(data stored in ACNUC30630 zone)

EMBL: CP001275

ID   CP001275; SV 1; circular; genomic DNA; STD; PRO; 2003006 BP.
XX
AC   CP001275;
XX
PR   Project:PRJNA32569;
XX
DT   26-JAN-2009 (Rel. 99, Created)
DT   09-JAN-2015 (Rel. 123, Last updated, Version 6)
XX
DE   Thermomicrobium roseum DSM 5159, complete genome.
XX
KW   .
XX
OS   Thermomicrobium roseum DSM 5159
OC   Bacteria; Chloroflexi; Thermomicrobiales; Thermomicrobiaceae;
OC   Thermomicrobium.
XX
RN   [1]
RP   1-2003006
RX   DOI; 10.1371/journal.pone.0004207.
RX   PUBMED; 19148287.
RA   Wu D., Raymond J., Wu M., Chatterji S., Ren Q., Graham J.E., Bryant D.A.,
RA   Robb F., Colman A., Tallon L.J., Badger J.H., Madupu R., Ward N.L.,
RA   Eisen J.A.;
RT   "Complete genome sequence of the aerobic CO-oxidizing thermophile
RT   Thermomicrobium roseum";
RL   PLoS One 4(1):E4207-E4207(2009).
XX
RN   [2]
RP   1-2003006
RA   Eisen J., Wu D., Raymond J., Wu M., Chatterji S., Ren Q., Graham J.,
RA   Bryant D., Robb F., Colman A., Tallon L., Badger J., Madupu R., Ward N.;
RT   ;
RL   Submitted (04-DEC-2008) to the INSDC.
RL   J. Craig Venter Institute, 9704 Medical Center Drive, Rockville, MD 20850,
RL   USA
XX
DR   MD5; c23c458d84479ed6a1ce50f967147ccd.
DR   BioSample; SAMN02603430.
DR   CABRI; DSM 5159.
DR   EnsemblGenomes-Gn; EBG00001102318.
DR   EnsemblGenomes-Gn; EBG00001102319.
DR   EnsemblGenomes-Gn; EBG00001102320.
DR   EnsemblGenomes-Gn; EBG00001102321.
DR   EnsemblGenomes-Gn; EBG00001102322.
DR   EnsemblGenomes-Gn; EBG00001102323.
DR   EnsemblGenomes-Gn; EBG00001102324.
DR   EnsemblGenomes-Gn; EBG00001102325.
DR   EnsemblGenomes-Gn; EBG00001102326.
DR   EnsemblGenomes-Gn; EBG00001102327.
DR   EnsemblGenomes-Gn; EBG00001102328.
DR   EnsemblGenomes-Gn; EBG00001102329.
DR   EnsemblGenomes-Gn; EBG00001102330.
DR   EnsemblGenomes-Gn; EBG00001102331.
DR   EnsemblGenomes-Gn; EBG00001102332.
DR   EnsemblGenomes-Gn; EBG00001102333.
DR   EnsemblGenomes-Gn; EBG00001102334.
DR   EnsemblGenomes-Gn; EBG00001102335.
DR   EnsemblGenomes-Gn; EBG00001102336.
DR   EnsemblGenomes-Gn; EBG00001102337.
DR   EnsemblGenomes-Gn; EBG00001102338.
DR   EnsemblGenomes-Gn; EBG00001102339.
DR   EnsemblGenomes-Gn; EBG00001102340.
DR   EnsemblGenomes-Gn; EBG00001102341.
DR   EnsemblGenomes-Gn; EBG00001102342.
DR   EnsemblGenomes-Gn; EBG00001102343.
DR   EnsemblGenomes-Gn; EBG00001102344.
DR   EnsemblGenomes-Gn; EBG00001102345.
DR   EnsemblGenomes-Gn; EBG00001102346.
DR   EnsemblGenomes-Gn; EBG00001102347.
DR   EnsemblGenomes-Gn; EBG00001102348.
DR   EnsemblGenomes-Gn; EBG00001102349.
DR   EnsemblGenomes-Gn; EBG00001102351.
DR   EnsemblGenomes-Gn; EBG00001102352.
DR   EnsemblGenomes-Gn; EBG00001102353.
DR   EnsemblGenomes-Gn; EBG00001102354.
DR   EnsemblGenomes-Gn; EBG00001102355.
DR   EnsemblGenomes-Gn; EBG00001102356.
DR   EnsemblGenomes-Gn; EBG00001102357.
DR   EnsemblGenomes-Gn; EBG00001102358.
DR   EnsemblGenomes-Gn; EBG00001102359.
DR   EnsemblGenomes-Gn; EBG00001102360.
DR   EnsemblGenomes-Gn; EBG00001102361.
DR   EnsemblGenomes-Gn; EBG00001102362.
DR   EnsemblGenomes-Gn; EBG00001102363.
DR   EnsemblGenomes-Gn; EBG00001102364.
DR   EnsemblGenomes-Gn; EBG00001102365.
DR   EnsemblGenomes-Gn; EBG00001102366.
DR   EnsemblGenomes-Gn; EBG00001102367.
DR   EnsemblGenomes-Gn; EBG00001102368.
DR   EnsemblGenomes-Gn; EBG00001102369.
DR   EnsemblGenomes-Gn; EBG00001102370.
DR   EnsemblGenomes-Gn; EBG00001102371.
DR   EnsemblGenomes-Gn; EBG00001102372.
DR   EnsemblGenomes-Gn; EBG00001102373.
DR   EnsemblGenomes-Gn; trd_0126.
DR   EnsemblGenomes-Gn; trd_0239.
DR   EnsemblGenomes-Gn; trd_0290.
DR   EnsemblGenomes-Gn; trd_0291.
DR   EnsemblGenomes-Gn; trd_0296.
DR   EnsemblGenomes-Gn; trd_0345.
DR   EnsemblGenomes-Gn; trd_0419.
DR   EnsemblGenomes-Gn; trd_0420.
DR   EnsemblGenomes-Gn; trd_0586.
DR   EnsemblGenomes-Gn; trd_0587.
DR   EnsemblGenomes-Gn; trd_0610.
DR   EnsemblGenomes-Gn; trd_0611.
DR   EnsemblGenomes-Gn; trd_0612.
DR   EnsemblGenomes-Gn; trd_0674.
DR   EnsemblGenomes-Gn; trd_0675.
DR   EnsemblGenomes-Gn; trd_0678.
DR   EnsemblGenomes-Gn; trd_0685.
DR   EnsemblGenomes-Gn; trd_0721.
DR   EnsemblGenomes-Gn; trd_0722.
DR   EnsemblGenomes-Gn; trd_0765.
DR   EnsemblGenomes-Gn; trd_0766.
DR   EnsemblGenomes-Gn; trd_0795.
DR   EnsemblGenomes-Gn; trd_0856.
DR   EnsemblGenomes-Gn; trd_0857.
DR   EnsemblGenomes-Gn; trd_0858.
DR   EnsemblGenomes-Gn; trd_0860.
DR   EnsemblGenomes-Gn; trd_0872.
DR   EnsemblGenomes-Gn; trd_0897.
DR   EnsemblGenomes-Gn; trd_0908.
DR   EnsemblGenomes-Gn; trd_0933.
DR   EnsemblGenomes-Gn; trd_0938.
DR   EnsemblGenomes-Gn; trd_0941.
DR   EnsemblGenomes-Gn; trd_0993.
DR   EnsemblGenomes-Gn; trd_1016.
DR   EnsemblGenomes-Gn; trd_1017.
DR   EnsemblGenomes-Gn; trd_1018.
DR   EnsemblGenomes-Gn; trd_1019.
DR   EnsemblGenomes-Gn; trd_1020.
DR   EnsemblGenomes-Gn; trd_1066.
DR   EnsemblGenomes-Gn; trd_1189.
DR   EnsemblGenomes-Gn; trd_1242.
DR   EnsemblGenomes-Gn; trd_1287.
DR   EnsemblGenomes-Gn; trd_1293.
DR   EnsemblGenomes-Gn; trd_1431.
DR   EnsemblGenomes-Gn; trd_1555.
DR   EnsemblGenomes-Gn; trd_1652.
DR   EnsemblGenomes-Gn; trd_1653.
DR   EnsemblGenomes-Gn; trd_1706.
DR   EnsemblGenomes-Tr; EBT00001694760.
DR   EnsemblGenomes-Tr; EBT00001694762.
DR   EnsemblGenomes-Tr; EBT00001694764.
DR   EnsemblGenomes-Tr; EBT00001694767.
DR   EnsemblGenomes-Tr; EBT00001694769.
DR   EnsemblGenomes-Tr; EBT00001694771.
DR   EnsemblGenomes-Tr; EBT00001694773.
DR   EnsemblGenomes-Tr; EBT00001694775.
DR   EnsemblGenomes-Tr; EBT00001694777.
DR   EnsemblGenomes-Tr; EBT00001694779.
DR   EnsemblGenomes-Tr; EBT00001694781.
DR   EnsemblGenomes-Tr; EBT00001694784.
DR   EnsemblGenomes-Tr; EBT00001694785.
DR   EnsemblGenomes-Tr; EBT00001694788.
DR   EnsemblGenomes-Tr; EBT00001694790.
DR   EnsemblGenomes-Tr; EBT00001694793.
DR   EnsemblGenomes-Tr; EBT00001694795.
DR   EnsemblGenomes-Tr; EBT00001694797.
DR   EnsemblGenomes-Tr; EBT00001694800.
DR   EnsemblGenomes-Tr; EBT00001694802.
DR   EnsemblGenomes-Tr; EBT00001694804.
DR   EnsemblGenomes-Tr; EBT00001694807.
DR   EnsemblGenomes-Tr; EBT00001694809.
DR   EnsemblGenomes-Tr; EBT00001694811.
DR   EnsemblGenomes-Tr; EBT00001694813.
DR   EnsemblGenomes-Tr; EBT00001694817.
DR   EnsemblGenomes-Tr; EBT00001694819.
DR   EnsemblGenomes-Tr; EBT00001694821.
DR   EnsemblGenomes-Tr; EBT00001694823.
DR   EnsemblGenomes-Tr; EBT00001694825.
DR   EnsemblGenomes-Tr; EBT00001694827.
DR   EnsemblGenomes-Tr; EBT00001694829.
DR   EnsemblGenomes-Tr; EBT00001694831.
DR   EnsemblGenomes-Tr; EBT00001694834.
DR   EnsemblGenomes-Tr; EBT00001694836.
DR   EnsemblGenomes-Tr; EBT00001694839.
DR   EnsemblGenomes-Tr; EBT00001694841.
DR   EnsemblGenomes-Tr; EBT00001694843.
DR   EnsemblGenomes-Tr; EBT00001694846.
DR   EnsemblGenomes-Tr; EBT00001694848.
DR   EnsemblGenomes-Tr; EBT00001694851.
DR   EnsemblGenomes-Tr; EBT00001694853.
DR   EnsemblGenomes-Tr; EBT00001694855.
DR   EnsemblGenomes-Tr; EBT00001694857.
DR   EnsemblGenomes-Tr; EBT00001694860.
DR   EnsemblGenomes-Tr; EBT00001694862.
DR   EnsemblGenomes-Tr; EBT00001694864.
DR   EnsemblGenomes-Tr; EBT00001694867.
DR   EnsemblGenomes-Tr; EBT00001694869.
DR   EnsemblGenomes-Tr; EBT00001694871.
DR   EnsemblGenomes-Tr; EBT00001694873.
DR   EnsemblGenomes-Tr; EBT00001694875.
DR   EnsemblGenomes-Tr; EBT00001694878.
DR   EnsemblGenomes-Tr; EBT00001694880.
DR   EnsemblGenomes-Tr; EBT00001694882.
DR   EnsemblGenomes-Tr; trd_0126-1.
DR   EnsemblGenomes-Tr; trd_0239-1.
DR   EnsemblGenomes-Tr; trd_0290-1.
DR   EnsemblGenomes-Tr; trd_0291-1.
DR   EnsemblGenomes-Tr; trd_0296-1.
DR   EnsemblGenomes-Tr; trd_0345-1.
DR   EnsemblGenomes-Tr; trd_0419-1.
DR   EnsemblGenomes-Tr; trd_0420-1.
DR   EnsemblGenomes-Tr; trd_0586-1.
DR   EnsemblGenomes-Tr; trd_0587-1.
DR   EnsemblGenomes-Tr; trd_0610-1.
DR   EnsemblGenomes-Tr; trd_0611-1.
DR   EnsemblGenomes-Tr; trd_0612-1.
DR   EnsemblGenomes-Tr; trd_0674-1.
DR   EnsemblGenomes-Tr; trd_0675-1.
DR   EnsemblGenomes-Tr; trd_0678-1.
DR   EnsemblGenomes-Tr; trd_0685-1.
DR   EnsemblGenomes-Tr; trd_0721-1.
DR   EnsemblGenomes-Tr; trd_0722-1.
DR   EnsemblGenomes-Tr; trd_0765-1.
DR   EnsemblGenomes-Tr; trd_0766-1.
DR   EnsemblGenomes-Tr; trd_0795-1.
DR   EnsemblGenomes-Tr; trd_0856-1.
DR   EnsemblGenomes-Tr; trd_0857-1.
DR   EnsemblGenomes-Tr; trd_0858-1.
DR   EnsemblGenomes-Tr; trd_0860-1.
DR   EnsemblGenomes-Tr; trd_0872-1.
DR   EnsemblGenomes-Tr; trd_0897-1.
DR   EnsemblGenomes-Tr; trd_0908-1.
DR   EnsemblGenomes-Tr; trd_0933-1.
DR   EnsemblGenomes-Tr; trd_0938-1.
DR   EnsemblGenomes-Tr; trd_0941-1.
DR   EnsemblGenomes-Tr; trd_0993-1.
DR   EnsemblGenomes-Tr; trd_1016-1.
DR   EnsemblGenomes-Tr; trd_1017-1.
DR   EnsemblGenomes-Tr; trd_1018-1.
DR   EnsemblGenomes-Tr; trd_1019-1.
DR   EnsemblGenomes-Tr; trd_1020-1.
DR   EnsemblGenomes-Tr; trd_1066-1.
DR   EnsemblGenomes-Tr; trd_1189-1.
DR   EnsemblGenomes-Tr; trd_1242-1.
DR   EnsemblGenomes-Tr; trd_1287-1.
DR   EnsemblGenomes-Tr; trd_1293-1.
DR   EnsemblGenomes-Tr; trd_1431-1.
DR   EnsemblGenomes-Tr; trd_1555-1.
DR   EnsemblGenomes-Tr; trd_1652-1.
DR   EnsemblGenomes-Tr; trd_1653-1.
DR   EnsemblGenomes-Tr; trd_1706-1.
DR   EuropePMC; PMC2615216; 19148287.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00234; glmS.
DR   RFAM; RF01734; crcB.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001275.
DR   SILVA-SSU; CP001275.
DR   StrainInfo; 159077; 1.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2003006
FT                   /organism="Thermomicrobium roseum DSM 5159"
FT                   /strain="DSM 5159"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:309801"
FT                   /culture_collection="DSM:5159"
FT   gene            102..1154
FT                   /locus_tag="trd_0002"
FT   CDS_pept        102..1154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0002"
FT                   /product="DNA polymerase III tau and gamma subunits"
FT                   /note="identified by match to protein family HMM TIGR00678"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06107"
FT                   /db_xref="GOA:B9L1A1"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A1"
FT                   /protein_id="ACM06107.1"
FT                   /translation="MNATNDLSPSRATPGWPIIGHEGAVRTLARAIESGQVHHAYLLAG
FT                   PAGIGRTTLAFVFAQALLCEGAAEQRPCGTCRSCQRIARRVHPDVTRIGLDTGAEEAKQ
FT                   VSIDQVRELRASLSLRPLEGAWRVAIVDDAERLSREAADALLKTLEEPPPYAVLVLVAE
FT                   DAQALPETIRSRCQTIVLQPLPISVVARALEVRGAAPELANRLARETRGRIALAFRLVS
FT                   DEAARVQREKRVAEVIAAMTEPLAAIGFARRLAEQYRRGRRAEVLSSLQLALELWRDAL
FT                   WLAADPSAPIVHEDARTTLERFARRCGIAGACAGLSATLQALADLEANVQARLALDAAM
FT                   VTWAEVSRCA"
FT   gene            1145..1801
FT                   /locus_tag="trd_0004"
FT   CDS_pept        1145..1801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0004"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05497"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A2"
FT                   /protein_id="ACM05497.1"
FT                   /translation="MRIAVRRVGSARLEIATVADAVPWVAVPGPLGEEAAAFAGDETAL
FT                   LGWEDETLLPARPLGADETARLAVLIADASVLAGQLAGLLPWRLVGLRPTLAGGLVIEV
FT                   IASPVDELSEREAELARLLSRPIALVSVGERALTGSTGRPALPIDLEEAAVKRLLAGAP
FT                   ARPGGFPRIGSPVRSPHGSGVVWSVRTRDRTVLVRVGDETVRVPLAELVTDEPGS"
FT   gene            complement(1796..4120)
FT                   /locus_tag="trd_0003"
FT   CDS_pept        complement(1796..4120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0003"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05015"
FT                   /db_xref="GOA:B9L1A3"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A3"
FT                   /protein_id="ACM05015.1"
FT                   /translation="MAHVVERSARSAWASPSPYVALQYPIGNGAVERRAFAIVLDPIDP
FT                   LPSSPEVARRIITLLQHAVWQLGEHPAVEDLCEALTEAFLRANHWLTTLNSGRPSRQWH
FT                   RFGATCALLSGHDLVLAQVPPGCALVAQDGELYRFPSEDHAASRYATALGNARQIQPAL
FT                   YYTRSAPGDVMLLTNAEYGARLLAAYADSLPGASPARLAELLEELAVDAGDTEPVPAVA
FT                   LRVPEPIRLTRQPVRRLSELLRLLLPEDGNQDSCTARRVDERDIDGTLPDRQTKEARAE
FT                   RPDERADTDAEPVDAIEDQITGAPGWHAQPLDAVAEETEPPRVAKRGGGRPLFELIAGL
FT                   AIATVTGLAGIWQLLRRRRRPLLPQDEGTFGLPRLERHEDRIRLPDFTPVRRQLPRLPA
FT                   SRLTGLIALGLIGALTTTLVVSVQNGRVSERKQEFAHLYQSAVAERQLAEQATDPTIAR
FT                   AYLATASQRLERAASLGLQPELLAQERAAIERTLDRLLHVERLSATTVQVLGAVPSAPA
FT                   GIAPRLFFGNGQLYLLTDALYRLDAGGTRLVRLIGPGDTVDGRTVGTLVGAAWADGAPI
FT                   AFDGNAAYLFDPAAARWSAQPVGTFGAPYQNVAAVGSFAGNLYLLVPQSGQILRFLNGA
FT                   YANLPQDWTGGLADKELRQATDFEIDGRIHVLLADGRILTFYRGALETTVTPAVEPPVT
FT                   DAVALAMQPDRPYRYVGTRSGRILRLKADGTLVQQFISGAGVPSLDGLLDLAVDDVQGL
FT                   AYVLTERGLFLVRLPVPPPGS"
FT   gene            complement(4299..6422)
FT                   /locus_tag="trd_0005"
FT   CDS_pept        complement(4299..6422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0005"
FT                   /product="Tetratricopeptide repeat family"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00515; match to protein family HMM PF07719; match to
FT                   protein family HMM PF07721"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04889"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041617"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A4"
FT                   /protein_id="ACM04889.1"
FT                   /translation="MSVFEQFGRWLRRRQGIERNPLYRIAADVVQGRLTLEQAYALAEQ
FT                   PATVARLADGDLWEVLDEATRARLDYPEHALLLNRLVILAARQKGFDRVLMEANLRAAD
FT                   ILADLAIESGEPNPTYQREQELHLQEALRAARRIANATGQRRALARLARLARDRGEHER
FT                   ARELLLRQLESGREDTDTIEDVDTALLLGDLARQEANLAAAREFYSRAARSARRIGHNV
FT                   GMVDALLRQVSILRELGDLDAAYPLLQQAQEAAERLLDRRLQAEIAIQIGALLAEQRRF
FT                   SKARAALLTALERARAADDLALESRCLIGLAQLERQAGRFRDAADHLNQLAHLELRIGN
FT                   QRAGIRALLDAAELALEGDQPERALQLLQLAQQQHETNEDTALRQRLLGLSGLAHAALD
FT                   HRGEALEYLYQAFRLASSTGSTAEQARWLIGTGEVLLQFGELADALLVAKHAADLVRAS
FT                   DDSRLEAQLAVLQGSIAMARGLRQEAMERLSEAVEAAERAHDFVTQERALLLLAELELQ
FT                   EADPHHAIGYLRQALDLARATGNDELRTRLHGRIARLYQSLHYFREAEEHYRAAAQLAQ
FT                   EIDSLPLQARALRGLATVLDASGRADEALATYKQAIALAEQLGDRRAALALHYNAALLL
FT                   LDRGNDGEARYHLRLAHDLALALGETQLAQNLRDLLGLQPAEPSFPDELSDELVSESPL
FT                   NPPRRETSPYDFL"
FT   gene            complement(6419..7444)
FT                   /locus_tag="trd_0006"
FT   CDS_pept        complement(6419..7444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0006"
FT                   /product="threonine ammonia-lyase, biosynthetic"
FT                   /note="identified by match to protein family HMM PF00291"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05310"
FT                   /db_xref="GOA:B9L1A5"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A5"
FT                   /protein_id="ACM05310.1"
FT                   /translation="MGGTDRRHQLEPPTFHDILRARAVVQRYLPPTPLLHSPLLSERLG
FT                   CQVYLKCEQLQPIGAFKVRGGIYLMSKLSPEERARGVVTASTGNHGQSIAYAARLFGVR
FT                   AIIYAPEGANPLKVAAMRRLGAEVVLTGRDFDEARLACEARAAADGLRYIHSANEPDLI
FT                   AGVGTYALEILESVPDLDAIIVPIGAGSGVCGTGIVMKTVDPAIQVIGVQAAGMPVVYE
FT                   SWRKGQLLELADGYTFAEGIATRVAFELPLRIIRERVDDIVLVSDEEIARAMIELLETR
FT                   IVAEGAGAAALAAAHRIRDRLAGKTVVLVVSGGNVTLETLRWAWELAGAAASEQATEVG
FT                   R"
FT   gene            7397..7546
FT                   /locus_tag="trd_0007"
FT   CDS_pept        7397..7546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0007"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04694"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A6"
FT                   /protein_id="ACM04694.1"
FT                   /translation="MECRWLQLVTSICAPHRSVLRRSRSCPHARSSLRRAARLVHHPAD
FT                   PARG"
FT   gene            complement(7673..7795)
FT                   /locus_tag="trd_0008"
FT   CDS_pept        complement(7673..7795)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0008"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05143"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A7"
FT                   /protein_id="ACM05143.1"
FT                   /translation="MIRAFSTVLGAALKRARTMTRRCVQLSSSDELSGDCAGRG"
FT   gene            complement(8491..11175)
FT                   /locus_tag="trd_0009"
FT   CDS_pept        complement(8491..11175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0009"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06006"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1A8"
FT                   /protein_id="ACM06006.1"
FT                   /translation="MHETGLRLATLLESVFPPRIARWIAAPAQRTPLDAALPAIWWRSQ
FT                   VCSLVLRLSPPHRRGDRAGLLYALHLAGASTARLAVVTGAEESRISDALLAVRAQLSDH
FT                   WSDPCPEGREGVASWRDRLADRDAWLALLLHTRTCSACRTALATSREVDEQVLERASTV
FT                   PVPPAPRQRRHPSIVVLVALALLLVFASWRLPGNRALGPPGETAAPSASGPYVWFGSAG
FT                   PYALAFDLGQRRWLAVTSRLPADAGGFRLLGPDGQLIAAWTPDPPREPRWLDILRWDGT
FT                   RLARYRWDRQTNRRPLAWLDATTLLIRETPVRHAYEREAEYLERLQRDARVLALDVLQG
FT                   TETTLLRELVTDAIPSPDGRSVAVVRAMEPFGAGATSRQIAIVERSGTRVLAVADGYVG
FT                   AGLDHPLWLPDSSALLFARRPPGTPPQLPTPTELVRFTLEGKTAIVVPSSPGTVLRPLA
FT                   LDEQRLFYLALPAGHAEPGELWELDLATSVRRRLGQLDRLNGFLTILPQPDSPLLVAVR
FT                   TLPASPPLRPESEVTELYRIGEDAPELIAAVPGRWGFDAWGQPLAVVTTTAPSAAASPL
FT                   VPPTGPLGAGPLALAPGRNWLLAPVPDGRVAIWDATSGIQLTEPWPFRKPHWHPAGLAF
FT                   VALGELGELQLVARSPDGFWQAVPLALDAPRGDTLDLTVGPDGRLALLTRTDGGELALW
FT                   AGFPPQALELARWRGPELVGTPCMAWLRTGTLLVAAPLVGGQLLLTSITIEERGRVAVR
FT                   TLARLRTDRGPAVETCTLALEPSGGALALRAGSRERERIVLLWLAEPDSPLILAEGRAS
FT                   RGLAWSPDGALLAGPLDGALVVHGRNGREVLNQRAAGLADLVWVDTRELWVLERSEAGS
FT                   AIHRVAIIDLSEAPTRAARPSAG"
FT   gene            11231..12076
FT                   /gene="pyrF"
FT                   /locus_tag="trd_0010"
FT   CDS_pept        11231..12076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrF"
FT                   /locus_tag="trd_0010"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="identified by match to protein family HMM PF00215;
FT                   match to protein family HMM TIGR02127"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05119"
FT                   /db_xref="GOA:B9L1A9"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR011995"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L1A9"
FT                   /protein_id="ACM05119.1"
FT                   /translation="MSFRERLEQTIAQNHSLLCIGLDPDLERFPTGIPRDPEGIVVFNR
FT                   AIIEATADLVCAYKPNLAFYLQYGAAGIAALATTRQLIPPHIPVILDAKLGDIASTSAA
FT                   YARAVFETLGFDALTVHPYLGSEALEPFLSTSDRGVFVLVRTSNPGASEIQDLPVGEAG
FT                   EPLYLWLAERARAWNQRSGNVGLVVGATYPVDLALVRQRCPDLPILAPGIGAQGGDLER
FT                   AVCAGLTEATAPLLVTVSRSILYADASARFAESARAAARRVRDTIERIRKEVAGQAGHR
FT                   "
FT   gene            complement(12112..12651)
FT                   /locus_tag="trd_0011"
FT   CDS_pept        complement(12112..12651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0011"
FT                   /product="protease I"
FT                   /EC_number="3.2.-.-"
FT                   /note="identified by match to protein family HMM PF01965;
FT                   match to protein family HMM TIGR01382"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05946"
FT                   /db_xref="GOA:B9L1B0"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B0"
FT                   /protein_id="ACM05946.1"
FT                   /translation="MAELAGKRVAMLLAKDFEDSEATDPKQYLETRGAEVVIVGLDRQP
FT                   ITGKKGTVLQPDKTIDEVTVEEFDALVIPGGGSPENLRIDDRAVAFTRAFVESGKPVAA
FT                   ICHGPQLLISADVLRGRTVTCVKKIRDDVKNAGAIYVDEAVVIDGNLITSRVPADLPFF
FT                   DQAIAEALARVPARGD"
FT   gene            complement(12729..13541)
FT                   /locus_tag="trd_0012"
FT   CDS_pept        complement(12729..13541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0012"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05845"
FT                   /db_xref="GOA:B9L1B1"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B1"
FT                   /protein_id="ACM05845.1"
FT                   /translation="MSWPMVRKAVRDLRWTTFWYAFGMALFIFLMTSFYPTHERQQEQF
FT                   VELLQQYPEFLFRIFGIDPTQAALFATFAGFMHAQTFGFIWPVTGLLFVVLSGTAVVAQ
FT                   EIERGTADLWLSVPIPRAHLLVSKQVALLSGILVFVLTSEVALAAGAFVFGGDITARGL
FT                   VQLAVALTCFLIAFGGLATLASSLASERSKAAGIVGGLALLMYLLWVLAGLAEEARWLR
FT                   YFSLFTVYDPQAAMLGELPWHKPVIQLLVGLAAAVAAQIAFARRDIVA"
FT   gene            complement(13541..14467)
FT                   /locus_tag="trd_0013"
FT   CDS_pept        complement(13541..14467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0013"
FT                   /product="probable transport ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04742"
FT                   /db_xref="GOA:B9L1B2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B2"
FT                   /protein_id="ACM04742.1"
FT                   /translation="MANYPAIAVERLTRSYGARRGVIDLTFQVQPGEIFGFLGPNGAGK
FT                   TTTIRVLMGFLRPTSGSARIFGLDCWGDATQVKERVGYVPGDVRLWENMTGEQFLDFMA
FT                   AFRARIDPKRRQMLLERFRVELDRPIKQLSRGNRQKLALVQALLHDPPLLILDEPTSGL
FT                   DPLMKHEFLAFLVEERERGKTIFLSSHELAEVERVADRVGIIREGRLVAALPIEELRRR
FT                   RTRPMEVVFAQPIDPRQFADLPGVRVLAVENSGTRFQLGVQDNLPALLRRLSELPVIDL
FT                   TYAPPDLESVFLAYYQPEHARVGEEDL"
FT   gene            complement(14659..15312)
FT                   /locus_tag="trd_0014"
FT   CDS_pept        complement(14659..15312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0014"
FT                   /product="tRNA guanosine-2'-O-methyltransferase"
FT                   /EC_number="2.1.1.34"
FT                   /note="identified by match to protein family HMM PF00588"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04494"
FT                   /db_xref="GOA:B9L1B3"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="InterPro:IPR033671"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B3"
FT                   /protein_id="ACM04494.1"
FT                   /translation="MGRPITERRLARMREVLARRQPDLTVVLENVHDPHNVSAVLRSCD
FT                   AVGLLRVHLVYTLEEFPELSENVSGSALKWLELVFHPSIEACYRTLRSQGFTIYTTYLG
FT                   DPARSVDLYDLDLTKPVALVFGNEQRGVSDEAVAGADGNFVIPMMGMVRSLNISVACAV
FT                   SLYEALRQRRLAGHYARPKLSPIELEERLQRWLEREGRALPIELRTSDPSAASE"
