference="protein motif:TFAM:TIGR03148"
FT                   /protein_id="ACK44721.1"
FT   gene            211599..211772
FT                   /locus_tag="Sbal223_0185"
FT   CDS_pept        211599..211772
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0185"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44722"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44722.1"
FT                   PCLQMGLATSIP"
FT   gene            complement(211811..212242)
FT                   /locus_tag="Sbal223_0186"
FT   CDS_pept        complement(211811..212242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0186"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; KEGG:
FT                   shn:Shewana3_3959 AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44723"
FT                   /db_xref="GOA:B8E3Y2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y2"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACK44723.1"
FT   gene            212494..213756
FT                   /locus_tag="Sbal223_0187"
FT   CDS_pept        212494..213756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0187"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   spc:Sputcn32_0317 inner membrane protein YjeH"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44724"
FT                   /db_xref="GOA:B8E3Y3"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y3"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACK44724.1"
FT   gene            214045..214869
FT                   /locus_tag="Sbal223_0188"
FT   CDS_pept        214045..214869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0188"
FT                   /product="putative signal transduction protein"
FT                   /note="PFAM: Metal-dependent hydrolase HDOD; KEGG:
FT                   shn:Shewana3_3956 putative signal transduction protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44725"
FT                   /db_xref="InterPro:IPR013976"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y4"
FT                   /inference="protein motif:PFAM:PF08668"
FT                   /protein_id="ACK44725.1"
FT   gene            complement(215155..215628)
FT                   /locus_tag="Sbal223_0189"
FT   CDS_pept        complement(215155..215628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0189"
FT                   /product="protein of unknown function DUF1332"
FT                   /note="PFAM: protein of unknown function DUF1332; KEGG:
FT                   shw:Sputw3181_3890 protein of unknown function DUF1332"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44726"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y5"
FT                   /inference="protein motif:PFAM:PF07049"
FT                   /protein_id="ACK44726.1"
FT   gene            complement(215730..216260)
FT                   /locus_tag="Sbal223_0190"
FT   CDS_pept        complement(215730..216260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3756 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44727"
FT                   /db_xref="InterPro:IPR021302"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y6"
FT                   /inference="similar to AA sequence:KEGG:Shewmr4_3756"
FT                   /protein_id="ACK44727.1"
FT                   TSDLLMKGLNSLL"
FT   sig_peptide     complement(216192..216260)
FT                   /locus_tag="Sbal223_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 23"
FT   gene            216450..217157
FT                   /locus_tag="Sbal223_0191"
FT   CDS_pept        216450..217157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0191"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44728"
FT                   /db_xref="GOA:B8E3Y7"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y7"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3888"
FT                   /protein_id="ACK44728.1"
FT                   FRLYMVSKKPSVE"
FT   gene            217191..218666
FT                   /locus_tag="Sbal223_0192"
FT   CDS_pept        217191..218666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0192"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: shw:Sputw3181_3887 Sel1 domain protein
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44729"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR025285"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y8"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACK44729.1"
FT   gene            complement(218752..219099)
FT                   /locus_tag="Sbal223_0193"
FT   CDS_pept        complement(218752..219099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44730"
FT                   /db_xref="GOA:B8E3Y9"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Y9"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3886"
FT                   /protein_id="ACK44730.1"
FT                   GRTFEHKEDEH"
FT   gene            219474..221345
FT                   /locus_tag="Sbal223_0194"
FT   CDS_pept        219474..221345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0194"
FT                   /product="methyl-accepting chemotaxis sensory transducer
FT                   with Cache sensor"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   Cache domain protein; chemotaxis sensory transducer; KEGG:
FT                   shm:Shewmr7_3825 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44731"
FT                   /db_xref="GOA:B8E3Z0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z0"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACK44731.1"
FT   sig_peptide     219474..219569
FT                   /locus_tag="Sbal223_0194"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.798 at
FT                   residue 32"
FT   gene            complement(221431..222402)
FT                   /locus_tag="Sbal223_0195"
FT   CDS_pept        complement(221431..222402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0195"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: shw:Sputw3181_3884 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44732"
FT                   /db_xref="GOA:B8E3Z1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z1"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACK44732.1"
FT   gene            222516..223724
FT                   /locus_tag="Sbal223_0196"
FT   CDS_pept        222516..223724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0196"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   shw:Sputw3181_3883 drug resistance transporter, Bcr/CflA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44733"
FT                   /db_xref="GOA:B8E3Z2"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z2"
FT                   /inference="protein motif:TFAM:TIGR00710"
FT                   /protein_id="ACK44733.1"
FT                   GEH"
FT   sig_peptide     222516..222611
FT                   /locus_tag="Sbal223_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.866 at
FT                   residue 32"
FT   gene            complement(223896..224729)
FT                   /locus_tag="Sbal223_0197"
FT   CDS_pept        complement(223896..224729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sse:Ssed_0255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44734"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z3"
FT                   /inference="similar to AA sequence:KEGG:Ssed_0255"
FT                   /protein_id="ACK44734.1"
FT   sig_peptide     complement(224664..224729)
FT                   /locus_tag="Sbal223_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            224954..225577
FT                   /locus_tag="Sbal223_0198"
FT   CDS_pept        224954..225577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0198"
FT                   /product="DTW domain containing protein"
FT                   /note="PFAM: DTW domain containing protein; KEGG:
FT                   shw:Sputw3181_3882 DTW domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44735"
FT                   /db_xref="InterPro:IPR005636"
FT                   /db_xref="InterPro:IPR039262"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z4"
FT                   /inference="protein motif:PFAM:PF03942"
FT                   /protein_id="ACK44735.1"
FT   gene            complement(225961..228081)
FT                   /locus_tag="Sbal223_0199"
FT   CDS_pept        complement(225961..228081)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0199"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: shw:Sputw3181_3881 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC and GAF sensor(s);
FT                   TIGRFAM: PAS sensor protein; diguanylate cyclase; PFAM:
FT                   GGDEF domain containing protein; EAL domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44736"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z5"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK44736.1"
FT                   FTQTFLAEKHIA"
FT   gene            228375..228746
FT                   /locus_tag="Sbal223_0200"
FT   CDS_pept        228375..228746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3747 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44737"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44737.1"
FT   sig_peptide     228375..228458
FT                   /locus_tag="Sbal223_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.505 at
FT                   residue 28"
FT   gene            228851..229501
FT                   /locus_tag="Sbal223_0201"
FT   CDS_pept        228851..229501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0201"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   shn:Shewana3_3944 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44738"
FT                   /db_xref="GOA:B8E3Z7"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z7"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACK44738.1"
FT   gene            complement(229548..230195)
FT                   /locus_tag="Sbal223_0202"
FT   CDS_pept        complement(229548..230195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0202"
FT                   /product="putative orphan protein"
FT                   /note="KEGG: sdn:Sden_1470 putative orphan protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44739"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z8"
FT                   /inference="similar to AA sequence:KEGG:Sden_1470"
FT                   /protein_id="ACK44739.1"
FT   gene            complement(230197..230526)
FT                   /locus_tag="Sbal223_0203"
FT   CDS_pept        complement(230197..230526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0203"
FT                   /product="Antibiotic biosynthesis monooxygenase"
FT                   /note="PFAM: Antibiotic biosynthesis monooxygenase; KEGG:
FT                   hch:HCH_05533 uncharacterized enzyme involved in
FT                   biosynthesis of extracellular polysaccharides"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44740"
FT                   /db_xref="GOA:B8E3Z9"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3Z9"
FT                   /inference="protein motif:PFAM:PF03992"
FT                   /protein_id="ACK44740.1"
FT                   APRSN"
FT   gene            complement(230523..230876)
FT                   /locus_tag="Sbal223_0204"
FT   CDS_pept        complement(230523..230876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0204"
FT                   /product="NIPSNAP family containing protein"
FT                   /note="PFAM: NIPSNAP family containing protein; KEGG:
FT                   sse:Ssed_1304 NIPSNAP family containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44741"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR012577"
FT                   /db_xref="UniProtKB/TrEMBL:B8E400"
FT                   /inference="protein motif:PFAM:PF07978"
FT                   /protein_id="ACK44741.1"
FT                   IAKTYQRAAETKL"
FT   gene            230971..231690
FT                   /locus_tag="Sbal223_0205"
FT   CDS_pept        230971..231690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0205"
FT                   /product="putative transcriptional regulator, ArsR family"
FT                   /note="SMART: regulatory protein ArsR; KEGG: hch:HCH_05536
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44742"
FT                   /db_xref="GOA:B8E401"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E401"
FT                   /inference="protein motif:SMART:SM00418"
FT                   /protein_id="ACK44742.1"
FT                   SSRGLKSFRADYGIATK"
FT   gene            231836..232270
FT                   /locus_tag="Sbal223_0206"
FT   CDS_pept        231836..232270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44743"
FT                   /db_xref="UniProtKB/TrEMBL:B8E402"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44743.1"
FT   sig_peptide     231836..231898
FT                   /locus_tag="Sbal223_0206"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            232465..233364
FT                   /locus_tag="Sbal223_0207"
FT   CDS_pept        232465..233364
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0207"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44744"
FT                   /db_xref="InterPro:IPR029074"
FT                   /db_xref="UniProtKB/TrEMBL:B8E403"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44744.1"
FT                   IYQIEDQAISFEQLEPIS"
FT   gene            234042..235442
FT                   /locus_tag="Sbal223_0208"
FT   CDS_pept        234042..235442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0208"
FT                   /product="amidohydrolase"
FT                   /EC_number=""
FT                   /note="KEGG: she:Shewmr4_3743 carboxypeptidase; TIGRFAM:
FT                   amidohydrolase; PFAM: peptidase M20; peptidase dimerisation
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44745"
FT                   /db_xref="GOA:B8E404"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B8E404"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACK44745.1"
FT                   ALTALNAQ"
FT   sig_peptide     234042..234206
FT                   /locus_tag="Sbal223_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 55"
FT   gene            235580..236911
FT                   /locus_tag="Sbal223_0209"
FT   CDS_pept        235580..236911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0209"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   son:SO_4537.2 Zn-dependent peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44746"
FT                   /db_xref="GOA:B8E405"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8E405"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACK44746.1"
FT   sig_peptide     235580..235645
FT                   /locus_tag="Sbal223_0209"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.949 at
FT                   residue 22"
FT   gene            236908..238401
FT                   /locus_tag="Sbal223_0210"
FT   CDS_pept        236908..238401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0210"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   shw:Sputw3181_0448 peptidase M16 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44747"
FT                   /db_xref="GOA:B8E406"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8E406"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACK44747.1"
FT   sig_peptide     236908..237054
FT                   /locus_tag="Sbal223_0210"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.483 at
FT                   residue 49"
FT   gene            complement(238519..240540)
FT                   /locus_tag="Sbal223_0211"
FT   CDS_pept        complement(238519..240540)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0211"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; WD40 domain protein beta Propeller; KEGG:
FT                   shw:Sputw3181_0447 peptidase S9, prolyl oligopeptidase
FT                   active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44748"
FT                   /db_xref="GOA:B8E407"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8E407"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACK44748.1"
FT   sig_peptide     complement(240478..240540)
FT                   /locus_tag="Sbal223_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 21"
FT   gene            240835..241389
FT                   /locus_tag="Sbal223_0212"
FT   CDS_pept        240835..241389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0212"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3937 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44749"
FT                   /db_xref="UniProtKB/TrEMBL:B8E408"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_3937"
FT                   /protein_id="ACK44749.1"
FT   sig_peptide     240835..240921
FT                   /locus_tag="Sbal223_0212"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(241444..241908)
FT                   /locus_tag="Sbal223_0213"
FT   CDS_pept        complement(241444..241908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0213"
FT                   /product="RNA methyltransferase, TrmH family, group 2"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   2; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   shw:Sputw3181_0443 RNA methyltransferase, TrmH family,
FT                   group 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44750"
FT                   /db_xref="GOA:B8E409"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B8E409"
FT                   /inference="protein motif:TFAM:TIGR00185"
FT                   /protein_id="ACK44750.1"
FT   gene            242069..242842
FT                   /locus_tag="Sbal223_0214"
FT   CDS_pept        242069..242842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0214"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44751"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B8E410"
FT                   /inference="similar to AA sequence:KEGG:SO_4528"
FT                   /protein_id="ACK44751.1"
FT   sig_peptide     242069..242146
FT                   /locus_tag="Sbal223_0214"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 26"
FT   gene            242969..243826
FT                   /locus_tag="Sbal223_0215"
FT   CDS_pept        242969..243826
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0215"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: spc:Sputcn32_3499 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44752"
FT                   /db_xref="GOA:B8E411"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8E411"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACK44752.1"
FT                   KVQP"
FT   gene            243855..244796
FT                   /locus_tag="Sbal223_0216"
FT   CDS_pept        243855..244796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0216"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: shw:Sputw3181_0406 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44753"
FT                   /db_xref="GOA:B8E412"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037402"
FT                   /db_xref="UniProtKB/TrEMBL:B8E412"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACK44753.1"
FT   gene            complement(244780..245661)
FT                   /locus_tag="Sbal223_0217"
FT   CDS_pept        complement(244780..245661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0217"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: shw:Sputw3181_0405 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44754"
FT                   /db_xref="GOA:B8E413"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:B8E413"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACK44754.1"
FT                   WLAAPKEPKPEA"
FT   gene            complement(245739..246752)
FT                   /locus_tag="Sbal223_0218"
FT   CDS_pept        complement(245739..246752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0218"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: shw:Sputw3181_0404 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44755"
FT                   /db_xref="GOA:B8E414"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E414"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK44755.1"
FT   sig_peptide     complement(246675..246752)
FT                   /locus_tag="Sbal223_0218"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.714) with cleavage site probability 0.649 at
FT                   residue 26"
FT   gene            246877..248877
FT                   /locus_tag="Sbal223_0219"
FT   CDS_pept        246877..248877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0219"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: spc:Sputcn32_3503 enterobactin
FT                   receptor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44756"
FT                   /db_xref="GOA:B8E415"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B8E415"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACK44756.1"
FT   sig_peptide     246877..246966
FT                   /locus_tag="Sbal223_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.995 at
FT                   residue 30"
FT   gene            complement(248962..249210)
FT                   /locus_tag="Sbal223_0220"
FT   CDS_pept        complement(248962..249210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0220"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44757"
FT                   /db_xref="UniProtKB/TrEMBL:B8E416"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0401"
FT                   /protein_id="ACK44757.1"
FT   gene            complement(249342..250679)
FT                   /locus_tag="Sbal223_0221"
FT   CDS_pept        complement(249342..250679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0221"
FT                   /product="Coproporphyrinogen dehydrogenase"
FT                   /EC_number=""
FT                   /note="KEGG: spc:Sputcn32_3506 coproporphyrinogen III
FT                   oxidase; PFAM: Radical SAM domain protein; HemN domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44758"
FT                   /db_xref="GOA:B8E417"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B8E417"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44758.1"
FT   gene            251058..251969
FT                   /locus_tag="Sbal223_0222"
FT   CDS_pept        251058..251969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0222"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   spc:Sputcn32_3507 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44759"
FT                   /db_xref="GOA:B8E418"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B8E418"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ACK44759.1"
FT   gene            complement(252043..253434)
FT                   /locus_tag="Sbal223_0223"
FT   CDS_pept        complement(252043..253434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0223"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: hch:HCH_06539 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44760"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8E419"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACK44760.1"
FT                   PLPVN"
FT   sig_peptide     complement(253369..253434)
FT                   /locus_tag="Sbal223_0223"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.919 at
FT                   residue 22"
FT   gene            complement(253706..254596)
FT                   /locus_tag="Sbal223_0224"
FT   CDS_pept        complement(253706..254596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0224"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abo:ABO_1732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44761"
FT                   /db_xref="UniProtKB/TrEMBL:B8E420"
FT                   /inference="similar to AA sequence:KEGG:ABO_1732"
FT                   /protein_id="ACK44761.1"
FT                   KTAFIYAATPNFCSQ"
FT   sig_peptide     complement(254516..254596)
FT                   /locus_tag="Sbal223_0224"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 27"
FT   gene            complement(254729..256270)
FT                   /locus_tag="Sbal223_0225"
FT   CDS_pept        complement(254729..256270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0225"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abo:ABO_1733 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44762"
FT                   /db_xref="InterPro:IPR027372"
FT                   /db_xref="UniProtKB/TrEMBL:B8E421"
FT                   /inference="similar to AA sequence:KEGG:ABO_1733"
FT                   /protein_id="ACK44762.1"
FT   sig_peptide     complement(256202..256270)
FT                   /locus_tag="Sbal223_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.846 at
FT                   residue 23"
FT   gene            complement(256748..258331)
FT                   /locus_tag="Sbal223_0226"
FT   CDS_pept        complement(256748..258331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0226"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: she:Shewmr4_3728
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44763"
FT                   /db_xref="GOA:B8E422"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B8E422"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACK44763.1"
FT                   LVGVVSHFKL"
FT   gene            complement(258754..259737)
FT                   /locus_tag="Sbal223_0227"
FT   CDS_pept        complement(258754..259737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0227"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   shw:Sputw3181_3877 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44764"
FT                   /db_xref="GOA:B8E423"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B8E423"
FT                   /inference="protein motif:TFAM:TIGR01583"
FT                   /protein_id="ACK44764.1"
FT   sig_peptide     complement(259669..259737)
FT                   /locus_tag="Sbal223_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.696 at
FT                   residue 23"
FT   gene            complement(259817..260386)
FT                   /locus_tag="Sbal223_0228"
FT   CDS_pept        complement(259817..260386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0228"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: shw:Sputw3181_3876 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44765"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8E424"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK44765.1"
FT   gene            complement(260416..263268)
FT                   /locus_tag="Sbal223_0229"
FT   CDS_pept        complement(260416..263268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0229"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: shm:Shewmr7_3795 formate dehydrogenase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44766"
FT                   /db_xref="GOA:B8E425"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B8E425"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACK44766.1"
FT   sig_peptide     complement(263110..263268)
FT                   /locus_tag="Sbal223_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.655) with cleavage site probability 0.646 at
FT                   residue 53"
FT   gene            complement(263286..263486)
FT                   /locus_tag="Sbal223_0230"
FT   CDS_pept        complement(263286..263486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0230"
FT                   /product="formate dehydrogenase region TAT target"
FT                   /note="TIGRFAM: formate dehydrogenase region TAT target;
FT                   KEGG: shn:Shewana3_3919 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44767"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B8E426"
FT                   /inference="protein motif:TFAM:TIGR02811"
FT                   /protein_id="ACK44767.1"
FT   sig_peptide     complement(263373..263486)
FT                   /locus_tag="Sbal223_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 38"
FT   gene            complement(263871..264899)
FT                   /locus_tag="Sbal223_0231"
FT   CDS_pept        complement(263871..264899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0231"
FT                   /product="formate dehydrogenase, gamma subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, gamma subunit; KEGG:
FT                   spc:Sputcn32_0335 formate dehydrogenase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44768"
FT                   /db_xref="GOA:B8E427"
FT                   /db_xref="InterPro:IPR006471"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B8E427"
FT                   /inference="protein motif:TFAM:TIGR01583"
FT                   /protein_id="ACK44768.1"
FT                   KD"
FT   sig_peptide     complement(264789..264899)
FT                   /locus_tag="Sbal223_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 37"
FT   gene            complement(264949..265545)
FT                   /locus_tag="Sbal223_0232"
FT   CDS_pept        complement(264949..265545)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0232"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: shn:Shewana3_3917 4Fe-4S ferredoxin
FT                   iron-sulfur binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44769"
FT                   /db_xref="GOA:B8E428"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8E428"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK44769.1"
FT   gene            complement(265572..268424)
FT                   /locus_tag="Sbal223_0233"
FT   CDS_pept        complement(265572..268424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0233"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: she:Shewmr4_3720 formate dehydrogenase
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44770"
FT                   /db_xref="GOA:B8E429"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR027467"