FT   gene            15375..15758
FT                   /locus_tag="trd_0015"
FT   CDS_pept        15375..15758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0015"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05801"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B4"
FT                   /protein_id="ACM05801.1"
FT                   /translation="MAEHLRWVGAAVSVWHSCVRADRAHGARRPAATDLASLTSRTTAL
FT                   PDLDRWDVVARSTSAVASAWDRLAGRGAAPFSWWGDAVRRPEVARRGRPLEQTTAVPTI
FT                   PVTRWCVRGDCGSVRRAEGAGSS"
FT   gene            16735..17598
FT                   /gene="cas6"
FT                   /locus_tag="trd_0016"
FT   CDS_pept        16735..17598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas6"
FT                   /locus_tag="trd_0016"
FT                   /product="CRISPR-associated protein Cas6"
FT                   /note="identified by match to protein family HMM PF01881;
FT                   match to protein family HMM TIGR01877"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05283"
FT                   /db_xref="GOA:B9L1B5"
FT                   /db_xref="InterPro:IPR010156"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B5"
FT                   /protein_id="ACM05283.1"
FT                   /translation="MRLEVRLEPERSGVLPLGYREALQAMIYRHLPKEIGQPLHDGLYW
FT                   QAERPLKLFVFSQLHGAVRYRPGEGVEVSGPVWFRFASPDRQLALGLAAGLLQFGRARI
FT                   ANLEFAVREIATLALPSLGERVVVRTLSPITVYRTIAIDGRRRTQYYNPLNEEFAELVV
FT                   ANLLRKAHVLGWSVPGAGEDGSAEAVAEGAARAGESLAVGERPIRIRALGVNPRAKRLE
FT                   RYKGTWIEGWTGRFLLEGPADLLRLALEAGLGAKNSQGFGYVEEVDERSLSLLSRQEQT
FT                   REEGGA"
FT   gene            17595..19292
FT                   /locus_tag="trd_0017"
FT   CDS_pept        17595..19292
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0017"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05601"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B6"
FT                   /protein_id="ACM05601.1"
FT                   /translation="MSLHWTGQPFVDAGLAALLAASGASRLSDVTATHLDIAVRELERI
FT                   LLSDQALGIGLEKSFAKGTLSQVFPNSELVNPSNWSKGPEGVRAKYRTALKEDLARAKE
FT                   ALHAERGDRLCGICGELRPSAGFVMLRRDRFPLLSGAVNFYPGFLSGVALCGLCALALR
FT                   FSVASLLRVGERGRLWFLHCPSDIVAARIAQEYGWGHFRRLIAANQPLDFYGDWRTSGN
FT                   SGAILCLLCQLLRKFANQLRTIYQHGIPTVAYVFSNDNRGGYVEGIPVPTSILDFLQSL
FT                   YLESVDAFDQFERELLRVDTGRDKREEAQRARFVATIADRIVRAEPIVGASLVEQRLLG
FT                   GWIAHRTYLREVNGMNEAVLALLERTGIALAQHERGKKLIGRLERAPARDVRAVLLDLV
FT                   REGVLSGRELAALLPPNEPTSAQIVRDVLLAVVYEYQRCNEVGESFPRLVGGWAIPEPD
FT                   EVVRRLERIAADLIRTLPNRRQWIADLMTARKTAQIRATYLRALRSGAMSLVDFLFLVP
FT                   LGDVTQAWVLRDYLLAFLFELGREAVPTDIELVEGEEGATDEVSVLAE"
FT   gene            19365..20432
FT                   /gene="cst2"
FT                   /locus_tag="trd_0018"
FT   CDS_pept        19365..20432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cst2"
FT                   /locus_tag="trd_0018"
FT                   /product="CRISPR-associated regulatory protein, DevR
FT                   family"
FT                   /note="identified by match to protein family HMM TIGR01875;
FT                   match to protein family HMM TIGR02585"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05967"
FT                   /db_xref="InterPro:IPR010154"
FT                   /db_xref="InterPro:IPR013414"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B7"
FT                   /protein_id="ACM05967.1"
FT                   /translation="MAGRATYPVVTGTVLIEASGAALNNAGQDEGRRTDNAIVVKQLQI
FT                   GRLRYPYVSGQAWRRWWREVLYTDFGWTPSPVTREAKSAYTEGNPIDYAEDDLFGYMAA
FT                   RKRGKDSDTYRRVSPLRASLLVSVLPNVIVSDFGHFSRNLPPGSDIIPFESEVYSTYLQ
FT                   GVFSIVLSEVGRFAVGAMADISAELAQKNGSRLRKAAVNPNQAEIYELPVRDRVQRVCE
FT                   ALQALARLRGGARLARNLSDVTPVAVIVGFLDGGNAPFQNLFVSDPVNAEQVLLNLERF
FT                   RSVLSDYTDRFLKVNNDKAVLLGLRPTVLANENEVREVIARKERPFDRVELLDSPRRAL
FT                   ERAAELVEQAYASIG"
FT   gene            20455..21162
FT                   /gene="cas5t"
FT                   /locus_tag="trd_0019"
FT   CDS_pept        20455..21162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas5t"
FT                   /locus_tag="trd_0019"
FT                   /product="CRISPR-associated protein Cas5, Tneap subtype"
FT                   /note="identified by match to protein family HMM TIGR01895;
FT                   match to protein family HMM TIGR02593"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05122"
FT                   /db_xref="InterPro:IPR013422"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B8"
FT                   /protein_id="ACM05122.1"
FT                   /translation="MLDGAVRIRLTALTASFRAPSFVAYQLSLAVPPLATIFGLLSAAR
FT                   GHWVMPHEVPWLAYRLTYAARAMDLEAIYSVERKDAADTPRFKERNIVQREFLVSPELD
FT                   LFLPAEWRDPFLRPRYQLVLGRSQDLATVSSIGPASLEPVSTGPVTGVLLPAEVVARNG
FT                   VTAVLQNLPVAFTPDPERAPVRVTMFGLIDGKRSTRGLQFVTIEDGAGWLVRDRESGVV
FT                   VPLYRQEWILDGR"
FT   gene            21152..23473
FT                   /gene="cas3"
FT                   /locus_tag="trd_0020"
FT   CDS_pept        21152..23473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas3"
FT                   /locus_tag="trd_0020"
FT                   /product="CRISPR-associated helicase Cas3 domain protein"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM TIGR01587"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04933"
FT                   /db_xref="GOA:B9L1B9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006474"
FT                   /db_xref="InterPro:IPR006483"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035011"
FT                   /db_xref="InterPro:IPR038257"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1B9"
FT                   /protein_id="ACM04933.1"
FT                   /translation="MVGEPLAKSGDPPITLRQHTLEVLAYVEQVIPAYRALWSRVLDSR
FT                   SVDHLGRALPLAAAGHDLGKAALGFQRSLQERGFRWEFRHEVLSAALLLASGHATGDPG
FT                   QLAIAAVLTHHRDLTEERLWRDCGVPQLPRPQFLEKAQRQFRERAAELGPFWEWIVRFS
FT                   QEVEVLRTDQWPCSPHDLEPPAEFLRSLQERADRLHAFRSAEGLLLTLSRGWLLAADHA
FT                   ASAGIPRFVSTIPTEWRARHAERLAHSRAQGDGQLRAFQRALGEYEGSALLIAPTGAGK
FT                   TDAAIRWIARNRIGGERIFYILPYQASIEAMGQTLERLFGRETVGTLHARTLEVAFQRY
FT                   FSGDDYEEAYQAARQDAELNRLVHKPIKVTTPFQLIKWLFGLPRFEVGLAEMVGALVIF
FT                   DEIHAYDAHVTALILELVRVLRELGARCLFMSATFPDFLRQYIEDAYAQPLRLFRLDQP
FT                   PAHDTWAERFLAQARHRVEWTADPLEELVDLVVEAAQNGERVLVVANRVQQAQALYQRL
FT                   VECVPDGLQLLHARLMRRDRVAREQRILAALRGESPEPVRVLVATQVVEVSLDISFDRL
FT                   VTEVAPVDDLLQRFGRVNRYYEHNSPRPIVISRTYGDALYYVYDRERLERTLEEAPPHG
FT                   HALDAFDAEQWVERVYREGWTTNEGRRFEQALASFRAVIEGLRPLQHADMAYEDFYRLF
FT                   QGAEVLPSPFQEEYLRYQIEGKHLLAQQLLVPVPYGTFWKLHRAGRISQLKDGTLVASV
FT                   QYDPDLGLLPEVADLDAVIV"
FT   gene            23488..24075
FT                   /gene="cas4"
FT                   /locus_tag="trd_0021"
FT   CDS_pept        23488..24075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas4"
FT                   /locus_tag="trd_0021"
FT                   /product="CRISPR-associated protein Cas4"
FT                   /note="identified by match to protein family HMM PF01930;
FT                   match to protein family HMM TIGR00372"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05786"
FT                   /db_xref="GOA:B9L1C0"
FT                   /db_xref="InterPro:IPR011604"
FT                   /db_xref="InterPro:IPR013343"
FT                   /db_xref="InterPro:IPR022765"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C0"
FT                   /protein_id="ACM05786.1"
FT                   /translation="MDQIVTGTLMSYVGICDRKIWLAGHAIEGYRDHELLALGRLLAES
FT                   AYPRERKELALPGMKVDVLRRRPADADEDEALVIGEVKRSPRAQHAQRLQLGYYLLRLR
FT                   EAGLHVRGELRYPEQRRVEPVELTPELEQAVRSAIARVEELLAQPQPPPPVRIAACANC
FT                   AYFEFCWVSEEPATADSPRRRTRSAASADGKR"
FT   gene            24072..25061
FT                   /gene="cas1"
FT                   /locus_tag="trd_0022"
FT   CDS_pept        24072..25061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cas1"
FT                   /locus_tag="trd_0022"
FT                   /product="CRISPR-associated protein Cas1"
FT                   /note="identified by match to protein family HMM PF01867;
FT                   match to protein family HMM TIGR00287; match to protein
FT                   family HMM TIGR03641"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05097"
FT                   /db_xref="GOA:B9L1C1"
FT                   /db_xref="InterPro:IPR002729"
FT                   /db_xref="InterPro:IPR019858"
FT                   /db_xref="InterPro:IPR042206"
FT                   /db_xref="InterPro:IPR042211"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C1"
FT                   /protein_id="ACM05097.1"
FT                   /translation="MTKPIYVFSSGRLARHQNTIVLETEEGKRFLPVEQVSELYVFGEV
FT                   DLNKRFLEFIAREGVLLHFFNRYGFYTGTFYPREYLSSGALILRQVEHYLDQAKRLTLA
FT                   RAFVHGALRNIRTVLLYYRRRGVDVQAAVEIIERARAGIEEAGTTAELMALEGQAREAY
FT                   YAVWPAIIEAEFPFGPRTRRPPRDETNALISFGNSLLYTAVLAQIYQTHLDPRIGYLHE
FT                   TNFRRHTLNLDVAEIFKPVLVDRLIFRLVNRGQLQRRHFVTGAEGVFLDDDGRKLVVEA
FT                   WEQTLQETYRHPSLNRSVSYRTTLRLELYKLEKHLLGEQAYVPFALRG"
FT   gene            25126..25389
FT                   /locus_tag="trd_0024"
FT   CDS_pept        25126..25389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0024"
FT                   /product="CRISPR-associated protein Cas2"
FT                   /note="identified by match to protein family HMM PF02647;
FT                   match to protein family HMM TIGR01573"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05402"
FT                   /db_xref="GOA:B9L1C2"
FT                   /db_xref="InterPro:IPR019199"
FT                   /db_xref="InterPro:IPR021127"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C2"
FT                   /protein_id="ACM05402.1"
FT                   /translation="MYVIVAYDVGVERVARVLKICRRYLTWVQNSLLEGELTPAQLRRL
FT                   QQELERTIDRENDSVQFYILPQASVAKRVTLGLVKNQPSQVI"
FT   gene            complement(25386..26456)
FT                   /locus_tag="trd_0023"
FT   CDS_pept        complement(25386..26456)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0023"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="identified by match to protein family HMM PF02769"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06025"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C3"
FT                   /protein_id="ACM06025.1"
FT                   /translation="MGLELPTLGKISGEVFDQIILPHLGAPSPQVLVPPQHGVDVGIVD
FT                   LGNGLVMAVTTDPVFVVPAYGWERAAWFAIHILASDAATSGLAPAFLAIDLNLPLAITA
FT                   EELSILWTTMHRVCAELGIAIIAGHTARYEGCHYPMVGGAAVMAIGPADRYVTPKMARV
FT                   GDLVVVTKGAAIEAAGLFAVSFPERIAAAYGREFADRAQELFWQMSVVADALTAVSIGV
FT                   RDDGVTAMHDATECGVYGGLVEVAEASGVGLRIEQERIILREDVAKICQLFGMDPYAAI
FT                   SEGTLIITVRPHKVDALLAALGAKGIAASVVGEVVPPERGLTLVVDGKERPLEHPRVDP
FT                   FWAAFGRAMAEAERGS"
FT   gene            complement(26685..27293)
FT                   /locus_tag="trd_0025"
FT   CDS_pept        complement(26685..27293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0025"
FT                   /product="glutamine amidotransferase subunit pdxT"
FT                   /EC_number="2.6.-.-"
FT                   /note="identified by match to protein family HMM PF01174;
FT                   match to protein family HMM PF07685"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04616"
FT                   /db_xref="GOA:B9L1C4"
FT                   /db_xref="InterPro:IPR002161"
FT                   /db_xref="InterPro:IPR021196"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C4"
FT                   /protein_id="ACM04616.1"
FT                   /translation="MAVTIGVLALQGDFAEHLTALARLGIAAHEVRQPRDLAGIDGLII
FT                   PGGESTTIGRLLERTELLGVIRDLAQRGMPLWGTCAGLILLAREVTAETRARHQPLLGL
FT                   LDIVVRRNAFGSQRESFECDLVVEPLGPPPLRAVFIRAPLIDAIGPGVAVLACLPDGRP
FT                   VAVRQGSIIGTAFHPELTNDLRFHRWFCELAERATVHTV"
FT   gene            complement(27304..28206)
FT                   /locus_tag="trd_0026"
FT   CDS_pept        complement(27304..28206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0026"
FT                   /product="pyridoxine biosynthesis protein"
FT                   /note="identified by match to protein family HMM PF01680;
FT                   match to protein family HMM TIGR00343"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05455"
FT                   /db_xref="GOA:B9L1C5"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C5"
FT                   /protein_id="ACM05455.1"
FT                   /translation="MEQTNGTIEQATWRTKVGLAQMLKGGVIMDVVTPEQAQIAEEAGA
FT                   VAVMALERVPADIRREGGVARMADPDRILRIKEAVTIPVMAKVRIGHFVEAQILEAIGV
FT                   DFIDESEVLTPADDRYHIDKHVFRVPFVCGARDLGEALRRIAEGAAMIRSKGEAGTGNI
FT                   VEAVRHLRDILDGIRRLAALPREELVTAAKELGAPYELVRQVAEQGRLPVVLFCAGGVA
FT                   TPADAALVMQLGAEGVFVGSGIFKSENPFARAKAIVEAVTHYRDPEVLARVSRGLGEAM
FT                   PGIDLATLAPEQRLAPRGW"
FT   gene            complement(28233..29576)
FT                   /locus_tag="trd_0027"
FT   CDS_pept        complement(28233..29576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0027"
FT                   /product="aminotransferase, class I and II"
FT                   /note="identified by match to protein family HMM PF00155"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04951"
FT                   /db_xref="GOA:B9L1C6"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C6"
FT                   /protein_id="ACM04951.1"
FT                   /translation="MSAYRELAAAGLISGHVGRGTVVVDPAQHRESRAPAGGVPWPQLF
FT                   APLATALYDPALEDAMIAAARPDVISFATGQPAPECYPIATVRQLLDEALHREGARLLQ
FT                   YCPSEGYPPLREAIASWSQQAGIRCTAENVLVVSGSQQGLYLVARALVEPGDLVAVESP
FT                   TYAGALQIFRAVGARLLPIPVDEFGMRVSLLERALEHRRPKLIYTLPTFQNPSGATLAL
FT                   DRRLHLLDLAARAGIPVVEDDPYRELWYDAPPPPPLAALDQAGTVISLTTVSKILFPGF
FT                   RIGWIIAPWPVIRQLALVKQLVDLDTNPLMQWAIWAFLERRLLPPHLEELRRVHRDRRD
FT                   LLLASLAAEANGALHCRVPAGGLYLWCELADGIRARDLVPEAARQGVAIVPGESFFVDP
FT                   AQGRSFVRLNFTYPAPAALVEGAKRLGRALSALREARALLAQASSPIV"
FT   gene            complement(29573..30691)
FT                   /locus_tag="trd_0028"
FT   CDS_pept        complement(29573..30691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0028"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05772"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C7"
FT                   /protein_id="ACM05772.1"
FT                   /translation="MPAKPDAGACHRRVGKAVQVTTFLPAPPITNRPVLASLARSDVEF
FT                   QRPTDDESGRPIGDCPSRAAAGPKCGRLVLRQLSFAAAAHTHTAWHARRPSPPTSDPGG
FT                   TAPRARCGRRARLQPPAGDAGQSAHGALTVARAVESAGDASPTEVEPGTVRVGGSWTWA
FT                   ETIPVRSIACDGASTRVPRSASGVCRGRAPSPSPISSASAWCPHHLVDRTGSRLRPARL
FT                   LTHRDPDRLRPDDPLPSHTPRPRAAPHQTVRLNTPPASDLVVDRPFGKRRDVSVASRGS
FT                   PIAPDWLAWMAFEAHNGTWRGSSPSVGSSSSGRLEEVSCNSGSIAPVASRSTASWLSSS
FT                   AGASSAANSRPVRACHPSAVSPPRSASTDPRS"
FT   gene            30736..30855
FT                   /locus_tag="trd_0029"
FT   CDS_pept        30736..30855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0029"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05149"
FT                   /db_xref="UniProtKB/TrEMBL:B9L1C8"
FT                   /protein_id="ACM05149.1"
FT                   /translation="MATSAHSFGRPVGCICRILATAHSERMGLATSIVMSCDR"
FT   misc_feature    31267..36203
FT                   /note="CRISPR repeat region, Tneap subtype"
FT   repeat_region   31267..31296
FT                   /rpt_family="CRISPR"
FT   misc_feature    31297..31334
FT                   /note="CRISPR spacer"
FT   repeat_region   31335..31364
FT                   /rpt_family="CRISPR"
FT   misc_feature    31365..31404
FT                   /note="CRISPR spacer"
FT   repeat_region   31405..31434
FT                   /rpt_family="CRISPR"
FT   misc_feature    31435..31470
FT                   /note="CRISPR spacer"
FT   repeat_region   31471..31500
FT                   /rpt_family="CRISPR"
FT   misc_feature    31501..31540
FT                   /note="CRISPR spacer"
FT   repeat_region   31541..31570
FT                   /rpt_family="CRISPR"
FT   misc_feature    31571..31606
FT                   /note="CRISPR spacer"
FT   repeat_region   31607..31636
FT                   /rpt_family="CRISPR"
FT   misc_feature    31637..31672
FT                   /note="CRISPR spacer"
FT   repeat_region   31673..31702
FT                   /rpt_family="CRISPR"
FT   misc_feature    31703..31737
FT                   /note="CRISPR spacer"
FT   repeat_region   31738..31767
FT                   /rpt_family="CRISPR"
FT   misc_feature    31768..31802
FT                   /note="CRISPR spacer"
FT   repeat_region   31803..31832
FT                   /rpt_family="CRISPR"
FT   misc_feature    31833..31869
FT                   /note="CRISPR spacer"
FT   repeat_region   31870..31899
FT                   /rpt_family="CRISPR"
FT   misc_feature    31900..31935
FT                   /note="CRISPR spacer"
FT   repeat_region   31936..31965
FT                   /rpt_family="CRISPR"
FT   misc_feature    31966..32003
FT                   /note="CRISPR spacer"
FT   repeat_region   32004..32033
FT                   /rpt_family="CRISPR"
FT   misc_feature    32034..32069
FT                   /note="CRISPR spacer"
FT   repeat_region   32070..32099
FT                   /rpt_family="CRISPR"
FT   misc_feature    32100..32136
FT                   /note="CRISPR spacer"
FT   repeat_region   32137..32166
FT                   /rpt_family="CRISPR"
FT   misc_feature    32167..32202
FT                   /note="CRISPR spacer"
FT   repeat_region   32203..32232
FT                   /rpt_family="CRISPR"
FT   misc_feature    32233..32269
FT                   /note="CRISPR spacer"
FT   repeat_region   32270..32299
FT                   /rpt_family="CRISPR"
FT   misc_feature    32300..32335
FT                   /note="CRISPR spacer"
FT   repeat_region   32336..32365
FT                   /rpt_family="CRISPR"
FT   misc_feature    32366..32401
FT                   /note="CRISPR spacer"
FT   repeat_region   32402..32431
FT                   /rpt_family="CRISPR"
FT   misc_feature    32432..32467
FT                   /note="CRISPR spacer"
FT   repeat_region   32468..32497
FT                   /rpt_family="CRISPR"
FT   misc_feature    32498..32533
FT                   /note="CRISPR spacer"
FT   repeat_region   32534..32563
FT                   /rpt_family="CRISPR"
FT   misc_feature    32564..32599
FT                   /note="CRISPR spacer"
FT   repeat_region   32600..32629
FT                   /rpt_family="CRISPR"
FT   misc_feature    32630..32665
FT                   /note="CRISPR spacer"
FT   repeat_region   32666..32695
FT                   /rpt_family="CRISPR"
FT   misc_feature    32696..32730
FT                   /note="CRISPR spacer"
FT   repeat_region   32731..32760
FT                   /rpt_family="CRISPR"
FT   misc_feature    32761..32798
FT                   /note="CRISPR spacer"
FT   repeat_region   32799..32828
FT                   /rpt_family="CRISPR"
FT   misc_feature    32829..32865
FT                   /note="CRISPR spacer"
FT   repeat_region   32866..32895
FT                   /rpt_family="CRISPR"
FT   misc_feature    32896..32930
FT                   /note="CRISPR spacer"
FT   repeat_region   32931..32960
FT                   /rpt_family="CRISPR"
FT   misc_feature    32961..32995
FT                   /note="CRISPR spacer"
FT   repeat_region   32996..33025
FT                   /rpt_family="CRISPR"
FT   misc_feature    33026..33061
FT                   /note="CRISPR spacer"
FT   repeat_region   33062..33091
FT                   /rpt_family="CRISPR"
FT   misc_feature    33092..33129
FT                   /note="CRISPR spacer"
FT   repeat_region   33130..33159
FT                   /rpt_family="CRISPR"
FT   misc_feature    33160..33194
FT                   /note="CRISPR spacer"
FT   repeat_region   33195..33224
FT                   /rpt_family="CRISPR"
FT   misc_feature    33225..33261
FT                   /note="CRISPR spacer"
FT   repeat_region   33262..33291
FT                   /rpt_family="CRISPR"
FT   misc_feature    33292..33328
FT                   /note="CRISPR spacer"
FT   repeat_region   33329..33358
FT                   /rpt_family="CRISPR"
FT   misc_feature    33359..33394
FT                   /note="CRISPR spacer"
FT   repeat_region   33395..33424
FT                   /rpt_family="CRISPR"
FT   misc_feature    33425..33460
FT                   /note="CRISPR spacer"
FT   repeat_region   33461..33490
FT                   /rpt_family="CRISPR"
FT   misc_feature    33491..33527
FT                   /note="CRISPR spacer"
FT   repeat_region   33528..33557
FT                   /rpt_family="CRISPR"
FT   misc_feature    33558..33594
FT                   /note="CRISPR spacer"
FT   repeat_region   33595..33624
FT                   /rpt_family="CRISPR"
FT   misc_feature    33625..33659
FT                   /note="CRISPR spacer"
FT   repeat_region   33660..33689
FT                   /rpt_family="CRISPR"
FT   misc_feature    33690..33727
FT                   /note="CRISPR spacer"
FT   repeat_region   33728..33757
FT                   /rpt_family="CRISPR"
FT   misc_feature    33758..33793
FT                   /note="CRISPR spacer"
FT   repeat_region   33794..33823
FT                   /rpt_family="CRISPR"
FT   misc_feature    33824..33860
FT                   /note="CRISPR spacer"
FT   repeat_region   33861..33890
FT                   /rpt_family="CRISPR"
FT   misc_feature    33891..33925
FT                   /note="CRISPR spacer"
FT   repeat_region   33926..33955
FT                   /rpt_family="CRISPR"
FT   misc_feature    33956..33991
FT                   /note="CRISPR spacer"
FT   repeat_region   33992..34021
FT                   /rpt_family="CRISPR"
FT   misc_feature    34022..34057
FT                   /note="CRISPR spacer"
FT   repeat_region   34058..34087
FT                   /rpt_family="CRISPR"
FT   misc_feature    34088..34122
FT                   /note="CRISPR spacer"
FT   repeat_region   34123..34152
FT                   /rpt_family="CRISPR"
FT   misc_feature    34153..34188
FT                   /note="CRISPR spacer"
FT   repeat_region   34189..34218
FT                   /rpt_family="CRISPR"
FT   misc_feature    34219..34253
FT                   /note="CRISPR spacer"
FT   repeat_region   34254..34283
FT                   /rpt_family="CRISPR"
FT   misc_feature    34284..34319
FT                   /note="CRISPR spacer"
FT   repeat_region   34320..34349
FT                   /rpt_family="CRISPR"
FT   misc_feature    34350..34385
FT                   /note="CRISPR spacer"
FT   repeat_region   34386..34415
FT                   /rpt_family="CRISPR"
FT   misc_feature    34416..34451
FT                   /note="CRISPR spacer"
FT   repeat_region   34452..34481
FT                   /rpt_family="CRISPR"
FT   misc_feature    34482..34516
FT                   /note="CRISPR spacer"
FT   repeat_region   34517..34546
FT                   /rpt_family="CRISPR"
FT   misc_feature    34547..34583
FT                   /note="CRISPR spacer"
FT   repeat_region   34584..34613
FT                   /rpt_family="CRISPR"
FT   misc_feature    34614..34648
FT                   /note="CRISPR spacer"
FT   repeat_region   34649..34678
FT                   /rpt_family="CRISPR"
FT   misc_feature    34679..34714
FT                   /note="CRISPR spacer"
FT   repeat_region   34715..34744
FT                   /rpt_family="CRISPR"
FT   misc_feature    34745..34780
FT                   /note="CRISPR spacer"
FT   repeat_region   34781..34810
FT                   /rpt_family="CRISPR"
FT   misc_feature    34811..34846
FT                   /note="CRISPR spacer"
FT   repeat_region   34847..34876
FT                   /rpt_family="CRISPR"
FT   misc_feature    34877..34912
FT                   /note="CRISPR spacer"
FT   repeat_region   34913..34942
FT                   /rpt_family="CRISPR"
FT   misc_feature    34943..34977
FT                   /note="CRISPR spacer"
FT   repeat_region   34978..35007
FT                   /rpt_family="CRISPR"
FT   misc_feature    35008..35043
FT                   /note="CRISPR spacer"
FT   repeat_region   35044..35073
FT                   /rpt_family="CRISPR"
FT   misc_feature    35074..35109
FT                   /note="CRISPR spacer"
FT   repeat_region   35110..35139
FT                   /rpt_family="CRISPR"
FT   misc_feature    35140..35177
FT                   /note="CRISPR spacer"
FT   repeat_region   35178..35207
FT                   /rpt_family="CRISPR"
FT   misc_feature    35208..35242
FT                   /note="CRISPR spacer"
FT   repeat_region   35243..35272
FT                   /rpt_family="CRISPR"
FT   misc_feature    35273..35308
FT                   /note="CRISPR spacer"
FT   repeat_region   35309..35338
FT                   /rpt_family="CRISPR"
FT   misc_feature    35339..35375
FT                   /note="CRISPR spacer"
FT   repeat_region   35376..35405
FT                   /rpt_family="CRISPR"
FT   misc_feature    35406..35442
FT                   /note="CRISPR spacer"
FT   repeat_region   35443..35472
FT                   /rpt_family="CRISPR"
FT   misc_feature    35473..35511
FT                   /note="CRISPR spacer"
FT   repeat_region   35512..35541
FT                   /rpt_family="CRISPR"
FT   misc_feature    35542..35578
FT                   /note="CRISPR spacer"
FT   repeat_region   35579..35608
FT                   /rpt_family="CRISPR"
FT   misc_feature    35609..35644
FT                   /note="CRISPR spacer"
FT   repeat_region   35645..35674
FT                   /rpt_family="CRISPR"
FT   misc_feature    35675..35711
FT                   /note="CRISPR spacer"
FT   repeat_region   35712..35741
FT                   /rpt_family="CRISPR"
FT   misc_feature    35742..35778
FT                   /note="CRISPR spacer"
FT   repeat_region   35779..35808
FT                   /rpt_family="CRISPR"
FT   misc_feature    35809..35844
FT                   /note="CRISPR spacer"
FT   repeat_region   35845..35874
FT                   /rpt_family="CRISPR"
FT   misc_feature    35875..35910
FT                   /note="CRISPR spacer"
FT   repeat_region   35911..35940
FT                   /rpt_family="CRISPR"
FT   misc_feature    35941..35977
FT                   /note="CRISPR spacer"
FT   repeat_region   35978..36007
FT                   /rpt_family="CRISPR"
FT   misc_feature    36008..36043
FT                   /note="CRISPR spacer"
FT   repeat_region   36044..36073
FT                   /rpt_family="CRISPR"
FT   misc_feature    36074..36109
FT                   /note="CRISPR spacer"
FT   repeat_region   36110..36139
FT                   /rpt_family="CRISPR"
FT   misc_feature    36140..36173
FT                   /note="CRISPR spacer"
FT   repeat_region   36174..36203
FT                   /rpt_family="CRISPR"
FT   gene            36860..38383
FT                   /locus_tag="trd_0031"
FT   CDS_pept        36860..38383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0031"
FT                   /product="UDP-N-acetylglucosamine synthesis bifunctional
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05346"
FT                   /db_xref="GOA:B9L249"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005882"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR038009"
FT                   /db_xref="UniProtKB/TrEMBL:B9L249"
FT                   /protein_id="ACM05346.1"
FT                   /translation="MKRYHRGLWSPCSRFESWPASRRHARASRSMPDRSATVDEKSDSI
FT                   QTRPAESLAAVVLAGGLGTRMRSRLPKEFHPLAGRPLLRYVLDAVEALPVAQRILVTSP
FT                   AKAALCSQLGADWEIALQEEPLGTGHALGCALPLLRPDIRWVLLVFGDHPLLRGEDLAR
FT                   LLSAALQQRPLAAVLTTLLPDPAAYGRIQRDPDGRVTGVIEAREDANHYAGPVEVVSGA
FT                   TIYWRAWLEDALPRLPRSPSGEYYHTALIGLAAAERSGEAVITVVAPPETALGVNDRVD
FT                   LARAEAILRDRIVQAHQRAGVTIVDPATTWIEPTVEIEPDARIEPFTILAGRTRIAQGA
FT                   RIGPHAVVHDSVVGPDSTVVASVLESAVLGARVRVGPYSHLRPGTIVEDDVHIGNFAEL
FT                   KNAHVGRATRIGHVSYIGDAELGERVNIGAGTVTCNFDGVAKHRTVIEDEAFIGSDTML
FT                   VAPVQVGRGARTGAGSVVTKDVAPGTTVVGVPARPVGARRQRRTGETGA"
FT   gene            38388..39326
FT                   /locus_tag="trd_0032"
FT   CDS_pept        38388..39326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0032"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01251"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06170"
FT                   /db_xref="GOA:B9L250"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/TrEMBL:B9L250"
FT                   /protein_id="ACM06170.1"
FT                   /translation="MDGRLQIFAGNSNPRLAQAIVGVLETPLGRAEVSSWSDGETRVRL
FT                   EENVRGSDVFVIQSLCTPVNQNIMELLIILDAVKRASAARITAVIPYYAYARQEKKTAG
FT                   REPISAKLLANLLTTAGADRVLTIDLHAPAIEGFFDIPVDHLRATPILAAHFRRLGLTD
FT                   FVVVSPDAGAVVRADEFRRRAGGSLAIISKKRPGPEVAEVLEMVGDVAGRDAVIVDDII
FT                   ATGGTLLQAAELLRERGARRIFAAAVHGVFAGQALERIQASPIEKVFVTDTIPLPEGMC
FT                   TDKVEVLTVAPLLAEAIMRIHKDLSISALFT"
FT   gene            39368..40630
FT                   /locus_tag="trd_0033"
FT   CDS_pept        39368..40630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0033"
FT                   /product="magnesium and cobalt efflux protein corC"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF03471"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05818"
FT                   /db_xref="GOA:B9L251"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9L251"
FT                   /protein_id="ACM05818.1"
FT                   /translation="MSSPWTEAILFVVLAALFFAAALADLASCLPARRSLREFLAELAE
FT                   TQNGNGENTLEQLRVARPAIRLVQATTFLGLTVLALRIGHRWWPKHELAVAVLIAFVAL
FT                   LVLASAAPMALLERRYPLTSARFRLLAGLLSRLGAPLRVLSELLERPLAALIPPAPAPA
FT                   VPSAAAPPAHEEVVEEAEELIERVLRLDRLTARDIMVPRTDIVAVPFELSVRDAIAVAR
FT                   QTRHSRLPVYQGTIDRIVGIVHVRDLLRFALESAEGIKVGDVMREAYFIPESKRVDELL
FT                   RDLQHQRVHMAIVVDEFGGTAGIVTIEDVLEEIVGEIQDEYDAEAPLVERLSADEAIVD
FT                   GRISLEEIADIFGVSLEEEESSTIGGLVQAHLGRIPQPGESVRVDGLEVTVLEVAGNRV
FT                   RKLSVRRVAASVSASDEDERS"
FT   gene            40637..41188
FT                   /locus_tag="trd_0035"
FT   CDS_pept        40637..41188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0035"
FT                   /product="BirA protein"
FT                   /note="identified by match to protein family HMM PF03099"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05648"
FT                   /db_xref="GOA:B9L252"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="UniProtKB/TrEMBL:B9L252"
FT                   /protein_id="ACM05648.1"
FT                   /translation="MVAWVVHRYQRVTSTMDIAADLAAQGAPAGTVVLAEEQTEGRGRE
FT                   GRRWLAPPGTSLLFTVIARPPFAVVQDERLAVRVAEHVAAAIAATCGLRPSIKEPNDLL
FT                   VKGRKLVGILLQSRVRAEVLEYLLLGIGINVNIPADCLPLPTATSLLVELGHPVDRDRL
FT                   LAAVLDQLARDERLFPPTVR"
FT   gene            complement(41175..42314)
FT                   /locus_tag="trd_0034"
FT   CDS_pept        complement(41175..42314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0034"
FT                   /product="N5,N10-methylenetetrahydromethanopterin
FT                   reductase-related protein"
FT                   /note="identified by match to protein family HMM PF00296"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04474"
FT                   /db_xref="GOA:B9L253"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9L253"
FT                   /protein_id="ACM04474.1"
FT                   /translation="MKDARLALALVVPAQPPLASVLGLVRLARLLRFDAVMVWDHLQDF
FT                   VPRVLWSPRTTWIARLRRSPHPYYDFASLLGRLSAHAGRLRLGVGVTDPIRRHPVLLAQ
FT                   TALTLAHLTRRPPIIGIGAGEAENLEPYGFPFDRPVTRLEEALAILRACLDTPGTIRFA
FT                   GRFYQITDGVFELTAPPRRRPEIWLGAHGPRMLELTGRFADGWYPNWIDSPERYAARLA
FT                   QVRQAAERAGRDPTQIVPALQAPVLLAPTENAARRLLHHPALRLTGLLRPADEWRELGL
FT                   EHPLGEHFRGYLDFIPERVDPHALRAALRAVPPELVERSFLWGTPEQVLARIRDYREAG
FT                   LRFLGLLPVSALASPQVAAWTVFTLWRLRRSLARELTER"
FT   gene            42561..42833
FT                   /locus_tag="trd_0036"
FT   CDS_pept        42561..42833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0036"
FT                   /product="putative cellulose-binding protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05299"
FT                   /db_xref="UniProtKB/TrEMBL:B9L254"
FT                   /protein_id="ACM05299.1"
FT                   /translation="MLLSEAIVRRMEKVAQLSCQVRELWAVSSELVAAHRAALARFAQG
FT                   EQAIAARRETVEAEGDQARALRETVRQQTEQLRATVEEHARPIAE"
FT   gene            complement(42864..43292)
FT                   /locus_tag="trd_0037"
FT   CDS_pept        complement(42864..43292)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0037"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06357"
FT                   /db_xref="UniProtKB/TrEMBL:B9L255"
FT                   /protein_id="ACM06357.1"
FT                   /translation="MQHQCSRRHPLAIRSIDDTRHRDHAPEPDRWILPQALPDEEISLQ
FT                   HRVEHRTTDEPPQLLGPVAGRTLCDLLEHETEPGATAPLRASFQRGPDQPIGSLLLPIE
FT                   TRLDPLELLPDSLAKRDELVPEMLDRCSEFRDQPGAIA"
FT   gene            43284..43439
FT                   /locus_tag="trd_0038"
FT   CDS_pept        43284..43439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0038"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05083"
FT                   /db_xref="UniProtKB/TrEMBL:B9L256"
FT                   /protein_id="ACM05083.1"
FT                   /translation="MLQPALRRVVPLVVGEGTTEGAMGRADRLDVVTLPNGRRQDGKQE
FT                   EARWVA"
FT   gene            43718..44929
FT                   /locus_tag="trd_0039"
FT   CDS_pept        43718..44929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0039"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04760"
FT                   /db_xref="GOA:B9L257"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9L257"
FT                   /protein_id="ACM04760.1"
FT                   /translation="MDFEFTPEQIQVRDMVREWAQREVAPYIREWDAKGEYHPEIYRRM
FT                   GELGLLGLPIPERYGGGGFDYIALALACEELEAVDTFLRVAISVHVGLNSLTLLQWGTE
FT                   EQKQRWLVPQARGEKLATFALTEPGAGSDAGHIQTRAVRDGDSYILNGEKMWISLANTA
FT                   DHFLVFATLDPALGHRGLCAFMVERGMPGLTTGSIHGKLGVRAGDTGWISLQNVRVPAE
FT                   NMIGEPGEGFKIAMSAIDQGRFTVAAGACGLIRACLEASVKYCHERQAFGQEIGRFQLV
FT                   QQMIAKMVRGYETSRLLVFRAAELKNRGIRNTRETSLAKWHACDCAFEAANDAVQIHGA
FT                   YGYSSEYPVERYFRNSRGAVIYEGTREIHTLLQAEYALGYRVDKLLRCPQPPAQGYETV
FT                   VARG"
FT   gene            44931..45467
FT                   /locus_tag="trd_0040"
FT   CDS_pept        44931..45467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0040"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF00132"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05228"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B9L258"
FT                   /protein_id="ACM05228.1"
FT                   /translation="MRPLVIPYRGKQPQLAPDVFVAPTAVVIGDVVVGSRSSLWFGVVL
FT                   RGDIGPIRIGQRVNLQEGVIVHLDEGFPVVIEDDVTIGHGAIVHGAQIAAGAQIGMGAI
FT                   LLTGSRVGAGAIVAAGALVPEGMEVPAGTVAVGIPARIRREVTTEERAELLERAQRYAQ
FT                   RGEEFRRLLAGGGEA"
FT   gene            45464..46237
FT                   /locus_tag="trd_0041"
FT   CDS_pept        45464..46237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0041"
FT                   /product="3-hydroxybutyryl-CoA dehydratase"
FT                   /EC_number="4.2.1.55"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06060"
FT                   /db_xref="GOA:B9L259"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9L259"
FT                   /protein_id="ACM06060.1"
FT                   /translation="MSVRVEREGAITLVTVERPERLNALDTATLRALLAAVQELATEEA
FT                   IAVVVLTGAGDRAFIAGADISEMVEKSPAEALAFAELGHAVCRAIEEAPQPYIAAVNGY
FT                   ALGGGCEIALACDIRLASERAVFAQPEVTLGIPPGWGGSQRLPRVVPPGIARELLYTGR
FT                   RVDAQEALRIGLVNAVYPADQLLERARELANRIAANGPLAVRLTKAAVRFGLEQGLEAG
FT                   LTYERQVFAYAFTTEDQREGMRAFLEKRRPAFRGR"
FT   gene            46271..47035
FT                   /locus_tag="trd_0042"
FT   CDS_pept        46271..47035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0042"
FT                   /product="electron transfer flavoprotein beta-subunit"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04965"
FT                   /db_xref="GOA:B9L260"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B9L260"
FT                   /protein_id="ACM04965.1"
FT                   /translation="MKIAVLVKQVPDPNAVRFDPRLGDLVPGIQEVANEYDLYALEAAL
FT                   RLREQVGGQIVVASVGPARDALNRALAMGADRAVSIEGEGLPGDSWVTATVLAAWLRGE
FT                   QPDVIWCGQETSDSGTGNVGPAVAALLDIPLVSNVVGWEFRDGVFTIEREIEDGHQFQE
FT                   VAPPLVLCALSALPQPRLPTLRGIMDARRKPVERLGPADLGLDASELVPLVSWAGLSQP
FT                   EAKAAGIVVQDVSPDEAAERLLVFLEARGLLG"
FT   gene            47054..48046
FT                   /locus_tag="trd_0043"
FT   CDS_pept        47054..48046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0043"
FT                   /product="electron transfer flavoprotein alpha subunit"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05675"
FT                   /db_xref="GOA:B9L261"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B9L261"
FT                   /protein_id="ACM05675.1"
FT                   /translation="MAGGGLLVVVETAQGVARPAALELFGAASRASAALGPVTALVVGH
FT                   GVSGAAEQVARLGVARVLVVDEPAFAEPVAERLARAVQVAWEQVEPALVLVPGTTLGRD
FT                   TAALVAAERRVPHLVDIVALEVTPEAFVATRPVYQSKLVTTVRAGRERAAVVTVRSGAF
FT                   RPPEPGEAGATIEPLAVGLEERQQRVRVTRMVDKPRGQVDLESAPVVVVGGRGIGGPEG
FT                   FAQLAELAELLGGALGCTRAVSDLGWRPHYEQIGQTGKQVRPKLYLGVGVSGAVQHTVA
FT                   MQGSETIVVINRDPNAPLVKMADLAVIGDWSEIVPRLIARLRERRGNGA"
FT   gene            48043..49341
FT                   /locus_tag="trd_0044"
FT   CDS_pept        48043..49341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0044"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494; match to protein
FT                   family HMM PF03486; match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06066"
FT                   /db_xref="GOA:B9L262"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039651"
FT                   /db_xref="UniProtKB/TrEMBL:B9L262"
FT                   /protein_id="ACM06066.1"
FT                   /translation="MSQERVEVIVVGAGPAGVAAALTLARAGVEVVVLERGAYPGAKNV
FT                   MGGILYRQPTEELVPGFWREAPLERAIVEQRYLLLTDEDAIGLSYRTPVFGQPPYNAFS
FT                   VLRAEWDRWFAQQAEAAGALIATEVTVEDLLWEDGRIVGVRAGEQGDLVADVVVIADGA
FT                   NSLLAQKAGLARDARPEEQALVAKELLRLPAEEIDRRFAVPPGQGVAIEAFGAATGGLL
FT                   GYGFIYTNRETLSIGTGALLSDLIAYEVNVSDLLERFKQHPAIAPLLEGAELVEYSAHL
FT                   IPEGGWRALPTLFTDGALVVGDAAGFVNPLSREGSNFAMISGKLAAETILEARQTGDYS
FT                   ALALSRYWEKLEASFILPDLELIRNVTPFFHARPYLLQDVPAALAHAVRHYLTVDSTPK
FT                   ARKYREILRELGRELRPARLLRDGLAALRELAS"
FT   gene            49406..50275
FT                   /locus_tag="trd_0045"
FT   CDS_pept        49406..50275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0045"
FT                   /product="putative CvpA family protein"
FT                   /note="identified by match to protein family HMM PF02674"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05668"
FT                   /db_xref="GOA:B9L263"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B9L263"
FT                   /protein_id="ACM05668.1"
FT                   /translation="MTLYLALDVLLLVLLALFVPVGFWRGAARELVVTLGILLGFALGE
FT                   FWAQPWGLDLAERTGLGEGAASFLAAVLALVACTFLIGYGVSSVILTPQPGMLGRLLGA
FT                   VIALANGMLVLGFALRAIRLYLLGGAPSGLFEQAIVARLLSESMPWVLLAGALLGLPLI
FT                   VLAAVLGARAVEEEVEPVRREQDFALQHTPTRPLPPRLPFVRHQSEVAYKTEPARPAEE
FT                   PTRPLRAAPAAPESGGSRRDDIAEQETAVLARPAAETAPRPVDNRCPYCHADISDAKVF
FT                   CPRCGRVL"
FT   gene            50507..50677
FT                   /locus_tag="trd_0046"
FT   CDS_pept        50507..50677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0046"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04858"
FT                   /db_xref="GOA:B9L264"
FT                   /db_xref="UniProtKB/TrEMBL:B9L264"
FT                   /protein_id="ACM04858.1"
FT                   /translation="MGFIGMQPEPLTPRGRAIVLTAVILALLFIVVWGAGIVLMLHNPG
FT                   QGTVCLSGRCW"
FT   gene            complement(50684..51187)
FT                   /locus_tag="trd_0047"
FT   CDS_pept        complement(50684..51187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0047"
FT                   /product="putative acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05348"
FT                   /db_xref="GOA:B9L265"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9L265"
FT                   /protein_id="ACM05348.1"
FT                   /translation="MAGQTVRLVTIERIAGQELWVQPASFRDLPQLAQLQRACFELRQA
FT                   YSLWALVVLWLWPGVRVLVARIADEIVGCVVGDQRGRHARVLNLCVAPAWRRRGIGALL
FT                   LAALEQELAADLYTLMVEDKNGPAQALYRRFGYVPIAEVRHYYGRNRHGVLMQKRRGER
FT                   PHWQ"
FT   gene            complement(51341..57166)
FT                   /locus_tag="trd_0048"
FT   CDS_pept        complement(51341..57166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0048"
FT                   /product="PAS domain S-box protein"
FT                   /note="identified by match to protein family HMM PF00989;
FT                   match to protein family HMM PF00990; match to protein
FT                   family HMM PF01590; match to protein family HMM PF08447;
FT                   match to protein family HMM PF08448; match to protein
FT                   family HMM TIGR00229; match to protein family HMM
FT                   TIGR00254"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05661"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B9L266"
FT                   /protein_id="ACM05661.1"
FT                   /translation="MEALLTKTMLLLRLDANGRVLEASPSDLVPVGTLLSDAVLPGDRA
FT                   AVEAMLQAARRGEPAWGAVTLQRDSTLQRCDAACIPGEFGTSSWLLRLRADDALPSFED
FT                   EEELERWLGRFLIHEIEIGLLVFDHTALLRYRNAPAVRLLASRESELPLGTPWSVVVER
FT                   LLDYFPSARAVIDALHASVAEGRALHQLELERRDGAVLSLDYLPVHVGQATVAHVLRMR
FT                   DITVRRRAERRAALAEQRYRDLVELVPVVVYRATAADTVETSYVSPQIERLLGYTPEEW
FT                   LAERGMWRRHLHPEDRPWITAAIERAVREGKEFSLEYRMVRRDGSIVWVQDWGRVRTDE
FT                   SGCTFIHGVMLDITERKEAERARAEVEARLRALVETMPAVLYVREPEPIRLPDGLLSYP
FT                   FRYLNDEVAELTGYPASQFLADPTLFARLIHPDDWGRYEAEMLRTDETGQLCDVDYRIV
FT                   RCDGSVRWIRERAVQLRDATGQPLAWQGLLIDVTAQKETERALRDAEERYRTLVEQLPG
FT                   ALLVVSAQPRWRADGTPAFDLIYVSPQIERLTGYPPAAWHEPGLWMRLVHPDDRPHVLS
FT                   CLERCLRERAARTVEYRLVRADGRTVWIRHEATLLLDQDGEPLAWQSLLLDITAEKEAE
FT                   AAQRESEERFRLLAEHHPGAVTIVEPEPVALSDGTLGWRTLFVSPRIVDLTGYTAEEWS
FT                   ELGVWMRNIHPEDRERVLAEAERWYRVGPQQPLEYRFRHKDGRWVWLRQEGALVRDQGG
FT                   RPRYLLLVTIDVTEQRQLLEQLREAELRYRTLVEQLPSVVLIRPLVPDREAFQRGMLNI
FT                   YVSPAIERLTGFRPEEWTTERFLAQLHPDDRERVLAAITTADRTGESLDLEYRLLHKDG
FT                   SVVWVWSISHVVRAADGIPPYRQVLLTDITARKRAEEALRGAEERYRTLVEQLPGAVIL
FT                   RSPESRRLPDGSLTYEILYISPNIERLTEFTASEWQEPGRWSRQIHPADRERVLAAQAE
FT                   SERTGSPLDIEYRFIRKDGRTIWLWHITRILRDANGTPRLRQVLLLDVTRRKESELALQ
FT                   EAEARYRSLVEQLPGAVLIRSASSELREDGSRQFDIHYVSPGIERLTGFTSQEWLVPGT
FT                   WTRQIHPDDRDRVFAAVLASEAAAEPLELEYRLYRKDGTLIWIWHQTKVIHDQDGKPLY
FT                   RQVLLTDITARKQAEEALRAAEAHYRTLVEQLPAVVIRVTARAQRLPDGLPGYETTYVS
FT                   PQIEAVTGYTPEEWKELGIWARRLHPEDRERVLDAFWQHEATGEPLQLEYRFLHKDGRT
FT                   VWLWHELRPIRAPDGTIQARQAVLMDITERKRAEQALREAEERYRTLVEQLPAVVYLEG
FT                   AQPVRYPDGRLARPLLYVSPQVEQLTGYRPEEHQQDRTLWVQAIHPEDYPRVRQETREA
FT                   WATGRFRSEFRILRRDGEVRWIESTARLVRDDQGKPLYWQGVMLDVTERKQAEEALREA
FT                   EERYRTLVEQIPAAVLVTSAEPVVLPDGSLHYPVTFLSQRIEEVTGFSREEFLATPGLW
FT                   FSRMHPDDQPRVFAEAVRTDETGEPFEATYRFQRKDGRWVWLENRAVMVRNAEGKPLFW
FT                   HGLLIDVTERKRAEALLFAQTTLLRLIAEAAPLSEILELLCRLVEQQAPGLRCSVLLLG
FT                   SDDRLYHGAAPSLPPRYLAAIDGLPIGPQAGSCGTAAYLDRPIFVEDIASDPRWADYRE
FT                   AALEAGLRACWSTPIRGTSGNVLGTVALYASEPRGPQPNEERLLELATQLAALALERWQ