FT                   /db_xref="UniProtKB/TrEMBL:B8E429"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACK44770.1"
FT   sig_peptide     complement(268266..268424)
FT                   /locus_tag="Sbal223_0233"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.992 at
FT                   residue 53"
FT   gene            complement(268442..268639)
FT                   /locus_tag="Sbal223_0234"
FT   CDS_pept        complement(268442..268639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0234"
FT                   /product="formate dehydrogenase region TAT target"
FT                   /note="TIGRFAM: formate dehydrogenase region TAT target;
FT                   KEGG: shn:Shewana3_3915 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44771"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR014177"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B8E430"
FT                   /inference="protein motif:TFAM:TIGR02811"
FT                   /protein_id="ACK44771.1"
FT   sig_peptide     complement(268532..268639)
FT                   /locus_tag="Sbal223_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.968 at
FT                   residue 36"
FT   gene            complement(268814..269491)
FT                   /locus_tag="Sbal223_0235"
FT   CDS_pept        complement(268814..269491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0235"
FT                   /product="cytoplasmic chaperone TorD family protein"
FT                   /note="PFAM: cytoplasmic chaperone TorD family protein;
FT                   KEGG: shw:Sputw3181_3869 cytoplasmic chaperone TorD family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44772"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:B8E431"
FT                   /inference="protein motif:PFAM:PF06192"
FT                   /protein_id="ACK44772.1"
FT                   LMN"
FT   gene            complement(269502..271163)
FT                   /locus_tag="Sbal223_0236"
FT   CDS_pept        complement(269502..271163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0236"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: shw:Sputw3181_3868 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44773"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8E432"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK44773.1"
FT   gene            complement(271353..272021)
FT                   /locus_tag="Sbal223_0237"
FT   CDS_pept        complement(271353..272021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3867 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44774"
FT                   /db_xref="InterPro:IPR021735"
FT                   /db_xref="UniProtKB/TrEMBL:B8E433"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3867"
FT                   /protein_id="ACK44774.1"
FT                   "
FT   gene            complement(272021..272485)
FT                   /locus_tag="Sbal223_0238"
FT   CDS_pept        complement(272021..272485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0238"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_3786 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44775"
FT                   /db_xref="InterPro:IPR021736"
FT                   /db_xref="UniProtKB/TrEMBL:B8E434"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_3786"
FT                   /protein_id="ACK44775.1"
FT   gene            272805..273677
FT                   /locus_tag="Sbal223_0239"
FT   CDS_pept        272805..273677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0239"
FT                   /product="formate dehydrogenase subunit FdhD"
FT                   /note="PFAM: formate dehydrogenase subunit FdhD; KEGG:
FT                   shw:Sputw3181_3865 formate dehydrogenase, subunit FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44776"
FT                   /db_xref="GOA:B8E435"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8E435"
FT                   /inference="protein motif:PFAM:PF02634"
FT                   /protein_id="ACK44776.1"
FT                   LQFDANTAP"
FT   gene            273747..274652
FT                   /locus_tag="Sbal223_0240"
FT   CDS_pept        273747..274652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0240"
FT                   /product="DNA binding domain protein, excisionase family"
FT                   /note="TIGRFAM: DNA binding domain protein, excisionase
FT                   family; KEGG: shw:Sputw3181_3864 DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44777"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B8E436"
FT                   /inference="protein motif:TFAM:TIGR01764"
FT                   /protein_id="ACK44777.1"
FT   gene            275597..277133
FT                   /locus_tag="Sbal223_R0004"
FT   rRNA            275597..277133
FT                   /locus_tag="Sbal223_R0004"
FT                   /product="16S ribosomal RNA"
FT   gene            277498..280400
FT                   /locus_tag="Sbal223_R0005"
FT   rRNA            277498..280400
FT                   /locus_tag="Sbal223_R0005"
FT                   /product="23S ribosomal RNA"
FT   gene            280541..280655
FT                   /locus_tag="Sbal223_R0006"
FT   rRNA            280541..280655
FT                   /locus_tag="Sbal223_R0006"
FT                   /product="5S ribosomal RNA"
FT   gene            280691..280767
FT                   /locus_tag="Sbal223_R0036"
FT                   /note="tRNA-Asp2"
FT   tRNA            280691..280767
FT                   /locus_tag="Sbal223_R0036"
FT                   /product="tRNA-Asp"
FT   gene            281253..281765
FT                   /locus_tag="Sbal223_0241"
FT   CDS_pept        281253..281765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0195 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44778"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B8E437"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0195"
FT                   /protein_id="ACK44778.1"
FT                   GAMPYKS"
FT   gene            282177..282374
FT                   /locus_tag="Sbal223_0242"
FT   CDS_pept        282177..282374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0196 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44779"
FT                   /db_xref="UniProtKB/TrEMBL:B8E438"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0196"
FT                   /protein_id="ACK44779.1"
FT   gene            complement(282480..282947)
FT                   /locus_tag="Sbal223_0243"
FT   CDS_pept        complement(282480..282947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0243"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   shw:Sputw3181_0205 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44780"
FT                   /db_xref="GOA:B8E439"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8E439"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACK44780.1"
FT   gene            complement(283080..284396)
FT                   /locus_tag="Sbal223_0244"
FT   CDS_pept        complement(283080..284396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0244"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: spc:Sputcn32_0356 integral membrane sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44781"
FT                   /db_xref="GOA:B8E440"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E440"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK44781.1"
FT   gene            complement(284402..285061)
FT                   /locus_tag="Sbal223_0245"
FT   CDS_pept        complement(284402..285061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0245"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: spc:Sputcn32_0357 two
FT                   component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44782"
FT                   /db_xref="GOA:B8E441"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8E441"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44782.1"
FT   gene            complement(285061..285327)
FT                   /locus_tag="Sbal223_0246"
FT   CDS_pept        complement(285061..285327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0246"
FT                   /product="Propeptide PepSY amd peptidase M4"
FT                   /note="PFAM: Propeptide PepSY amd peptidase M4; KEGG:
FT                   shn:Shewana3_0242 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44783"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B8E442"
FT                   /inference="protein motif:PFAM:PF03413"
FT                   /protein_id="ACK44783.1"
FT   gene            complement(285320..285871)
FT                   /locus_tag="Sbal223_0247"
FT   CDS_pept        complement(285320..285871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0247"
FT                   /product="diheme cytochrome c"
FT                   /note="KEGG: shw:Sputw3181_0209 diheme cytochrome c"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44784"
FT                   /db_xref="InterPro:IPR018588"
FT                   /db_xref="UniProtKB/TrEMBL:B8E443"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0209"
FT                   /protein_id="ACK44784.1"
FT   sig_peptide     complement(285755..285871)
FT                   /locus_tag="Sbal223_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.751 at
FT                   residue 39"
FT   gene            complement(285962..286408)
FT                   /locus_tag="Sbal223_0248"
FT   CDS_pept        complement(285962..286408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0248"
FT                   /product="Domain of unknown function DUF1924"
FT                   /note="PFAM: Domain of unknown function DUF1924; KEGG:
FT                   shw:Sputw3181_0210 cytochrome c-type protein Shp"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44785"
FT                   /db_xref="GOA:B8E444"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR015170"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8E444"
FT                   /inference="protein motif:PFAM:PF09086"
FT                   /protein_id="ACK44785.1"
FT   sig_peptide     complement(286316..286408)
FT                   /locus_tag="Sbal223_0248"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.975 at
FT                   residue 31"
FT   gene            complement(286462..287049)
FT                   /locus_tag="Sbal223_0249"
FT   CDS_pept        complement(286462..287049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0249"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: shw:Sputw3181_0211
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44786"
FT                   /db_xref="GOA:B8E445"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B8E445"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACK44786.1"
FT   gene            287270..287734
FT                   /locus_tag="Sbal223_0250"
FT   CDS_pept        287270..287734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0362 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44787"
FT                   /db_xref="GOA:B8E446"
FT                   /db_xref="InterPro:IPR021257"
FT                   /db_xref="UniProtKB/TrEMBL:B8E446"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0362"
FT                   /protein_id="ACK44787.1"
FT   gene            287802..288305
FT                   /locus_tag="Sbal223_0251"
FT   CDS_pept        287802..288305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0251"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44788"
FT                   /db_xref="UniProtKB/TrEMBL:B8E447"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0363"
FT                   /protein_id="ACK44788.1"
FT                   DNIN"
FT   gene            complement(288473..289993)
FT                   /locus_tag="Sbal223_0252"
FT   CDS_pept        complement(288473..289993)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0252"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   shw:Sputw3181_0214 aldehyde dehydrogenase (NAD(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44789"
FT                   /db_xref="GOA:B8E448"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8E448"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACK44789.1"
FT   gene            290375..292333
FT                   /locus_tag="Sbal223_0253"
FT   CDS_pept        290375..292333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0253"
FT                   /product="GAF modulated sigma54 specific transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; GAF domain protein;
FT                   SMART: AAA ATPase; KEGG: shw:Sputw3181_0215 GAF modulated
FT                   sigma54 specific transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44790"
FT                   /db_xref="GOA:B8E449"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B8E449"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACK44790.1"
FT                   ISRNALYRRLKQMGLKG"
FT   gene            292684..293664
FT                   /locus_tag="Sbal223_0254"
FT   CDS_pept        292684..293664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0254"
FT                   /product="quinone oxidoreductase, YhdH/YhfP family"
FT                   /note="TIGRFAM: quinone oxidoreductase, YhdH/YhfP family;
FT                   PFAM: Alcohol dehydrogenase zinc-binding domain protein;
FT                   Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   spc:Sputcn32_3530 alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44791"
FT                   /db_xref="GOA:B8E450"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014188"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8E450"
FT                   /inference="protein motif:TFAM:TIGR02823"
FT                   /protein_id="ACK44791.1"
FT   gene            complement(293761..295137)
FT                   /locus_tag="Sbal223_0255"
FT   CDS_pept        complement(293761..295137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0255"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: son:SO_4478 sensor protein
FT                   CpxA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44792"
FT                   /db_xref="GOA:B8E451"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E451"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK44792.1"
FT                   "
FT   gene            complement(295125..295811)
FT                   /locus_tag="Sbal223_0256"
FT   CDS_pept        complement(295125..295811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0256"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: shn:Shewana3_0253 two
FT                   component transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44793"
FT                   /db_xref="GOA:B8E452"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8E452"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44793.1"
FT                   GYIWLP"
FT   repeat_region   295948..296050
FT                   /note="MITE, 5'"
FT   gene            296192..296716
FT                   /locus_tag="Sbal223_0257"
FT   CDS_pept        296192..296716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0257"
FT                   /product="protein of unknown function Spy-related"
FT                   /note="PFAM: protein of unknown function Spy-related; KEGG:
FT                   she:Shewmr4_0253 protein of unknown function, Spy-related"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44794"
FT                   /db_xref="GOA:B8E453"
FT                   /db_xref="InterPro:IPR012899"
FT                   /db_xref="UniProtKB/TrEMBL:B8E453"
FT                   /inference="protein motif:PFAM:PF07813"
FT                   /protein_id="ACK44794.1"
FT                   FEAQAGKEPRG"
FT   sig_peptide     296192..296275
FT                   /locus_tag="Sbal223_0257"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 28"
FT   gene            296768..297658
FT                   /locus_tag="Sbal223_0258"
FT   CDS_pept        296768..297658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0258"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   shw:Sputw3181_0219 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44795"
FT                   /db_xref="GOA:B8E454"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR027470"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:B8E454"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACK44795.1"
FT                   VIIHQDPVKPEVNET"
FT   gene            297673..298008
FT                   /locus_tag="Sbal223_0259"
FT   CDS_pept        297673..298008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0259"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44796"
FT                   /db_xref="UniProtKB/TrEMBL:B8E455"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44796.1"
FT                   GAPVLFV"
FT   gene            298324..298887
FT                   /locus_tag="Sbal223_0260"
FT   CDS_pept        298324..298887
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0260"
FT                   /product="OmpA domain protein transmembrane
FT                   region-containing protein"
FT                   /note="PFAM: OmpA domain protein transmembrane
FT                   region-containing protein; KEGG: shm:Shewmr7_3765 OmpA
FT                   domain protein transmembrane region-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44797"
FT                   /db_xref="GOA:B8E456"
FT                   /db_xref="InterPro:IPR006315"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B8E456"
FT                   /inference="protein motif:PFAM:PF01389"
FT                   /protein_id="ACK44797.1"
FT   sig_peptide     298324..298392
FT                   /locus_tag="Sbal223_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.804 at
FT                   residue 23"
FT   gene            complement(299031..300443)
FT                   /locus_tag="Sbal223_0261"
FT   CDS_pept        complement(299031..300443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0261"
FT                   /product="nitrogen metabolism transcriptional regulator,
FT                   NtrC, Fis Family"
FT                   /note="KEGG: shw:Sputw3181_0221 nitrogen metabolism
FT                   transcriptional regulator, NtrC, fis family; TIGRFAM:
FT                   nitrogen regulation protein NR(I); PFAM: response regulator
FT                   receiver; sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; ATPase associated with
FT                   various cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44798"
FT                   /db_xref="GOA:B8E457"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010114"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E457"
FT                   /inference="protein motif:TFAM:TIGR01818"
FT                   /protein_id="ACK44798.1"
FT                   TLTRKLKELSMD"
FT   gene            complement(300482..301528)
FT                   /locus_tag="Sbal223_0262"
FT   CDS_pept        complement(300482..301528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0262"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-4 domain
FT                   protein; KEGG: shn:Shewana3_0259 signal transduction
FT                   histidine kinase, nitrogen specific, NtrB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44799"
FT                   /db_xref="GOA:B8E458"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E458"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK44799.1"
FT                   SLPILGAK"
FT   gene            complement(301682..302188)
FT                   /locus_tag="Sbal223_0263"
FT   CDS_pept        complement(301682..302188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0263"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4470 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44800"
FT                   /db_xref="InterPro:IPR025392"
FT                   /db_xref="UniProtKB/TrEMBL:B8E459"
FT                   /inference="similar to AA sequence:KEGG:SO_4470"
FT                   /protein_id="ACK44800.1"
FT                   QAAKR"
FT   sig_peptide     complement(302132..302188)
FT                   /locus_tag="Sbal223_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.993 at
FT                   residue 19"
FT   gene            complement(302243..302359)
FT                   /locus_tag="Sbal223_0264"
FT   CDS_pept        complement(302243..302359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0264"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44801"
FT                   /db_xref="UniProtKB/TrEMBL:B8E460"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44801.1"
FT   gene            complement(302382..303008)
FT                   /locus_tag="Sbal223_0265"
FT   CDS_pept        complement(302382..303008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0265"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   sdn:Sden_1385 glutathione S-transferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44802"
FT                   /db_xref="GOA:B8E461"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B8E461"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACK44802.1"
FT   gene            complement(303144..303836)
FT                   /locus_tag="Sbal223_0266"
FT   CDS_pept        complement(303144..303836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0266"
FT                   /product="ThiJ/PfpI domain protein"
FT                   /note="PFAM: ThiJ/PfpI domain protein; KEGG:
FT                   shw:Sputw3181_0226 ThiJ/PfpI domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44803"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8E462"
FT                   /inference="protein motif:PFAM:PF01965"
FT                   /protein_id="ACK44803.1"
FT                   VAQLNARG"
FT   gene            complement(303896..305053)
FT                   /locus_tag="Sbal223_0267"
FT   CDS_pept        complement(303896..305053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0267"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   shw:Sputw3181_0227 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44804"
FT                   /db_xref="GOA:B8E463"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="UniProtKB/TrEMBL:B8E463"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACK44804.1"
FT   gene            complement(305237..305833)
FT                   /locus_tag="Sbal223_0268"
FT   CDS_pept        complement(305237..305833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0268"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   shw:Sputw3181_0228 transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44805"
FT                   /db_xref="GOA:B8E464"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8E464"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACK44805.1"
FT   gene            complement(306121..306432)
FT                   /locus_tag="Sbal223_0269"
FT   CDS_pept        complement(306121..306432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0269"
FT                   /product="protein of unknown function DUF1255"
FT                   /note="PFAM: protein of unknown function DUF1255; KEGG:
FT                   shw:Sputw3181_0229 protein of unknown function DUF1255"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44806"
FT                   /db_xref="GOA:B8E465"
FT                   /db_xref="InterPro:IPR009664"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E465"
FT                   /inference="protein motif:PFAM:PF06865"
FT                   /protein_id="ACK44806.1"
FT   gene            306791..308746
FT                   /locus_tag="Sbal223_0270"
FT   CDS_pept        306791..308746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0270"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   spc:Sputcn32_0380 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44807"
FT                   /db_xref="GOA:B8E466"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B8E466"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACK44807.1"
FT                   LGLANQLGLTTAQFKV"
FT   sig_peptide     306791..306865
FT                   /locus_tag="Sbal223_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.562 at
FT                   residue 25"
FT   gene            complement(308886..311000)
FT                   /locus_tag="Sbal223_0271"
FT   CDS_pept        complement(308886..311000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0271"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   spc:Sputcn32_0381 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44808"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR027577"
FT                   /db_xref="InterPro:IPR027625"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B8E467"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACK44808.1"
FT                   VSEMTIWRKR"
FT   gene            311379..312362
FT                   /locus_tag="Sbal223_0272"
FT   CDS_pept        311379..312362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0272"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; SMART: Prolyl
FT                   4-hydroxylase alpha subunit; KEGG: shn:Shewana3_0266
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44809"
FT                   /db_xref="GOA:B8E468"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:B8E468"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACK44809.1"
FT   gene            312502..312897
FT                   /locus_tag="Sbal223_0273"
FT   CDS_pept        312502..312897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44810"
FT                   /db_xref="UniProtKB/TrEMBL:B8E469"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0236"
FT                   /protein_id="ACK44810.1"
FT   gene            complement(312938..313120)
FT                   /locus_tag="Sbal223_0274"
FT   CDS_pept        complement(312938..313120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0274"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4461 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44811"
FT                   /db_xref="UniProtKB/TrEMBL:B8E470"
FT                   /inference="similar to AA sequence:KEGG:SO_4461"
FT                   /protein_id="ACK44811.1"
FT                   LAELVKVQSTSDPER"
FT   gene            313481..314332
FT                   /locus_tag="Sbal223_0275"
FT   CDS_pept        313481..314332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0275"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: shw:Sputw3181_0237
FT                   PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44812"
FT                   /db_xref="GOA:B8E471"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8E471"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACK44812.1"
FT                   IA"
FT   gene            314650..316110
FT                   /locus_tag="Sbal223_0276"
FT   CDS_pept        314650..316110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0276"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: shw:Sputw3181_0238 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44813"
FT                   /db_xref="GOA:B8E472"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B8E472"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK44813.1"
FT   sig_peptide     314650..314751
FT                   /locus_tag="Sbal223_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.925) with cleavage site probability 0.440 at
FT                   residue 34"
FT   gene            316228..316941
FT                   /locus_tag="Sbal223_0277"
FT   CDS_pept        316228..316941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0277"
FT                   /product="MOSC domain containing protein"
FT                   /note="PFAM: 3-alpha domain protein; MOSC domain containing
FT                   protein; KEGG: shw:Sputw3181_0239 MOSC domain containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44814"
FT                   /db_xref="GOA:B8E473"
FT                   /db_xref="InterPro:IPR005163"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B8E473"
FT                   /inference="protein motif:PFAM:PF03473"
FT                   /protein_id="ACK44814.1"
FT                   TVEDWQMRLYGPSGK"
FT   gene            316979..317335
FT                   /locus_tag="Sbal223_0278"
FT   CDS_pept        316979..317335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44815"
FT                   /db_xref="GOA:B8E474"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:B8E474"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0240"
FT                   /protein_id="ACK44815.1"
FT                   VYKYPLTIKFIAMD"
FT   gene            complement(317412..319328)
FT                   /locus_tag="Sbal223_0279"
FT   CDS_pept        complement(317412..319328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0279"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: shw:Sputw3181_0241
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44816"
FT                   /db_xref="GOA:B8E475"
FT                   /db_xref="InterPro:IPR000727"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B8E475"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACK44816.1"
FT                   FKV"
FT   sig_peptide     complement(319221..319328)
FT                   /locus_tag="Sbal223_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.563 at
FT                   residue 36"
FT   gene            complement(319678..321327)
FT                   /locus_tag="Sbal223_0280"
FT   CDS_pept        complement(319678..321327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0280"
FT                   /product="Electron-transferring-flavoprotein dehydrogenase"
FT                   /EC_number=""
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; electron transfer flavoprotein-ubiquinone
FT                   oxidoreductase; KEGG: spc:Sputcn32_0388
FT                   electron-transferring-flavoprotein dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44817"