FT                   ESEELRHRAFHDPLTGLPNRLLFLDRLEHAVARADRDGGGIAVLFLDLDDFKRVNDTWG
FT                   HAVGDVVLQEAAARLSRQVRAGDTVARFAGDEFTVLLDGVTGEHDVRVVTERLLAALAS
FT                   PIRCGEQEIRMGLSIGAAVATGRPMPDSGALLLSADQALYAAKRRGKGCYEIVIAQPGS
FT                   SQAERRSS"
FT   gene            57525..58982
FT                   /locus_tag="trd_0049"
FT   CDS_pept        57525..58982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0049"
FT                   /product="putative RNA nucleotidyltransferase"
FT                   /note="identified by match to protein family HMM PF01743;
FT                   match to protein family HMM PF01966; match to protein
FT                   family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05110"
FT                   /db_xref="GOA:B9L267"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:B9L267"
FT                   /protein_id="ACM05110.1"
FT                   /translation="MSEPSTMPVETRPDRSLLERLPPALHDINDRLARSFAAAGHELYL
FT                   VGGVVRDLLLGRPVTDLDYATSAHPEETRCLGEEAGAESIYTVGEAFGTIGLVFAGVTV
FT                   EITTYRTEWYPTLDRRPAVRFGDSLLEDLARRDFTVNAMAVHAVTGELIDPYGGQLDLE
FT                   RRLLRAVGDPFERFREDPLRILRAARFAAQLGFEVEAQTRLAMQELASELQRVSVERIA
FT                   LELNRLLVAPEPDRGLELMRQTRLLPVVLPELVPLAEDPGDRRHKDIWRHTLQVVRQSP
FT                   PRLAVRWAALLHDAAKPMTRTIDEQGEVHFFGHELKGAELARKVLRRLRQEKALIERVA
FT                   QLVELHLRPAAYDETWTDSAVRRLMVEAGDLLEDLLDLVAADVTSARAWRRREARARIE
FT                   RLRAHIRRLEEEAALAQIKSPLDGHELMAIFGLPPGRWIAEVKNYLRDLVIEGQLAPGD
FT                   KETARVLAERWVAEHPEIIERGQQARR"
FT   gene            59015..60220
FT                   /locus_tag="trd_0050"
FT   CDS_pept        59015..60220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0050"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04893"
FT                   /db_xref="UniProtKB/TrEMBL:B9L268"
FT                   /protein_id="ACM04893.1"
FT                   /translation="MLSSSGRNARATLASCAAFARTEAAVSRQADALGLFAQLLDERGE
FT                   CFGCRTGIPAHRSDVAHLLGDGGERRCDLLGRGRMPVDDLRNTLQFSDEFVLRSGHRFA
FT                   GSSDRTDLVTDLPCVLGESVQRGFCLARQGDSFFDLAHARSRFSDHVIERVQDLIDQSA
FT                   DLLGGRAGAFGELAHLFGHDGKALASFPCSCSLDRGIEGEEIGLSGDLVDRLDHRGDPS
FT                   GTIRHLLDARADASHPLTGVPERGDGTAHRFAAGGRFGDVTLARSDSAACRVGDSLDTG
FT                   SQRLRQLGQAVQCLLLGAGAAREFGDGTLDLVDRPLGCAEEVALAYGAAGNRLHGLGRF
FT                   GSGMGQVLAALAQLVADSGGQGSCALEAGDRLAHRLFERPVQVGEIVLRSLGRDAREIE
FT                   PD"
FT   gene            60192..60365
FT                   /locus_tag="trd_0051"
FT   CDS_pept        60192..60365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0051"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04963"
FT                   /db_xref="UniProtKB/TrEMBL:B9L269"
FT                   /protein_id="ACM04963.1"
FT                   /translation="MTLERSNPTESRNSKKNASTTACWSRLKTLASARSTRHQRQGWKG
FT                   KLRRNSARTKSR"
FT   gene            61007..62080
FT                   /locus_tag="trd_0052"
FT   CDS_pept        61007..62080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0052"
FT                   /product="tyrosine recombinase xerC"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF02899"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06054"
FT                   /db_xref="GOA:B9L270"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="UniProtKB/TrEMBL:B9L270"
FT                   /protein_id="ACM06054.1"
FT                   /translation="MEGNFSLTRTIDEWLAGRPAATRRAYAHDVREFLAALGGELAQLD
FT                   ETALRRWLATFEHRRLARATVRRKLAAVRSFLRYLAERGYLERDLSSVVPAAFGKPPDQ
FT                   TPRVHATERGRLLATALQLADPRLQLLLWLAGCGCPLPVIARLRWRDLEQWNGQGIAFC
FT                   HDERERAYRCVIPGLIWRGLQSLAETQAGDALVFAHPDGRPVSPQELAETIGWLLDEAA
FT                   PELATDHRDDDRLLTLSEVAQRLGLPETTIRYYRDRFAPYLPTVGRGRSRRYSPQAVER
FT                   LRWIIEQLHAGVSPVEIEAQLGGKTNAFASTEDEHRLIESVERLSQRIAELTVSLQLVA
FT                   KALLQQEGWSPREPGTD"
FT   gene            complement(62193..62459)
FT                   /locus_tag="trd_0053"
FT   CDS_pept        complement(62193..62459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0053"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05223"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B9L271"
FT                   /protein_id="ACM05223.1"
FT                   /translation="MPADLFLDLLDLGEGHVALHWARFRDAIALFQRVATRQSSSAWAA
FT                   EAIYWWGVAVYLATHSREQLDGVWEHLRVRFPDSIWAARTRHA"
FT   gene            complement(62593..63603)
FT                   /locus_tag="trd_0054"
FT   CDS_pept        complement(62593..63603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0054"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06297"
FT                   /db_xref="UniProtKB/TrEMBL:B9L272"
FT                   /protein_id="ACM06297.1"
FT                   /translation="MKRPRNTALPSFVRPAGEQLPGTFPQDPPLIPTFPHSCPQAYART
FT                   PHRASRFCQLRSVSGRSVRTDHRLAERCRESSIEASSSLGALSAHSRFTARRPDAPLLR
FT                   RPAARCATLAHEPCSTAQRRSAPQSCRLASACPASRRQPLTAVETGLVVRDAPANSTGP
FT                   SLPSPAGCARLRKERLAEMASRAAGSTRRERLRPAGRHSGSAIRSPTHQPATERCPAPF
FT                   RTSDHPGHGSTTTTPLPPGALATRRPRQHRSFAGRGALLSRRKRLLDLAISWILRAATE
FT                   VHGDDRLATLSSRGARTGWSRATTDPRLCLERRVKRLRAAGSRDLCRSNGSGSDR"
FT   gene            63584..64012
FT                   /gene="mraZ"
FT                   /locus_tag="trd_0055"
FT   CDS_pept        63584..64012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraZ"
FT                   /locus_tag="trd_0055"
FT                   /product="mraZ protein"
FT                   /note="identified by match to protein family HMM PF02381;
FT                   match to protein family HMM TIGR00242"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04939"
FT                   /db_xref="GOA:B9L273"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L273"
FT                   /protein_id="ACM04939.1"
FT                   /translation="MFLGRFTHAIDDKGRLAIPARFREAFRGQGVLTRGIDRCLTLYPM
FT                   DSWQPLAEKVSSLSISDPDARAFRRMVFAEATVVEFDRQGRILLPPELRAYAGLEREAI
FT                   VVGVHSYVEIWSPENWAAQAELLAAEGPSIAQRLATLI"
FT   gene            64032..65012
FT                   /gene="mraW"
FT                   /locus_tag="trd_0056"
FT   CDS_pept        64032..65012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraW"
FT                   /locus_tag="trd_0056"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01795;
FT                   match to protein family HMM TIGR00006"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05553"
FT                   /db_xref="GOA:B9L274"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L274"
FT                   /protein_id="ACM05553.1"
FT                   /translation="MSERARLALEDPLSTTHEPVLLSAALTFLAPRDGGRYIDATFGGG
FT                   GHSRAILEASAPSGQVLAIDADPAAVARARALAERYPGRLLPCHGNFRDLARLAQSYGF
FT                   VPVDGILFDLGLSSDQLADPARGFSFQLAGPLDMRFDPTSGEPAAVIVNTWSAEELAEL
FT                   FWQYGEEPRAWAIAQTIVAERARQPIETTTQLAALVARVAGSRRERIHPATRVFQALRI
FT                   AVNQELEALAAGLAQAVELLRPGGRLVVIAFHSLEDRLVKQFFRREAAACLCPPGTPVC
FT                   ICGHRPRLRLLTPRPVRPSAEEITRNPRSRSARLRAAERIAHDGR"
FT   gene            65002..65460
FT                   /locus_tag="trd_0057"
FT   CDS_pept        65002..65460
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0057"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06118"
FT                   /db_xref="GOA:B9L275"
FT                   /db_xref="UniProtKB/TrEMBL:B9L275"
FT                   /protein_id="ACM06118.1"
FT                   /translation="MVAEPVDRAAAPVRPTPVGRRVAPRRSRAWLGVLLVLVAAIGGLC
FT                   LLYLEQTSRVVELGYELTRLQRNRDQVALEVAALRYELARRQSLARVEELARREYGMVP
FT                   LRKAESLRLARPAPLPTPVPPPRSERSWWQRVQDALLGVGHAEAETTP"
FT   gene            65457..67184
FT                   /locus_tag="trd_0058"
FT   CDS_pept        65457..67184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0058"
FT                   /product="penicillin-binding protein"
FT                   /note="identified by match to protein family HMM PF00905;
FT                   match to protein family HMM PF03717"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05787"
FT                   /db_xref="GOA:B9L276"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B9L276"
FT                   /protein_id="ACM05787.1"
FT                   /translation="MSDLATWRLRLIFAALVLLASGIGYRVVSFAVLQGPVLAQRAEAF
FT                   RFREDVVPAHRGEILDARGRVLATDVPADRVSAIVREVEDPQRTAQLLAPLIGRPAEEI
FT                   LAALTQPGREWVVLQRQLDPAVSAQIRALDLPGIVLDPEPKRAYPMGDFASQVLGFVNW
FT                   EYRGAYGLEAQYDAVVGGVPGQLVGERDLAGNVIALAPSSWNPPQDGATLVLTIDSAVQ
FT                   YLAESILERTIQDQRAAGGTIIVMDVRTGAILAMANRPSFDPNRFREVTDPSLFANPAI
FT                   GAAYEPGSTFKVITLALGLDAGVIQPETVVDGGAYRELPDGTRIFNALHQVFGPETMTE
FT                   VLIHSSNVGAMEVADRLGPERFAEGIQRFGFGQPTGVDLPGEIGGIVNLPGSPGWSLTT
FT                   FYTTSFGQGIAVTPLQLVTAVAAIANGGVLMRPYVVQEIRRGDRVQVVQPQPVRRVISE
FT                   ETARTLTAMLAEVMDSYAGRFAVPGYRIAAKTGTAEIPGPQGYERGEGATIASVVGYGP
FT                   VEDPRYCVLVKIDRPKGSPWGERAAGPAFAELFRQLLLLKGIPPSQPVTSTPSGGSQP"
FT   gene            67181..68581
FT                   /locus_tag="trd_0059"
FT   CDS_pept        67181..68581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0059"
FT                   /product="probable udp-n-acetylmuramoylalanyl-d-glutamyl-2,
FT                   6-diaminopimelate--d-alanyl-d-alanyl ligase protein"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01143"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06210"
FT                   /db_xref="GOA:B9L277"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9L277"
FT                   /protein_id="ACM06210.1"
FT                   /translation="MISLRDVLDGTAGMLRGSAAPDLLFRRVWHDSRTVEPGDLFVALR
FT                   GERHDGHDFVADAVRRGAAGALVEARWAEELANLGIPLIVVDDTLAALLRLASYWRRLF
FT                   AVPVAAVTGSVGKTSTKEAIASVLAQRFQVVRSRASFNTDVGIALDLLTIDPNTDVVVL
FT                   EFGEAYRLGEVRELCALAEPRIGVVTNVSYAHLARMGTIERIAQSIAELPESLPADGVA
FT                   VLNGDDFRVRLMAERTPARVLLYGLSPDCHVRAEEIESRGLDGISFDLVAFGERNRVRL
FT                   PLLGQHSVHHALAAIAVGYELGLTLEEMLPGFHDPRVQVRLLTVPGINGATLLDDTYNA
FT                   SPASCMAALSLLAEIPAQRRIAVFGDMYELGWYEEEGHRMVGRRAAAVVDRLFTLGPRA
FT                   RWIAEAAIEAGLAPERVWATDDRRELVAVLRETLRPGDFVLIKGARGMRMEEIVEALRA
FT                   AQETEQGR"
FT   gene            68578..69597
FT                   /gene="mraY"
FT                   /locus_tag="trd_0060"
FT   CDS_pept        68578..69597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mraY"
FT                   /locus_tag="trd_0060"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /EC_number="2.7.8.13"
FT                   /note="identified by match to protein family HMM PF00953;
FT                   match to protein family HMM TIGR00445"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05117"
FT                   /db_xref="GOA:B9L278"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="UniProtKB/TrEMBL:B9L278"
FT                   /protein_id="ACM05117.1"
FT                   /translation="MMDLFEVLRTRSVLPRDPGENLALSLALSGVAFVITVGIGKPYIA
FT                   WLRRHKIGKQIRLEGPEGHLTKLGTPTMGGFMITVPVILLTLLFNLAGRLSMLLPLGVL
FT                   IGTAVLGAIDDRLSLVTTGRGGMTARFKMAWLLLFSLAAALVLHFPLGLRSIYIPFLGK
FT                   FEIGLWYLPIAVLAIAGTANAVNLTDGLDTLAGGTAAVAFTAYGIIAFLQGQIQVVTFC
FT                   FTMVGAILGFLWYNAHPAQVFMGDTGSLALGAALATAAFMTGQWLLLPVIGIVFVAEAL
FT                   SVILQVAYYKLTKGKRLLRMAPLHHHFELIGWSETQITMRFWLISMMAGLLGIALALV"
FT   gene            69613..71022
FT                   /gene="murD"
FT                   /locus_tag="trd_0061"
FT   CDS_pept        69613..71022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murD"
FT                   /locus_tag="trd_0061"
FT                   /product="UDP-N-acetylmuramoylalanine--D-glutamate ligase"
FT                   /EC_number="6.3.2.9"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01087"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06380"
FT                   /db_xref="GOA:B9L279"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9L279"
FT                   /protein_id="ACM06380.1"
FT                   /translation="MGDRAPLDLRGKAVLVMGLGTRSGGLGVTRWLVEQGAEVTVTDLR
FT                   TAEQLAPSLRALAGLPVRLVLGEHRREDFERAEIVVRNPAVPRESPWLALARAAGARIE
FT                   MEMTLFFRACPAPIVGVTGTKGKTTTATLCAAILRQWRPDTVLAGNLGRSALETLPGIQ
FT                   PDTPVVLELSSWQLEGLDEHGLSPHIAVLTSISPDHLDRYPSFEAYIDAKRAIARHQRP
FT                   GDWFVVNRDDPVAWACRDAGCGKVVPFGRDDGVSDGAFWRDDRLIWRWGGEEQDLLRRS
FT                   DFPLMGEHAVGNALAAAAAALLRGASPAHVAAALREAEPVPHRLEHVARLGTVDFVNDS
FT                   AATAPAAVLAALATFRERPIVLIGGGAAKGVSLAELAEAVARQVRAVVLLDGTATPDYQ
FT                   AALRAAGARVEGPYQSMEEAVRRAAELAEPGAVVLLSPGCASFGLFRDEFHRGESFREA
FT                   VRQLVRERGGD"
FT   gene            71022..72296
FT                   /gene="ftsW"
FT                   /locus_tag="trd_0062"
FT   CDS_pept        71022..72296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsW"
FT                   /locus_tag="trd_0062"
FT                   /product="cell division protein FtsW"
FT                   /note="identified by match to protein family HMM PF01098;
FT                   match to protein family HMM TIGR02614"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05308"
FT                   /db_xref="GOA:B9L280"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:B9L280"
FT                   /protein_id="ACM05308.1"
FT                   /translation="MRWCLRRVMDALAVPGERRLAHEPDLVLLLTLLGLVTFGMVMVFS
FT                   ASVGSDPGYAVRHAIWLALGALAALATAALDYRIWRRLAVLALLGALGLMTLVLLPGFG
FT                   DTRLGAQRWIELGPLSFQPSEMAKLALVLYLASWLASKGERIRRFDLGVLPFMLLLGLL
FT                   GGLTMLQPDLGTAIVLGFTGLAMFFAAGATLRHTVLLGGIALVAGTVLAFGAPYRRDRI
FT                   LILFSSDQELFDPNGLLRTLGWQIAQARLAFGSGGWFGVGLGMGRQKFQWLPHAHNDAI
FT                   FAVIGEELGVVGCLVLLLLFLILAWRGLSIARRAPDRFGGLLAVGITSWLVSQALINAG
FT                   GISSVLPFTGIPLPFVSYGGSSLITSLAAAGILVNISRVTLPRPAPTSAAPRERPRHAP
FT                   PAVSLSRFGRRGRRRVAPRAGGRHP"
FT   gene            72293..73681
FT                   /gene="murC"
FT                   /locus_tag="trd_0063"
FT   CDS_pept        72293..73681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murC"
FT                   /locus_tag="trd_0063"
FT                   /product="UDP-N-acetylmuramate--alanine ligase"
FT                   /EC_number="6.3.2.8"
FT                   /note="identified by match to protein family HMM PF01225;
FT                   match to protein family HMM PF02875; match to protein
FT                   family HMM PF08245; match to protein family HMM TIGR01082"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04761"
FT                   /db_xref="GOA:B9L281"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005758"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9L281"
FT                   /protein_id="ACM04761.1"
FT                   /translation="MRWPAHLNHLQPGLPIHFLGIGGAGMSGLAELLADRGYRVTGCDV
FT                   AWSPVLDRLVARDIAVAVGHDERHAQDAHLLVVTSAVRAQHPEVAAFAAQRIPIVKRAA
FT                   LLGWLAASYRTIAVAGTHGKSTTCGMIALALDAAGLTPGFAIGAEVRDLGGTSARLPGG
FT                   NLFVVEADEYDYSFLFLEPDIAVVLNVDHDHPDLFPDRASVARAFRRFLARLRPVGTAV
FT                   VWADDPVACAVADELQSRGHRVVTFGETAEAAYRVLPDGALRDPSGAIWPLALAVPGRH
FT                   NRLNAAAAVAAVVQVGVPLVVAVRALEHFNGVGRRFEEVGIVNGVRVILDYAHHPREIA
FT                   ATIAAARERFPAARLWAVFQPHTYSRTARFLTEFAHALEQADLAVVAEIYAAREQPLAG
FT                   IDAAALASAIRRIPAIAVPDPMAAAETVGAAMRAGDVVLVLGAGDIWKAAVRLREGHGD
FT                   ADTG"
FT   gene            73659..74618
FT                   /gene="murB"
FT                   /locus_tag="trd_0064"
FT   CDS_pept        73659..74618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="murB"
FT                   /locus_tag="trd_0064"
FT                   /product="UDP-N-acetylenolpyruvoylglucosamine reductase"
FT                   /EC_number="1.3.1.98"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02873; match to protein
FT                   family HMM TIGR00179"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04484"
FT                   /db_xref="GOA:B9L282"
FT                   /db_xref="InterPro:IPR003170"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR011601"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036635"
FT                   /db_xref="UniProtKB/TrEMBL:B9L282"
FT                   /protein_id="ACM04484.1"
FT                   /translation="MAMPTRAERSRVVTVDGRSLRVLVSEPLARYTTFRIGGPADFLVR
FT                   ASDRATLESALIWAEREGLPVTVIGGGSNLLVRDGGIRGLVIVFRAPGESVGELATAAQ
FT                   DDGSVLVTLPATAPLSWVGHWASEHGLAGMEWAAGLPGVVGGAVVNNAGAHGGEIGHVI
FT                   VDLELYDLPSRRLVRWTREQLAPRYRMTALKALSQPRSLVVLGARLRLLRDDPARLLAF
FT                   AEEHARWRRMHQPTGPCAGSVFTNPPGTYAGYLIEQAGLKGFRIGQMAVSERHANFFVN
FT                   LGGATAREALALIEAVQERVAERFGIVLQPEIEIIGES"
FT   gene            74622..75740
FT                   /locus_tag="trd_0065"
FT   CDS_pept        74622..75740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0065"
FT                   /product="D-alanine--D-alanine ligase"
FT                   /EC_number="6.3.2.4"
FT                   /note="identified by match to protein family HMM PF01820;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM PF07478; match to protein family HMM TIGR01205"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05555"
FT                   /db_xref="GOA:B9L283"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B9L283"
FT                   /protein_id="ACM05555.1"
FT                   /translation="MARKIRVAVIFGGQSGEHDVSLRSARAILRHIDRERFEIVPVGIT
FT                   REGRWLIGGDPLRELATASRLPLELEPVSSGAGSAPATGESALALPGSLPGEIDVVFPV
FT                   LHGPYGEDGTIQGLLELAGIPYVGCGVLASAVAMDKPTAKRLFASVGLEQARWIAFTWH
FT                   EWQCQHQTLLARIERELGYPCFVKPANLGSSVGVSKARRREELLAAIELASRYDRRIVV
FT                   EEAIDARELEVSVLGNEEPVASIVGEIVPSREFYDYEAKYIDPHSQLLIPAPISEEQAA
FT                   TVRRMALEAFRVIDGAGMARVDFFLERSTGRILINEVNTIPGFTAISMYPKLWEASGLC
FT                   FRDLITRLIELALERHQAQQRRRAQATQPFSG"
FT   gene            75737..76456
FT                   /locus_tag="trd_0066"
FT   CDS_pept        75737..76456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0066"
FT                   /product="cell division protein ftsQ homolog"
FT                   /note="identified by match to protein family HMM PF08478"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04663"
FT                   /db_xref="GOA:B9L284"
FT                   /db_xref="InterPro:IPR005548"
FT                   /db_xref="InterPro:IPR013685"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B9L284"
FT                   /protein_id="ACM04663.1"
FT                   /translation="MSRRRRARRAVVRGVVTGQFLAALLVVAGAVLLVGFLGGPQYQVR
FT                   TVVVRGNQLAFAEEVARESGVLGRSVFLIDTQDVARRIVSHPAIAQATVRAFYPDTVVI
FT                   DVVERVPASVWANESGTWLVDGEGRVIGAGDLPGLPHVQVASSLSLVPGQRVPPSVADA
FT                   LAEVTRRYAGRLGGLAYRPGDGLVLVFVGGERILLGDAERLAEQLAVLDALLAEGRGFL
FT                   HLDLRDPDRPVLWQIAP"
FT   gene            76471..76608
FT                   /locus_tag="trd_0067"
FT   CDS_pept        76471..76608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0067"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06341"
FT                   /db_xref="UniProtKB/TrEMBL:B9L285"
FT                   /protein_id="ACM06341.1"
FT                   /translation="MLHWNSDDWHSEQVVASPLVGRVFDFLEWAAGANRSEGLRRRGGG
FT                   "
FT   gene            76614..77729
FT                   /gene="ftsZ"
FT                   /locus_tag="trd_0068"
FT   CDS_pept        76614..77729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ftsZ"
FT                   /locus_tag="trd_0068"
FT                   /product="cell division protein FtsZ"
FT                   /note="identified by match to protein family HMM PF00091;
FT                   match to protein family HMM PF03953; match to protein
FT                   family HMM TIGR00065"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06281"
FT                   /db_xref="GOA:B9L286"
FT                   /db_xref="InterPro:IPR000158"
FT                   /db_xref="InterPro:IPR003008"
FT                   /db_xref="InterPro:IPR008280"
FT                   /db_xref="InterPro:IPR018316"
FT                   /db_xref="InterPro:IPR020805"
FT                   /db_xref="InterPro:IPR024757"
FT                   /db_xref="InterPro:IPR036525"
FT                   /db_xref="UniProtKB/TrEMBL:B9L286"
FT                   /protein_id="ACM06281.1"
FT                   /translation="MAMFENHHEDLEYSFARIKVIGVGGGGGNAINRMIEAGVQGVEFI
FT                   AVNTDSQALLKSLAPVTVRIGDKLTKGLGAGGRPEIGERAAEESAEILAELVRGADMIF
FT                   IAAGMGGGTGTGASPVIARLAREAGALTVAVVTRPFDFEGAKRRRIADEGIAVLKEHVD
FT                   ALIVIPNQRLVSMVDPKTPLTETFRIADDVLRQGIQGITDLITRPGLINLDFADVKSIL
FT                   RDAGTALIAIGRGSGENRCVDAARAAVESPLLEMSIEGATRVLYNIAGGPDLTMAEVSE
FT                   AAELIRTMVDDEAEIIFGTTEPDDAMGRDVTITLIAAGFTGTGTARRPRTPERRFRPEP
FT                   VRPAGSGAPRTPILPDDEWAEPSILRFLRER"
FT   gene            77748..78233
FT                   /gene="nrdR"
FT                   /locus_tag="trd_0069"
FT   CDS_pept        77748..78233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nrdR"
FT                   /locus_tag="trd_0069"
FT                   /product="transcriptional regulator, NrdR family"
FT                   /note="identified by match to protein family HMM PF03477;
FT                   match to protein family HMM TIGR00244"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04997"
FT                   /db_xref="GOA:B9L287"
FT                   /db_xref="InterPro:IPR003796"
FT                   /db_xref="InterPro:IPR005144"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L287"
FT                   /protein_id="ACM04997.1"
FT                   /translation="MKCPYCGARDARVIDSRELNGGESIRRRRECIACGRRFTTYERVE
FT                   PIWLMVVKRDGRREPFDVGKLREGLRLALKKRPVSPDEIDRIVATVERELQSLGTSEVP
FT                   STLIGEIVLRELKQLDDVAYIRFASVYRRFADLEDLRREMEALGWRPRAAVTVDETS"
FT   gene            78191..79363
FT                   /locus_tag="trd_0070"