FT                   /db_xref="GOA:B8E476"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR040156"
FT                   /db_xref="UniProtKB/TrEMBL:B8E476"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44817.1"
FT   gene            321663..322676
FT                   /locus_tag="Sbal223_0281"
FT   CDS_pept        321663..322676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0281"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="KEGG: shw:Sputw3181_0243 molybdenum cofactor
FT                   biosynthesis protein A; TIGRFAM: molybdenum cofactor
FT                   biosynthesis protein A; PFAM: Radical SAM domain protein;
FT                   molybdenum cofactor synthesis domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44818"
FT                   /db_xref="GOA:B8E477"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8E477"
FT                   /inference="protein motif:TFAM:TIGR02666"
FT                   /protein_id="ACK44818.1"
FT   gene            322773..323249
FT                   /locus_tag="Sbal223_0282"
FT   CDS_pept        322773..323249
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0282"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="TIGRFAM: molybdenum cofactor biosynthesis protein C;
FT                   PFAM: molybdopterin cofactor biosynthesis MoaC region;
FT                   KEGG: shw:Sputw3181_0244 molybdenum cofactor biosynthesis
FT                   protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44819"
FT                   /db_xref="GOA:B8E478"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E478"
FT                   /inference="protein motif:TFAM:TIGR00581"
FT                   /protein_id="ACK44819.1"
FT   gene            323366..323617
FT                   /locus_tag="Sbal223_0283"
FT   CDS_pept        323366..323617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0283"
FT                   /product="molybdopterin converting factor, subunit 1"
FT                   /note="TIGRFAM: molybdopterin converting factor, subunit 1;
FT                   PFAM: thiamineS protein; KEGG: shw:Sputw3181_0245
FT                   molybdopterin converting factor, subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44820"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B8E479"
FT                   /inference="protein motif:TFAM:TIGR01682"
FT                   /protein_id="ACK44820.1"
FT   gene            323619..324086
FT                   /locus_tag="Sbal223_0284"
FT   CDS_pept        323619..324086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0284"
FT                   /product="molybdopterin biosynthesis MoaE protein"
FT                   /note="PFAM: molybdopterin biosynthesis MoaE protein; KEGG:
FT                   shw:Sputw3181_0246 molybdopterin biosynthesis MoaE"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44821"
FT                   /db_xref="GOA:B8E480"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:B8E480"
FT                   /inference="protein motif:PFAM:PF02391"
FT                   /protein_id="ACK44821.1"
FT   gene            324164..324964
FT                   /locus_tag="Sbal223_0285"
FT   CDS_pept        324164..324964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0285"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: she:Shewmr4_0277
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44822"
FT                   /db_xref="GOA:B8E481"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:B8E481"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ACK44822.1"
FT   sig_peptide     324164..324250
FT                   /locus_tag="Sbal223_0285"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.974 at
FT                   residue 29"
FT   gene            324973..325653
FT                   /locus_tag="Sbal223_0286"
FT   CDS_pept        324973..325653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0286"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: shw:Sputw3181_0248
FT                   molybdate ABC transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44823"
FT                   /db_xref="GOA:B8E482"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8E482"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ACK44823.1"
FT                   ANHR"
FT   sig_peptide     324973..325071
FT                   /locus_tag="Sbal223_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.755 at
FT                   residue 33"
FT   gene            325634..326737
FT                   /locus_tag="Sbal223_0287"
FT   CDS_pept        325634..326737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0287"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: shw:Sputw3181_0249 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44824"
FT                   /db_xref="GOA:B8E483"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E483"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK44824.1"
FT   gene            complement(326747..330172)
FT                   /locus_tag="Sbal223_0288"
FT   CDS_pept        complement(326747..330172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0288"
FT                   /product="Hpt sensor hybrid histidine kinase"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   response regulator receiver; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; Hpt
FT                   domain protein; KEGG: son:SO_4445 response regulator/sensor
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44825"
FT                   /db_xref="GOA:B8E484"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E484"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44825.1"
FT   sig_peptide     complement(330083..330172)
FT                   /locus_tag="Sbal223_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 30"
FT   gene            330267..330905
FT                   /locus_tag="Sbal223_0289"
FT   CDS_pept        330267..330905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0289"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; KEGG: son:SO_4444 capsular synthesis regulator
FT                   component B, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44826"
FT                   /db_xref="GOA:B8E485"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8E485"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44826.1"
FT   gene            complement(330908..332119)
FT                   /locus_tag="Sbal223_0290"
FT   CDS_pept        complement(330908..332119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0290"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO_4443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44827"
FT                   /db_xref="UniProtKB/TrEMBL:B8E486"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44827.1"
FT                   IPPL"
FT   sig_peptide     complement(332051..332119)
FT                   /locus_tag="Sbal223_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.965) with cleavage site probability 0.926 at
FT                   residue 23"
FT   gene            complement(332116..335812)
FT                   /pseudo
FT                   /locus_tag="Sbal223_0291"
FT   mobile_element  complement(334436..335653)
FT                   /mobile_element_type="insertion sequence:ISSba1_1"
FT   gene            complement(334465..335565)
FT                   /locus_tag="Sbal223_0292"
FT   CDS_pept        complement(334465..335565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0292"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   asa:ASA_P4G164 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44828"
FT                   /db_xref="GOA:B8E487"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B8E487"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK44828.1"
FT   gene            complement(335918..336403)
FT                   /locus_tag="Sbal223_0293"
FT   CDS_pept        complement(335918..336403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: asa:ASA_3281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44829"
FT                   /db_xref="GOA:B8E488"
FT                   /db_xref="InterPro:IPR007540"
FT                   /db_xref="UniProtKB/TrEMBL:B8E488"
FT                   /inference="similar to AA sequence:KEGG:ASA_3281"
FT                   /protein_id="ACK44829.1"
FT   sig_peptide     complement(336344..336403)
FT                   /locus_tag="Sbal223_0293"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 20"
FT   gene            complement(336426..337145)
FT                   /locus_tag="Sbal223_0294"
FT   CDS_pept        complement(336426..337145)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0294"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4434 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44830"
FT                   /db_xref="InterPro:IPR008962"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B8E489"
FT                   /inference="similar to AA sequence:KEGG:SO_4434"
FT                   /protein_id="ACK44830.1"
FT                   RFQLIEGDKTQSIVIGN"
FT   sig_peptide     complement(337086..337145)
FT                   /locus_tag="Sbal223_0294"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.952 at
FT                   residue 20"
FT   gene            337354..338112
FT                   /locus_tag="Sbal223_0295"
FT   CDS_pept        337354..338112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0295"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: son:SO_4433
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44831"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B8E490"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACK44831.1"
FT   gene            complement(338159..338335)
FT                   /locus_tag="Sbal223_0296"
FT   CDS_pept        complement(338159..338335)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0296"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4430 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44832"
FT                   /db_xref="GOA:B8E491"
FT                   /db_xref="UniProtKB/TrEMBL:B8E491"
FT                   /inference="similar to AA sequence:KEGG:SO_4430"
FT                   /protein_id="ACK44832.1"
FT                   GLLGKRKPKNISQ"
FT   sig_peptide     complement(338267..338335)
FT                   /locus_tag="Sbal223_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.587 at
FT                   residue 23"
FT   gene            338828..339349
FT                   /locus_tag="Sbal223_0297"
FT   CDS_pept        338828..339349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0281 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44833"
FT                   /db_xref="UniProtKB/TrEMBL:B8E492"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_0281"
FT                   /protein_id="ACK44833.1"
FT                   LRPLPLLKWD"
FT   sig_peptide     338828..338881
FT                   /locus_tag="Sbal223_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.913 at
FT                   residue 18"
FT   gene            339410..340087
FT                   /locus_tag="Sbal223_0298"
FT   CDS_pept        339410..340087
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0298"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: shw:Sputw3181_0251 two
FT                   component transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44834"
FT                   /db_xref="GOA:B8E493"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8E493"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44834.1"
FT                   QRH"
FT   gene            340137..341393
FT                   /locus_tag="Sbal223_0299"
FT   CDS_pept        340137..341393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0299"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: son:SO_4427 sensor histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44835"
FT                   /db_xref="GOA:B8E494"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E494"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK44835.1"
FT   gene            341427..342119
FT                   /locus_tag="Sbal223_0300"
FT   CDS_pept        341427..342119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0300"
FT                   /product="pseudouridine synthase Rlu family protein,
FT                   TIGR01621"
FT                   /note="TIGRFAM: pseudouridine synthase Rlu family protein,
FT                   TIGR01621; PFAM: pseudouridine synthase; KEGG:
FT                   spc:Sputcn32_0399 pseudouridine synthase Rlu family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44836"
FT                   /db_xref="GOA:B8E495"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006508"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B8E495"
FT                   /inference="protein motif:TFAM:TIGR01621"
FT                   /protein_id="ACK44836.1"
FT                   LAWPAKGD"
FT   gene            complement(342168..343337)
FT                   /locus_tag="Sbal223_0301"
FT   CDS_pept        complement(342168..343337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0301"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: son:SO_4425 GGDEF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44837"
FT                   /db_xref="GOA:B8E496"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8E496"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK44837.1"
FT   sig_peptide     complement(343263..343337)
FT                   /locus_tag="Sbal223_0301"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.955) with cleavage site probability 0.775 at
FT                   residue 25"
FT   gene            343601..343768
FT                   /locus_tag="Sbal223_0302"
FT   CDS_pept        343601..343768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0302"
FT                   /product="protein of unknown function UPF0057"
FT                   /note="PFAM: protein of unknown function UPF0057; KEGG:
FT                   shw:Sputw3181_0254 protein of unknown function UPF0057"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44838"
FT                   /db_xref="GOA:B8E497"
FT                   /db_xref="InterPro:IPR000612"
FT                   /db_xref="UniProtKB/TrEMBL:B8E497"
FT                   /inference="protein motif:PFAM:PF01679"
FT                   /protein_id="ACK44838.1"
FT                   LHALWVVTKA"
FT   sig_peptide     343601..343669
FT                   /locus_tag="Sbal223_0302"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.928) with cleavage site probability 0.525 at
FT                   residue 23"
FT   gene            complement(343841..346018)
FT                   /locus_tag="Sbal223_0303"
FT   CDS_pept        complement(343841..346018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0303"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: spc:Sputcn32_0401 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44839"
FT                   /db_xref="GOA:B8E498"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B8E498"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACK44839.1"
FT   sig_peptide     complement(345950..346018)
FT                   /locus_tag="Sbal223_0303"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 23"
FT   gene            346460..346711
FT                   /locus_tag="Sbal223_0304"
FT   CDS_pept        346460..346711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0304"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44840"
FT                   /db_xref="InterPro:IPR021677"
FT                   /db_xref="UniProtKB/TrEMBL:B8E499"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44840.1"
FT   gene            complement(346844..347356)
FT                   /locus_tag="Sbal223_0305"
FT   CDS_pept        complement(346844..347356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0305"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: spc:Sputcn32_0403
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44841"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A0"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACK44841.1"
FT                   ITYLETH"
FT   gene            complement(347396..347998)
FT                   /locus_tag="Sbal223_0306"
FT   CDS_pept        complement(347396..347998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0306"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44842"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A1"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0404"
FT                   /protein_id="ACK44842.1"
FT   gene            complement(348475..349818)
FT                   /locus_tag="Sbal223_0307"
FT   CDS_pept        complement(348475..349818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0307"
FT                   /product="anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family"
FT                   /note="TIGRFAM: anaerobic c4-dicarboxylate antiporter, Dcu
FT                   family; PFAM: anaerobic c4-dicarboxylate membrane
FT                   transporter; KEGG: son:SO_4417 anaerobic C4-dicarboxylate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44843"
FT                   /db_xref="GOA:B8E4A2"
FT                   /db_xref="InterPro:IPR004668"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A2"
FT                   /inference="protein motif:TFAM:TIGR00770"
FT                   /protein_id="ACK44843.1"
FT   gene            350084..351262
FT                   /locus_tag="Sbal223_0308"
FT   CDS_pept        350084..351262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0308"
FT                   /product="Domain of unknown function DUF1864"
FT                   /note="PFAM: Domain of unknown function DUF1864; KEGG:
FT                   son:SO_4414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44844"
FT                   /db_xref="GOA:B8E4A3"
FT                   /db_xref="InterPro:IPR015029"
FT                   /db_xref="InterPro:IPR037217"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A3"
FT                   /inference="protein motif:PFAM:PF08933"
FT                   /protein_id="ACK44844.1"
FT   gene            351267..352388
FT                   /locus_tag="Sbal223_0309"
FT   CDS_pept        351267..352388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0309"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; KEGG:
FT                   shw:Sputw3181_0261 aminotransferase, class V"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44845"
FT                   /db_xref="GOA:B8E4A4"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A4"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACK44845.1"
FT   gene            complement(352451..353647)
FT                   /locus_tag="Sbal223_0310"
FT   CDS_pept        complement(352451..353647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0310"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   shm:Shewmr7_3722 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44846"
FT                   /db_xref="GOA:B8E4A5"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A5"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACK44846.1"
FT   sig_peptide     complement(353570..353647)
FT                   /locus_tag="Sbal223_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.893) with cleavage site probability 0.724 at
FT                   residue 26"
FT   gene            complement(353908..355317)
FT                   /locus_tag="Sbal223_0311"
FT   CDS_pept        complement(353908..355317)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0311"
FT                   /product="glutamine synthetase, type I"
FT                   /note="TIGRFAM: glutamine synthetase, type I; PFAM:
FT                   glutamine synthetase catalytic region; glutamine synthetase
FT                   beta-Grasp; KEGG: shw:Sputw3181_0266 glutamine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44847"
FT                   /db_xref="GOA:B8E4A6"
FT                   /db_xref="InterPro:IPR001637"
FT                   /db_xref="InterPro:IPR004809"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR008147"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR027302"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A6"
FT                   /inference="protein motif:TFAM:TIGR00653"
FT                   /protein_id="ACK44847.1"
FT                   HPLEFEMYYSL"
FT   gene            356341..358152
FT                   /locus_tag="Sbal223_0312"
FT   CDS_pept        356341..358152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0312"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: shw:Sputw3181_0267 GTP-binding
FT                   protein TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44848"
FT                   /db_xref="GOA:B8E4A7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A7"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACK44848.1"
FT   gene            358246..358383
FT                   /locus_tag="Sbal223_0313"
FT   CDS_pept        358246..358383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44849"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44849.1"
FT                   "
FT   gene            complement(358441..359463)
FT                   /locus_tag="Sbal223_0314"
FT   CDS_pept        complement(358441..359463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0314"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: shw:Sputw3181_0268 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44850"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4A9"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK44850.1"
FT                   "
FT   gene            complement(359637..360851)
FT                   /locus_tag="Sbal223_0315"
FT   CDS_pept        complement(359637..360851)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0315"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: shw:Sputw3181_0270 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44851"
FT                   /db_xref="GOA:B8E4B0"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B0"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK44851.1"
FT                   DRVGH"
FT   sig_peptide     complement(360780..360851)
FT                   /locus_tag="Sbal223_0315"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.943) with cleavage site probability 0.727 at
FT                   residue 24"
FT   gene            361219..362223
FT                   /locus_tag="Sbal223_0316"
FT   CDS_pept        361219..362223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0316"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: shw:Sputw3181_3445
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44852"
FT                   /db_xref="GOA:B8E4B1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B1"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACK44852.1"
FT   gene            362242..363402
FT                   /locus_tag="Sbal223_0317"
FT   CDS_pept        362242..363402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0317"
FT                   /product="Methionine gamma-lyase"
FT                   /EC_number=""
FT                   /note="PFAM: Cys/Met metabolism
FT                   pyridoxal-phosphate-dependent protein; KEGG:
FT                   shw:Sputw3181_3444 methionine gamma-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44853"
FT                   /db_xref="GOA:B8E4B2"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B2"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44853.1"
FT   gene            complement(363649..364302)
FT                   /locus_tag="Sbal223_0318"
FT   CDS_pept        complement(363649..364302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0318"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_0309 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44854"
FT                   /db_xref="InterPro:IPR021342"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B3"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_0309"
FT                   /protein_id="ACK44854.1"
FT   sig_peptide     complement(364234..364302)
FT                   /locus_tag="Sbal223_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.526 at
FT                   residue 23"
FT   gene            complement(364332..364553)
FT                   /locus_tag="Sbal223_0319"
FT   CDS_pept        complement(364332..364553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_0315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44855"
FT                   /db_xref="GOA:B8E4B4"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B4"
FT                   /inference="similar to AA sequence:KEGG:Shewmr4_0315"
FT                   /protein_id="ACK44855.1"
FT   gene            364635..365606
FT                   /locus_tag="Sbal223_0320"
FT   CDS_pept        364635..365606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0320"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: shm:Shewmr7_3708
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44856"
FT                   /db_xref="GOA:B8E4B5"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="InterPro:IPR023679"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4B5"
FT                   /inference="protein motif:PFAM:PF03631"
FT                   /protein_id="ACK44856.1"
FT   gene            365643..366608
FT                   /locus_tag="Sbal223_0321"
FT   CDS_pept        365643..366608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0321"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: son:SO_4400
FT                   proline iminopeptidase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44857"
FT                   /db_xref="GOA:B8E4B6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR005944"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B6"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACK44857.1"
FT   gene            366605..367210
FT                   /locus_tag="Sbal223_0322"
FT   CDS_pept        366605..367210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4399 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44858"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B7"
FT                   /inference="similar to AA sequence:KEGG:SO_4399"
FT                   /protein_id="ACK44858.1"
FT   sig_peptide     366605..366685
FT                   /locus_tag="Sbal223_0322"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.587 at
FT                   residue 27"
FT   gene            367228..367665
FT                   /locus_tag="Sbal223_0323"
FT   CDS_pept        367228..367665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0323"
FT                   /product="D-tyrosyl-tRNA(Tyr) deacylase"
FT                   /note="PFAM: D-tyrosyl-tRNA(Tyr) deacylase; KEGG:
FT                   shw:Sputw3181_0273 D-tyrosyl-tRNA deacylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44859"
FT                   /db_xref="GOA:B8E4B8"
FT                   /db_xref="InterPro:IPR003732"
FT                   /db_xref="InterPro:IPR023509"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4B8"
FT                   /inference="protein motif:PFAM:PF02580"
FT                   /protein_id="ACK44859.1"
FT   gene            367825..368277
FT                   /locus_tag="Sbal223_0324"
FT   CDS_pept        367825..368277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0324"
FT                   /product="thioesterase domain protein"
FT                   /note="TIGRFAM: thioesterase domain protein; PFAM:
FT                   Thioesterase putative; KEGG: she:Shewmr4_0320 thioesterase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44860"
FT                   /db_xref="InterPro:IPR012660"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4B9"
FT                   /inference="protein motif:TFAM:TIGR02447"
FT                   /protein_id="ACK44860.1"
FT   gene            368437..369033
FT                   /locus_tag="Sbal223_0325"
FT   CDS_pept        368437..369033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0325"
FT                   /product="NAD(P)H dehydrogenase (quinone)"
FT                   /note="PFAM: NAD(P)H dehydrogenase (quinone);
FT                   NADPH-dependent FMN reductase; KEGG: shw:Sputw3181_0277
FT                   azoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44861"
FT                   /db_xref="GOA:B8E4C0"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR023048"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4C0"
FT                   /inference="protein motif:PFAM:PF02525"
FT                   /protein_id="ACK44861.1"
FT   gene            complement(369186..369371)
FT                   /locus_tag="Sbal223_0326"
FT   CDS_pept        complement(369186..369371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0326"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO_4395 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44862"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44862.1"
FT                   RYVETSALAKGCSLCE"
FT   gene            complement(369438..369761)
FT                   /locus_tag="Sbal223_0327"
FT   CDS_pept        complement(369438..369761)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0327"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   shn:Shewana3_0318 rhodanese domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44863"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C2"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACK44863.1"
FT                   QPS"
FT   gene            complement(369907..370482)
FT                   /locus_tag="Sbal223_0328"
FT   CDS_pept        complement(369907..370482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0328"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: spc:Sputcn32_0424
FT                   XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44864"
FT                   /db_xref="GOA:B8E4C3"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C3"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACK44864.1"
FT   gene            370609..371796