FT   CDS_pept        78191..79363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0070"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05089"
FT                   /db_xref="GOA:B9L288"
FT                   /db_xref="UniProtKB/TrEMBL:B9L288"
FT                   /protein_id="ACM05089.1"
FT                   /translation="MASSSRGDGGRDQLSLTLLSPSGEPLATLRYTNDGSDRFRWIPDR
FT                   FRLLVTSEGDAETEFSSLELDLPRHWRSLPIQEGEQRGWLVFPEGPPSFPVELRVVEHT
FT                   GKTQRALAAFALPVRFCGRNRFDPQRDRLPWANRIDEFGPAEPSWDTFRRTFRLTIAPR
FT                   AFFRGLYREVVQLQCDADGGVRGGLCTGLARAALARALGRLPAVHDLRETVLVLHGRQL
FT                   SDRALLAGLPWFLWPSPRRAYRAFVGDLLEQGWSERCFDLNVPRPWRRDLLQALLGQGH
FT                   TVVPYAFCQEHADEAFVWVADPNYPDATSTVVTIDLARDRYAYPPLAVDGRRTTIVAVP
FT                   LSAYLEGSTAILASLAGPLVTAPQRAVRTAGLALLVFLAGLAVVLLRRKR"
FT   gene            complement(79413..79736)
FT                   /gene="trx"
FT                   /locus_tag="trd_0071"
FT   CDS_pept        complement(79413..79736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trx"
FT                   /locus_tag="trd_0071"
FT                   /product="thioredoxin"
FT                   /note="identified by match to protein family HMM PF00085;
FT                   match to protein family HMM TIGR01068"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05725"
FT                   /db_xref="GOA:B9L289"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9L289"
FT                   /protein_id="ACM05725.1"
FT                   /translation="MAKPVTVSDETFEREVVQSPVPVLVDFWAPWCGPCRMIAPILEEI
FT                   AEEKAGKLKVAKINVDENMQVAMQHGISSIPTLILYKGGKPVERIIGAMPKQRLLQQIE
FT                   KHL"
FT   gene            80067..81029
FT                   /locus_tag="trd_0072"
FT   CDS_pept        80067..81029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0072"
FT                   /product="putative fructokinase"
FT                   /note="identified by match to protein family HMM PF00294"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05408"
FT                   /db_xref="GOA:B9L290"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9L290"
FT                   /protein_id="ACM05408.1"
FT                   /translation="MFDVVTCGELLVDFVALRRGVRLADAPAFRRAAGGAPANVAVGVA
FT                   RLGRRAAFLGQVGDDDFGHFLAETLHRAGVDTRGLRFSSAARTALAFVSLRADGERDFL
FT                   FYRHPSADMLWRPQDVERSVAGATRIVHFGSVSLIDEPARSATLEAVALARASGALVSY
FT                   DPNLRLTLWPSPTVAREGMLRGLAEADIVKLSSEELAFLTGSSDPASARQLWHDRLRLL
FT                   VVTLGAAGCAYLTRYGEGRVPGFPVRVVDTTGAGDGFVAGLLVGLLEHGGEWSQEIIEQ
FT                   ALRLANAVGALVCTRRGAIPALPTRQRVKQFLRAAAETF"
FT   gene            81053..82456
FT                   /locus_tag="trd_0073"
FT   CDS_pept        81053..82456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0073"
FT                   /product="aminopeptidase"
FT                   /note="identified by match to protein family HMM PF02225;
FT                   match to protein family HMM PF04389"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05964"
FT                   /db_xref="GOA:B9L291"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniProtKB/TrEMBL:B9L291"
FT                   /protein_id="ACM05964.1"
FT                   /translation="MTRDLREFDRIVLGEIWTSDEAWRNLVFLCDDLGHRFAGTDRERR
FT                   AAEFLAERMRAYGLQNVRLEEFPMATWERGPCHLWVTAPLERELPAIAMPYCPSARLEA
FT                   EVIDVGEGELPDFERWASEIPGKIVLTDAETNRPGERKSHRTDKFNWAIQRGAVAVLFI
FT                   NQNPGQLHITGSLTGRTPNGTRAVDREALIPGLGLSYETGMLLRRLAERGALRLRIATE
FT                   NRTYDSRSANVIGEIPGRERPDEIVLVGGHYDGHDIAQGAGDDAAGTVVGLEVGRALAP
FT                   LAGQLRRTVRIICFGAEELGLLGAYHHAAQGAARGERFRFVLNLDGAGRGTGGQEQLVL
FT                   SGLPELVPYFQSLARQLPYDFTIRDELNAHSDHFPFALHGIPNATLSSRDATAGMLGRG
FT                   WGHTEADTLDKVTLRSIQLAAALAARLVIRLSEDEAFPGRLRTPEEVRQQLADAGLLER
FT                   VRATEGNVI"
FT   gene            complement(82533..84128)
FT                   /locus_tag="trd_0074"
FT   CDS_pept        complement(82533..84128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0074"
FT                   /product="Amidohydrolase family"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05012"
FT                   /db_xref="GOA:B9L292"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B9L292"
FT                   /protein_id="ACM05012.1"
FT                   /translation="MQAYLVTNGTILTMDPSQPQVEAFGVIGEWIVSAGSLAEVEAALP
FT                   RGAGRLDLAGATCLPGFNEAHNHMLNFGFVLGQVNCRYPAVRSIEEIVARFAERAEGTP
FT                   PGSWIRGRGYDDNKLTEHRHPTRWDLDRASTAHPLVLVHSSGHMLVANSLALQLAGVSR
FT                   ETPDPPGGHIVRDEHGDPTGLLQENAMELIERVIPAPTLEDMVEALRRCNDAYVAAGIT
FT                   SSQDAGLDDPQQVEAFQRAVQRGLLRLRTSIMLRHQLLPHLLGLGIKQGFGNHHLRIGP
FT                   VKLFADGSLIGRTAAVSRPFLADPRSDNCGITIWSQEELDELVWQAHAAGFQVATHAIG
FT                   DRAIEMVLDAYERALARLPRPDHRHRIEHGGVLRPDLIERIARLGVLVVSQPIFIAEYG
FT                   DGFIRHLGLERIQLTYPFRSLLDAGIRLVFSTDCPVSAYQPLRCIQAAVQERTASGRSY
FT                   ALEEAITVEEALPLYTVNGAYASFEEHCKGMLRPGMLADFVVLERDPRRVDPEELAEIR
FT                   VLRTVIGGETVYEA"
FT   gene            84484..84822
FT                   /locus_tag="trd_0075"
FT   CDS_pept        84484..84822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0075"
FT                   /product="putative arsenic-efflux pump regulatory protein"
FT                   /note="identified by match to protein family HMM PF01022"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06312"
FT                   /db_xref="GOA:B9L293"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9L293"
FT                   /protein_id="ACM06312.1"
FT                   /translation="MEHHCCPIDDRSRVGHALPTRQLAQLARALADETRLEILTLLVEQ
FT                   NQPICVCHLVERVPVGQPTVSHHLRLLRQAGLVTVERRGTWAYYQATPLARLLLERLSE
FT                   AIHWPVMA"
FT   gene            85026..85256
FT                   /locus_tag="trd_0076"
FT   CDS_pept        85026..85256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0076"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05258"
FT                   /db_xref="UniProtKB/TrEMBL:B9L294"
FT                   /protein_id="ACM05258.1"
FT                   /translation="MGISGGLVFRPPVHVVGARSISFVDRVHPCWLTVLSSREFDEGEP
FT                   NQRPTAYREALGKLLLSRSGPGAHAGAVIRG"
FT   gene            85283..86776
FT                   /locus_tag="trd_0077"
FT   CDS_pept        85283..86776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0077"
FT                   /product="putative FAD dependent oxidoreductase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04591"
FT                   /db_xref="GOA:B9L295"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9L295"
FT                   /protein_id="ACM04591.1"
FT                   /translation="MVVRETLPVVVVGAGPIGLVAAAHLAQRGLPFLVLEAGPDIATSV
FT                   RRWSHVRMFSPWHFDLDPVAVSLLTSEGWSSPDPESYPTGGEFIARFLEPLARHPLIRP
FT                   ALRFSHRVTAIGRLGRDKLSGHDRAGRPFAVRVMTPTGEQELLARAVLDASGAIPNPLG
FT                   GSGWPAIGERACTDSIDYGMPDVLGRDRARYAGARTLVVGAGHSAFGTLLDLVSLAEQE
FT                   PGTVVHWAIRRRSLAGRLGSPQDELPERGRLGQRLAAALEADRIVLHRGILVDRLERTS
FT                   QGIVVFAGERALPPVDRIVCATGYRPDLGLLRELRLALDTVVEAPVALAPAIDPALHSC
FT                   GTVPPHGVEELTHPQEPDFFVVGLKSYGRAPTFLLRTGYEQVRSIVAALAGDWEAARRV
FT                   ELRLPATGVCGGEKGEACCSEPGVTEKETDQPTAVAKRPLLLVGGPERARLRPALEISG
FT                   PACPWPRPSKAEQGVCCADRADEPVCTCESESAGQTCGG"
FT   gene            complement(86783..87646)
FT                   /locus_tag="trd_0078"
FT   CDS_pept        complement(86783..87646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0078"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05883"
FT                   /db_xref="GOA:B9L296"
FT                   /db_xref="InterPro:IPR019108"
FT                   /db_xref="UniProtKB/TrEMBL:B9L296"
FT                   /protein_id="ACM05883.1"
FT                   /translation="MLLPLLHTCPTCPSVLGITLYPPSLLLIAVPTIVYTLALRRLAQR
FT                   GRPVPTSWVIAFYAGMLSALIALAGPLDTWNDELLTMHMAQHLVLIQVTAPLLLLGRPV
FT                   QVILRALPPQRAGLVTRLLLRPIWSRRVLEFLTRPLVATGLSILALVVWHFPALYEEAV
FT                   LRQSVHDLQHVSFFGTALLFWWPIIDPVPRHHRVSGLWASLMVFITAVASTVIGAILTL
FT                   ADEVLYEPYRYAAMPWGFTPLVDQQVAGLLMWIGGGTLYLVIILVLLARWLLREEGRRM
FT                   ASEPAG"
FT   gene            87796..89814
FT                   /locus_tag="trd_0080"
FT   CDS_pept        87796..89814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0080"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05746"
FT                   /db_xref="GOA:B9L297"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B9L297"
FT                   /protein_id="ACM05746.1"
FT                   /translation="MEAGETSSSSRKSTSIPGTHPGDRFIRHVASSDLPIREVEPGRFI
FT                   AELVEPASVWGKTWVRLRRALIGRPLRTAEAAHERIGKAKALAVFSSDALSSTAYATEE
FT                   ILRVLVLAGTAAYAFVQPIGLAIVLLLAIVVFSYRQTIRAYPHGGGTYIVTKDNLGIAP
FT                   GLLAAGALLSDYVLTVAVSISAGVAAMTSAFPSLYPYRVELAVAAIVLLTVANLRGVRE
FT                   SATIFMLPTYAFIVSIGALILLGLASLAGLGPQPHPIHREVSPPSSPLTLFLILRAFAS
FT                   GSTALTGVEAIADGVPAFKEPQADNARTTLLAMGLILAFLFSGITFLSYHFRLAPNERE
FT                   TIVSQLARTLVDGSPFYYVVQAVTASILFLAANTAFADFPRLGYFLARDRFLPRQFRFQ
FT                   GDRLAFSTGILTLGALTILLVIARHASVAALIPLYAVGVFTAFTLSQTSMVVHWWRSAQ
FT                   GELRRVPWHSLVINAIGAVVTGIVTVVVIVTKFTHGAWIVILLIPALIGMMLAIHRHYV
FT                   SVAEQLRISSEEARHWLRLLPRRSVAIVPIASLNRASLTALAYARVIADDVTAVHVATE
FT                   PETGQTLQQRWREAGLTIPLVIVDSPYRELLGPLVAVIEKLHREKGGPLITVVIPEFVP
FT                   VHWWERLLHTQTAWRLRRALAQIPDLAITMVPYHLRD"
FT   gene            complement(89783..90688)
FT                   /locus_tag="trd_0079"
FT   CDS_pept        complement(89783..90688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0079"
FT                   /product="putative universal stress protein"
FT                   /note="identified by match to protein family HMM PF00582"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04573"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9L298"
FT                   /protein_id="ACM04573.1"
FT                   /translation="MPTLIVPLEYDRTKPQPHGVSERVLPWARALAGRLESSLVLVSVL
FT                   DVPVGLRSLQEQELLRALLEDWRAECRRYLEEIAGTFPSGRPARIFVEEGDPALVLTRL
FT                   AAEVPDPLLVMAAHARAGWRRLVLGSVTAQVIGSGVAPVFVVPAHLPPPVEEPVLDRVL
FT                   VPLDGSRLAEAALTLLPVLGTKGWEVLLLHVRESRARRIEADVIGDDPEAYLRELADRL
FT                   TAQGYRTQWLVAGGRPAQVIVETARARSVDLIAMVTHGWTGLRDVLMGSTAEQVLAHAP
FT                   VPVLVRRPVPFSPGGGTGPS"
FT   gene            complement(90738..91694)
FT                   /locus_tag="trd_0081"
FT   CDS_pept        complement(90738..91694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0081"
FT                   /product="putative integral membrane export protein"
FT                   /note="identified by match to protein family HMM PF03741"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04906"
FT                   /db_xref="GOA:B9L299"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:B9L299"
FT                   /protein_id="ACM04906.1"
FT                   /translation="MVDVPLWGWLAFLALILGLLTLDLGVFHRKAHVVEMKEAGLWVAF
FT                   WVSLSLLFGVFLWWWDGHEAGLQYFTGYLIELSLSADNMFVFVLIFTAFAVPAQYQHRV
FT                   LYYGILGALIMRGLMILGGAWLISQFHWILYIFGAFLVFTGIRMLLEKEEREVDVENNI
FT                   AIRLVSRFAPIVPRYYEQRFFVRIDGKRYATPLIVVLVLVEITDLMFAIDSIPAIFAVT
FT                   RDPFIVFSSNVFAILGLRSMYFLLAGLVRRLAYLRYGLAFILSYIGVKMLIQDFYKIPT
FT                   ALSLGIVIVTLAISVIVSLVLAERRTVRQPVEVPPRD"
FT   gene            complement(92197..93852)
FT                   /locus_tag="trd_0082"
FT   CDS_pept        complement(92197..93852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0082"
FT                   /product="alpha-D-1,4-glucosidase"
FT                   /note="identified by match to protein family HMM PF00128"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05526"
FT                   /db_xref="GOA:B9L2A0"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022567"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A0"
FT                   /protein_id="ACM05526.1"
FT                   /translation="MRANRSPALSPCGEGTVEEERRWSWWQRAVIYHIYPRSFADSNGD
FT                   GVGDLEGIRRKLDYLTWLGVDALWLSPIFRSPMADFGYDISDYLDVDPTFGTLEDLDRL
FT                   IADAHARGIRVILDFVPNHTSDQHPWFIESRSHRDNPRRDWYIWADPAPDGGPPNNWRS
FT                   VFGGSAWKFDTATGQYYLHTFLEEQPDLNWRNPEVQAAMLDVLRFWFARGVDGFRLDAI
FT                   WFLIKDAELRDNPVDPDYTPDQPAYRELLPVYTSDRPEVHDILARMRQVADAFGERLLI
FT                   GEIYLPIGRLVTYYGCRHRRELHLPFNFQLMLVPWEAQRIAAAIDTYEALLGPDDWPNW
FT                   VLSNHDRPRVATRIGEEQARVAALLLLTLRGTPTIYYGDELGLADVPIPPDRRRDPLEH
FT                   TIGPGAGRDPCRTPMPWDTSPYAGFSTVEPWLPLNPDYPKRNVAVQRDDPRSMLSLYRQ
FT                   LLILRRAEPALAIGSYRPVSATRDLLAYLREAAGRRLLVALDFGGREQVFTTTRFTLHG
FT                   RILLSTHLDRAGEMVSGSLHLRPNEGCIVALAAH"
FT   gene            complement(93878..94369)
FT                   /locus_tag="trd_0083"
FT   CDS_pept        complement(93878..94369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0083"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05641"
FT                   /db_xref="GOA:B9L2A1"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A1"
FT                   /protein_id="ACM05641.1"
FT                   /translation="MRTAALRFLRSLGSCHDEACAFPAEVAPLNQALRRRHPSVLSVAG
FT                   IRESSHCAFPLDSPSSLRQAGTRVKRLGWEERAMGEILPISAGILVGLICWRIASVRLR
FT                   TAALVVLSVLFGALASLVNGELALSWGFLLIDIPLVFLVAVGTSLLVSRLVSARQTARR
FT                   "
FT   gene            94450..96873
FT                   /gene="recG"
FT                   /locus_tag="trd_0084"
FT   CDS_pept        94450..96873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recG"
FT                   /locus_tag="trd_0084"
FT                   /product="ATP-dependent DNA helicase RecG"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF01336; match to protein family HMM PF04851;
FT                   match to protein family HMM TIGR00643"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05622"
FT                   /db_xref="GOA:B9L2A2"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004609"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033454"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A2"
FT                   /protein_id="ACM05622.1"
FT                   /translation="MTTGTSQDPFQLLRRILELEKRKGFQDTAAAGGLERLVARNLLGW
FT                   LAEFPSQKARLQELAALFRGYADRSPAARAELVEKALAVLDGSASVPAEQTRRPARPRP
FT                   AARTAPVRVDRAVEPDDPVTVLPGVGSQRARQLEALGVTTVRDLLFLVPRRYLDYTQVV
FT                   PIGRLGRLVRPGEEVTCSVIGEVVQIETRETSGGRRYVSVQLRDETGTIPVIWFNPYIA
FT                   RQLEAGQRIAVSGRLEGHGPYVRFRNPEWEPAEAELLQAGRIVPVYPLTQGLYQRQVRQ
FT                   LTRAALDLALPRLEDPLPPALRERNRLPSLAWALEQLHYPETLAAAERARRRLAFDEFL
FT                   VLQLGLVQRRLAWHAQAGIAIPIDRAFLETFLASLPFQLTGAQRRALEEILADLAEPHP
FT                   MSRLLQGDVGSGKTVVAAAAALLVHRAGYQAAILAPTEILAEQHFRTLTRLYHGLPGGE
FT                   RPLVALLTGSTPERDRGSILAGLASGTISIIVGTHALLEERVQFRRLALAVIDEQHRFG
FT                   VLQRHTLRSKGENPHVLVMTATPIPRSLALVLHGDLDLSIIDELPPGRQPVKTYVVPGR
FT                   KRTQAYEFVRREIEKGHQAFIICPLVEESEAIEARAATAEYERLQREVFPDLRLGLLHG
FT                   RMSPREKEDVMTRFRDGELHILVSTAVVEVGIDIPNATVILIEGAERFGLAQLHQFRGR
FT                   VGRGSAPSYCLLVSDASTETARQRLEAVASTTDGFRLAEIDLELRGPGEFLGTRQSGLP
FT                   NLRFASLADLSTLQAARRTAEDLLRQDPLLAAPEHVPLAELVRALWTRSVADVS"
FT   gene            96888..97676
FT                   /locus_tag="trd_0086"
FT   CDS_pept        96888..97676
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0086"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05908"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A3"
FT                   /protein_id="ACM05908.1"
FT                   /translation="MPSPVFWLDESLLGRVLAPFLRPVLEQMGWELRQQRDLTAMTLRR
FT                   FPGLALLDTIEALALVPAYALATDLALVAQHASVVALETPDRPDQIGEAVVVSEGCRPA
FT                   SRALARATIEPFFGLRIRAWDGEQGADALPVLRVHEDEAALGPLGERSHDLGRAWFVLT
FT                   GQPFVSHLLVVAPELPSDVLRPVASLLQVLPEQLAGRAAEIAAELVAARPLDAGRLRVV
FT                   LTEALSVVTPKVRKAVDELVRRSGSGLRLPPGEIYRPLAS"
FT   gene            complement(97655..98257)
FT                   /locus_tag="trd_0085"
FT   CDS_pept        complement(97655..98257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0085"
FT                   /product="putative flavin reductase-like protein"
FT                   /note="identified by match to protein family HMM PF01613"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04570"
FT                   /db_xref="GOA:B9L2A4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A4"
FT                   /protein_id="ACM04570.1"
FT                   /translation="MGRKERREPRLAARLLEPGPVVLVTTHYRAQPNVMTAAWVIPLSL
FT                   EPPRIGLAVHPSRLTHELLTKGEFFTLNIVTIEYLPALHLCGLLSGRDTDKFTRAQLHP
FT                   TDALETDVPVLEEAIAQIECGLAARLSLGDHDLFVGEVLAVAADSELFGDRWLHLEEAP
FT                   LAHHVGGEWYAALARVYRARLPDEEETEAEDHEASGR"
FT   gene            complement(98264..99400)
FT                   /locus_tag="trd_0087"
FT   CDS_pept        complement(98264..99400)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0087"
FT                   /product="putative glycosyl transferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06092"
FT                   /db_xref="GOA:B9L2A5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A5"
FT                   /protein_id="ACM06092.1"
FT                   /translation="MRILMVSKALVNGMYQRKLEELARLPGIELLAVVPPAWHESRVGV
FT                   LQLERRFVQGYQLVVEPMWFNGHHHIHLYPGLGKQIARFRPDILHIDEEPYNLVTAHAA
FT                   LLGWRYGARMLFFTWQNLYRRYPPPFSWFERLNYRLASMAVAGNQEAAAVLRRKGYQGP
FT                   LAVIPQFGVDPDLFRPLSVPRADVPTLGFVGRLVPEKGADLVIRALARLPVRVQLEIVG
FT                   EGTERTRLELLAAQLGVRDRVIFRGSVPAALMPEALNRFDLLVVPSRTRRNWKEQFGRV
FT                   IIEAMACGVPVVGSSSGEIPHVIGDPSLIFPEDDVEALARLLATLLVNPERLRELGEAG
FT                   RRRVLAHYTQRRIAEQYYAVYQAMLAAPRARHSTAERS"
FT   gene            complement(99388..100728)
FT                   /locus_tag="trd_0088"
FT   CDS_pept        complement(99388..100728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0088"
FT                   /product="glycosyltransferase WbpY"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06298"
FT                   /db_xref="GOA:B9L2A6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A6"
FT                   /protein_id="ACM06298.1"
FT                   /translation="MQSARSLLAPDFPWNALPARQAGGWLRYLEDGPSRARTLYSPWEE
FT                   RGAVAGTRIDVLLDGAFIAQPRTGSGQYTLALWRELARNDDPVVTLALPAQPPVDLADA
FT                   ARALVLVPPTRWPSKVRKLWWEQRGIPQLARAVQPRLVHIPYFAAPLRLSTPFVVTVHD
FT                   VIPLVLPEYRSSLAMRFYTALMRRTVRRARLILTDSEWSRKDIVRVLGYPAERIRVVPL
FT                   GVEERFAPTPEPDATQALAQAWGITGPVVLNLGGFDVRKNLPLLVRAFARALPRLPAGT
FT                   RLVIPGQPHSANPRLYPPLAPLIRELGLEQHVLLPGPVSEEEKLLWYRLASVYAYPSRY
FT                   EGFGLSPLEAMACGTPVIAARCTSLPEVVGEAGILVEPEEDAFAEALVRVLTDAELRCT
FT                   LRERGLARARMFSWQRTAEQTLTVYREAIAEAGGNGLRAVVGKPCGS"
FT   gene            100807..100998
FT                   /gene="rpmB"
FT                   /locus_tag="trd_0089"
FT   CDS_pept        100807..100998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmB"
FT                   /locus_tag="trd_0089"
FT                   /product="ribosomal protein L28"
FT                   /note="identified by match to protein family HMM PF00830;
FT                   match to protein family HMM TIGR00009"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05298"
FT                   /db_xref="GOA:B9L2A7"
FT                   /db_xref="InterPro:IPR001383"
FT                   /db_xref="InterPro:IPR026569"
FT                   /db_xref="InterPro:IPR034704"
FT                   /db_xref="InterPro:IPR037147"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L2A7"
FT                   /protein_id="ACM05298.1"
FT                   /translation="MAMCELCGKKPMFGHNVSHSNRKTNRKFKPNVQRVTVILNGVPKR
FT                   MRICTRCLRTLYKEAREA"
FT   gene            complement(101023..101874)
FT                   /locus_tag="trd_0090"
FT   CDS_pept        complement(101023..101874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0090"
FT                   /product="methyltransferase, HemK family"
FT                   /note="identified by match to protein family HMM TIGR00536;
FT                   match to protein family HMM TIGR03387"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06037"
FT                   /db_xref="GOA:B9L2A8"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A8"
FT                   /protein_id="ACM06037.1"
FT                   /translation="MLTLRDVLRRATERLRQSGSPTPRLDAEVLLCHVLGIDRAELYRR
FT                   LPEQPPGTLERFWELVARRERGEPVAYLTGHREFYGLDFLVTPETLIPRPETEFLVTWA
FT                   AERLRARHDEPRCVDVGTGCGAIIVSLAVTLGKQHPAVLVGSDRSLAALQVARVNRERL
FT                   APGRVHLVCGDLLSWCRGPLDLVVANLPYLRPDQWHPGLAWEPAEALFAPDEGFGWYAR
FT                   LLPQVATLLRSGGGCIVEIDPAQAERALSTARSLFPHGKIAIRRDLAGLSRYLTIELPD
FT                   PT"
FT   gene            complement(101883..102974)
FT                   /gene="prfA"
FT                   /locus_tag="trd_0091"
FT   CDS_pept        complement(101883..102974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prfA"
FT                   /locus_tag="trd_0091"
FT                   /product="peptide chain release factor 1"
FT                   /note="identified by match to protein family HMM PF00472;
FT                   match to protein family HMM PF03462; match to protein
FT                   family HMM TIGR00019"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04723"
FT                   /db_xref="GOA:B9L2A9"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2A9"
FT                   /protein_id="ACM04723.1"
FT                   /translation="MTTQTVSVLDKLAELEQRFDEVERQLADPDVATDPQRVAQLARER
FT                   AELEEIVALYRQLKDIDRQVAQAEELLEAEDPDLVELAAEEIDRLREYRETIYQELRRR
FT                   LVPRDPNDEKDVIVEIRAGTGGEEAALFAADLFRMYTRYAERQGWKVEVLSSSPTELGG
FT                   FKEIIFEVRGKGAYSHFKHESGVHRVQRVPITESSGRIHTSTATVAVLPEADEVEVHID
FT                   EDDLRIEVFRSSGHGGQSVNTTDSAVRITHLPTGIVVSCQDERSQLKNRLKAMAVLRAR
FT                   LYELQRRKLEEERTGLRRQQVGTGERAEKIRTYNFPQDRVTDHRLKLTVNNLPAVLDGE
FT                   IDIFIQELQALEMAERLRAAGID"
FT   gene            complement(102971..103480)