FT                   /locus_tag="Sbal223_0329"
FT   CDS_pept        370609..371796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0329"
FT                   /product="benzoate transporter"
FT                   /note="TIGRFAM: benzoate transporter; PFAM: Benzoate
FT                   membrane transport protein; KEGG: shw:Sputw3181_0279
FT                   benzoate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44865"
FT                   /db_xref="GOA:B8E4C4"
FT                   /db_xref="InterPro:IPR004711"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C4"
FT                   /inference="protein motif:TFAM:TIGR00843"
FT                   /protein_id="ACK44865.1"
FT   gene            complement(371849..372316)
FT                   /locus_tag="Sbal223_0330"
FT   CDS_pept        complement(371849..372316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0330"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   shw:Sputw3181_0280 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44866"
FT                   /db_xref="GOA:B8E4C5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C5"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACK44866.1"
FT   gene            373031..374026
FT                   /locus_tag="Sbal223_0331"
FT   CDS_pept        373031..374026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mbu:Mbur_1752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44867"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C6"
FT                   /inference="similar to AA sequence:KEGG:Mbur_1752"
FT                   /protein_id="ACK44867.1"
FT   gene            374135..374248
FT                   /locus_tag="Sbal223_0332"
FT   CDS_pept        374135..374248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0332"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_0894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44868"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C7"
FT                   /inference="similar to AA sequence:KEGG:SO_0894"
FT                   /protein_id="ACK44868.1"
FT   gene            complement(374381..374578)
FT                   /pseudo
FT                   /locus_tag="Sbal223_0333"
FT   gene            complement(374704..375447)
FT                   /locus_tag="Sbal223_0334"
FT   CDS_pept        complement(374704..375447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0334"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44869"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C8"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0284"
FT                   /protein_id="ACK44869.1"
FT   sig_peptide     complement(375382..375447)
FT                   /locus_tag="Sbal223_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(375476..376735)
FT                   /locus_tag="Sbal223_0335"
FT   CDS_pept        complement(375476..376735)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0335"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG:
FT                   spc:Sputcn32_0431 3-oxoacyl-(acyl carrier protein) synthase
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44870"
FT                   /db_xref="GOA:B8E4C9"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4C9"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACK44870.1"
FT   gene            complement(376736..377461)
FT                   /locus_tag="Sbal223_0336"
FT   CDS_pept        complement(376736..377461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0336"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) reductase"
FT                   /note="TIGRFAM: 3-oxoacyl-(acyl-carrier-protein) reductase;
FT                   PFAM: short-chain dehydrogenase/reductase SDR; KR domain
FT                   protein; KEGG: shw:Sputw3181_0286
FT                   3-ketoacyl-(acyl-carrier-protein) reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44871"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011285"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D0"
FT                   /inference="protein motif:TFAM:TIGR01831"
FT                   /protein_id="ACK44871.1"
FT   gene            complement(377627..378163)
FT                   /locus_tag="Sbal223_0337"
FT   CDS_pept        complement(377627..378163)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0337"
FT                   /product="Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ"
FT                   /note="PFAM: Beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA/FabZ; KEGG: spc:Sputcn32_0433 thioester
FT                   dehydrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44872"
FT                   /db_xref="InterPro:IPR016776"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D1"
FT                   /inference="protein motif:PFAM:PF07977"
FT                   /protein_id="ACK44872.1"
FT                   YLDGNQDAGNRSLGH"
FT   gene            complement(378165..379364)
FT                   /locus_tag="Sbal223_0338"
FT   CDS_pept        complement(378165..379364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0338"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG:
FT                   spc:Sputcn32_0434 3-oxoacyl-(acyl carrier protein) synthase
FT                   I"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44873"
FT                   /db_xref="GOA:B8E4D2"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D2"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACK44873.1"
FT                   "
FT   gene            complement(379414..380178)
FT                   /locus_tag="Sbal223_0339"
FT   CDS_pept        complement(379414..380178)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0289 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44874"
FT                   /db_xref="InterPro:IPR021675"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D3"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0289"
FT                   /protein_id="ACK44874.1"
FT   sig_peptide     complement(380104..380178)
FT                   /locus_tag="Sbal223_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.649 at
FT                   residue 25"
FT   gene            complement(380183..381472)
FT                   /locus_tag="Sbal223_0340"
FT   CDS_pept        complement(380183..381472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0340"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; tryptophan halogenase; KEGG:
FT                   shw:Sputw3181_0290 monooxygenase, FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44875"
FT                   /db_xref="GOA:B8E4D4"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D4"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACK44875.1"
FT   gene            complement(381496..384039)
FT                   /locus_tag="Sbal223_0341"
FT   CDS_pept        complement(381496..384039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44876"
FT                   /db_xref="GOA:B8E4D5"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D5"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0291"
FT                   /protein_id="ACK44876.1"
FT   sig_peptide     complement(383929..384039)
FT                   /locus_tag="Sbal223_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.647) with cleavage site probability 0.468 at
FT                   residue 37"
FT   gene            complement(384042..384857)
FT                   /locus_tag="Sbal223_0342"
FT   CDS_pept        complement(384042..384857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0292 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44877"
FT                   /db_xref="GOA:B8E4D6"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D6"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0292"
FT                   /protein_id="ACK44877.1"
FT   sig_peptide     complement(384744..384857)
FT                   /locus_tag="Sbal223_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 38"
FT   gene            complement(384857..385288)
FT                   /locus_tag="Sbal223_0343"
FT   CDS_pept        complement(384857..385288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0343"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   spc:Sputcn32_0439 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44878"
FT                   /db_xref="GOA:B8E4D7"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D7"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACK44878.1"
FT   gene            complement(385285..386859)
FT                   /locus_tag="Sbal223_0344"
FT   CDS_pept        complement(385285..386859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0344"
FT                   /product="Histidine ammonia-lyase"
FT                   /EC_number=""
FT                   /note="PFAM: phenylalanine/histidine ammonia-lyase; KEGG:
FT                   spc:Sputcn32_0440 histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44879"
FT                   /db_xref="GOA:B8E4D8"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D8"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44879.1"
FT                   GEWEVCR"
FT   gene            complement(386856..388727)
FT                   /locus_tag="Sbal223_0345"
FT   CDS_pept        complement(386856..388727)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0345"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; lipid A
FT                   biosynthesis acyltransferase; KEGG: spc:Sputcn32_0441
FT                   glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44880"
FT                   /db_xref="GOA:B8E4D9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4D9"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACK44880.1"
FT   gene            complement(388721..389125)
FT                   /locus_tag="Sbal223_0346"
FT   CDS_pept        complement(388721..389125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0346"
FT                   /product="thioester dehydrase family protein"
FT                   /note="KEGG: shw:Sputw3181_0296 thioester dehydrase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44881"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR016962"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E0"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0296"
FT                   /protein_id="ACK44881.1"
FT   gene            complement(389118..390482)
FT                   /locus_tag="Sbal223_0347"
FT   CDS_pept        complement(389118..390482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0347"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44882"
FT                   /db_xref="GOA:B8E4E1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E1"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0443"
FT                   /protein_id="ACK44882.1"
FT   gene            complement(390479..391027)
FT                   /locus_tag="Sbal223_0348"
FT   CDS_pept        complement(390479..391027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44883"
FT                   /db_xref="GOA:B8E4E2"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E2"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0298"
FT                   /protein_id="ACK44883.1"
FT   gene            complement(391027..391275)
FT                   /locus_tag="Sbal223_0349"
FT   CDS_pept        complement(391027..391275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0349"
FT                   /product="phosphopantetheine-binding protein"
FT                   /note="PFAM: phosphopantetheine-binding; KEGG:
FT                   shm:Shewmr7_3677 acyl carrier protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44884"
FT                   /db_xref="GOA:B8E4E3"
FT                   /db_xref="InterPro:IPR003231"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E3"
FT                   /inference="protein motif:PFAM:PF00550"
FT                   /protein_id="ACK44884.1"
FT   gene            complement(391285..391539)
FT                   /locus_tag="Sbal223_0350"
FT   CDS_pept        complement(391285..391539)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0350"
FT                   /product="acyl carrier protein, putative"
FT                   /note="KEGG: shw:Sputw3181_0300 acyl carrier protein,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44885"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E4"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0300"
FT                   /protein_id="ACK44885.1"
FT   gene            complement(391523..392398)
FT                   /locus_tag="Sbal223_0351"
FT   CDS_pept        complement(391523..392398)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0351"
FT                   /product="phospholipid/glycerol acyltransferase"
FT                   /note="PFAM: phospholipid/glycerol acyltransferase; KEGG:
FT                   spc:Sputcn32_0447 phospholipid/glycerol acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44886"
FT                   /db_xref="GOA:B8E4E5"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E5"
FT                   /inference="protein motif:PFAM:PF01553"
FT                   /protein_id="ACK44886.1"
FT                   QLENNYELKQ"
FT   gene            complement(392391..393125)
FT                   /locus_tag="Sbal223_0352"
FT   CDS_pept        complement(392391..393125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0352"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44887"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E6"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0302"
FT                   /protein_id="ACK44887.1"
FT   gene            complement(393481..394377)
FT                   /locus_tag="Sbal223_0353"
FT   CDS_pept        complement(393481..394377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44888"
FT                   /db_xref="GOA:B8E4E7"
FT                   /db_xref="InterPro:IPR021382"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E7"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0303"
FT                   /protein_id="ACK44888.1"
FT                   TRKLKVALRKLENQLAQ"
FT   gene            complement(394576..396651)
FT                   /locus_tag="Sbal223_0354"
FT   CDS_pept        complement(394576..396651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0354"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /note="KEGG: shw:Sputw3181_0304 ATP-dependent DNA helicase
FT                   RecG; TIGRFAM: ATP-dependent DNA helicase RecG; PFAM:
FT                   helicase domain protein; nucleic acid binding OB-fold
FT                   tRNA/helicase-type; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44889"
FT                   /db_xref="GOA:B8E4E8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E8"
FT                   /inference="protein motif:TFAM:TIGR00643"
FT                   /protein_id="ACK44889.1"
FT   gene            complement(396837..397433)
FT                   /locus_tag="Sbal223_0355"
FT   CDS_pept        complement(396837..397433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0355"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Bacterio-opsin activator HTH domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: son:SO_0351 LuxR family
FT                   DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44890"
FT                   /db_xref="GOA:B8E4E9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4E9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44890.1"
FT   sig_peptide     complement(397338..397433)
FT                   /locus_tag="Sbal223_0355"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.823) with cleavage site probability 0.802 at
FT                   residue 32"
FT   gene            complement(397433..398512)
FT                   /locus_tag="Sbal223_0356"
FT   CDS_pept        complement(397433..398512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0356"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   KEGG: shn:Shewana3_3817 putative signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44891"
FT                   /db_xref="GOA:B8E4F0"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F0"
FT                   /inference="protein motif:PFAM:PF07730"
FT                   /protein_id="ACK44891.1"
FT   gene            complement(398645..399349)
FT                   /locus_tag="Sbal223_0357"
FT   CDS_pept        complement(398645..399349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0357"
FT                   /product="TPR domain-containing protein"
FT                   /note="KEGG: son:SO_0353 TPR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44892"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F1"
FT                   /inference="similar to AA sequence:KEGG:SO_0353"
FT                   /protein_id="ACK44892.1"
FT                   FLLQQNQQLSAN"
FT   sig_peptide     complement(399290..399349)
FT                   /locus_tag="Sbal223_0357"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.931 at
FT                   residue 20"
FT   gene            complement(399564..400508)
FT                   /locus_tag="Sbal223_0358"
FT   CDS_pept        complement(399564..400508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0358"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   shw:Sputw3181_3775 Na+/Ca+ antiporter, CaCA family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44893"
FT                   /db_xref="GOA:B8E4F2"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F2"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ACK44893.1"
FT   gene            complement(400688..402352)
FT                   /locus_tag="Sbal223_0359"
FT   CDS_pept        complement(400688..402352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0359"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   son:SO_0355 AMP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44894"
FT                   /db_xref="GOA:B8E4F3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F3"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACK44894.1"
FT   gene            complement(402580..402963)
FT                   /locus_tag="Sbal223_0360"
FT   CDS_pept        complement(402580..402963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0360"
FT                   /product="endoribonuclease L-PSP"
FT                   /note="TIGRFAM: endoribonuclease L-PSP; PFAM:
FT                   Endoribonuclease L-PSP; KEGG: shn:Shewana3_3813 putative
FT                   endoribonuclease L-PSP"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44895"
FT                   /db_xref="InterPro:IPR006056"
FT                   /db_xref="InterPro:IPR006175"
FT                   /db_xref="InterPro:IPR019897"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F4"
FT                   /inference="protein motif:TFAM:TIGR00004"
FT                   /protein_id="ACK44895.1"
FT   gene            complement(402989..405094)
FT                   /locus_tag="Sbal223_0361"
FT   CDS_pept        complement(402989..405094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0361"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3772 bifunctional (p)ppGpp
FT                   synthetase II/guanosine-3',5'-bis pyrophosphate
FT                   3'-pyrophosphohydrolase; TIGRFAM: RelA/SpoT family protein;
FT                   PFAM: amino acid-binding ACT domain protein; TGS domain
FT                   protein; metal-dependent phosphohydrolase HD sub domain;
FT                   RelA/SpoT domain protein; SMART: metal-dependent
FT                   phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44896"
FT                   /db_xref="GOA:B8E4F5"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F5"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ACK44896.1"
FT                   LRTSRNR"
FT   gene            complement(405140..405418)
FT                   /locus_tag="Sbal223_0362"
FT   CDS_pept        complement(405140..405418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0362"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: shw:Sputw3181_3771
FT                   DNA-directed RNA polymerase subunit omega"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44897"
FT                   /db_xref="GOA:B8E4F6"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4F6"
FT                   /inference="protein motif:TFAM:TIGR00690"
FT                   /protein_id="ACK44897.1"
FT   gene            complement(405468..406100)
FT                   /locus_tag="Sbal223_0363"
FT   CDS_pept        complement(405468..406100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0363"
FT                   /product="Guanylate kinase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3770 guanylate kinase; PFAM:
FT                   guanylate kinase; SMART: guanylate kinase/L-type calcium
FT                   channel region"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44898"
FT                   /db_xref="GOA:B8E4F7"
FT                   /db_xref="InterPro:IPR008144"
FT                   /db_xref="InterPro:IPR008145"
FT                   /db_xref="InterPro:IPR017665"
FT                   /db_xref="InterPro:IPR020590"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44898.1"
FT   gene            406353..407999
FT                   /locus_tag="Sbal223_0364"
FT   CDS_pept        406353..407999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0364"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3809 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44899"
FT                   /db_xref="GOA:B8E4F8"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F8"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_3809"
FT                   /protein_id="ACK44899.1"
FT   sig_peptide     406353..406466
FT                   /locus_tag="Sbal223_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.939) with cleavage site probability 0.780 at
FT                   residue 38"
FT   gene            408204..409076
FT                   /locus_tag="Sbal223_0365"
FT   CDS_pept        408204..409076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44900"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4F9"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_3628"
FT                   /protein_id="ACK44900.1"
FT                   QKLTELLSD"
FT   sig_peptide     408204..408263
FT                   /locus_tag="Sbal223_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.603) with cleavage site probability 0.600 at
FT                   residue 20"
FT   gene            409069..410133
FT                   /locus_tag="Sbal223_0366"
FT   CDS_pept        409069..410133
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0366"
FT                   /product="aminoglycoside phosphotransferase"
FT                   /note="PFAM: aminoglycoside phosphotransferase; KEGG:
FT                   shw:Sputw3181_3767 aminoglycoside phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44901"
FT                   /db_xref="GOA:B8E4G0"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G0"
FT                   /inference="protein motif:PFAM:PF01636"
FT                   /protein_id="ACK44901.1"
FT                   QSLLDQETVLKAHF"
FT   gene            410316..411734
FT                   /locus_tag="Sbal223_0367"
FT   CDS_pept        410316..411734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0367"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   she:Shewmr4_3609 twin-arginine translocation pathway
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44902"
FT                   /db_xref="GOA:B8E4G1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACK44902.1"
FT                   VSLDWLTVVKRRKQ"
FT   gene            complement(411745..412716)
FT                   /locus_tag="Sbal223_0368"
FT   CDS_pept        complement(411745..412716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3844 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44903"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040632"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G2"
FT                   /inference="similar to AA sequence:KEGG:Sfri_3844"
FT                   /protein_id="ACK44903.1"
FT   repeat_region   complement(412842..413120)
FT                   /note="MITE"
FT   gene            413377..414492
FT                   /locus_tag="Sbal223_0369"
FT   CDS_pept        413377..414492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0369"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: spc:Sputcn32_3625 filamentation induced by cAMP
FT                   protein Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44904"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR025230"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G3"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ACK44904.1"
FT   gene            414717..417884
FT                   /locus_tag="Sbal223_0370"
FT   CDS_pept        414717..417884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0370"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; SMART: DEAD-like helicases; KEGG:
FT                   son:SO_0368 helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44905"
FT                   /db_xref="GOA:B8E4G4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021835"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G4"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACK44905.1"
FT                   AAKLAVG"
FT   gene            complement(417888..418784)
FT                   /locus_tag="Sbal223_0371"
FT   CDS_pept        complement(417888..418784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0371"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number=""
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: shn:Shewana3_3800 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44906"
FT                   /db_xref="GOA:B8E4G5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G5"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44906.1"
FT                   SVLIEFLMEKLAERLGK"
FT   gene            419079..419759
FT                   /locus_tag="Sbal223_0372"
FT   CDS_pept        419079..419759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0372"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; PFAM: Haloacid dehalogenase domain protein hydrolase;
FT                   KEGG: spc:Sputcn32_3620 nucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44907"
FT                   /db_xref="GOA:B8E4G6"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011951"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G6"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACK44907.1"
FT                   ILLP"
FT   gene            complement(420094..420354)
FT                   /pseudo
FT                   /locus_tag="Sbal223_0373"
FT   gene            complement(420499..421113)
FT                   /locus_tag="Sbal223_0374"
FT   CDS_pept        complement(420499..421113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0374"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: slo:Shew_1250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44908"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G7"
FT                   /inference="similar to AA sequence:KEGG:Shew_1250"
FT                   /protein_id="ACK44908.1"
FT   gene            421242..422588
FT                   /locus_tag="Sbal223_0375"
FT   CDS_pept        421242..422588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0375"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3512 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44909"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44909.1"
FT   gene            422841..423449
FT                   /locus_tag="Sbal223_0376"
FT   CDS_pept        422841..423449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0376"
FT                   /product="transposase"
FT                   /note="KEGG: spl:Spea_1254 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44910"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4G9"
FT                   /inference="similar to AA sequence:KEGG:Spea_1254"
FT                   /protein_id="ACK44910.1"
FT   gene            complement(423511..424071)
FT                   /locus_tag="Sbal223_0377"
FT   CDS_pept        complement(423511..424071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0377"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   spc:Sputcn32_3517 phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44911"
FT                   /db_xref="GOA:B8E4H0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H0"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACK44911.1"
FT   gene            complement(424192..424605)
FT                   /locus_tag="Sbal223_0378"
FT   CDS_pept        complement(424192..424605)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_3518 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44912"
FT                   /db_xref="InterPro:IPR021248"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H1"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_3518"
FT                   /protein_id="ACK44912.1"
FT   gene            complement(424849..425211)
FT                   /locus_tag="Sbal223_0379"
FT   CDS_pept        complement(424849..425211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0379"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_1698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44913"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H2"
FT                   /inference="similar to AA sequence:KEGG:Shewmr4_1698"
FT                   /protein_id="ACK44913.1"
FT                   YLNHGNNEQPNWSVHT"
FT   gene            complement(425258..425749)
FT                   /locus_tag="Sbal223_0380"
FT   CDS_pept        complement(425258..425749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0380"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG:
FT                   shm:Shewmr7_1776 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44914"
FT                   /db_xref="GOA:B8E4H3"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H3"
FT                   /inference="protein motif:PFAM:PF04002"
FT                   /protein_id="ACK44914.1"
FT                   "
FT   gene            425948..426148
FT                   /locus_tag="Sbal223_0381"
FT   CDS_pept        425948..426148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0381"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   spl:Spea_1260 phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44915"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H4"
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /protein_id="ACK44915.1"
FT   gene            complement(426200..426298)
FT                   /locus_tag="Sbal223_0382"
FT   CDS_pept        complement(426200..426298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0382"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44916"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44916.1"
FT                   /translation="MFNFVMHKPIAELFLLGVIAGYKWAVENDSKS"
FT   gene            complement(426378..426521)
FT                   /locus_tag="Sbal223_0383"
FT   CDS_pept        complement(426378..426521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0383"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44917"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK44917.1"
FT                   FN"
FT   gene            426561..426758
FT                   /locus_tag="Sbal223_0384"
FT   CDS_pept        426561..426758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0384"
FT                   /product="phage transcriptional regulator, AlpA"
FT                   /note="PFAM: Prophage CP4-57 regulatory; KEGG:
FT                   spc:Sputcn32_3522 phage transcriptional regulator, AlpA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44918"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010260"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H7"
FT                   /inference="protein motif:PFAM:PF05930"
FT                   /protein_id="ACK44918.1"
FT   gene            complement(426860..427327)
FT                   /locus_tag="Sbal223_0385"
FT   CDS_pept        complement(426860..427327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0385"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shl:Shal_4050 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44919"
FT                   /db_xref="InterPro:IPR007053"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H8"
FT                   /inference="similar to AA sequence:KEGG:Shal_4050"
FT                   /protein_id="ACK44919.1"
FT   gene            427459..427848
FT                   /locus_tag="Sbal223_0386"
FT   CDS_pept        427459..427848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0386"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   slo:Shew_1266 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44920"
FT                   /db_xref="GOA:B8E4H9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4H9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACK44920.1"
FT   gene            428012..428233
FT                   /locus_tag="Sbal223_0387"
FT   CDS_pept        428012..428233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0387"
FT                   /product="XRE family transcriptional regulator"
FT                   /note="KEGG: dde:Dde_2500 XRE family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44921"
FT                   /db_xref="GOA:B8E4I0"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I0"
FT                   /inference="similar to AA sequence:KEGG:Dde_2500"
FT                   /protein_id="ACK44921.1"
FT   gene            428220..430943
FT                   /locus_tag="Sbal223_0388"
FT   CDS_pept        428220..430943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0388"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; protein of unknown function DUF450;
FT                   SMART: DEAD-like helicases; KEGG: neu:NE2499 DEAD/DEAH box
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44922"
FT                   /db_xref="GOA:B8E4I1"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR013670"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I1"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACK44922.1"
FT   gene            430962..433418
FT                   /locus_tag="Sbal223_0389"
FT   CDS_pept        430962..433418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0389"
FT                   /product="N-6 DNA methylase"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: mma:MM_3147 type I
FT                   restriction-modification system specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44923"
FT                   /db_xref="GOA:B8E4I2"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I2"
FT                   /inference="protein motif:PFAM:PF02384"
FT                   /protein_id="ACK44923.1"
FT                   IVEGRE"
FT   gene            433415..435343
FT                   /locus_tag="Sbal223_0390"
FT   CDS_pept        433415..435343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0390"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: nth:Nther_1991 restriction
FT                   modification system DNA specificity domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44924"
FT                   /db_xref="GOA:B8E4I3"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I3"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ACK44924.1"
FT                   QIELETD"
FT   gene            435348..437063
FT                   /locus_tag="Sbal223_0391"
FT   CDS_pept        435348..437063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44925"
FT                   /db_xref="GOA:B8E4I4"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038734"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I4"
FT                   /inference="similar to AA sequence:KEGG:PFL_2963"
FT                   /protein_id="ACK44925.1"
FT   gene            437047..438156
FT                   /locus_tag="Sbal223_0392"
FT   CDS_pept        437047..438156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0392"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pfl:PFL_2962 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44926"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I5"
FT                   /inference="similar to AA sequence:KEGG:PFL_2962"
FT                   /protein_id="ACK44926.1"
FT   gene            complement(438476..439687)
FT                   /locus_tag="Sbal223_0393"
FT   CDS_pept        complement(438476..439687)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0393"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: sdn:Sden_0317
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44927"
FT                   /db_xref="GOA:B8E4I6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I6"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACK44927.1"
FT                   SIIN"
FT   gene            complement(439887..440750)
FT                   /locus_tag="Sbal223_0394"
FT   CDS_pept        complement(439887..440750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0394"
FT                   /product="YicC domain protein"
FT                   /note="PFAM: YicC domain protein; domain of unknown
FT                   function DUF1732; KEGG: shw:Sputw3181_0331 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44928"
FT                   /db_xref="InterPro:IPR005229"
FT                   /db_xref="InterPro:IPR013527"
FT                   /db_xref="InterPro:IPR013551"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I7"
FT                   /inference="protein motif:PFAM:PF03755"
FT                   /protein_id="ACK44928.1"
FT                   QIQNVE"
FT   repeat_region   440831..441158
FT                   /note="MITE"
FT   gene            441288..442001
FT                   /locus_tag="Sbal223_0395"
FT   CDS_pept        441288..442001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0395"
FT                   /product="ribonuclease PH"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0332 ribonuclease PH; TIGRFAM:
FT                   ribonuclease PH; PFAM: 3' exoribonuclease; Exoribonuclease,
FT                   phosphorolytic domain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44929"
FT                   /db_xref="GOA:B8E4I8"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4I8"
FT                   /inference="protein motif:TFAM:TIGR01966"
FT                   /protein_id="ACK44929.1"
FT                   NSIREIVDVQKAALN"
FT   gene            442178..442819
FT                   /locus_tag="Sbal223_0396"
FT   CDS_pept        442178..442819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0396"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0333 orotate
FT                   phosphoribosyltransferase; TIGRFAM: orotate
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44930"
FT                   /db_xref="GOA:B8E4I9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR004467"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4I9"
FT                   /inference="protein motif:TFAM:TIGR00336"
FT                   /protein_id="ACK44930.1"
FT   gene            complement(443046..443696)
FT                   /locus_tag="Sbal223_0397"
FT   CDS_pept        complement(443046..443696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0397"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number=""
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: shw:Sputw3181_0334
FT                   GTP cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44931"
FT                   /db_xref="GOA:B8E4J0"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4J0"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44931.1"
FT   gene            complement(443967..445955)
FT                   /locus_tag="Sbal223_0398"
FT   CDS_pept        complement(443967..445955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0398"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; dienelactone hydrolase; KEGG: son:SO_4252
FT                   prolyl oligopeptidase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44932"
FT                   /db_xref="GOA:B8E4J1"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4J1"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACK44932.1"
FT   sig_peptide     complement(445884..445955)
FT                   /locus_tag="Sbal223_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(446091..446684)
FT                   /locus_tag="Sbal223_0399"
FT   CDS_pept        complement(446091..446684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0399"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG:
FT                   shw:Sputw3181_0335 nucleoid occlusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44933"
FT                   /db_xref="GOA:B8E4J2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023769"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4J2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACK44933.1"
FT   gene            complement(446719..447177)
FT                   /locus_tag="Sbal223_0400"
FT   CDS_pept        complement(446719..447177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0400"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /EC_number=""
FT                   /note="KEGG: shn:Shewana3_3772 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase; TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44934"
FT                   /db_xref="GOA:B8E4J3"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4J3"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ACK44934.1"
FT   gene            complement(447174..448388)
FT                   /locus_tag="Sbal223_0401"
FT   CDS_pept        complement(447174..448388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0401"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="KEGG: spc:Sputcn32_0461 phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase;
FT                   TIGRFAM: phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate/cysteine ligase; PFAM:
FT                   flavoprotein; DNA/pantothenate metabolism flavoprotein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44935"
FT                   /db_xref="GOA:B8E4J4"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4J4"
FT                   /inference="protein motif:TFAM:TIGR00521"
FT                   /protein_id="ACK44935.1"
FT                   EKTNT"
FT   gene            448520..449197
FT                   /locus_tag="Sbal223_0402"
FT   CDS_pept        448520..449197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0402"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG:
FT                   shw:Sputw3181_0338 DNA repair protein RadC"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44936"
FT                   /db_xref="GOA:B8E4J5"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4J5"
FT                   /inference="protein motif:PFAM:PF04002"
FT                   /protein_id="ACK44936.1"
FT                   WIN"
FT   gene            449319..449555
FT                   /locus_tag="Sbal223_0403"
FT   CDS_pept        449319..449555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0403"
FT                   /product="ribosomal protein L28"
FT                   /note="PFAM: ribosomal protein L28; KEGG:
FT                   shw:Sputw3181_0339 ribosomal protein L28"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44937"
FT                   /db_xref="GOA:B8E4J6"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4J6"
FT                   /inference="protein motif:PFAM:PF00830"
FT                   /protein_id="ACK44937.1"
FT   gene            449562..449735
FT                   /locus_tag="Sbal223_0404"
FT   CDS_pept        449562..449735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0404"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: shn:Shewana3_3768
FT                   50S ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44938"
FT                   /db_xref="GOA:B8E4J7"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR018264"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4J7"
FT                   /inference="protein motif:PFAM:PF00471"
FT                   /protein_id="ACK44938.1"
FT                   RQHVIYKEAKIK"
FT   gene            450059..451378
FT                   /locus_tag="Sbal223_0405"
FT   CDS_pept        450059..451378
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0405"
FT                   /product="amino-acid N-acetyltransferase"
FT                   /note="TIGRFAM: amino-acid N-acetyltransferase; PFAM:
FT                   GCN5-related N-acetyltransferase;
FT                   aspartate/glutamate/uridylate kinase; KEGG:
FT                   shw:Sputw3181_0368 N-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44939"
FT                   /db_xref="GOA:B8E4J8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR033719"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4J8"
FT                   /inference="protein motif:TFAM:TIGR01890"
FT                   /protein_id="ACK44939.1"
FT   gene            451498..452016
FT                   /locus_tag="Sbal223_0406"
FT   CDS_pept        451498..452016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0369 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44940"
FT                   /db_xref="GOA:B8E4J9"
FT                   /db_xref="InterPro:IPR027783"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4J9"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0369"
FT                   /protein_id="ACK44940.1"
FT                   SEFLAQLQK"
FT   gene            complement(452064..452948)
FT                   /locus_tag="Sbal223_0407"
FT   CDS_pept        complement(452064..452948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0407"
FT                   /product="RarD protein, DMT superfamily transporter"
FT                   /note="TIGRFAM: RarD protein, DMT superfamily transporter;
FT                   PFAM: protein of unknown function DUF6 transmembrane; KEGG:
FT                   shw:Sputw3181_0370 RarD protein, DMT superfamily
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44941"
FT                   /db_xref="GOA:B8E4K0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4K0"
FT                   /inference="protein motif:TFAM:TIGR00688"
FT                   /protein_id="ACK44941.1"
FT                   VFTLDMAYKRKTA"
FT   gene            complement(453150..453614)
FT                   /locus_tag="Sbal223_0408"
FT   CDS_pept        complement(453150..453614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0408"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   shw:Sputw3181_0371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44942"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4K1"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACK44942.1"
FT   gene            454055..455878
FT                   /locus_tag="Sbal223_0409"
FT   CDS_pept        454055..455878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0409"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: shw:Sputw3181_0372 ATP-dependent DNA helicase
FT                   RecQ; TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44943"
FT                   /db_xref="GOA:B8E4K2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4K2"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACK44943.1"
FT   gene            complement(455860..457641)
FT                   /locus_tag="Sbal223_0410"
FT   CDS_pept        complement(455860..457641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0410"
FT                   /product="Tetratricopeptide domain protein"
FT                   /note="SMART: Tetratricopeptide domain protein; KEGG:
FT                   shw:Sputw3181_0373 tetratricopeptide domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44944"
FT                   /db_xref="GOA:B8E4K3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4K3"
FT                   /inference="protein motif:SMART:SM00028"
FT                   /protein_id="ACK44944.1"
FT                   GKVKISENNPNHYSPAK"
FT   sig_peptide     complement(457576..457641)
FT                   /locus_tag="Sbal223_0410"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.799 at
FT                   residue 22"
FT   gene            457959..458027
FT                   /locus_tag="Sbal223_4533"
FT   CDS_pept        457959..458027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_4533"
FT                   /product="leuABCD operon attenuation leader peptide, LeuL"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_4533"
FT                   /db_xref="EnsemblGenomes-Tr:ACN66792"
FT                   /db_xref="UniProtKB/TrEMBL:C0QV01"
FT                   /protein_id="ACN66792.1"
FT                   /translation="MNRISSKLDLLLSLLAVYTRRS"
FT   gene            458149..459717
FT                   /locus_tag="Sbal223_0411"
FT   CDS_pept        458149..459717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0411"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: shw:Sputw3181_0374 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44945"
FT                   /db_xref="GOA:B8E4K4"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005671"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4K4"
FT                   /inference="protein motif:TFAM:TIGR00973"
FT                   /protein_id="ACK44945.1"
FT                   ELGGV"
FT   gene            459788..460882
FT                   /locus_tag="Sbal223_0412"
FT   CDS_pept        459788..460882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0412"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0375 3-isopropylmalate
FT                   dehydrogenase; TIGRFAM: 3-isopropylmalate dehydrogenase;
FT                   PFAM: isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44946"
FT                   /db_xref="GOA:B8E4K5"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4K5"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ACK44946.1"
FT   gene            460882..462288
FT                   /locus_tag="Sbal223_0413"
FT   CDS_pept        460882..462288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0413"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0376 isopropylmalate isomerase
FT                   large subunit; TIGRFAM: 3-isopropylmalate dehydratase,
FT                   large subunit; PFAM: aconitate hydratase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44947"
FT                   /db_xref="GOA:B8E4K6"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4K6"
FT                   /inference="protein motif:TFAM:TIGR00170"
FT                   /protein_id="ACK44947.1"
FT                   GHFVDIRKPY"
FT   gene            462316..462921
FT                   /locus_tag="Sbal223_0414"
FT   CDS_pept        462316..462921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0414"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   shw:Sputw3181_0377 3-isopropylmalate dehydratase, small
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44948"
FT                   /db_xref="GOA:B8E4K7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4K7"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ACK44948.1"
FT   gene            463448..464797
FT                   /locus_tag="Sbal223_0415"
FT   CDS_pept        463448..464797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0415"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: shw:Sputw3181_0378 membrane
FT                   protein involved in aromatic hydrocarbon degradation"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44949"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="InterPro:IPR042117"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4K8"
FT                   /inference="protein motif:PFAM:PF03349"
FT                   /protein_id="ACK44949.1"
FT   sig_peptide     463448..463519
FT                   /locus_tag="Sbal223_0415"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            464990..466474
FT                   /locus_tag="Sbal223_0416"
FT   CDS_pept        464990..466474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0416"
FT                   /product="glycerol kinase"
FT                   /note="TIGRFAM: glycerol kinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: shw:Sputw3181_0379 glycerol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44950"
FT                   /db_xref="GOA:B8E4K9"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4K9"
FT                   /inference="protein motif:TFAM:TIGR01311"
FT                   /protein_id="ACK44950.1"
FT   gene            complement(466641..466970)
FT                   /locus_tag="Sbal223_0417"
FT   CDS_pept        complement(466641..466970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_0380 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44951"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4L0"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_0380"
FT                   /protein_id="ACK44951.1"
FT                   IDVEV"
FT   gene            467707..468165
FT                   /locus_tag="Sbal223_0418"
FT   CDS_pept        467707..468165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0418"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: shw:Sputw3181_0381 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44952"
FT                   /db_xref="GOA:B8E4L1"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4L1"
FT                   /inference="protein motif:TFAM:TIGR00242"
FT                   /protein_id="ACK44952.1"
FT   gene            468197..469138
FT                   /locus_tag="Sbal223_0419"
FT   CDS_pept        468197..469138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0419"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: she:Shewmr4_3578
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44953"
FT                   /db_xref="GOA:B8E4L2"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E4L2"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ACK44953.1"
FT   gene            469149..469463
FT                   /locus_tag="Sbal223_0420"
FT   CDS_pept        469149..469463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0420"
FT                   /product="cell division protein FtsL"
FT                   /note="PFAM: cell division protein FtsL; KEGG:
FT                   she:Shewmr4_3577 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44954"
FT                   /db_xref="GOA:B8E4L3"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B8E4L3"
FT                   /inference="protein motif:PFAM:PF04999"
FT                   /protein_id="ACK44954.1"
FT                   "
FT   sig_peptide     469149..469256
FT                   /locus_tag="Sbal223_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.923) with cleavage site probability 0.668 at
FT                   residue 36"
FT   gene            469477..471231
FT                   /locus_tag="Sbal223_0421"
FT   CDS_pept        469477..471231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0421"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number=""
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; KEGG:
FT                   shn:Shewana3_3749 peptidoglycan synthetase FtsI"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44955"
FT                   /db_xref="GOA:B8E692"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="InterPro:IPR037532"
FT                   /db_xref="UniProtKB/TrEMBL:B8E692"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44955.1"
FT                   GIAAGRAE"
FT   sig_peptide     469477..469602
FT                   /locus_tag="Sbal223_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.802) with cleavage site probability 0.722 at
FT                   residue 42"
FT   gene            471228..472727
FT                   /locus_tag="Sbal223_0422"
FT   CDS_pept        471228..472727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0422"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: shw:Sputw3181_0385
FT                   UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44956"
FT                   /db_xref="GOA:B8E693"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8E693"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ACK44956.1"
FT   gene            472724..474106
FT                   /locus_tag="Sbal223_0423"
FT   CDS_pept        472724..474106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0423"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: shw:Sputw3181_0386
FT                   UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate--D-alanyl- D-alanyl ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44957"
FT                   /db_xref="GOA:B8E694"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8E694"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACK44957.1"
FT                   LV"
FT   gene            474107..475189
FT                   /locus_tag="Sbal223_0424"
FT   CDS_pept        474107..475189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0424"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0387
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4;
FT                   phospho-N-acetylmuramoyl-pentapeptide transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44958"
FT                   /db_xref="GOA:B8E695"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E695"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ACK44958.1"
FT   gene            475196..476515
FT                   /locus_tag="Sbal223_0425"
FT   CDS_pept        475196..476515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0425"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   son:SO_4221 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44959"
FT                   /db_xref="GOA:B8E696"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8E696"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACK44959.1"
FT   gene            476505..477716
FT                   /locus_tag="Sbal223_0426"
FT   CDS_pept        476505..477716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0426"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: shn:Shewana3_3744 cell division
FT                   protein FtsW"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44960"
FT                   /db_xref="GOA:B8E697"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B8E697"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ACK44960.1"
FT                   GRLK"
FT   gene            477716..478804
FT                   /locus_tag="Sbal223_0427"
FT   CDS_pept        477716..478804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0427"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_0390
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44961"
FT                   /db_xref="GOA:B8E698"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E698"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ACK44961.1"
FT   sig_peptide     477716..477790
FT                   /locus_tag="Sbal223_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.935 at
FT                   residue 25"
FT   gene            478807..480273
FT                   /locus_tag="Sbal223_0428"
FT   CDS_pept        478807..480273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0428"
FT                   /product="UDP-N-acetylmuramate/alanine ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramate/alanine ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: shw:Sputw3181_0391
FT                   UDP-N-acetylmuramate--alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44962"
FT                   /db_xref="GOA:B8E699"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E699"
FT                   /inference="protein motif:TFAM:TIGR01082"
FT                   /protein_id="ACK44962.1"
FT   gene            480425..481174
FT                   /locus_tag="Sbal223_0429"