FT                   /locus_tag="trd_0092"
FT   CDS_pept        complement(102971..103480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0092"
FT                   /product="conserved hypothetical protein TIGR00725"
FT                   /note="identified by match to protein family HMM TIGR00725"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05523"
FT                   /db_xref="InterPro:IPR005268"
FT                   /db_xref="InterPro:IPR041164"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B0"
FT                   /protein_id="ACM05523.1"
FT                   /translation="MKSARHVAVCGPHEATPEEQALAERLGELLAVSGLTVVCGGRGGV
FT                   MAAVCRGAKRRGGQTIGILPGTDPSDANEWVDHPICTGLGEARNVVVVASGRVVIAVGG
FT                   GLGTLSEIALALKLGRPVIALRSWPLDASLLSRAGATISEVATPEEAVNQVLAVLSVQP
FT                   TGGAEL"
FT   gene            complement(103477..104052)
FT                   /locus_tag="trd_0093"
FT   CDS_pept        complement(103477..104052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0093"
FT                   /product="2'-5' RNA ligase"
FT                   /EC_number="6.5.1.-"
FT                   /note="identified by match to protein family HMM PF02834;
FT                   match to protein family HMM TIGR02258"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04884"
FT                   /db_xref="GOA:B9L2B1"
FT                   /db_xref="InterPro:IPR004175"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B1"
FT                   /protein_id="ACM04884.1"
FT                   /translation="MREEWRLFAAIPVPDDVRQRVAAAIAHLQARGYRAKWVDPEATHL
FT                   TVKFFGSVATDSLPDLTRALRKSVTGLARFELQVHGAGAFPHPLRPRVLWLGIDGETAP
FT                   LAQLVEQVERSAGSFAEKTDERPFHPHLTLARVRPEDLATLRALPQELERLARLPPLPF
FT                   TVDRLTLYRSELFRSGPRYTIIEEFLLR"
FT   gene            104245..104499
FT                   /locus_tag="trd_0094"
FT   CDS_pept        104245..104499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0094"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04713"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B2"
FT                   /protein_id="ACM04713.1"
FT                   /translation="MESREPIDCWQELGLPFPPERLRGRLVPCPQCGAPLALMRRRRFY
FT                   ALCATVEETSQGAVLICRQCGARQPVRELLLSGRRARTG"
FT   gene            104551..105408
FT                   /locus_tag="trd_0095"
FT   CDS_pept        104551..105408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0095"
FT                   /product="P-protein"
FT                   /EC_number="5.4.99.5"
FT                   /EC_number="4.2.1.51"
FT                   /note="identified by match to protein family HMM PF00800;
FT                   match to protein family HMM PF01842"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05849"
FT                   /db_xref="GOA:B9L2B3"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B3"
FT                   /protein_id="ACM05849.1"
FT                   /translation="MRLAYLGPPGTFTEEAALRYAERESAELIPFSSMPALVSAVETGL
FT                   ADRAILPIENSLEGTVSTTVDLLIHETDLKICAELILPVRHFLLAHPGTRLEEIRVVLS
FT                   HPQALAQCRRFLERCLPQAEQVAALSTAAAVAEVMRSEDRSRAAIGTLRAAELYGAVVL
FT                   ARDIQDQKSNATRFVVLAHQDAEPTGVDRTSLCFTVKRNVPGALVEVLNELAVANIQMT
FT                   KVESRPMKSVLGEYVFLVDIEGHRKDPHIAAALERVAEKAAELKIFGSYPRDEDGLNGT
FT                   RGSR"
FT   gene            105421..106008
FT                   /locus_tag="trd_0096"
FT   CDS_pept        105421..106008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0096"
FT                   /product="N6-adenine-specific methylase"
FT                   /note="identified by match to protein family HMM PF03602;
FT                   match to protein family HMM PF05175"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06368"
FT                   /db_xref="GOA:B9L2B4"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B4"
FT                   /protein_id="ACM06368.1"
FT                   /translation="MRVIGGSARGRRLKAPRGLRTRPMADKIREALFSMLDSLGIRPQR
FT                   VLDLYAGSGAIGIETLSRGARWVDFVDRSAAACAVIRDNLTATGFADRGAVHCTTVQAF
FT                   LRRPPREPYDFVIMDPPYADPTIHETMLAVARSPHVRDGTILVVGHSPRVPMPERLDGL
FT                   EQLRDRCHGDSCVAIYVIRRGERAEAEDEGDP"
FT   gene            106005..106508
FT                   /gene="coaD"
FT                   /locus_tag="trd_0097"
FT   CDS_pept        106005..106508
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaD"
FT                   /locus_tag="trd_0097"
FT                   /product="pantetheine-phosphate adenylyltransferase"
FT                   /EC_number="2.7.7.3"
FT                   /note="identified by match to protein family HMM PF01467;
FT                   match to protein family HMM TIGR00125; match to protein
FT                   family HMM TIGR01510"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05333"
FT                   /db_xref="GOA:B9L2B5"
FT                   /db_xref="InterPro:IPR001980"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9L2B5"
FT                   /protein_id="ACM05333.1"
FT                   /translation="MSHRALYPGTFDPITNGHVDVVQRAARLFDFLIVGIYAGHEGRAK
FT                   QPLFSAEERRFLAEQALRHLPNVRVDVFSGLAVDYARAVGAQAIVRGLRAVSDFEYEFS
FT                   LAHMYRHLAPDVDVVCLMTSSQYSFISSSMIKEVAQLGGNLTGLVPDHVAEALVQKFRT
FT                   LVRE"
FT   gene            106513..107001
FT                   /locus_tag="trd_0098"
FT   CDS_pept        106513..107001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0098"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04952"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B6"
FT                   /protein_id="ACM04952.1"
FT                   /translation="MASVDELRGYPVAEPAPDLYQLLERLQELAERSRRMPFSNSLMID
FT                   EHELLDLVYSLRQAFPRELRQARRVLQDRQQIIAEAQLEAQRILATAQERAQYLMSEQG
FT                   IMNETRARCEEMLRQAMERKQRIMSETDEYVRQMLEQIEAAALSTLQHVQRVKTELKL"
FT   gene            complement(107040..107246)
FT                   /locus_tag="trd_0099"
FT   CDS_pept        complement(107040..107246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0099"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05686"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B7"
FT                   /protein_id="ACM05686.1"
FT                   /translation="MRQTPSLSMSLEPRSVEEVEKLTPGLRSVALLLPDRAQHVRTARA
FT                   KPTILPGFARAQLNARRAHLRLR"
FT   gene            complement(107247..109193)
FT                   /locus_tag="trd_0100"
FT   CDS_pept        complement(107247..109193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0100"
FT                   /product="putative methyl-accepting chemotaxis protein"
FT                   /note="identified by match to protein family HMM PF00015;
FT                   match to protein family HMM PF00672"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05284"
FT                   /db_xref="GOA:B9L2B8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B8"
FT                   /protein_id="ACM05284.1"
FT                   /translation="MAIENGADEETVQRLLADSQRTRQDYEERLSYWRSVLPEGEIRQS
FT                   LTEQAADPAREFFDIRDRQVIPALLAGETARAEELIWNELRPRFEAHRSAIDRTVELGY
FT                   ASVNNSEQSAEGVVARVNVLVPAVSLISALLATLLAALMARLLTKRLGHVAKALDELTT
FT                   HDIPALERALGALARGDLRATVSFKVRPSELTGRDEVATLIGAYNRLQSALGNVEQSFR
FT                   TLVEGLRDMVTSLRGAAALINDVGADVHRRVEQTTVAIQSMTGAAERVARGSADQANAL
FT                   TGLRQSLTELAQTSDALAKAAADQARVVHQAFELASEINRQNREAAQTARAVGRLATEH
FT                   AQHAQRGQRAVERTLGAITRAQAKSTEAQKRVDEMVKHAQSIDQVLTIVRSITEQTNLL
FT                   ALNAAIEAARAGEAGRGFAVVTEEVRKLSANAAESTTHIAELVHQLQNSAASAGQAATE
FT                   SLEAMTGVVTETNTVSDLFESTAEAARELATLSERALTLAEQALKSVEYLRAQLEQAAS
FT                   TVEETSAGTAELATSVATISTTASQLSAIGEENAQASEHASNAMEEISHELSEVAHNAQ
FT                   ALFQLAQQLLRETERFLLDQPVAHAQADSSRRLLPVDSVHSLGDGLALPVAASRTGSLM
FT                   PAPSRWTNGHGEP"
FT   gene            complement(109215..109424)
FT                   /locus_tag="trd_0101"
FT   CDS_pept        complement(109215..109424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0101"
FT                   /product="methyl-accepting chemotaxis protein McpL"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05900"
FT                   /db_xref="GOA:B9L2B9"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2B9"
FT                   /protein_id="ACM05900.1"
FT                   /translation="MVGFIARFRLGYQMGLMVLVFLTGFILSSAVSMYGLRQVMVNGPL
FT                   YQQIARDQELIADILPPPAYIVDA"
FT   gene            110224..111843
FT                   /gene="trpE"
FT                   /locus_tag="trd_0102"
FT   CDS_pept        110224..111843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpE"
FT                   /locus_tag="trd_0102"
FT                   /product="anthranilate synthase component I"
FT                   /EC_number="4.1.3.27"
FT                   /note="identified by match to protein family HMM PF00425;
FT                   match to protein family HMM PF04715; match to protein
FT                   family HMM TIGR00564"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05014"
FT                   /db_xref="GOA:B9L2C0"
FT                   /db_xref="InterPro:IPR005256"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2C0"
FT                   /protein_id="ACM05014.1"
FT                   /translation="MTRTDAALRSPARRYHPSLEEVAVLAREATVIPIYRELDADLETP
FT                   VSAFLKVASEPYAFLLESVEGGERLARYSFIGTDPFLLVELDRGCARLRRTGTRTAFAA
FT                   PALASFGGADYYEPPTAEQVTTFSDPLRFLERLLARYRTVHLPGMPRFLGGAVGYLGYE
FT                   AIRYFEPRVPAAPRDTLGMPEAVFLLVDSMLVFDHLEHTIAVVSHVHVEEGISLAQAYA
FT                   DAVERIERLVDRLRRPPVIPFGPGPVDPESVEARLRPHVEPAQYVAMVERAKEYIAAGD
FT                   VIQVVLSQRQELETGAHPFTIYRALRRINPSPYMYFLRLGDDALIGASPEMLVRVDGRE
FT                   LSTHPIAGTRRRGRTPEEDAALAEELAADEKERAEHIMLVDLARNDIGRVAQPGTVHVP
FT                   RLMVVERYSHVMHLVSEVAGRLREDLSALDALRSCFPAGTVSGAPKVRAMEIIAELEPE
FT                   QRGPYAGAVGYVDFSGNLDTAITLRTIVMRGQRAFLQAGAGIVADSVPEFEHKECHHKM
FT                   RALVRAIEQAERLETEQRGGRA"
FT   gene            111840..112451
FT                   /locus_tag="trd_0103"
FT   CDS_pept        111840..112451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0103"
FT                   /product="para-aminobenzoate synthase glutamine
FT                   amidotransferase component II"
FT                   /EC_number="2.6.1.85"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM TIGR00566"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06346"
FT                   /db_xref="GOA:B9L2C1"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9L2C1"
FT                   /protein_id="ACM06346.1"
FT                   /translation="MILVIDNYDSFTFNLVQYLAELGADLVVFRNDAVTVEEIEDLAPA
FT                   GIVVSPGPCTPREAGISVPVIQRFRGRVPILGVCLGHQAIGAAYGARIVRAPRLMHGKT
FT                   SWITHDGKGVFAGLPNPFLATRYHSLMVEEESLPEDLVVTARSEDGVIMGVRDRTGLVE
FT                   GVQFHPESILTAVGKELLRNFLHQVDTHQRELVSSKGGTA"
FT   gene            112448..113494
FT                   /gene="trpD"
FT                   /locus_tag="trd_0104"
FT   CDS_pept        112448..113494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpD"
FT                   /locus_tag="trd_0104"
FT                   /product="anthranilate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.18"
FT                   /note="identified by match to protein family HMM PF00591;
FT                   match to protein family HMM PF02885; match to protein
FT                   family HMM TIGR01245"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05533"
FT                   /db_xref="GOA:B9KXB8"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR005940"
FT                   /db_xref="InterPro:IPR017459"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="InterPro:IPR036320"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXB8"
FT                   /protein_id="ACM05533.1"
FT                   /translation="MIGSVLQKVVAGQILDIDEAMEAMSAIMTGEATPAQIAALVTALR
FT                   MRGERETEIAGFVKGLRAHMIPVELQLAQPVIDVVGTGGDGNRTFNISTATAFVVAGAG
FT                   VPVAKHGNRAMSSRAGSADVLEALGVRIDLNPSAVARCVEEAGIGFMFAQRFHPALRHA
FT                   APVRRELGFRTVFNVLGPLANPARVRYQLLGVAMPELVETVARVLALLDVEHALVVHSA
FT                   DGLDEISLGAPTTVYEVRRNGTVEVRRWTLEPESLGLERVPSDALRGGTAEENARIVRA
FT                   VLEGARGPARDVVLLNAAAALVAADAAQSLAEGLELARHAIDSGAALDRLERLKVLSNA
FT                   LAEAEVPS"
FT   gene            113491..114318
FT                   /gene="trpC"
FT                   /locus_tag="trd_0105"
FT   CDS_pept        113491..114318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpC"
FT                   /locus_tag="trd_0105"
FT                   /product="indole-3-glycerol phosphate synthase"
FT                   /EC_number="4.1.1.48"
FT                   /note="identified by match to protein family HMM PF00218"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06153"
FT                   /db_xref="GOA:B9KXB9"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR013798"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXB9"
FT                   /protein_id="ACM06153.1"
FT                   /translation="MTRTGTVLDRIVERTSADLAERRRRVPEGALRAQAHEQAPPVPLV
FT                   PALRADRVSVIAEVKRGSPSRGLFAPEADAAAVAMDYLAGGAAALSVLTDEPFFHGSLK
FT                   DLAVVARLAHASPGPVPVLRKDFLLDPYQIVEARAHGADAVLLIVAVLDRWQLAELLGV
FT                   TWELGMEALVEVHDESELATAVEAGARVIGINNRDLRTFTVDLTVSERLAPLVPADRVV
FT                   VAESGIHSVADVERLARAGIDAILVGEALMMAPDRRAIVQALGSVEVVRCRGS"
FT   gene            114303..114995
FT                   /gene="trpF"
FT                   /locus_tag="trd_0106"
FT   CDS_pept        114303..114995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpF"
FT                   /locus_tag="trd_0106"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase"
FT                   /EC_number="5.3.1.24"
FT                   /note="identified by match to protein family HMM PF00697"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05336"
FT                   /db_xref="GOA:B9KXC0"
FT                   /db_xref="InterPro:IPR001240"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC0"
FT                   /protein_id="ACM05336.1"
FT                   /translation="MPGLVKLCGMRTPEDARAAIETGADLIGLVFAPSRRRVSLEEARA
FT                   ICRTVRESRNPPRIVGLFVDAPVDEIAMIASALELDLVQLHGNEPPEVLARLGWPALKA
FT                   IRLRPGESLEAACDRIAPYFSRERNPLAILLDAYHPSLLGGTGQIVDWTLAAELAARFP
FT                   IILAGGLRPETVAEAIALVRPLGVDVSSGIERDGHKDPQLMQAFVAAARRAFLTLDRPA
FT                   EIRIGGMR"
FT   gene            114992..116206
FT                   /gene="trpB"
FT                   /locus_tag="trd_0107"
FT   CDS_pept        114992..116206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpB"
FT                   /locus_tag="trd_0107"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00291;
FT                   match to protein family HMM TIGR00263"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04822"
FT                   /db_xref="GOA:B9KXC1"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC1"
FT                   /protein_id="ACM04822.1"
FT                   /translation="MTTRTQPVRQLPDERGRFGEFGGMYAPVTLLPAIEELIAAYEDAR
FT                   RDPAFQAEFERLLRDFVGRPTPLYYAASLTETVGGARIFLKREDLAHTGAHKINNAVGQ
FT                   GLLAKRMGKPRVIAETGAGQHGVATATVCAMLGLECVVYMGELDVQRQSLNVFRMKLLG
FT                   AEVRPVSSGSRTLKDAMNEAIRDWVTNVRTTYYLVGSVAGMHPYPMIVRDFQSVIGKET
FT                   REQVLAAVGRLPDAVVACVGGGSNAIGIFSAFLEDESVELHGAEAAGEGIETGRHAASL
FT                   TAGRVGVLHGSRSFVLQDEDGQIVEAHSIAAGLDYPGVGPEHAYLKVTGRAQYHAITDA
FT                   EALAAFQLLCRTEGIIPALESAHAIALAVRLAKERPRDQVIVVNLSGRGDKDMQTVASA
FT                   LGVTL"
FT   gene            116206..117036
FT                   /gene="trpA"
FT                   /locus_tag="trd_0108"
FT   CDS_pept        116206..117036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpA"
FT                   /locus_tag="trd_0108"
FT                   /product="tryptophan synthase, alpha subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="identified by match to protein family HMM PF00290;
FT                   match to protein family HMM TIGR00262"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06119"
FT                   /db_xref="GOA:B9KXC2"
FT                   /db_xref="InterPro:IPR002028"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018204"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC2"
FT                   /protein_id="ACM06119.1"
FT                   /translation="MRRTSRIADAFAALRARGQLGIIPYLTIGYPQRESTLELVPALVR
FT                   GGACAVELGIPFSDPLADGVTIQRASHVALANGVTVRFCLETAARLREQGVDVPLVFMG
FT                   YFNPLLQYGLERFVHACVEVGVDGVIVPDLPPNESDELHALCRAAGRDLIFMVAPTSTD
FT                   RHLREVAARASGFVYCVSLTGVTGARERLPDDLPAFLQRVRAVTALPLALGFGISRPEH
FT                   VSQARGLVDAVVVGSALLDRLAGEPPEGQAAAAESFIAWLRQGADAVAPVGEGS"
FT   gene            117043..117459
FT                   /gene="aroH"
FT                   /locus_tag="trd_0109"
FT   CDS_pept        117043..117459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroH"
FT                   /locus_tag="trd_0109"
FT                   /product="chorismate mutase"
FT                   /EC_number="5.4.99.5"
FT                   /note="identified by match to protein family HMM PF07736;
FT                   match to protein family HMM TIGR01796"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04473"
FT                   /db_xref="GOA:B9KXC3"
FT                   /db_xref="InterPro:IPR008243"
FT                   /db_xref="InterPro:IPR035959"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC3"
FT                   /protein_id="ACM04473.1"
FT                   /translation="MVQCRGIRGATTVEANTAEAIVQATRELLLALVEANGVEPDQIAS
FT                   IIFTTTRDLTATFPAVAARELGWIHVPLLCAHEMDVPGAPMGVVRVLMHVNTEKSPREI
FT                   RHVYLRGARVLRPEFGQDLTVLTEDRRGMGGAEQ"
FT   gene            117456..118514
FT                   /gene="aroF"
FT                   /locus_tag="trd_0110"
FT   CDS_pept        117456..118514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="trd_0110"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR01361"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06152"
FT                   /db_xref="GOA:B9KXC4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR041071"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC4"
FT                   /protein_id="ACM06152.1"
FT                   /translation="MIVVMQPGATQEQIQAVIDRVAEFGFQTKLAPGAERMVIGVVGSP
FT                   LPDTLKEALERLPGVEEVIRVSKRYKLVSREFYPLDTVIQVRDVTIGGNEVVVIAGPCS
FT                   VENERQILETARAVKAAGASMLRGGAFKPRTSPYEFRGLGEQGLKLLAKAREETGLPIV
FT                   TEVLSAQHVDLVAEYADLLQIGARNCQNYLLLEAVGRAKKPVLLKRGMAVQIEEWLLAA
FT                   EYIVAQGNEQVLLCERGIRTFETFTRNTLDLNAVPAVKHLSHLPIIVDPSHGTGRWFMV
FT                   PAMMLAAVAAGADGLIVEVHPNPDHALSDGAQSLTPENFAAVMPKLAAVARAVGRSLRG
FT                   VATAEPSLSPAD"
FT   gene            118523..119179
FT                   /locus_tag="trd_0112"
FT   CDS_pept        118523..119179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0112"
FT                   /product="histidine biosynthesis bifunctional protein
FT                   hisIE"
FT                   /EC_number="3.5.4.19"
FT                   /EC_number="3.6.1.31"
FT                   /note="identified by match to protein family HMM PF01502;
FT                   match to protein family HMM PF01503; match to protein
FT                   family HMM TIGR03188; match to protein family HMM
FT                   TIGR03456"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05494"
FT                   /db_xref="GOA:B9KXC5"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC5"
FT                   /protein_id="ACM05494.1"
FT                   /translation="MSDDALARLLGAIRFGADGLVPLIVQDATTGQVRMVGYVNADAVR
FT                   RTVETGRVHFWSRSRQRLWMKGETSGHVLELVELRTDCDGDALLARVHPHGPTCHTGRP
FT                   SCFDTEPLVGTSQDPVNATILDELASIIAARAVEPQPGSYTSALLQAGVDRIARKIGEE
FT                   AAEVIVAAKNGEPEAIAQEAADLLYHLLVLLQASGVPAGEVWRVLQARRGRHSSS"
FT   gene            complement(119164..119718)
FT                   /gene="rimM"
FT                   /locus_tag="trd_0111"
FT   CDS_pept        complement(119164..119718)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rimM"
FT                   /locus_tag="trd_0111"
FT                   /product="16S rRNA processing protein RimM"
FT                   /note="identified by match to protein family HMM PF01782;
FT                   match to protein family HMM PF05239; match to protein
FT                   family HMM TIGR02273"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04633"
FT                   /db_xref="GOA:B9KXC6"
FT                   /db_xref="InterPro:IPR002676"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR011033"
FT                   /db_xref="InterPro:IPR011961"
FT                   /db_xref="InterPro:IPR027275"
FT                   /db_xref="InterPro:IPR036976"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC6"
FT                   /protein_id="ACM04633.1"
FT                   /translation="MTRSTPNRQPPVERPASPERLSIGRIVGAHGVRGTVKLKIWTHFP
FT                   ERIPHLEYVYLGEEPTPRRLLRARVQGDLAFLQLEGITTRNEAEAMRGVVVRIDRSQAA
FT                   PLGEDEYYQFEILGLQVVDEAGNVLGRVIEILETGANDVYVVQRPDGSELLLPAIRSVI
FT                   LAVDLEQQRLVVRPPRYYDEE"
FT   gene            complement(119681..120028)
FT                   /locus_tag="trd_0113"
FT   CDS_pept        complement(119681..120028)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0113"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05681"
FT                   /db_xref="GOA:B9KXC7"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR020627"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC7"
FT                   /protein_id="ACM05681.1"
FT                   /translation="MQRRDGQRPPQRPPRRERPPIDPDLAMNRLATLVRYIAGQLVDDP
FT                   DAIQVRARRRGRAVILRLSVPHDQLGKVIGREGKIARAIRTMLGIAAVRQGVHASLTID
FT                   DQIDAQPTATS"
FT   gene            complement(120041..120340)
FT                   /gene="rpsP"
FT                   /locus_tag="trd_0114"
FT   CDS_pept        complement(120041..120340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsP"
FT                   /locus_tag="trd_0114"
FT                   /product="ribosomal protein S16"
FT                   /note="identified by match to protein family HMM PF00886;