FT   CDS_pept        480425..481174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0429"
FT                   /product="cell division protein FtsQ"
FT                   /note="PFAM: cell division protein FtsQ;
FT                   Polypeptide-transport-associated domain protein FtsQ-type;
FT                   KEGG: shn:Shewana3_3741 polypeptide-transport-associated
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44963"
FT                   /db_xref="GOA:B8E6A0"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR026579"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A0"
FT                   /inference="protein motif:PFAM:PF03799"
FT                   /protein_id="ACK44963.1"
FT   sig_peptide     480425..480502
FT                   /locus_tag="Sbal223_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.853) with cleavage site probability 0.813 at
FT                   residue 26"
FT   gene            481155..482390
FT                   /locus_tag="Sbal223_0430"
FT   CDS_pept        481155..482390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0430"
FT                   /product="cell division protein FtsA"
FT                   /note="PFAM: cell division protein FtsA; KEGG:
FT                   shw:Sputw3181_0393 cell division protein FtsA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44964"
FT                   /db_xref="GOA:B8E6A1"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR020823"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A1"
FT                   /inference="protein motif:PFAM:PF02491"
FT                   /protein_id="ACK44964.1"
FT                   WNRVQSWFKGEF"
FT   gene            482424..483611
FT                   /locus_tag="Sbal223_0431"
FT   CDS_pept        482424..483611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0431"
FT                   /product="cell division protein FtsZ"
FT                   /note="TIGRFAM: cell division protein FtsZ; PFAM:
FT                   Tubulin/FtsZ GTPase; Tubulin/FtsZ domain protein; KEGG:
FT                   son:SO_4215 cell division protein FtsZ"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44965"
FT                   /db_xref="GOA:B8E6A2"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="InterPro:IPR037103"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A2"
FT                   /inference="protein motif:TFAM:TIGR00065"
FT                   /protein_id="ACK44965.1"
FT   gene            483792..484712
FT                   /locus_tag="Sbal223_0432"
FT   CDS_pept        483792..484712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0432"
FT                   /product="UDP-3-0-acyl N-acetylglucosamine deacetylase"
FT                   /note="PFAM: UDP-3-0-acyl N-acetylglucosamine deacetylase;
FT                   KEGG: shn:Shewana3_3738 UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44966"
FT                   /db_xref="GOA:B8E6A3"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6A3"
FT                   /inference="protein motif:PFAM:PF03331"
FT                   /protein_id="ACK44966.1"
FT   gene            complement(484725..485171)
FT                   /locus_tag="Sbal223_0433"
FT   CDS_pept        complement(484725..485171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0433"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   shw:Sputw3181_0396 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44967"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A4"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACK44967.1"
FT   gene            485199..486098
FT                   /locus_tag="Sbal223_0434"
FT   CDS_pept        485199..486098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0434"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: shw:Sputw3181_0397
FT                   peptidase M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44968"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A5"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACK44968.1"
FT                   LRGGQQIDPQKFVYRKAS"
FT   gene            486150..488885
FT                   /locus_tag="Sbal223_0435"
FT   CDS_pept        486150..488885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0435"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecA subunit; PFAM:
FT                   SEC-C motif domain protein; SecA DEAD domain protein; SecA
FT                   Wing and Scaffold; SecA preprotein cross-linking region;
FT                   KEGG: shw:Sputw3181_0398 preprotein translocase subunit
FT                   SecA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44969"
FT                   /db_xref="GOA:B8E6A6"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A6"
FT                   /inference="protein motif:TFAM:TIGR00963"
FT                   /protein_id="ACK44969.1"
FT   gene            489659..491195
FT                   /locus_tag="Sbal223_R0007"
FT   rRNA            489659..491195
FT                   /locus_tag="Sbal223_R0007"
FT                   /product="16S ribosomal RNA"
FT   gene            491296..491372
FT                   /locus_tag="Sbal223_R0037"
FT                   /note="tRNA-Ile1"
FT   tRNA            491296..491372
FT                   /locus_tag="Sbal223_R0037"
FT                   /product="tRNA-Ile"
FT   gene            491510..491585
FT                   /locus_tag="Sbal223_R0038"
FT                   /note="tRNA-Ala1"
FT   tRNA            491510..491585
FT                   /locus_tag="Sbal223_R0038"
FT                   /product="tRNA-Ala"
FT   gene            491953..494855
FT                   /locus_tag="Sbal223_R0008"
FT   rRNA            491953..494855
FT                   /locus_tag="Sbal223_R0008"
FT                   /product="23S ribosomal RNA"
FT   gene            495048..495162
FT                   /locus_tag="Sbal223_R0009"
FT   rRNA            495048..495162
FT                   /locus_tag="Sbal223_R0009"
FT                   /product="5S ribosomal RNA"
FT   gene            495197..495272
FT                   /locus_tag="Sbal223_R0039"
FT                   /note="tRNA-Thr1"
FT   tRNA            495197..495272
FT                   /locus_tag="Sbal223_R0039"
FT                   /product="tRNA-Thr"
FT   gene            495312..495426
FT                   /locus_tag="Sbal223_R0010"
FT   rRNA            495312..495426
FT                   /locus_tag="Sbal223_R0010"
FT                   /product="5S ribosomal RNA"
FT   gene            497525..499061
FT                   /locus_tag="Sbal223_R0011"
FT   rRNA            497525..499061
FT                   /locus_tag="Sbal223_R0011"
FT                   /product="16S ribosomal RNA"
FT   gene            499426..502328
FT                   /locus_tag="Sbal223_R0012"
FT   rRNA            499426..502328
FT                   /locus_tag="Sbal223_R0012"
FT                   /product="23S ribosomal RNA"
FT   gene            502521..502635
FT                   /locus_tag="Sbal223_R0013"
FT   rRNA            502521..502635
FT                   /locus_tag="Sbal223_R0013"
FT                   /product="5S ribosomal RNA"
FT   gene            complement(502864..503871)
FT                   /locus_tag="Sbal223_0436"
FT   CDS_pept        complement(502864..503871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0436"
FT                   /product="Porphobilinogen synthase"
FT                   /EC_number=""
FT                   /note="PFAM: delta-aminolevulinic acid dehydratase; KEGG:
FT                   shw:Sputw3181_3673 delta-aminolevulinic acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44970"
FT                   /db_xref="GOA:B8E6A7"
FT                   /db_xref="InterPro:IPR001731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR030656"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A7"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44970.1"
FT   gene            complement(503881..505767)
FT                   /locus_tag="Sbal223_0437"
FT   CDS_pept        complement(503881..505767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0437"
FT                   /product="periplasmic/7TM domain sensor diguanylate
FT                   cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; Diverse 7TM receptor extracellular
FT                   region 2; Diverse 7TM receptor transmembrane region; KEGG:
FT                   spc:Sputcn32_0498 diguanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44971"
FT                   /db_xref="GOA:B8E6A8"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR011623"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A8"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK44971.1"
FT   sig_peptide     complement(505696..505767)
FT                   /locus_tag="Sbal223_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 24"
FT   gene            complement(505760..506563)
FT                   /locus_tag="Sbal223_0438"
FT   CDS_pept        complement(505760..506563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0438"
FT                   /product="TatD-related deoxyribonuclease"
FT                   /note="PFAM: TatD-related deoxyribonuclease; KEGG:
FT                   shw:Sputw3181_3671 TatD-related deoxyribonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44972"
FT                   /db_xref="GOA:B8E6A9"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6A9"
FT                   /inference="protein motif:PFAM:PF01026"
FT                   /protein_id="ACK44972.1"
FT   gene            complement(506563..507090)
FT                   /locus_tag="Sbal223_0439"
FT   CDS_pept        complement(506563..507090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3670 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44973"
FT                   /db_xref="InterPro:IPR016987"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6B0"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3670"
FT                   /protein_id="ACK44973.1"
FT                   ERNAKARVKRLN"
FT   sig_peptide     complement(507031..507090)
FT                   /locus_tag="Sbal223_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 20"
FT   gene            complement(507136..507891)
FT                   /locus_tag="Sbal223_0440"
FT   CDS_pept        complement(507136..507891)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0440"
FT                   /product="Sec-independent protein translocase, TatC
FT                   subunit"
FT                   /note="TIGRFAM: Sec-independent protein translocase, TatC
FT                   subunit; PFAM: Sec-independent periplasmic protein
FT                   translocase; KEGG: shw:Sputw3181_3669 sec-independent
FT                   protein translocase, TatC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44974"
FT                   /db_xref="GOA:B8E6B1"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6B1"
FT                   /inference="protein motif:TFAM:TIGR00945"
FT                   /protein_id="ACK44974.1"
FT   sig_peptide     complement(507781..507891)
FT                   /locus_tag="Sbal223_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.755) with cleavage site probability 0.754 at
FT                   residue 37"
FT   gene            complement(507895..508395)
FT                   /locus_tag="Sbal223_0441"
FT   CDS_pept        complement(507895..508395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0441"
FT                   /product="twin-arginine translocation protein, TatB
FT                   subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatB
FT                   subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: shw:Sputw3181_3668 twin-arginine
FT                   translocation protein, TatB subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44975"
FT                   /db_xref="GOA:B8E6B2"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR018448"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6B2"
FT                   /inference="protein motif:TFAM:TIGR01410"
FT                   /protein_id="ACK44975.1"
FT                   ANG"
FT   gene            complement(508402..508641)
FT                   /locus_tag="Sbal223_0442"
FT   CDS_pept        complement(508402..508641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0442"
FT                   /product="twin-arginine translocation protein, TatA/E
FT                   family subunit"
FT                   /note="TIGRFAM: twin-arginine translocation protein, TatA/E
FT                   family subunit; PFAM: sec-independent translocation protein
FT                   mttA/Hcf106; KEGG: shw:Sputw3181_3667 twin-arginine
FT                   translocation protein, TatA/E family subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44976"
FT                   /db_xref="GOA:B8E6B3"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6B3"
FT                   /inference="protein motif:TFAM:TIGR01411"
FT                   /protein_id="ACK44976.1"
FT   gene            complement(508701..510350)
FT                   /locus_tag="Sbal223_0443"
FT   CDS_pept        complement(508701..510350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0443"
FT                   /product="2-polyprenylphenol 6-hydroxylase"
FT                   /note="TIGRFAM: 2-polyprenylphenol 6-hydroxylase; PFAM:
FT                   ABC-1 domain protein; KEGG: shm:Shewmr7_0403
FT                   2-octaprenylphenol hydroxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44977"
FT                   /db_xref="GOA:B8E6B4"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR010232"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6B4"
FT                   /inference="protein motif:TFAM:TIGR01982"
FT                   /protein_id="ACK44977.1"
FT   gene            complement(510347..510967)
FT                   /locus_tag="Sbal223_0444"
FT   CDS_pept        complement(510347..510967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0444"
FT                   /product="Sterol-binding domain protein"
FT                   /note="PFAM: Sterol-binding domain protein; KEGG:
FT                   shn:Shewana3_3726 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44978"
FT                   /db_xref="GOA:B8E6B5"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6B5"
FT                   /inference="protein motif:PFAM:PF02036"
FT                   /protein_id="ACK44978.1"
FT   gene            complement(510967..511722)
FT                   /locus_tag="Sbal223_0445"
FT   CDS_pept        complement(510967..511722)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0445"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   shw:Sputw3181_3664 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44979"
FT                   /db_xref="GOA:B8E6B6"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6B6"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACK44979.1"
FT   gene            complement(511968..513032)
FT                   /locus_tag="Sbal223_0446"
FT   CDS_pept        complement(511968..513032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0446"
FT                   /product="Arginase/agmatinase/formiminoglutamase"
FT                   /note="PFAM: Arginase/agmatinase/formiminoglutamase; KEGG:
FT                   spc:Sputcn32_0507 arginase/agmatinase/formiminoglutamase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44980"
FT                   /db_xref="GOA:B8E6B7"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6B7"
FT                   /inference="protein motif:PFAM:PF00491"
FT                   /protein_id="ACK44980.1"
FT                   IYAYVQARMQFLAQ"
FT   gene            complement(513162..513647)
FT                   /locus_tag="Sbal223_0447"
FT   CDS_pept        complement(513162..513647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0447"
FT                   /product="regulator of ribonuclease activity A"
FT                   /note="TIGRFAM: regulator of ribonuclease activity A; PFAM:
FT                   Dimethylmenaquinone methyltransferase; KEGG:
FT                   shw:Sputw3181_3662 ribonuclease activity regulator protein
FT                   RraA"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44981"
FT                   /db_xref="GOA:B8E6B8"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR010203"
FT                   /db_xref="InterPro:IPR014339"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6B8"
FT                   /inference="protein motif:TFAM:TIGR01935"
FT                   /protein_id="ACK44981.1"
FT   gene            513972..514220
FT                   /locus_tag="Sbal223_0448"
FT   CDS_pept        513972..514220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0448"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44982"
FT                   /db_xref="GOA:B8E6B9"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6B9"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3661"
FT                   /protein_id="ACK44982.1"
FT   gene            514634..515146
FT                   /locus_tag="Sbal223_0449"
FT   CDS_pept        514634..515146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0449"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   son:SO_4195 PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44983"
FT                   /db_xref="GOA:B8E6C0"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C0"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACK44983.1"
FT                   LLVHPVI"
FT   gene            515222..516262
FT                   /locus_tag="Sbal223_0450"
FT   CDS_pept        515222..516262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44984"
FT                   /db_xref="InterPro:IPR005262"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C1"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0410"
FT                   /protein_id="ACK44984.1"
FT                   LPDTWR"
FT   gene            516405..517871
FT                   /locus_tag="Sbal223_0451"
FT   CDS_pept        516405..517871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0451"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3658 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44985"
FT                   /db_xref="GOA:B8E6C2"
FT                   /db_xref="InterPro:IPR002921"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C2"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3658"
FT                   /protein_id="ACK44985.1"
FT   sig_peptide     516405..516497
FT                   /locus_tag="Sbal223_0451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.967) with cleavage site probability 0.795 at
FT                   residue 31"
FT   gene            518047..518271
FT                   /locus_tag="Sbal223_0452"
FT   CDS_pept        518047..518271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44986"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C3"
FT                   /inference="similar to AA sequence:KEGG:Sfri_3708"
FT                   /protein_id="ACK44986.1"
FT   gene            complement(518284..518898)
FT                   /locus_tag="Sbal223_0453"
FT   CDS_pept        complement(518284..518898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0453"
FT                   /product="SNARE associated Golgi protein"
FT                   /note="PFAM: SNARE associated Golgi protein; KEGG:
FT                   spc:Sputcn32_0514 DedA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44987"
FT                   /db_xref="GOA:B8E6C4"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C4"
FT                   /inference="protein motif:PFAM:PF09335"
FT                   /protein_id="ACK44987.1"
FT   gene            complement(519108..520028)
FT                   /locus_tag="Sbal223_0454"
FT   CDS_pept        complement(519108..520028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0454"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number=""
FT                   /note="PFAM: phosphoesterase RecJ domain protein; DHHA2
FT                   domain protein; KEGG: shm:Shewmr7_0413 putative
FT                   manganese-dependent inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44988"
FT                   /db_xref="GOA:B8E6C5"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C5"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK44988.1"
FT   gene            complement(520172..520633)
FT                   /locus_tag="Sbal223_0455"
FT   CDS_pept        complement(520172..520633)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   shn:Shewana3_3716 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44989"
FT                   /db_xref="InterPro:IPR004375"
FT                   /db_xref="InterPro:IPR037012"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C6"
FT                   /inference="protein motif:PFAM:PF04074"
FT                   /protein_id="ACK44989.1"
FT   gene            complement(520783..523176)
FT                   /locus_tag="Sbal223_0456"
FT   CDS_pept        complement(520783..523176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0456"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: shm:Shewmr7_0415 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44990"
FT                   /db_xref="GOA:B8E6C7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C7"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACK44990.1"
FT   sig_peptide     complement(523111..523176)
FT                   /locus_tag="Sbal223_0456"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 22"
FT   gene            523494..524549
FT                   /locus_tag="Sbal223_0457"
FT   CDS_pept        523494..524549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44991"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C8"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_3714"
FT                   /protein_id="ACK44991.1"
FT                   KGNVLERLERF"
FT   sig_peptide     523494..523547
FT                   /locus_tag="Sbal223_0457"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.705) with cleavage site probability 0.701 at
FT                   residue 18"
FT   gene            524751..525326
FT                   /locus_tag="Sbal223_0458"
FT   CDS_pept        524751..525326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0458"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; KEGG:
FT                   shm:Shewmr7_0417 ATP-dependent protease La (LON) domain
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44992"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6C9"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ACK44992.1"
FT   gene            525380..526297
FT                   /locus_tag="Sbal223_0459"
FT   CDS_pept        525380..526297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0459"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG:
FT                   shw:Sputw3181_3651 pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44993"
FT                   /db_xref="GOA:B8E6D0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D0"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACK44993.1"
FT   gene            526445..526834
FT                   /locus_tag="Sbal223_0460"
FT   CDS_pept        526445..526834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44994"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D1"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_3711"
FT                   /protein_id="ACK44994.1"
FT   sig_peptide     526445..526525
FT                   /locus_tag="Sbal223_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.476 at
FT                   residue 27"
FT   gene            complement(526839..528689)
FT                   /locus_tag="Sbal223_0461"
FT   CDS_pept        complement(526839..528689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0461"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44995"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR038607"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D2"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0423"
FT                   /protein_id="ACK44995.1"
FT   gene            528868..529782
FT                   /locus_tag="Sbal223_0462"
FT   CDS_pept        528868..529782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0462"
FT                   /product="dTDP-4-dehydrorhamnose reductase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   polysaccharide biosynthesis protein CapD;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: son:SO_4174 NAD dependent epimerase/dehydratase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44996"
FT                   /db_xref="GOA:B8E6D3"
FT                   /db_xref="InterPro:IPR005913"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D3"
FT                   /inference="protein motif:PFAM:PF04321"
FT                   /protein_id="ACK44996.1"
FT   gene            529791..531101
FT                   /locus_tag="Sbal223_0463"
FT   CDS_pept        529791..531101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0463"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: she:Shewmr4_3530 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44997"
FT                   /db_xref="GOA:B8E6D4"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D4"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK44997.1"
FT   gene            531098..531649
FT                   /locus_tag="Sbal223_0464"
FT   CDS_pept        531098..531649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0464"
FT                   /product="two component transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: response regulator receiver; helix-turn-helix
FT                   Fis-type; KEGG: son:SO_4172 DNA-binding response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44998"
FT                   /db_xref="GOA:B8E6D5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D5"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK44998.1"
FT   gene            complement(531860..534196)
FT                   /locus_tag="Sbal223_0465"
FT   CDS_pept        complement(531860..534196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0465"
FT                   /product="peptidase M4 thermolysin"
FT                   /note="PFAM: PKD domain containing protein; peptidase M4
FT                   thermolysin; Propeptide PepSY amd peptidase M4; peptidase
FT                   domain protein; Peptidase M4 thermolysin; KEGG:
FT                   sdn:Sden_3015 peptidase M4, thermolysin"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACK44999"
FT                   /db_xref="GOA:B8E6D6"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR001570"
FT                   /db_xref="InterPro:IPR007280"
FT                   /db_xref="InterPro:IPR011096"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013856"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR023612"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="InterPro:IPR027268"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D6"
FT                   /inference="protein motif:PFAM:PF02868"
FT                   /protein_id="ACK44999.1"
FT   sig_peptide     complement(534122..534196)
FT                   /locus_tag="Sbal223_0465"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            complement(534808..535515)
FT                   /locus_tag="Sbal223_0466"
FT   CDS_pept        complement(534808..535515)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0466"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   spc:Sputcn32_0523 C factor cell-cell signaling protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45000"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACK45000.1"
FT                   GRFFAYDGTELPW"
FT   gene            complement(535529..537094)
FT                   /locus_tag="Sbal223_0467"
FT   CDS_pept        complement(535529..537094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0467"
FT                   /product="deoxyribodipyrimidine photolyase-related protein"
FT                   /note="PFAM: deoxyribodipyrimidine photolyase-related
FT                   protein; KEGG: shw:Sputw3181_3646 deoxyribodipyrimidine
FT                   photolyase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45001"
FT                   /db_xref="GOA:B8E6D8"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D8"
FT                   /inference="protein motif:PFAM:PF04244"
FT                   /protein_id="ACK45001.1"
FT                   LNRL"
FT   gene            537326..537544
FT                   /locus_tag="Sbal223_0468"
FT   CDS_pept        537326..537544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0468"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45002"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6D9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK45002.1"
FT   gene            complement(537584..538951)
FT                   /locus_tag="Sbal223_0469"
FT   CDS_pept        complement(537584..538951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0469"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vpa:VPA1256 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45003"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK45003.1"
FT   gene            complement(538948..539154)
FT                   /locus_tag="Sbal223_0470"
FT   CDS_pept        complement(538948..539154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45004"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK45004.1"
FT   gene            complement(539537..539923)
FT                   /locus_tag="Sbal223_0471"
FT   CDS_pept        complement(539537..539923)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0471"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   shn:Shewana3_3701 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45005"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E2"
FT                   /inference="protein motif:PFAM:PF06155"
FT                   /protein_id="ACK45005.1"
FT   gene            complement(540131..541459)