FT                   match to protein family HMM TIGR00002"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05058"
FT                   /db_xref="GOA:B9KXC8"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXC8"
FT                   /protein_id="ACM05058.1"
FT                   /translation="MIKLRLRRMGKKRQPHYRIVAAEARWPRDGRFIEVIGYYNPRTDP
FT                   YTLEVNVERARWWLEHGAQPTDTVRALLVRAGVLPPRQQNEAKRETAETAQPEA"
FT   gene            complement(120815..121147)
FT                   /locus_tag="trd_0115"
FT   CDS_pept        complement(120815..121147)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0115"
FT                   /product="putative Domain of unknown function"
FT                   /note="identified by match to protein family HMM PF01906"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05477"
FT                   /db_xref="InterPro:IPR002765"
FT                   /db_xref="InterPro:IPR035439"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXC9"
FT                   /protein_id="ACM05477.1"
FT                   /translation="MASDLLITTTTAIEGRPVKEYLGVVTGEAILGANIFRDIFASIRD
FT                   IVGGRSGAYEKELRKAREIAFQEMAEAARQLGANAVIGVDIDYETIDMGGSNMLMVTVS
FT                   GTAVRI"
FT   gene            complement(121514..122800)
FT                   /locus_tag="trd_0116"
FT   CDS_pept        complement(121514..122800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0116"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.99.-"
FT                   /note="identified by match to protein family HMM PF00441;
FT                   match to protein family HMM PF02770; match to protein
FT                   family HMM PF02771; match to protein family HMM PF08028"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04879"
FT                   /db_xref="GOA:B9KXD0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD0"
FT                   /protein_id="ACM04879.1"
FT                   /translation="MMDGVRAEVLEFVEETKRYVYEELMPLEDEIERTDYLPPEVIADV
FT                   AKRGYFGMTIPKEYGGLGFNLLETCMVLEQIHKAPLAIGYVVDLNNGIGSLAILHGGSE
FT                   ELKREYLPRLARGEIIGVFAMSEPQVGSDGQGISTRAEWRDGYWVLNGVKYWITWAERG
FT                   DVFTVAAATDPGKGAHGGISVFLVPKGTPGMRVARRQKMMGNAGIDESVLVFEDCKVPA
FT                   ENLLGELGWGFRLLMRTLDEGRVKCCSLAIGYAERAWELAMAYVKRRQAFGQRLADFQG
FT                   IQWQLAEAATTIWLSRLAMYEAARKIDRGEFAAKEAAMAKLYSTEACQHVVDTAVQLFG
FT                   ARGYCRDYPLERIYRNYRSLRIVEGTSEIQRRIIWKQMSKLYDPERAPDERTREHAIRV
FT                   ERMLERALAVDRPYQDWGFRYLDEVAADD"
FT   gene            complement(122797..124947)
FT                   /locus_tag="trd_0117"
FT   CDS_pept        complement(122797..124947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0117"
FT                   /product="putative pimeloyl-CoA synthetase"
FT                   /note="identified by match to protein family HMM PF02629"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05257"
FT                   /db_xref="GOA:B9KXD1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD1"
FT                   /protein_id="ACM05257.1"
FT                   /translation="MQSEMLAPLLRPRSIVVVGASPRRRMARTVLSNLRTFGFRGPVWA
FT                   LHPSGEAVEGFPCFRTVEDLPETPDCAVIALSPENTLQAFRALAERGVRAAVLLGSGFA
FT                   EAGPSGLAIQQEITAIARDRGIAVCGPNCLGLVTPDARATLTGYHLPGDLATGPAAAVV
FT                   QSGSVFWSLAHNTRSLRFRYLVSSGNEAVLTAADYFAAALSDPHVRLLVGFLEVVRDGE
FT                   RFLDVIQAAHARSVPIVLLKVGRSELARATVLVHTGAIAGSDAIFRDIMRQYGVILVET
FT                   LDELYDTAEFLLAGRWPRSFRVGVVTDSGGEKALIADWGERIGLEFPPLSPKTAERLRT
FT                   VLAPYVKLENPLDAWGSGNFDEVYPATLAAFAEDPNIETIVLGTDMVRETEEAHLYAEA
FT                   MLALRERTAKPLAVVTNQATGLDCTEVQRLRAAGIPVLQGTEYGYRAIAHAARYSQWRA
FT                   SAPDSLAPPSSLGEIRQEIERWHQRATRSAHDQPVTLTEYEAKQILARIGLPIPSERWV
FT                   TCLEEALAAADEIGFPVVLKAQGPNLLHKSDLGAVRLGISDRQALIEAWQGMVETLAAT
FT                   PSLEVTGYLVQRQIPHGLELLLGCLRDSTFGMVVSVGLGGEFVEIWRDVVYRKAPVSPE
FT                   EADRMLSELRGAALLAGHRRLAPRDRRAAAEAIARFSWFAVAAADLIEVAEVNPLIVLE
FT                   EGRGAWAVDSLIVLRAPERRDG"
FT   gene            complement(124965..125402)
FT                   /locus_tag="trd_0118"
FT   CDS_pept        complement(124965..125402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0118"
FT                   /product="thioesterase family protein"
FT                   /note="identified by match to protein family HMM PF03061"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04635"
FT                   /db_xref="GOA:B9KXD2"
FT                   /db_xref="InterPro:IPR006684"
FT                   /db_xref="InterPro:IPR008272"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD2"
FT                   /protein_id="ACM04635.1"
FT                   /translation="MMQAELESFRFWYPWRVRYRDCDMQGIVYFSVYFEYVEQAIMEYF
FT                   RQIGVPIGKTIHEGSFDWAFAHAEIDYRAPVAFDDLVSIGIRIPKRGRSSFEVHFAVVD
FT                   AARERVHAHGRLVLVCYDSRSRRSCPLPDFVREKIEAFEGA"
FT   gene            complement(125806..126990)
FT                   /locus_tag="trd_0119"
FT   CDS_pept        complement(125806..126990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0119"
FT                   /product="putative transport system periplasmic protein"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05069"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD3"
FT                   /protein_id="ACM05069.1"
FT                   /translation="MADRIDALLQFLARQQRLRRRELLGGLLAAGTLAACRQAATPTPT
FT                   PAPAATPTPAAQAPAGEFAVPGYDDPNRWKGRSIVVTSWGGALQDALRKTIYQPFSRLT
FT                   GCQIVEDTTDEAKLRTMVESGTVEWDVVDVGTESVIPMGRLNLLEPLDYSKIDTTDIFP
FT                   ELVLEHGVGYFYYSTCLAYRKDKFPDKPPQSWADFWDVQGFPGPRAFQKYIQWGPLEAA
FT                   LLADGVPIDQLYPPDVDRAFRALDRLKPHVTVWWEAGAQPAQLLTDGEVYLTDAWIARI
FT                   QFLIEQGSTVLGYTWNQGRLSSDSLVIPRGSKNVDVAHDFINFALRPEVQRAFALAYPD
FT                   GPANKRAFEALPAERVAVLPSAPQNKALQVYPDYQWWADHLDEVVERFNSWIAR"
FT   gene            complement(127029..128195)
FT                   /locus_tag="trd_0120"
FT   CDS_pept        complement(127029..128195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0120"
FT                   /product="putative sarcosine oxidase subunit beta"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05718"
FT                   /db_xref="GOA:B9KXD4"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD4"
FT                   /protein_id="ACM05718.1"
FT                   /translation="MPSYDVLIIGGGNLGLWTAYFLAKRGLHRIAVCERYWAGFGATTR
FT                   SAGIVRQQGGSETAVKLGKWSRELYQELGRELGLGSGFVEVGYYVLASTPEERAAFQEL
FT                   VTLRQRCGVENTWLEPSELAQRLPFVDWSRYLGATYTPNDGFVYPHIVARNITHAVLRA
FT                   GVALFEECEVQEIEPLASGYRVRTTRGTFEAERVVDAAGPRGARRIGELVGIDVPVSAA
FT                   RHQIVSFPTRPADLPANFPMLFVLAKGYYLRPDEHGLLLGMSNPAEQPDPTDRFLLEFD
FT                   WDYFERLKPDWEATIPALRGLPIGRAWTGSIDYTPDHLPIIDEPRFGFYVLAAGGHGMM
FT                   WGPALGMKMAELILDERVSDLPDEEIRLSRFQEPGKVRDAIALPFPTR"
FT   gene            complement(128242..129378)
FT                   /locus_tag="trd_0121"
FT   CDS_pept        complement(128242..129378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0121"
FT                   /product="rieske 2Fe-2S domain protein"
FT                   /note="identified by match to protein family HMM PF00355"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04599"
FT                   /db_xref="GOA:B9KXD5"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD5"
FT                   /protein_id="ACM04599.1"
FT                   /translation="MKVESISLVPTLPGRYYVDPAIYAREQERIFGRLWTCIGLAQSLA
FT                   EPGQYLTTQLAGEPLLVIRGHDGELRAFLNVCRHRGARLCTESRGCLESRVIQCPYHAW
FT                   SYALDGRLIGAPNMRDVPEFSPERYGLVPVPLAVWEGMIWVNLSNDPPPVESQIVPRII
FT                   ERLGDRAIFDRYGVGQLRIGATLTYDVQANWKLIVENFMECYHCAVVHPELSRLVPSFR
FT                   AGYAYQEGVGATFAEGVETLTLTGKRTRPLLPGLRPEDDRTYYGMVLVPNIFVNLHPDY
FT                   VLIHRLEPLDVGRTLVHCDWLFDPAIVATPDFDPSDAVELWDLVNRQDWAMCERCQLGV
FT                   GSRVYAEGGVFAPIEAHIRRFNDWVLTQLGDVATDSST"
FT   gene            complement(129467..129649)
FT                   /locus_tag="trd_0122"
FT   CDS_pept        complement(129467..129649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0122"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05328"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD6"
FT                   /protein_id="ACM05328.1"
FT                   /translation="MRAVTDGEERSLGRAGCRLTSVPVKRFSAIPLFVLVHLYEAFRQS
FT                   FDAPWIASRDSNQYT"
FT   gene            complement(129807..130970)
FT                   /locus_tag="trd_0123"
FT   CDS_pept        complement(129807..130970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0123"
FT                   /product="putative oxidoreductase protein"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05323"
FT                   /db_xref="GOA:B9KXD7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD7"
FT                   /protein_id="ACM05323.1"
FT                   /translation="MSSDDVVIVGGGNLGLWTAYHLAQRGVRRILVCERYWAGYGATVR
FT                   SAGIMRQQGGSETAVKLGKWSRELYRKLGQELGLDSGFREVGYYVVASSPMEKAVFQRL
FT                   VELRTAHGVPNEWLDPEDLARRLPYVDWSRFAGATYTPNDGYVEPAIIVRNIVMAVRAA
FT                   GVELLEQCEVQGIEPLTSGYRVETSRGVFETERVIDAGGPRGARRIAEFVGIDVPVAAS
FT                   RHMVISFPERPPDMPANFPMMFVLAAGFYLRPDEQGVLLGFSNPLEQPDPSDRYLLEFD
FT                   WDYFEKLKPEWEATIPSLAGKAIGRAWTGSIDYTPDQLPIIDEPRFGFYVLAAGGHGIM
FT                   WGPALGMKMAELVTEERLSDLDPEEVRLRRFTEGRMATDAIHLPFPH"
FT   gene            complement(131009..131506)
FT                   /locus_tag="trd_0124"
FT   CDS_pept        complement(131009..131506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0124"
FT                   /product="Carbon monoxide dehydrogenase subunit G (CoxG)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06240"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06147"
FT                   /db_xref="InterPro:IPR010419"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD8"
FT                   /protein_id="ACM06147.1"
FT                   /translation="MSARGEHGGDVTAGAETLLPASRERVWQFRLDIPLSTRCLPGVHD
FT                   VVQVGERTFRGSVRFRAGFVQFACDATVELTELIPPERIRLTALATDPLTRETVTAHAV
FT                   AELREDGERTAIRYTLTVSSPGLFGSLGWRMLEEVNRRMIDAFFRCVERTLLSEQPVET
FT                   HE"
FT   gene            131800..133335
FT                   /locus_tag="trd_0125"
FT   CDS_pept        131800..133335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0125"
FT                   /product="helix-turn-helix, Fis-type"
FT                   /note="identified by match to protein family HMM PF07905"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05043"
FT                   /db_xref="GOA:B9KXD9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012914"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXD9"
FT                   /protein_id="ACM05043.1"
FT                   /translation="MGITVRELLEHPELKTRLVAGAAGLDRVITWAHVCELEDPTVWLS
FT                   GGELVMTVGIGIPRDEAGQVAYIERLARARLSGLMICEGMRAPALSDAMLETADRLAVP
FT                   VLLAAYDVPFVAVSRVVADANLGDEHERLRRTVQIYEVARLVVHGTAEDAELRGRLERI
FT                   LAARLIVLDLVLGQELLPVTVPEPEFLRAVRRAVERYPEGQLPAVVQLPELASGAIALP
FT                   VPTRGRTFLVVVPKDRRRGHDVVVLRHVATVVALALERKAVERERQRRLAGELLAQLVD
FT                   QRLNPDLAHELLLREHGFPEPPYAIAAVPELAVRLEELHTMLEGQFVPHAVIRRDGYFL
FT                   VLLPDSSDALEVMRALATDRAIGWSDPIRSLSRIPVAVVEARWAAHVQERGLQRYAAVR
FT                   GGALGWPLSLEAAQELVARVVAPVQAYDATHGTALLPSLRTFLACNGSWSETARRLSIH
FT                   RQTLLYRLRRVEMLTGLRVDRLDDLATLWLAMRAAQILGADASNSAPQGSVVD"
FT   gene            133642..133727
FT                   /locus_tag="trd_0126"
FT   tRNA            133642..133727
FT                   /locus_tag="trd_0126"
FT                   /product="tRNA-Leu"
FT   gene            complement(133752..134702)
FT                   /locus_tag="trd_0127"
FT   CDS_pept        complement(133752..134702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0127"
FT                   /product="transposase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05924"
FT                   /db_xref="GOA:B9KXE0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE0"
FT                   /protein_id="ACM05924.1"
FT                   /translation="MPCGRRTSLRPRTWAGYESIVRVRIIPALGRLPLDKVEPQVLQAF
FT                   ASQLLTQGLSVQSVQNTHPLLHRPFADAVKWGLLGRNPCDLVDLSRASRLQLRALTAPE
FT                   VARLLATCADDPLGPLVTVAVLSGLRLRELLALQWGDIDWERSEPSVVRSLQRVRGQGL
FT                   VVVPPKTAASRRRVPLSPLALEALRRQRRHQVEWRLAAGPTWAEGDWVFTSVRGVPLDP
FT                   AETTRRFHRLLERAGLPHRRFHDLRHTTASLLLADGVHPKVVASILGHSTVQVTLDVYS
FT                   RVTPGLARQAAERLQQLVANSIAHSALASREEGGR"
FT   gene            134759..134965
FT                   /locus_tag="trd_0128"
FT   CDS_pept        134759..134965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0128"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05602"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE1"
FT                   /protein_id="ACM05602.1"
FT                   /translation="MLFVQLLEEFERLALGKVLSLTSIRIAVVVVMIRRAVHGAPNDEV
FT                   SLVPDDMIESVECLLNRDCSSVD"
FT   gene            complement(135215..135898)
FT                   /locus_tag="trd_0129"
FT   CDS_pept        complement(135215..135898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0129"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00392;
FT                   match to protein family HMM PF07729"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04471"
FT                   /db_xref="GOA:B9KXE2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE2"
FT                   /protein_id="ACM04471.1"
FT                   /translation="MPAGLGNSRGHRQLLHQQAYEVIRNAIVQSDLPPGSVVSERTLSE
FT                   QFGFGRAPIRAAIQRLAAEGFLLIVPQQGIIVASPSLEEVRDLFELRVALESYVVRRLA
FT                   LEPQEVDFVHLELLLEKQEKAAQEQNVRLYRQLDVDFHLFLAHSLGNSELYSSMERLSD
FT                   RLHRIIASVISRRPARMLDSTIEHRAIVQAIATGDPDAAEMAMITHLDWAWNFLTGGHL
FT                   PRHGR"
FT   gene            complement(135951..136790)
FT                   /locus_tag="trd_0130"
FT   CDS_pept        complement(135951..136790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0130"
FT                   /product="NADP oxidoreductase coenzyme F420-dependent
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05319"
FT                   /db_xref="InterPro:IPR031663"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037161"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE3"
FT                   /protein_id="ACM05319.1"
FT                   /translation="MQVAFRTIGIVGAAGRMGTRVRTRLAQRPELELLLVDVGKGAEQL
FT                   QQEGLHVVSGVEAAQRSDVLVLAVPDNKIAAVAQELVPFVRSGCAVLYLDPAVPFAGVL
FT                   PQRPDVTYFVVHPSHPPLFQDEETPEARRDHWGGIAPQSIVCTLLQGPEEHYQPCEQLA
FT                   KEIFAPIRAAYRLNIHQMALLEPILSEAIAYTLLSVLRDAYHEAVARGIPEPAVRDFLL
FT                   GHIRVELAILFGEIQWRPSDAAERVRMWTYPRLIKENWRRLFDDDQLHECVQIILES"
FT   gene            complement(136830..138155)
FT                   /locus_tag="trd_0131"
FT   CDS_pept        complement(136830..138155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0131"
FT                   /product="ygbK domain protein"
FT                   /note="identified by match to protein family HMM PF07005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04724"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE4"
FT                   /protein_id="ACM04724.1"
FT                   /translation="MSVDFAYIADDFTGATDVLEALASAGARARLYLDCAPSAVEPGLQ
FT                   AIGIATTARATAAAELPNVLAPLFDALVSLQPAIVQYKVCSTFDSSPEIGNIATVISTA
FT                   WERFPYQSVLPVIVGAPRLGRWVVFGNLFARYGVTAKIYRLDRHPVMRFHPITPMEESD
FT                   LGVILHHQGLPHPVEYLTVLDYTLDQSTSFEKFQRTDRTVLIADTLLEEHLTTLGRLVL
FT                   AALRTPALVIGSSGATQAICNALIERGKFCGEPLLAAPYPVDPVLVVSGSCSRVSANQT
FT                   QRAIQAGFCEIAIVPDKLLHNDAYIEEVAEKIAQQLCRGKSVIAHTCSGPDDPRLLNRH
FT                   SPWERLHLGRELGRQLGELVARVAGRVPVRRIIVTGGDTSGYVALAAGLKALDPIAVIA
FT                   PGAPLCRACAPQTCLDGIEFCFKGGQTGPEDFYLIARDGVKT"
FT   gene            complement(138155..139411)
FT                   /locus_tag="trd_0132"
FT   CDS_pept        complement(138155..139411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0132"
FT                   /product="ribulose bisphosphate carboxylase"
FT                   /EC_number="4.1.1.39"
FT                   /note="identified by match to protein family HMM PF00016"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05757"
FT                   /db_xref="GOA:B9KXE5"
FT                   /db_xref="InterPro:IPR000685"
FT                   /db_xref="InterPro:IPR017443"
FT                   /db_xref="InterPro:IPR020878"
FT                   /db_xref="InterPro:IPR033966"
FT                   /db_xref="InterPro:IPR036376"
FT                   /db_xref="InterPro:IPR036422"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE5"
FT                   /protein_id="ACM05757.1"
FT                   /translation="MSFVRATYYVETPLTLEAAAEALASEQSTGTFIAVPLETAELKAR
FT                   YRARIERIELIETRSRPTLPGSRPASGSYQCGFVELAFPLENMGCNLPTLMATLAGNLF
FT                   ELSELSAIRLVDLDLPDEFAQAYTGPRFGIQGTRDIAQVYDRPLIGTIIKPSVGLSPEQ
FT                   TAVVVRELVEAGIDFIKDDELMANPPHNPLPARARAVMRVIRDYADRTGKYVIYAFNIS
FT                   DRLEDMIRHIEILVEEGARCCMVSLNWVGIAAFDYLRRNCPLIIHGHRNGWGMMTRAPG
FT                   LGMDFRAYQKIWRLAGVDHLHVNGLANKFWEPDDSVVRSIHDMLQPLFGGYFAMPVISS
FT                   GQWGGQAPDTYRRCRTIDLLYLAGGGIFAHPHGVAAGIRAIREAWEAAVAGISLAEYAQ
FT                   THPDLAAALHHFGTARRGR"
FT   gene            complement(139413..140465)
FT                   /locus_tag="trd_0133"
FT   CDS_pept        complement(139413..140465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0133"
FT                   /product="probable nadh-dependent dyhydrogenase"
FT                   /note="identified by match to protein family HMM PF01408"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05957"
FT                   /db_xref="GOA:B9KXE6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE6"
FT                   /protein_id="ACM05957.1"
FT                   /translation="MIEKDRLRLALIGCGYFARYHAAAWRVIPQVELVAVCDRAPERAQ
FT                   AFAEQFDVPRYYTNPEALFRAERLDIVDIVTTPESHRELVELAARYGVHVICQKPMALS
FT                   EADCVAMVESCERAGVSFMVHENFRWQRIFRRARTLTEAIGEPFFLRLWFRSHYDVFAR
FT                   QPYLATAERFIILDLGVHLLDLARFLMRDEFSTLYCITQRVHPQIRGEDVATILLRSRR
FT                   GAAASIELSYASFAPRELFPQTLALIEGPLGTVLVEADGLLRLITSSGHTEERLAPPSL
FT                   PWQEPPGEWIQEAVLAIQQHFVDCLRRGLMPETHGRDNLRTMQLVFAAYRSADTTSSIA
FT                   LDQSESERRG"
FT   gene            complement(140462..142204)
FT                   /locus_tag="trd_0134"
FT   CDS_pept        complement(140462..142204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0134"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05941"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE7"
FT                   /protein_id="ACM05941.1"
FT                   /translation="MFQSLYPAVRDRNWATIPTRVTAWSVTGRDYEVIVTLSGVCGNEE
FT                   IALDWTGQVTASQAGLLQYAFEARARKDFWKNRIGLCIHIPATYAGAPARGIARDGTVT
FT                   DGALPVSIAPHQPFRNLAQFTFTLPDKRHCTIIFEGDIFEMEDQRNWSDASFKIYSTPL
FT                   DLPFPVLVHEGQVLFQRVTALIEPKETAPAKAELISLDCDPTPLTPVPFGTQLPPLTTA
FT                   DEMDRLTHCLALLQPDHLRLDVHAASVQADYLRAAAHLAKRTATPLLIALYATDPAQVQ
FT                   EVVPLLTALDAPLKALMLHHPAEKVTPPALLAALGDELHRIGPLPLAAGTDFFFAELNR
FT                   DPHPWPQADWIVFTMTPGVHALDDRSLLLNATIQGQVVESARAVAGGRPILVSPITLRM
FT                   RRNPNATTGGWDIPREEQVDRRLHAVFGAAWLLQSLASLATAQPVAVTYFELAGSLGIF
FT                   AEHGSAPGDRQNSEETLSFTPLASVMHRLLRTARNGARWFRARSTNPVQIQTLGILLQE
FT                   RWELLIANPWPSPQVVEITHLPGTIEGIDALHPLASPSMPALSQAVPLLALPPNAVVVL
FT                   WGRR"
FT   gene            complement(142309..143841)
FT                   /locus_tag="trd_0135"
FT   CDS_pept        complement(142309..143841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0135"
FT                   /product="putative Bacterial extracellular solute-binding
FT                   protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05334"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE8"
FT                   /protein_id="ACM05334.1"
FT                   /translation="MADRLTRREVLRAGTGALVGLLAACSQQQASKTPAPSPAAQSTGQ
FT                   AAAGTPAVSGEPRFDGVTLKYMSHPGQIHPIITHHLDYLKEKYGISIQIIDSPDPTSYQ
FT                   DAMRDIRAGGGQFDIYMIFPRYNGELAAAGGIRELDDLIQKYNAKPLWDNIMDAYRILY
FT                   SEWHGKIITAPVDGDVAMMYYRKDAFENPDYQKQFKEKYGFDLRVPRTWEECLKIAEFF
FT                   TGWAWGPTGKPGYGFQTSTWDRAFIEQQWAPMMASAGGNWLTEDLDPGWNNDAGTRALI
FT                   DLKHFLDFAPPGSISLSWNQTMETVFANDVAIILWYMDLGRLGWSPNSWFAKSGGPEKM
FT                   KNIGYAEWPGYEINGKYRNYNSMFYGRVVAISKFSKNPDAAFMVLKTLLTPERRVLSMD
FT                   DDQSGSDMFLKTDYDPSVFKKLTPTKEFLDVAKVVITKGFPEMQIPGVGEYMDALQGQI
FT                   HAYLTGSESDPKKALQAAAERWKEITDRYNRSKQKEYWLEVLERYRKAGLQV"
FT   gene            complement(143893..144774)
FT                   /locus_tag="trd_0136"
FT   CDS_pept        complement(143893..144774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0136"
FT                   /product="possible multiple sugar transport system permease
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06231"
FT                   /db_xref="GOA:B9KXE9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXE9"
FT                   /protein_id="ACM06231.1"
FT                   /translation="MRHAKRAGYIFVGPATLLLLLYALVPLLWTLYYAVYRFSPNPSVP
FT                   PEFTGIGNFLDLWADPQFRGALLNTLLLGLIGIPLQLLLGFLAALGLSALDHSRWFGLL
FT                   FAAVMLPIAVAPIVAGIAWWLLFNTRFGAVNGILLRLGAPLIDWTVSMPWALLTIVVAF
FT                   VWFGTPVAAVLLYSGLTSIPRTLVEAARVDGATGLQLVRAIILPLLQPFFGLSGIFLLT
FT                   ELLRLYELPFYLTQGGPGNSTVVLGIYLFKLAFNFFDLGRSAALALLYVILLSLVAIGY
FT                   VRLLARTAQETA"
FT   gene            complement(144776..145684)
FT                   /locus_tag="trd_0137"
FT   CDS_pept        complement(144776..145684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0137"
FT                   /product="sugar abc transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04696"
FT                   /db_xref="GOA:B9KXF0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF0"
FT                   /protein_id="ACM04696.1"