FT                   /locus_tag="Sbal223_0472"
FT   CDS_pept        complement(540131..541459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0472"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="KEGG: spc:Sputcn32_0528 ATP-dependent protease
FT                   ATP-binding subunit; TIGRFAM: heat shock protein HslVU,
FT                   ATPase subunit HslU; PFAM: AAA ATPase central domain
FT                   protein; ATPase AAA-2 domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45006"
FT                   /db_xref="GOA:B8E6E3"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6E3"
FT                   /inference="protein motif:TFAM:TIGR00390"
FT                   /protein_id="ACK45006.1"
FT   gene            complement(541479..542003)
FT                   /locus_tag="Sbal223_0473"
FT   CDS_pept        complement(541479..542003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0473"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="PFAM: 20S proteasome A and B subunits; KEGG:
FT                   shw:Sputw3181_3642 ATP-dependent protease peptidase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45007"
FT                   /db_xref="GOA:B8E6E4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6E4"
FT                   /inference="protein motif:PFAM:PF00227"
FT                   /protein_id="ACK45007.1"
FT                   NQFKTIEELNY"
FT   gene            complement(542316..542867)
FT                   /locus_tag="Sbal223_0474"
FT   CDS_pept        complement(542316..542867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0474"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: spc:Sputcn32_0531 deaminase-reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45008"
FT                   /db_xref="GOA:B8E6E5"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E5"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACK45008.1"
FT   gene            complement(542883..543107)
FT                   /locus_tag="Sbal223_0475"
FT   CDS_pept        complement(542883..543107)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0475"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3639 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45009"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E6"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3639"
FT                   /protein_id="ACK45009.1"
FT   gene            complement(543127..543309)
FT                   /locus_tag="Sbal223_0476"
FT   CDS_pept        complement(543127..543309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45010"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK45010.1"
FT                   NHGRANVQTFNITQF"
FT   gene            complement(543589..544773)
FT                   /locus_tag="Sbal223_0477"
FT   CDS_pept        complement(543589..544773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0477"
FT                   /product="flagellar biosynthesis protein, putative"
FT                   /note="KEGG: spc:Sputcn32_0533 flagellar biosynthesis
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45011"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E8"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0533"
FT                   /protein_id="ACK45011.1"
FT   gene            complement(544976..545578)
FT                   /locus_tag="Sbal223_0478"
FT   CDS_pept        complement(544976..545578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0478"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: regulatory protein LuxR; response regulator
FT                   receiver; Sigma-70 region 4 type 2; KEGG: shm:Shewmr7_0436
FT                   two component transcriptional regulator, LuxR family"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45012"
FT                   /db_xref="GOA:B8E6E9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6E9"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK45012.1"
FT   gene            545796..547607
FT                   /locus_tag="Sbal223_0479"
FT   CDS_pept        545796..547607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0479"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: spc:Sputcn32_0535
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45013"
FT                   /db_xref="GOA:B8E6F0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F0"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK45013.1"
FT   sig_peptide     545796..545876
FT                   /locus_tag="Sbal223_0479"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            complement(547655..547939)
FT                   /locus_tag="Sbal223_0480"
FT   CDS_pept        complement(547655..547939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0480"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: son:SO_4154 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45014"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK45014.1"
FT   gene            complement(548069..549229)
FT                   /locus_tag="Sbal223_0481"
FT   CDS_pept        complement(548069..549229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0481"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: shm:Shewmr7_0438 sulphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45015"
FT                   /db_xref="GOA:B8E6F2"
FT                   /db_xref="InterPro:IPR031563"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F2"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACK45015.1"
FT   gene            complement(549469..550857)
FT                   /locus_tag="Sbal223_0482"
FT   CDS_pept        complement(549469..550857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0482"
FT                   /product="cytochrome c, putative"
FT                   /note="KEGG: shn:Shewana3_3690 cytochrome c, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45016"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR023155"
FT                   /db_xref="InterPro:IPR024673"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F3"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_3690"
FT                   /protein_id="ACK45016.1"
FT                   HKQP"
FT   sig_peptide     complement(550801..550857)
FT                   /locus_tag="Sbal223_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 19"
FT   gene            complement(550913..552637)
FT                   /locus_tag="Sbal223_0483"
FT   CDS_pept        complement(550913..552637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: son:SO_4143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45017"
FT                   /db_xref="InterPro:IPR021803"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F4"
FT                   /inference="similar to AA sequence:KEGG:SO_4143"
FT                   /protein_id="ACK45017.1"
FT   sig_peptide     complement(552572..552637)
FT                   /locus_tag="Sbal223_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            complement(552831..553160)
FT                   /locus_tag="Sbal223_0484"
FT   CDS_pept        complement(552831..553160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0484"
FT                   /product="cytochrome c family protein"
FT                   /note="KEGG: she:Shewmr4_3511 cytochrome c family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45018"
FT                   /db_xref="GOA:B8E6F5"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F5"
FT                   /inference="similar to AA sequence:KEGG:Shewmr4_3511"
FT                   /protein_id="ACK45018.1"
FT                   PQTCG"
FT   sig_peptide     complement(553086..553160)
FT                   /locus_tag="Sbal223_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 25"
FT   gene            complement(553658..554431)
FT                   /locus_tag="Sbal223_0485"
FT   CDS_pept        complement(553658..554431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3635 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45019"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F6"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3635"
FT                   /protein_id="ACK45019.1"
FT   sig_peptide     complement(554372..554431)
FT                   /locus_tag="Sbal223_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.996 at
FT                   residue 20"
FT   gene            complement(554668..556203)
FT                   /locus_tag="Sbal223_0486"
FT   CDS_pept        complement(554668..556203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0486"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: shw:Sputw3181_3634 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45020"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F7"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACK45020.1"
FT   gene            complement(556322..557158)
FT                   /locus_tag="Sbal223_0487"
FT   CDS_pept        complement(556322..557158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0487"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   shw:Sputw3181_3633 MscS mechanosensitive ion channel"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45021"
FT                   /db_xref="GOA:B8E6F8"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F8"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACK45021.1"
FT   gene            557329..557808
FT                   /locus_tag="Sbal223_0488"
FT   CDS_pept        557329..557808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0488"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45022"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6F9"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3632"
FT                   /protein_id="ACK45022.1"
FT   sig_peptide     557329..557388
FT                   /locus_tag="Sbal223_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.713 at
FT                   residue 20"
FT   repeat_region   complement(557988..558252)
FT                   /note="SonMITE2"
FT   gene            558451..559626
FT                   /locus_tag="Sbal223_0489"
FT   CDS_pept        558451..559626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0489"
FT                   /product="Diaminopimelate decarboxylase"
FT                   /EC_number=""
FT                   /note="PFAM: Orn/DAP/Arg decarboxylase 2; KEGG:
FT                   shw:Sputw3181_3631 diaminopimelate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45023"
FT                   /db_xref="GOA:B8E6G0"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR022657"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G0"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK45023.1"
FT   gene            complement(559691..559903)
FT                   /locus_tag="Sbal223_0490"
FT   CDS_pept        complement(559691..559903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shn:Shewana3_3681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45024"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G1"
FT                   /inference="similar to AA sequence:KEGG:Shewana3_3681"
FT                   /protein_id="ACK45024.1"
FT   gene            560317..561075
FT                   /locus_tag="Sbal223_0491"
FT   CDS_pept        560317..561075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0491"
FT                   /product="uridine phosphorylase"
FT                   /note="TIGRFAM: uridine phosphorylase; PFAM: purine or
FT                   other phosphorylase family 1; KEGG: son:SO_4133 uridine
FT                   phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45025"
FT                   /db_xref="GOA:B8E6G2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR010058"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G2"
FT                   /inference="protein motif:TFAM:TIGR01718"
FT                   /protein_id="ACK45025.1"
FT   gene            complement(561178..561930)
FT                   /locus_tag="Sbal223_0492"
FT   CDS_pept        complement(561178..561930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0492"
FT                   /product="nucleoside-specific channel-forming protein Tsx"
FT                   /note="PFAM: nucleoside-specific channel-forming protein
FT                   Tsx; KEGG: shw:Sputw3181_3628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45026"
FT                   /db_xref="GOA:B8E6G3"
FT                   /db_xref="InterPro:IPR018013"
FT                   /db_xref="InterPro:IPR036777"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G3"
FT                   /inference="protein motif:PFAM:PF03502"
FT                   /protein_id="ACK45026.1"
FT   sig_peptide     complement(561874..561930)
FT                   /locus_tag="Sbal223_0492"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 19"
FT   gene            562405..562875
FT                   /locus_tag="Sbal223_0493"
FT   CDS_pept        562405..562875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0493"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   shw:Sputw3181_3627 protein of unknown function DUF107"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45027"
FT                   /db_xref="GOA:B8E6G4"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G4"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACK45027.1"
FT   gene            562888..563823
FT                   /locus_tag="Sbal223_0494"
FT   CDS_pept        562888..563823
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0494"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: shw:Sputw3181_3626 band
FT                   7 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45028"
FT                   /db_xref="GOA:B8E6G5"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G5"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACK45028.1"
FT   gene            563823..564761
FT                   /locus_tag="Sbal223_0495"
FT   CDS_pept        563823..564761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0495"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: son:SO_4128 SPFH
FT                   domain-containing protein/band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45029"
FT                   /db_xref="GOA:B8E6G6"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR032435"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G6"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACK45029.1"
FT   gene            complement(564968..565192)
FT                   /locus_tag="Sbal223_0496"
FT   CDS_pept        complement(564968..565192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3624 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45030"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G7"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3624"
FT                   /protein_id="ACK45030.1"
FT   gene            complement(565550..566266)
FT                   /locus_tag="Sbal223_0497"
FT   CDS_pept        complement(565550..566266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0497"
FT                   /product="Sporulation domain protein"
FT                   /note="PFAM: Sporulation domain protein; KEGG:
FT                   shw:Sputw3181_3623 sporulation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45031"
FT                   /db_xref="GOA:B8E6G8"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6G8"
FT                   /inference="protein motif:PFAM:PF05036"
FT                   /protein_id="ACK45031.1"
FT                   LQNAGINGCQILAIPK"
FT   gene            complement(566270..568015)
FT                   /locus_tag="Sbal223_0498"
FT   CDS_pept        complement(566270..568015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0498"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3622 arginyl-tRNA synthetase;
FT                   TIGRFAM: arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45032"
FT                   /db_xref="GOA:B8E6G9"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6G9"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACK45032.1"
FT                   TLERM"
FT   gene            complement(568150..570345)
FT                   /locus_tag="Sbal223_0499"
FT   CDS_pept        complement(568150..570345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0499"
FT                   /product="primosomal protein N'"
FT                   /note="KEGG: shw:Sputw3181_3621 primosomal protein N';
FT                   TIGRFAM: primosomal protein N'; PFAM: helicase domain
FT                   protein; type III restriction protein res subunit;
FT                   DEAD/DEAH box helicase domain protein; SMART: DEAD-like
FT                   helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45033"
FT                   /db_xref="GOA:B8E6H0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H0"
FT                   /inference="protein motif:TFAM:TIGR00595"
FT                   /protein_id="ACK45033.1"
FT   gene            570448..571542
FT                   /locus_tag="Sbal223_0500"
FT   CDS_pept        570448..571542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45034"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR020012"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H1"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0458"
FT                   /protein_id="ACK45034.1"
FT   sig_peptide     570448..570513
FT                   /locus_tag="Sbal223_0500"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            571724..571936
FT                   /locus_tag="Sbal223_0501"
FT   CDS_pept        571724..571936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0501"
FT                   /product="ribosomal protein L31"
FT                   /note="PFAM: ribosomal protein L31; KEGG:
FT                   shw:Sputw3181_3619 50S ribosomal protein L31"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45035"
FT                   /db_xref="GOA:B8E6H2"
FT                   /db_xref="InterPro:IPR002150"
FT                   /db_xref="InterPro:IPR027491"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR042105"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E6H2"
FT                   /inference="protein motif:PFAM:PF01197"
FT                   /protein_id="ACK45035.1"
FT   gene            572473..573717
FT                   /locus_tag="Sbal223_0502"
FT   CDS_pept        572473..573717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0502"
FT                   /product="Malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /EC_number=""
FT                   /note="PFAM: malic protein domain protein; malic protein
FT                   NAD-binding; KEGG: shw:Sputw3181_3618 malate dehydrogenase
FT                   (oxaloacetate-decarboxylating) (NADP(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45036"
FT                   /db_xref="GOA:B8E6H3"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H3"
FT                   /inference="protein motif:PRIAM:"
FT                   /protein_id="ACK45036.1"
FT                   DSGVAAIPTLPKYAD"
FT   gene            573903..575846
FT                   /locus_tag="Sbal223_0503"
FT   CDS_pept        573903..575846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0503"
FT                   /product="diguanylate cyclase/phosphodiesterase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG:
FT                   shn:Shewana3_3668 regulatory protein CsrD"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45037"
FT                   /db_xref="GOA:B8E6H4"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H4"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK45037.1"
FT                   QGMYFSEPIEAK"
FT   sig_peptide     573903..574010
FT                   /locus_tag="Sbal223_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.795 at
FT                   residue 36"
FT   gene            576092..576970
FT                   /locus_tag="Sbal223_0504"
FT   CDS_pept        576092..576970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0504"
FT                   /product="biogenesis protein MshI"
FT                   /note="KEGG: son:SO_4114.2 biogenesis protein MshI"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45038"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H5"
FT                   /inference="similar to AA sequence:KEGG:SO_4114.2"
FT                   /protein_id="ACK45038.1"
FT                   LAFAEFSRGAE"
FT   gene            576967..577569
FT                   /locus_tag="Sbal223_0505"
FT   CDS_pept        576967..577569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0505"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: she:Shewmr4_3489 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45039"
FT                   /db_xref="GOA:B8E6H6"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H6"
FT                   /inference="similar to AA sequence:KEGG:Shewmr4_3489"
FT                   /protein_id="ACK45039.1"
FT   sig_peptide     576967..577080
FT                   /locus_tag="Sbal223_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.691) with cleavage site probability 0.412 at
FT                   residue 38"
FT   gene            577566..578216
FT                   /locus_tag="Sbal223_0506"
FT   CDS_pept        577566..578216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0506"
FT                   /product="MSHA biogenesis protein MshJ"
FT                   /note="KEGG: spc:Sputcn32_0558 MSHA biogenesis protein
FT                   MshJ"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45040"
FT                   /db_xref="GOA:B8E6H7"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H7"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0558"
FT                   /protein_id="ACK45040.1"
FT   gene            578203..578523
FT                   /locus_tag="Sbal223_0507"
FT   CDS_pept        578203..578523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0507"
FT                   /product="MSHA biogenesis protein MshK"
FT                   /note="KEGG: shw:Sputw3181_3613 MSHA biogenesis protein
FT                   MshK"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45041"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H8"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3613"
FT                   /protein_id="ACK45041.1"
FT                   ER"
FT   sig_peptide     578203..578271
FT                   /locus_tag="Sbal223_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.997 at
FT                   residue 23"
FT   gene            578538..580217
FT                   /locus_tag="Sbal223_0508"
FT   CDS_pept        578538..580217
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0508"
FT                   /product="pilus (MSHA type) biogenesis protein MshL"
FT                   /note="TIGRFAM: pilus (MSHA type) biogenesis protein MshL;
FT                   PFAM: type II and III secretion system protein; Secretin
FT                   domain protein; Secretin/TonB short domain; KEGG:
FT                   son:SO_4112 MSHA biogenesis protein MshL"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45042"
FT                   /db_xref="GOA:B8E6H9"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004845"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR011514"
FT                   /db_xref="InterPro:IPR011662"
FT                   /db_xref="InterPro:IPR013358"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6H9"
FT                   /inference="protein motif:TFAM:TIGR02519"
FT                   /protein_id="ACK45042.1"
FT   gene            580224..581132
FT                   /locus_tag="Sbal223_0509"
FT   CDS_pept        580224..581132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0509"
FT                   /product="MSHA biogenesis protein MshM"
FT                   /note="KEGG: she:Shewmr4_3485 MSHA biogenesis protein MshM"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45043"
FT                   /db_xref="GOA:B8E6I0"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I0"
FT                   /inference="similar to AA sequence:KEGG:Shewmr4_3485"
FT                   /protein_id="ACK45043.1"
FT   gene            581129..582481
FT                   /locus_tag="Sbal223_0510"
FT   CDS_pept        581129..582481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0510"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: shm:Shewmr7_0468
FT                   tetratricopeptide TPR_2 repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45044"
FT                   /db_xref="GOA:B8E6I1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I1"
FT                   /inference="protein motif:PFAM:PF00515"
FT                   /protein_id="ACK45044.1"
FT   gene            582478..584238
FT                   /locus_tag="Sbal223_0511"
FT   CDS_pept        582478..584238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0511"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; General
FT                   secretory system II protein E domain protein; KEGG:
FT                   shw:Sputw3181_3609 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45045"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="InterPro:IPR042181"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I2"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACK45045.1"
FT                   DIISQQGVEA"
FT   gene            584241..585461
FT                   /locus_tag="Sbal223_0512"
FT   CDS_pept        584241..585461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0512"
FT                   /product="type II secretion system protein"
FT                   /note="PFAM: type II secretion system protein; KEGG:
FT                   shw:Sputw3181_3608 type II secretion system protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45046"
FT                   /db_xref="GOA:B8E6I3"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I3"
FT                   /inference="protein motif:PFAM:PF00482"
FT                   /protein_id="ACK45046.1"
FT                   NVVKGGK"
FT   gene            585512..586006
FT                   /locus_tag="Sbal223_0513"
FT   CDS_pept        585512..586006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0513"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0565 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45047"
FT                   /db_xref="GOA:B8E6I4"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I4"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0565"
FT                   /protein_id="ACK45047.1"
FT                   P"
FT   gene            586082..586699
FT                   /locus_tag="Sbal223_0514"
FT   CDS_pept        586082..586699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0514"
FT                   /product="MSHA pilin protein MshB"
FT                   /note="KEGG: son:SO_4106 MSHA pilin protein MshB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45048"
FT                   /db_xref="GOA:B8E6I5"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I5"
FT                   /inference="similar to AA sequence:KEGG:SO_4106"
FT                   /protein_id="ACK45048.1"
FT   gene            586753..587259
FT                   /locus_tag="Sbal223_0515"
FT   CDS_pept        586753..587259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0515"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: slo:Shew_0396 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45049"
FT                   /db_xref="GOA:B8E6I6"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I6"
FT                   /inference="similar to AA sequence:KEGG:Shew_0396"
FT                   /protein_id="ACK45049.1"
FT                   VATAC"
FT   sig_peptide     586753..586833
FT                   /locus_tag="Sbal223_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.697) with cleavage site probability 0.693 at
FT                   residue 27"
FT   gene            587274..587792
FT                   /locus_tag="Sbal223_0516"
FT   CDS_pept        587274..587792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0516"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: sfr:Sfri_3744 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45050"
FT                   /db_xref="GOA:B8E6I7"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I7"
FT                   /inference="similar to AA sequence:KEGG:Sfri_3744"
FT                   /protein_id="ACK45050.1"
FT                   TALPTADKC"
FT   sig_peptide     587274..587354
FT                   /locus_tag="Sbal223_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.857) with cleavage site probability 0.851 at
FT                   residue 27"
FT   gene            587964..588452
FT                   /locus_tag="Sbal223_0517"
FT   CDS_pept        587964..588452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0517"
FT                   /product="MSHA pilin protein MshC"
FT                   /note="KEGG: son:SO_4104 MSHA pilin protein MshC"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45051"
FT                   /db_xref="GOA:B8E6I8"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I8"
FT                   /inference="similar to AA sequence:KEGG:SO_4104"
FT                   /protein_id="ACK45051.1"
FT   gene            588442..589020
FT                   /locus_tag="Sbal223_0518"
FT   CDS_pept        588442..589020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0518"
FT                   /product="methylation site containing protein"
FT                   /note="KEGG: shm:Shewmr7_0475 methylation site containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45052"
FT                   /db_xref="GOA:B8E6I9"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6I9"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0475"
FT                   /protein_id="ACK45052.1"
FT   gene            589020..589868
FT                   /locus_tag="Sbal223_0519"
FT   CDS_pept        589020..589868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0519"
FT                   /product="MSHA biogenesis protein MshO"
FT                   /note="KEGG: shw:Sputw3181_3601 MSHA biogenesis protein
FT                   MshO"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45053"
FT                   /db_xref="GOA:B8E6J0"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J0"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3601"
FT                   /protein_id="ACK45053.1"
FT                   P"
FT   gene            589858..590337
FT                   /locus_tag="Sbal223_0520"
FT   CDS_pept        589858..590337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0520"
FT                   /product="MSHA biogenesis protein MshP"
FT                   /note="KEGG: spc:Sputcn32_0572 MSHA biogenesis protein
FT                   MshP"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45054"
FT                   /db_xref="GOA:B8E6J1"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J1"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0572"
FT                   /protein_id="ACK45054.1"
FT   sig_peptide     589858..590019
FT                   /locus_tag="Sbal223_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.818) with cleavage site probability 0.446 at
FT                   residue 54"
FT   gene            590327..594958
FT                   /locus_tag="Sbal223_0521"
FT   CDS_pept        590327..594958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfr:Sfri_3739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45055"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR035665"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J2"
FT                   /inference="similar to AA sequence:KEGG:Sfri_3739"
FT                   /protein_id="ACK45055.1"
FT   sig_peptide     590327..590401
FT                   /locus_tag="Sbal223_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            595299..596348
FT                   /locus_tag="Sbal223_0522"
FT   CDS_pept        595299..596348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0522"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: son:SO_4098 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45056"
FT                   /db_xref="GOA:B8E6J3"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J3"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACK45056.1"
FT                   GGDLFSEET"
FT   gene            596393..597403
FT                   /locus_tag="Sbal223_0523"
FT   CDS_pept        596393..597403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0523"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: shm:Shewmr7_0480
FT                   rod shape-determining protein MreC"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45057"
FT                   /db_xref="GOA:B8E6J4"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J4"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ACK45057.1"
FT   gene            597400..597888
FT                   /locus_tag="Sbal223_0524"
FT   CDS_pept        597400..597888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0524"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; PFAM:
FT                   Rod shape-determining protein MreD; KEGG:
FT                   shw:Sputw3181_3596 rod shape-determining protein MreD"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45058"
FT                   /db_xref="GOA:B8E6J5"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J5"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ACK45058.1"
FT   gene            597891..598493
FT                   /locus_tag="Sbal223_0525"
FT   CDS_pept        597891..598493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0525"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: shw:Sputw3181_3595 maf protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45059"
FT                   /db_xref="GOA:B8E6J6"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J6"
FT                   /inference="protein motif:TFAM:TIGR00172"
FT                   /protein_id="ACK45059.1"
FT   gene            598723..600189
FT                   /locus_tag="Sbal223_0526"
FT   CDS_pept        598723..600189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0526"
FT                   /product="ribonuclease, Rne/Rng family"
FT                   /note="TIGRFAM: ribonuclease, Rne/Rng family; PFAM: RNA
FT                   binding S1 domain protein; ribonuclease E and G; KEGG:
FT                   shw:Sputw3181_3594 ribonuclease G"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45060"
FT                   /db_xref="GOA:B8E6J7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004659"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR019307"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J7"
FT                   /inference="protein motif:TFAM:TIGR00757"
FT                   /protein_id="ACK45060.1"
FT   gene            600189..604553
FT                   /locus_tag="Sbal223_0527"
FT   CDS_pept        600189..604553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0527"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shw:Sputw3181_3593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45061"
FT                   /db_xref="InterPro:IPR011836"
FT                   /db_xref="InterPro:IPR025263"
FT                   /db_xref="InterPro:IPR032712"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J8"
FT                   /inference="similar to AA sequence:KEGG:Sputw3181_3593"
FT                   /protein_id="ACK45061.1"
FT   sig_peptide     600189..600275
FT                   /locus_tag="Sbal223_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.836) with cleavage site probability 0.798 at
FT                   residue 29"
FT   gene            604477..605307
FT                   /locus_tag="Sbal223_0528"
FT   CDS_pept        604477..605307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0528"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: spc:Sputcn32_0580
FT                   nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45062"
FT                   /db_xref="GOA:B8E6J9"
FT                   /db_xref="InterPro:IPR001110"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6J9"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACK45062.1"
FT   gene            605421..606869
FT                   /locus_tag="Sbal223_0529"
FT   CDS_pept        605421..606869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0529"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   shw:Sputw3181_3591 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45063"
FT                   /db_xref="GOA:B8E6K0"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR025502"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6K0"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACK45063.1"
FT   gene            607141..608562
FT                   /locus_tag="Sbal223_0530"
FT   CDS_pept        607141..608562
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0530"
FT                   /product="outer membrane efflux protein"
FT                   /note="PFAM: outer membrane efflux protein; KEGG:
FT                   shm:Shewmr7_0487 outer membrane efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45064"
FT                   /db_xref="GOA:B8E6K1"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6K1"
FT                   /inference="protein motif:PFAM:PF02321"
FT                   /protein_id="ACK45064.1"
FT                   RTIALTQVQETNNAR"
FT   sig_peptide     607141..607215
FT                   /locus_tag="Sbal223_0530"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            608552..609526
FT                   /locus_tag="Sbal223_0531"
FT   CDS_pept        608552..609526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0531"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   shw:Sputw3181_3589 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45065"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6K2"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACK45065.1"
FT   sig_peptide     608552..608614
FT                   /locus_tag="Sbal223_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.727 at
FT                   residue 21"
FT   gene            609607..610824
FT                   /locus_tag="Sbal223_0532"
FT   CDS_pept        609607..610824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0532"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   shw:Sputw3181_3588 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45066"
FT                   /db_xref="GOA:B8E6K3"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6K3"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACK45066.1"
FT                   LPAKGQ"
FT   gene            610832..611971
FT                   /locus_tag="Sbal223_0533"
FT   CDS_pept        610832..611971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0533"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG:
FT                   spc:Sputcn32_0585 ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45067"
FT                   /db_xref="GOA:B8E6K4"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6K4"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACK45067.1"
FT   gene            612328..612483
FT                   /locus_tag="Sbal223_0534"
FT   CDS_pept        612328..612483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45068"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6K5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK45068.1"
FT                   VMGACS"
FT   gene            612480..613811
FT                   /locus_tag="Sbal223_0535"
FT   CDS_pept        612480..613811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0535"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   spc:Sputcn32_0587 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45069"
FT                   /db_xref="GOA:B8E6K6"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B8E6K6"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACK45069.1"
FT   gene            complement(613949..616459)
FT                   /locus_tag="Sbal223_0536"
FT   CDS_pept        complement(613949..616459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0536"
FT                   /product="Ig domain protein group 1 domain protein"
FT                   /note="PFAM: Ig domain protein group 1 domain protein;
FT                   KEGG: shn:Shewana3_3633 Ig domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45070"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8G3"
FT                   /inference="protein motif:PFAM:PF02369"
FT                   /protein_id="ACK45070.1"
FT   sig_peptide     complement(616385..616459)
FT                   /locus_tag="Sbal223_0536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.535 at
FT                   residue 25"
FT   gene            complement(616489..617025)
FT                   /locus_tag="Sbal223_0537"
FT   CDS_pept        complement(616489..617025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0537"
FT                   /product="protein of unknown function DUF615"
FT                   /note="PFAM: protein of unknown function DUF615; KEGG:
FT                   shw:Sputw3181_3579 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45071"
FT                   /db_xref="InterPro:IPR006839"
FT                   /db_xref="InterPro:IPR023153"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8G4"
FT                   /inference="protein motif:PFAM:PF04751"
FT                   /protein_id="ACK45071.1"
FT                   SSKELFKYLRSEIQD"
FT   repeat_region   617099..617363
FT                   /note="MITE"
FT   gene            617463..618806
FT                   /locus_tag="Sbal223_0538"
FT   CDS_pept        617463..618806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0538"
FT                   /product="peptidase U62 modulator of DNA gyrase"
FT                   /note="PFAM: peptidase U62 modulator of DNA gyrase; KEGG:
FT                   shw:Sputw3181_3578 peptidase U62, modulator of DNA gyrase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45072"
FT                   /db_xref="GOA:B8E8G5"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8G5"
FT                   /inference="protein motif:PFAM:PF01523"
FT                   /protein_id="ACK45072.1"
FT   gene            complement(619006..621132)
FT                   /locus_tag="Sbal223_0539"
FT   CDS_pept        complement(619006..621132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0539"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: shw:Sputw3181_3577 TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45073"
FT                   /db_xref="GOA:B8E8G6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8G6"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACK45073.1"
FT                   GAGRSFELSASYAF"
FT   sig_peptide     complement(621025..621132)
FT                   /locus_tag="Sbal223_0539"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 36"
FT   gene            complement(621408..622256)
FT                   /locus_tag="Sbal223_0540"
FT   CDS_pept        complement(621408..622256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: shm:Shewmr7_0497 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45074"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8G7"
FT                   /inference="similar to AA sequence:KEGG:Shewmr7_0497"
FT                   /protein_id="ACK45074.1"
FT                   G"
FT   sig_peptide     complement(622173..622256)
FT                   /locus_tag="Sbal223_0540"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.961 at
FT                   residue 28"
FT   gene            622532..622792
FT                   /locus_tag="Sbal223_0541"
FT   CDS_pept        622532..622792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0541"
FT                   /product="protein of unknown function DUF331"
FT                   /note="PFAM: protein of unknown function DUF331; KEGG:
FT                   shw:Sputw3181_3575 protein of unknown function DUF331"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45075"
FT                   /db_xref="GOA:B8E8G8"
FT                   /db_xref="InterPro:IPR005589"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8G8"
FT                   /inference="protein motif:PFAM:PF03889"
FT                   /protein_id="ACK45075.1"
FT   gene            622973..624376
FT                   /locus_tag="Sbal223_0542"
FT   CDS_pept        622973..624376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0542"
FT                   /product="fumarate hydratase, class II"
FT                   /note="TIGRFAM: fumarate hydratase, class II; PFAM:
FT                   fumarate lyase; fumarate hydratase class II; KEGG:
FT                   spc:Sputcn32_0598 fumarate hydratase, class II"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45076"
FT                   /db_xref="GOA:B8E8G9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8G9"
FT                   /inference="protein motif:TFAM:TIGR00979"
FT                   /protein_id="ACK45076.1"
FT                   ANKMLGPDA"
FT   gene            complement(624614..626032)
FT                   /locus_tag="Sbal223_0543"
FT   CDS_pept        complement(624614..626032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0543"
FT                   /product="MiaB-like tRNA modifying enzyme YliG"
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3573 MiaB-like tRNA modifying
FT                   enzyme YliG; TIGRFAM: RNA modification enzyme, MiaB family;
FT                   MiaB-like tRNA modifying enzyme YliG; PFAM: Radical SAM
FT                   domain protein; Protein of unknown function UPF0004; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45077"
FT                   /db_xref="GOA:B8E8H0"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR005840"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="InterPro:IPR041582"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H0"
FT                   /inference="protein motif:TFAM:TIGR01125"
FT                   /protein_id="ACK45077.1"
FT                   HDLWAEVVDADTQD"
FT   gene            626450..627163
FT                   /locus_tag="Sbal223_0544"
FT   CDS_pept        626450..627163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0544"
FT                   /product="protein of unknown function DUF541"
FT                   /note="PFAM: protein of unknown function DUF541; KEGG:
FT                   shw:Sputw3181_3572 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45078"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H1"
FT                   /inference="protein motif:PFAM:PF04402"
FT                   /protein_id="ACK45078.1"
FT                   QVSIEDRVEVIYKLK"
FT   sig_peptide     626450..626530
FT                   /locus_tag="Sbal223_0544"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 27"
FT   gene            627370..628143
FT                   /locus_tag="Sbal223_0545"
FT   CDS_pept        627370..628143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0545"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: spc:Sputcn32_0601
FT                   diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45079"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H2"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACK45079.1"
FT   gene            628423..628884
FT                   /locus_tag="Sbal223_0546"
FT   CDS_pept        628423..628884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0546"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sdn:Sden_1944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45080"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H3"
FT                   /inference="similar to AA sequence:KEGG:Sden_1944"
FT                   /protein_id="ACK45080.1"
FT   sig_peptide     628423..628494
FT                   /locus_tag="Sbal223_0546"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 24"
FT   gene            629139..629996
FT                   /locus_tag="Sbal223_0547"
FT   CDS_pept        629139..629996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0547"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: shw:Sputw3181_3570 methyltransferase type
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45081"
FT                   /db_xref="GOA:B8E8H4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H4"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACK45081.1"
FT                   CVKI"
FT   mobile_element  630328..631544
FT                   /mobile_element_type="insertion sequence:ISSba2_5"
FT   gene            630415..631524
FT                   /locus_tag="Sbal223_0548"
FT   CDS_pept        630415..631524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0548"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   asa:ASA_P4G164 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45082"
FT                   /db_xref="GOA:B8E3L4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:B8E3L4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK45082.1"
FT   gene            631790..632524
FT                   /locus_tag="Sbal223_0549"
FT   CDS_pept        631790..632524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0549"
FT                   /product="nicotinamide mononucleotide transporter PnuC"
FT                   /note="TIGRFAM: nicotinamide mononucleotide transporter
FT                   PnuC; PFAM: Nicotinamide mononucleotide transporter PnuC;
FT                   KEGG: ppr:PBPRA1430 putative nicotinamide mononucleotide
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45083"
FT                   /db_xref="GOA:B8E8H6"
FT                   /db_xref="InterPro:IPR006419"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H6"
FT                   /inference="protein motif:TFAM:TIGR01528"
FT                   /protein_id="ACK45083.1"
FT   gene            632521..633255
FT                   /locus_tag="Sbal223_0550"
FT   CDS_pept        632521..633255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0550"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   vvy:VVA0211 uridine phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45084"
FT                   /db_xref="GOA:B8E8H7"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR018016"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H7"
FT                   /inference="protein motif:PFAM:PF01048"
FT                   /protein_id="ACK45084.1"
FT   gene            633382..634074
FT                   /locus_tag="Sbal223_0551"
FT   CDS_pept        633382..634074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0551"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: vpa:VPA0656
FT                   putative cyclic nucleotide binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45085"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H8"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACK45085.1"
FT                   DDSSHNDL"
FT   gene            634523..635218
FT                   /locus_tag="Sbal223_0552"
FT   CDS_pept        634523..635218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: saz:Sama_1558 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45086"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8H9"
FT                   /inference="similar to AA sequence:KEGG:Sama_1558"
FT                   /protein_id="ACK45086.1"
FT                   SFSWVNREG"
FT   gene            635680..636258
FT                   /locus_tag="Sbal223_0553"
FT   CDS_pept        635680..636258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0553"
FT                   /product="OmpA domain protein transmembrane
FT                   region-containing protein"
FT                   /note="PFAM: OmpA domain protein transmembrane
FT                   region-containing protein; KEGG: shw:Sputw3181_3568 OmpA
FT                   domain protein transmembrane region-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45087"
FT                   /db_xref="GOA:B8E8I0"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="InterPro:IPR027385"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I0"
FT                   /inference="protein motif:PFAM:PF01389"
FT                   /protein_id="ACK45087.1"
FT   sig_peptide     635680..635751
FT                   /locus_tag="Sbal223_0553"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.935 at
FT                   residue 24"
FT   gene            637580..637852
FT                   /locus_tag="Sbal223_0554"
FT   CDS_pept        637580..637852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0554"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psb:Psyr_3719 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45088"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I1"
FT                   /inference="similar to AA sequence:KEGG:Psyr_3719"
FT                   /protein_id="ACK45088.1"
FT   repeat_region   637949..638049
FT                   /note="MITE_102"
FT   gene            complement(638145..639248)
FT                   /locus_tag="Sbal223_0555"
FT   CDS_pept        complement(638145..639248)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0555"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /EC_number=""
FT                   /note="KEGG: spc:Sputcn32_0608
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   TIGRFAM: phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase; PFAM: SAICAR synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45089"
FT                   /db_xref="GOA:B8E8I2"
FT                   /db_xref="InterPro:IPR014106"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8E8I2"
FT                   /inference="protein motif:TFAM:TIGR02735"
FT                   /protein_id="ACK45089.1"
FT   gene            complement(639235..639663)
FT                   /locus_tag="Sbal223_0556"
FT   CDS_pept        complement(639235..639663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0556"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: spc:Sputcn32_0609 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45090"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I3"
FT                   /inference="similar to AA sequence:KEGG:Sputcn32_0609"
FT                   /protein_id="ACK45090.1"
FT   gene            639889..640368
FT                   /locus_tag="Sbal223_0557"
FT   CDS_pept        639889..640368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0557"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: smd:Smed_0005 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45091"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I4"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACK45091.1"
FT   gene            640465..641127
FT                   /locus_tag="Sbal223_0558"
FT   CDS_pept        640465..641127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0558"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   shw:Sputw3181_3561 pentapeptide repeat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45092"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I5"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACK45092.1"
FT   gene            641571..643853
FT                   /locus_tag="Sbal223_0559"
FT   CDS_pept        641571..643853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0559"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: son:SO_4062 polysulfide reductase,
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45093"
FT                   /db_xref="GOA:B8E8I6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I6"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACK45093.1"
FT                   GVTLAKR"
FT   sig_peptide     641571..641669
FT                   /locus_tag="Sbal223_0559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.673 at
FT                   residue 33"
FT   gene            643866..644432
FT                   /locus_tag="Sbal223_0560"
FT   CDS_pept        643866..644432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0560"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: shw:Sputw3181_3558 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45094"
FT                   /db_xref="GOA:B8E8I7"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK45094.1"
FT   gene            644435..645382
FT                   /locus_tag="Sbal223_0561"
FT   CDS_pept        644435..645382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0561"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   shw:Sputw3181_3557 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45095"
FT                   /db_xref="GOA:B8E8I8"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I8"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACK45095.1"
FT   gene            complement(645488..646231)
FT                   /locus_tag="Sbal223_0562"
FT   CDS_pept        complement(645488..646231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0562"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   shw:Sputw3181_3556 protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45096"
FT                   /db_xref="GOA:B8E8I9"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8I9"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACK45096.1"
FT   sig_peptide     complement(646124..646231)
FT                   /locus_tag="Sbal223_0562"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.949) with cleavage site probability 0.658 at
FT                   residue 36"
FT   gene            complement(646313..646627)
FT                   /locus_tag="Sbal223_0563"
FT   CDS_pept        complement(646313..646627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0563"
FT                   /product="methionine repressor, MetJ"
FT                   /note="PFAM: Methionine repressor MetJ; KEGG:
FT                   shw:Sputw3181_3555 transcriptional repressor protein MetJ"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45097"
FT                   /db_xref="GOA:B8E8J0"
FT                   /db_xref="InterPro:IPR002084"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR023453"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8J0"
FT                   /inference="protein motif:PFAM:PF01340"
FT                   /protein_id="ACK45097.1"
FT                   "
FT   gene            646840..648003
FT                   /locus_tag="Sbal223_0564"
FT   CDS_pept        646840..648003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0564"
FT                   /product="O-succinylhomoserine (thiol)-lyase"
FT                   /EC_number=""
FT                   /note="KEGG: spc:Sputcn32_0616 O-succinylhomoserine
FT                   (thiol)-lyase; TIGRFAM: O-succinylhomoserine (thiol)-lyase;
FT                   PFAM: Cys/Met metabolism pyridoxal-phosphate-dependent
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45098"
FT                   /db_xref="GOA:B8E8J1"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR011821"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8J1"
FT                   /inference="protein motif:TFAM:TIGR02080"
FT                   /protein_id="ACK45098.1"
FT   gene            648015..650408
FT                   /locus_tag="Sbal223_0565"
FT   CDS_pept        648015..650408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Sbal223_0565"
FT                   /product="aspartate kinase"
FT                   /EC_number=""
FT                   /EC_number=""
FT                   /note="KEGG: shw:Sputw3181_3553 bifunctional aspartate
FT                   kinase II/homoserine dehydrogenase II; TIGRFAM: aspartate
FT                   kinase; PFAM: aspartate/glutamate/uridylate kinase;
FT                   homoserine dehydrogenase; homoserine dehydrogenase
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Sbal223_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACK45099"
FT                   /db_xref="GOA:B8E8J2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR011147"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B8E8J2"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACK45099.1"