FT                   /translation="MRTSEATTGPYPIVPAEVARPIRSTGRRLRHRLIWATMIIFALFC
FT                   IVPIYWILITALRPRGEIFESPALLYPQHITLDNLRYVWLGSQTNDPVLPFVFTSFLVA
FT                   TASACLTLFLSLPAAYALSRWRVGGNHLAMWILSQRFIPPIAVIVPLYLLYRRIGWLDT
FT                   YHGLILLYTVINIPITVWILRNYIDALPRDIEEAALVDGATPVQILRHIVLPLSWPSLG
FT                   AAAILAFLAIWNEYVFAYQLAGRNVAMVTVYFPRLRSAIGELYGEVAAAGLLALLPALL
FT                   VTGFLRRYIVRGLTLGGGREL"
FT   gene            complement(146292..146597)
FT                   /locus_tag="trd_0138"
FT   CDS_pept        complement(146292..146597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0138"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04611"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF1"
FT                   /protein_id="ACM04611.1"
FT                   /translation="MYGSIFHLHPKPGQKATIRQLFEQWDRERAPRVQGFHAGYLFQPD
FT                   RSSDELIGVAIFADRESYRKNATDPKQDERYRSLRALLTEDPRWEDGEIIEAAERT"
FT   gene            complement(146698..146988)
FT                   /locus_tag="trd_0139"
FT   CDS_pept        complement(146698..146988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0139"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05486"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF2"
FT                   /protein_id="ACM05486.1"
FT                   /translation="MYATYVVREMDAATRAMTLERAANEFWPQLRAAAGFRHYYLIQQS
FT                   DSQTLGIILWDTAEQAAAFAAVTDGWQSTMDNLGHRRIVSGGGDVLEIAEG"
FT   gene            complement(147115..148047)
FT                   /locus_tag="trd_0140"
FT   CDS_pept        complement(147115..148047)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0140"
FT                   /product="putative purple acid phosphatase-like protein"
FT                   /note="identified by match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06068"
FT                   /db_xref="GOA:B9KXF3"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF3"
FT                   /protein_id="ACM06068.1"
FT                   /translation="MVRLMSRLRCSIIALVFLAACTTSHAATITPHATEAITTTSATPA
FT                   RPVILWAVGDAATCRSKQDDEIAAFLAQQPGIIALLGDVVYERGTPEEFARCFDPLYGP
FT                   LKDRLRPAVGNHEYGSRDAGPYFEYFGARAGLPGQGWYSYDLGEWHIIVLNSNCKPVGG
FT                   CDEKSPQYQWLKADLTTHPARCTLAYWHHPRWSSGEHGSFESMQPIWSLLVRSGVDIVL
FT                   SGHDHDYERFQPLDADGHPDPRHGTMQFVVGTGGRSLRPLGNPLPTSAIGTDTTFGVLR
FT                   LELYPDHYSWEFVTIPGANFTDSGSAACH"
FT   gene            complement(148057..152910)
FT                   /locus_tag="trd_0141"
FT   CDS_pept        complement(148057..152910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0141"
FT                   /product="putative cable pili-associated 22 kDa adhesin
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00041;
FT                   match to protein family HMM PF00149"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05861"
FT                   /db_xref="GOA:B9KXF4"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF4"
FT                   /protein_id="ACM05861.1"
FT                   /translation="MNDGREQSLHIRSMRRVRRLPPLLLACALVTGLFGARPQPAAAAS
FT                   CATSGPSTGTYLVTVCLTQPVSGAFVSGDITVTASVTTSGAAPRVQRLIYSLDGTYLLT
FT                   EFFSPYTFRLPTRQWADGQHTLSASALMSDGFTSAPTSITLFLQNGMSSPPPIPTGFQP
FT                   TSGTTPPAGQPFRVVAVGDGGDDGTYSAQVAQLIGTQSPNLFLYLGDLYEKGSYTEFVN
FT                   YYGLNGQLFSAYRSITNPIVGNHEYEGRVAEGYVRYWQSPPDFYSLDAGGWHIIALNSN
FT                   SQFGQYGPGTPQYEWLLRDLQAHRDACTIAFFHHPRFSIGPQGDTPALQPIWELLFQFG
FT                   VELVLVGHDHDYQRWMPLDRDGQPHPNGIVQLVIGTGGHGIRAFARSDSRVAAGFDQPP
FT                   SAYGVLTASLFSDRADLAFVDLAGQVRDSTTVACHGPNDTMAPSAPTGLRATLVSSQQV
FT                   ALSWDAATDDYAVTSYEILRDGVVIGIVPGTTRTFLDNTPQPDQTYSYQVVALDAVGNR
FT                   STASAPVTISTRTTLFADDFESGTLSRWSAVSGLTITTLQPHTGQYAARALSTRGTVAY
FT                   ARTLLPSAQTDVTVETWFYLAARGTNDQVTLVRLLKPTGGGLGFVQIAADGLLAFRNEV
FT                   TGTTITTTASVSMNAWHQLRLRLVTGSGGRVELWYDSNQLISSAQSFGSSSVGQIQIGE
FT                   HKTKRTFDVRFDDVLVTPPAAPPPDTTPPDTTLTSTPPLSTAETTATFSFTASEPATFQ
FT                   CSLDGADWQTCSSPVTFSNLATGPHTFSVFAVDRAGNADPTPASFAWEITAPIAPETTL
FT                   LTTPPALTNQTTATFTFSSSDTAASFECQLDATPAVPCASPWTLSDLTEGLHTFSVRAI
FT                   DGEGVPDPTPASWSWTIDTTAPPAPGSVTASALSSTQVSLSWTSVTDASGIAGYDVYRD
FT                   GTLLVQLGPVTSVTDSTVQPATTYQYTIRARDNAGNVSSDSVPATVTTPSLRLFEDDFE
FT                   SGSLVRWSSVSGLTITTDAPYSGTYAAQALSTSGTPAYALGNLARPVSEFSYRIRFQLV
FT                   SQGNNPVYLVKWRRGTTSLGGVYLTSTGRLGIRNDIAGQALSTTTLVTTGAWHTLETHV
FT                   RTGPDGFVEVWYDGIRIHQSFQNFGANQATAIQLGENSTGRIFDVRFDEVVADTAAIDA
FT                   PPDSTPPETTITSAPPSTTDQTSATFSFTANELATFRCSLDGAPAQPCTSPVTYTGLAV
FT                   GTHTFSVTATDLAGNTDPTPATFNWEVTATSTAPETVLTETPPLLTNSTQASFAFHSDD
FT                   PSATFQCQLDGAAPAPCTSPLTLTNLSEGAHTFTVTAVNASGNVDPTPASWAWTIDVTP
FT                   PPAPTGVGATPGNGQVTITWQRVSDANGIASYEIYRDGTLLTSVGDTTSYVDSSVQPNT
FT                   TYSYTVAARDRAGNASAQSDPVSVTTGRFVLFADDFESGTLNAWTTVSGLTLTTTDPYA
FT                   GTYAAQALSTSGTPAYAITALPNSASDLHVRVRFFVATQGANTVYLLKLRTPTGTSLGG
FT                   VFISSTGKLGFRNDIAGQSTTTTVAVSPGTWHTLLLHVVVSTSGTVELWYDGMQIASIS
FT                   GNLGTDPIGGFQLGENRTGRTFDVRFDDVLLDTQPIAG"
FT   gene            complement(153163..154236)
FT                   /locus_tag="trd_0142"
FT   CDS_pept        complement(153163..154236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0142"
FT                   /product="putative protein"
FT                   /note="identified by match to protein family HMM PF03099"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04572"
FT                   /db_xref="GOA:B9KXF5"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF5"
FT                   /protein_id="ACM04572.1"
FT                   /translation="MRVRVVDLGLVDPIRSQSVYHAVGYTFRSDTLPTILLVSPTTPYV
FT                   SIGFHQDAEREVDLDYCRSVGLPVIRREVGGGAVYLDQHQVFTQWIFPRALVPLRLEER
FT                   FAWYVRPFVETYRRWGIEATWRPINDVHVRGRKIGGTGAASIGEAEILVGSLMLDFDTR
FT                   QMARVLKVASEKMRDKVFESLEEYMTTMHRELGTLPDRDAVVETYLECCAAALGAEIEF
FT                   GTLTPEEEAMAAELDERFASEEWLYQKGGLRQSGIKIHADVHLHEAALKVPGGLIRVIV
FT                   RTHRGRIDDISISGDFTLLPALGLAAIEQAVRGLALRREELTARVRDVYRALGLQSPGV
FT                   SPDDFAAAILRAVESMR"
FT   gene            complement(154253..154717)
FT                   /locus_tag="trd_0143"
FT   CDS_pept        complement(154253..154717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0143"
FT                   /product="glycine cleavage system H protein"
FT                   /note="similar to mitochondrial precursor; identified by
FT                   match to protein family HMM PF01597"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05628"
FT                   /db_xref="GOA:B9KXF6"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF6"
FT                   /protein_id="ACM05628.1"
FT                   /translation="MSFAETTRVYRGCVIPLDLLYDVERDVWVRREGELATLGMTDPAQ
FT                   TRAGKLVAIRFRRPGTIVERGRALATIESGKWVGPFPAPFRCELVETNQAAFERDILIA
FT                   NRDPYGEGWLVRVRPLAPEELAELVTGEEAFTRYRARIDALDLNCFRCAE"
FT   gene            complement(154714..155151)
FT                   /locus_tag="trd_0144"
FT   CDS_pept        complement(154714..155151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0144"
FT                   /product="GcvH"
FT                   /note="identified by match to protein family HMM PF01597"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04497"
FT                   /db_xref="GOA:B9KXF7"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF7"
FT                   /protein_id="ACM04497.1"
FT                   /translation="MAEVHGCSIPEDRYYWPEKHVWARPEPDGTVTIGITDVAQHLAKT
FT                   IISVTPRGVGRKVQRGKSAGTLESGKWVGPVTSPISGEIVAVNDAAIADPKLLNQDPYG
FT                   AGWFARLRPDDWENESKLLVTGPEAVEAYRKVLEQEGISCS"
FT   gene            complement(155144..155443)
FT                   /locus_tag="trd_0145"
FT   CDS_pept        complement(155144..155443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0145"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05782"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF8"
FT                   /protein_id="ACM05782.1"
FT                   /translation="MSMRCPYCDFAGDRPTIHVHLAEAHADRLAFSWHERSGYAIATVR
FT                   CPLCGASWDQPLRKARRDPGFLDEYAYEIRLVLFDLLLHHIRGEHETEGEARDG"
FT   gene            complement(155440..155913)
FT                   /locus_tag="trd_0146"
FT   CDS_pept        complement(155440..155913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0146"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05249"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXF9"
FT                   /protein_id="ACM05249.1"
FT                   /translation="MSAGCPDQLASAFAQRFRVLARALDRLDRLEGERAFVGWLDQLTE
FT                   QPHVLQDASEALVLQALRAASDPMNLALLRHLSVEEATGLAELAAELPLERIALHVRLG
FT                   ELAQAGLVALELEREAARLTALGNALRDWLDTLIRCTLDQVGAWLELVRSTQS"
FT   gene            complement(155910..157946)
FT                   /locus_tag="trd_0147"
FT   CDS_pept        complement(155910..157946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0147"
FT                   /product="heterodisulfide reductase"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05513"
FT                   /db_xref="GOA:B9KXG0"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG0"
FT                   /protein_id="ACM05513.1"
FT                   /translation="MLSTPERIAFLLLALVSLLLTAHGVSRLVRAIGRGQGRPRWSLFV
FT                   RRVVPVSLDILLQRPIFRARPWVSLLHAGIFFAFVFYGLVNILDILEGFTGFTTLHRGG
FT                   IAGAYNLVADLLSVAALVGMIGLLFRRFGLRPFRFNERVLLLPSVRFGIARDSAIVGGF
FT                   ILLHVGSRWVGQAVRIAESRHSDWSQPTASLVARLFTGWEVETLALASHVTWWLALGLI
FT                   LAFLPYFPYSKHIHLFMAPLNLILREERPLGQLEPPVARDGQLGSERLEQLRWFQILDA
FT                   YACIMCNRCQDVCPAHGTGRALSPAALEINKRYYLNRNLRAFADGTSSPPLLEIATSKE
FT                   AVWACTTCAACVRICPVGNRPMLDLIDIRRALVNQGDPLDPNLQAALESLGRYGNSFGK
FT                   PARQRARWAKELPFTIKDARKEPVEYLWFVGDFASFDPRMQENTKTVAWLFHTAGLDFG
FT                   LLYEDERNAGNDVRRVGEEGLFELLVEQNLRAFEKAQFRAIVTTDPHSYNALKNEYAAF
FT                   GFSVPVYHYTEVLAQLLEDGRLTVRQPLAAAVTYHDPCYLGRYNRITAAPRRILRALGA
FT                   ELREMPRHGENTYCCGAGGGQIWMASDGEERPSEQRIREAVQLGEDLRYFVVACPKDMA
FT                   MYSDAVKTTGYEGRLVVTDIARLVASAVGFEEAPVFAATEERS"
FT   gene            complement(157951..158916)
FT                   /locus_tag="trd_0148"
FT   CDS_pept        complement(157951..158916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0148"
FT                   /product="electron transfer flavoprotein alpha-subunit"
FT                   /note="identified by match to protein family HMM PF00766;
FT                   match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04988"
FT                   /db_xref="GOA:B9KXG1"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG1"
FT                   /protein_id="ACM04988.1"
FT                   /translation="MAQRIAVLVEHLDGEPTDVTYELLGVARRMADEDGAMVDAVLLGS
FT                   EVRQLSERLPADRVTILDHPSLRYLAPEAAARALAALLADAPPKLTLVPNTSLGMDIAA
FT                   WVAARLGWPLVSYCRALESRDGQWIATAQLFGGKILADVALGDEPAIIGALAGAFSQDA
FT                   ASPGPPGTIEQVPAPAELEQLRSRVIALERPEAADVDITRAEKIVAVGRGIESKDNLEL
FT                   AEQLAQALGAVLAASRPLVDAGWLPRSRQVGKSGLKVKPKLYVALGISGAPEHLEGMKD
FT                   AELIIAINKDPKAPIFTVADYGAVADLFEVAEALLERLEG"
FT   gene            complement(158932..159699)
FT                   /locus_tag="trd_0149"
FT   CDS_pept        complement(158932..159699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0149"
FT                   /product="electron transfer flavoprotein subunit beta"
FT                   /note="identified by match to protein family HMM PF01012"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06227"
FT                   /db_xref="GOA:B9KXG2"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG2"
FT                   /protein_id="ACM06227.1"
FT                   /translation="MTIAVILEQVPDVVEELAIAPSGNELDRDTVTYVLNEYDDHALEE
FT                   ALLLAEASGDEVIAVGIDTTGELDQALYTALAKGAKRAIKLVGDFEETWLSTRATAEIL
FT                   APILRDLAPRLVLTGVQAPDDLDGQLAPTLAARLGWPHASVVIGTEFSDGRLRARKELW
FT                   GGMTLLLELEPPAILGIQAARQAPRYVPVSRVRQVMREATIEEIEVELPTQPSVAVERL
FT                   RLPEEASQAELLTGSAAEIAERMIELLRARGLL"
FT   gene            complement(159696..160997)
FT                   /locus_tag="trd_0150"
FT   CDS_pept        complement(159696..160997)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0150"
FT                   /product="iron-sulfur cluster-binding protein"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05727"
FT                   /db_xref="GOA:B9KXG3"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG3"
FT                   /protein_id="ACM05727.1"
FT                   /translation="MDPSLEKVQEVWERETAIVEGVDISGPWNRMFGQRVIWDYTPELI
FT                   EEIARLPSGESFAWCYQCGKCVPVCPVDVVGDYGPRKLYRRAQTGINLLDSPDLWLCTT
FT                   CANCLRVCPKQVDMIQIMPAAREHAMLSGRVIPSELQEALENTAKYGNPLGQPARKREA
FT                   WVKDAGVPVPILHQIQRPVEWLWWVECYPSYHPRGIDASIALARIFHALGLDFAILGRE
FT                   EKCAGDSQRLAGERGLFEMLAEENIRTLSKYEFQHIVVTDPHALNAFRKHYPKLGGQYD
FT                   VWHYTTLLARELSRLQPLLVRPLPYRVTFHDPCYLGRHNGEYDAPRQLIQAIPGIEFVE
FT                   MLRCRENSYCCGGGGGGMWLDSFAAGHQRRRLSEERVLEAVSTGADTLVVCCPYEVSRF
FT                   EDAVKSTGNEGRLRVRDIAELLAEAMGMIGEATA"
FT   gene            complement(161010..161810)
FT                   /locus_tag="trd_0151"
FT   CDS_pept        complement(161010..161810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0151"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06263"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG4"
FT                   /protein_id="ACM06263.1"
FT                   /translation="MGQPLRPSHLIKPKTGPEDPELAETLREGLEQVSPDDVLAIAREL
FT                   AGRRQYLAPLVERIAREVERGELRGWEELTRAVTATARQAETLAQQAARAQACAALPLL
FT                   LREEQPVEQRLDEFLARCSDLDRRLALELATGVLHLRAPARYWLWTRWLWDIEHGTGIL
FT                   PLLASSTRALEGRSVGAQYRQLRPLVAMGTELGRNSGLVAHDLADDPELGPFVTDAFLA
FT                   LAYSVYLYGITNWRLSREFNRLLPPLPQLARRLLGLGRARAVRS"
FT   gene            complement(161820..162062)
FT                   /locus_tag="trd_0152"
FT   CDS_pept        complement(161820..162062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0152"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05605"
FT                   /db_xref="GOA:B9KXG5"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG5"
FT                   /protein_id="ACM05605.1"
FT                   /translation="MALPAKRNPFVSFMASGAGRLLRIVVGIVLILLGLLVVQGTWGWV
FT                   LVVIGLVPLAAGVFDFCLLGPLFGVGFWGRDIRGR"
FT   gene            complement(162116..163183)
FT                   /locus_tag="trd_0153"
FT   CDS_pept        complement(162116..163183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0153"
FT                   /product="CoB--CoM heterodisulfide reductase iron-sulfur
FT                   subunit A 1"
FT                   /EC_number="1.8.98.1"
FT                   /note="identified by match to protein family HMM PF00070;
FT                   match to protein family HMM PF07992"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04541"
FT                   /db_xref="GOA:B9KXG6"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG6"
FT                   /protein_id="ACM04541.1"
FT                   /translation="MQETTRPILVIGGGPGGLEAARTVAALGHPVLLVERRGRLGGTPD
FT                   AERYAKLTHHFRDAEEAIGELVAAVTDHPLIEVLTRSEVTACEGEAGDFRVTVSTPTGS
FT                   REARVSAIIVATGFQHFDPGRETQLYNYYSFPDVVTLSDMEAMLKAHQVVRPSNGQPPE
FT                   RVAFIQCVGSRDRQIGNEFCSKVCCGIASKQAIEIKEQLPDARVFIFYIDMRMYGYWEN
FT                   ELYWPAQERYKVNYVKGIVSEILPKGDRLLIRGEDTTMGRPMEITVDLVVLSVGMEPSS
FT                   GTRQMAKLLGIAQNKYGYIEAGGPSGLDPVATSRPGIYVVGAAARPADLDDTFATAGLA
FT                   AARAVATARQALVGT"
FT   gene            complement(163194..164411)
FT                   /locus_tag="trd_0154"
FT   CDS_pept        complement(163194..164411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0154"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04989"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG7"
FT                   /protein_id="ACM04989.1"
FT                   /translation="MSEYMLPLVEIREKKAQPVRPNPAEAPRPDLREELFELEARGELI
FT                   VQRVPEPYVEVTTKYGRTKKVPIDHLWHHKSCGQCGHIPGYTTSILWLNRQFGIDYLDP
FT                   TDQTSCTGWNYYASATSNAVAQLLVMCRNFAAAYETGYYPLIHCGTSYGHYKELREQLV
FT                   HHKELRDQVRRVLDKLGKPLVVPEEIVHYSEWVHVMRQRIAERQVIDMRGITACVHPAC
FT                   HYYKIVAEDAIYDPDIYGGQRTATVTALLQALGITVADYSTWFDCCGFGFRHILVQRDF
FT                   TRSFAVLRKIEVMKDEANPDMTVTHDTGCVTTLDKSQFAARAHQRRVGVPVLADSQVAA
FT                   LAMGAHPFRVLQLHWHSTDWRPLLEKLGIDWERYWTEFEEDLAAIERGEKPGLTWQDAE
FT                   QPIVTR"
FT   gene            complement(164408..165112)
FT                   /locus_tag="trd_0155"
FT   CDS_pept        complement(164408..165112)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0155"
FT                   /product="metabolism heterodisulfide reductase C"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06277"
FT                   /db_xref="GOA:B9KXG8"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG8"
FT                   /protein_id="ACM06277.1"
FT                   /translation="MSVATWSPTKSGQRYADVPEERKRELFEEVKSDPRYPDFLYGCYE
FT                   CGICVSACPSARFYDFSPRVIAQALAREDVERFYEILMEDIWNCAQCFSCVRCPRGNNP
FT                   GGLVTLMREVAVRHGLERAQQALQGYSRVIYKIMLKGNQVSPDMLQPDFFPDWGPWVRE
FT                   FSRNMTAWRKAIPVDTLRNVTDAAWRTDDKTLRELYTIWFETGNMEVIREVDEGLYELL
FT                   VEIMEEELEAVE"
FT   gene            complement(165115..165378)
FT                   /locus_tag="trd_0156"
FT   CDS_pept        complement(165115..165378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0156"
FT                   /product="thioredoxin:Glutaredoxin:Thioredoxins/glutaredox
FT                   i n"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05887"
FT                   /db_xref="GOA:B9KXG9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXG9"
FT                   /protein_id="ACM05887.1"
FT                   /translation="MTRIRLFTHPICSGCAEALALVQRLAAEEPEIQVEVISLASAAGR
FT                   AAAQEAGVVVVPTLLIDGERLTGVPTLEELRARVQHATRTGG"
FT   gene            complement(165375..165857)
FT                   /locus_tag="trd_0157"
FT   CDS_pept        complement(165375..165857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0157"
FT                   /product="glycine cleavage H protein"
FT                   /note="identified by match to protein family HMM PF01597"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04821"
FT                   /db_xref="GOA:B9KXH0"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH0"
FT                   /protein_id="ACM04821.1"
FT                   /translation="MRETAGYAIVHSCILPLDLYYRVESHQWVRVEADGSVRLGYTDVA
FT                   QTVAGRILQVTFRPTGRHYARDATVAVVESAKWLGAYRTPIAGVLLETNTALLEDPELV
FT                   NRSPYRRGWLVRLAPDDLAHDLSELLSGPAAVAAYDAFMTRRGLDDCVHCEGYELP"
FT   gene            complement(165857..166240)
FT                   /locus_tag="trd_0158"
FT   CDS_pept        complement(165857..166240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0158"
FT                   /product="putative protein"
FT                   /note="identified by match to protein family HMM PF02635"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04476"
FT                   /db_xref="InterPro:IPR003787"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH1"
FT                   /protein_id="ACM04476.1"
FT                   /translation="MSEETKKILYVQTHGVDTPERSATPFFLAAAAAAMEIEAAIYFTM
FT                   NGPTLLKKGVPETLVVPKAGGGGAKLKHFIDQALDLGVKLYVCQPSLDLHGLTMDDLIE
FT                   GVQMIGGAAFNLMALEADAVVAF"
FT   gene            complement(166262..166783)
FT                   /locus_tag="trd_0159"
FT   CDS_pept        complement(166262..166783)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0159"
FT                   /product="hypothetical conserved protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05824"
FT                   /db_xref="GOA:B9KXH2"
FT                   /db_xref="InterPro:IPR027396"
FT                   /db_xref="InterPro:IPR032836"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH2"
FT                   /protein_id="ACM05824.1"
FT                   /translation="MSRRDPEAPRRLAIIASKGTLDFAYPPFILGSTAAAMGWEVAIFF
FT                   TFYGLPLLLRNYDPKVSPLGNPAMPLKMPFGPPALRQISWPIPALVEALPGFSHLATTL
FT                   MQQTFKEKGVPSLLELRQLCIDAGVNLIACQMTMDVFGFKKEDFIPECTVGGAATFLEF
FT                   AADADVSLFI"
FT   gene            complement(166802..167044)
FT                   /locus_tag="trd_0160"
FT   CDS_pept        complement(166802..167044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0160"
FT                   /product="Uncharacterized protein family UPF0033"
FT                   /note="identified by match to protein family HMM PF01206"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05419"
FT                   /db_xref="InterPro:IPR001455"
FT                   /db_xref="InterPro:IPR036868"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH3"
FT                   /protein_id="ACM05419.1"
FT                   /translation="MTDVLQPDRVLDCSGLLCPLPVIRTSKAIKEIAIGQVLKVIATDP
FT                   GAPADMEAWARQTGNELIDAHEENGKYVFFFRRVR"
FT   gene            complement(167325..167579)
FT                   /locus_tag="trd_0161"
FT   CDS_pept        complement(167325..167579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0161"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05237"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH4"
FT                   /protein_id="ACM05237.1"
FT                   /translation="MPQRTRPVILSRRYPPFLAAASIAARGVVSDCEWIARSITPDRRV
FT                   RRDARLGPKTVLSATTSALWALASLPVDARHRKWATGLE"
FT   gene            167677..168336
FT                   /locus_tag="trd_0162"
FT   CDS_pept        167677..168336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0162"
FT                   /product="Translin family"
FT                   /note="identified by match to protein family HMM PF01997"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06053"
FT                   /db_xref="GOA:B9KXH5"
FT                   /db_xref="InterPro:IPR002848"
FT                   /db_xref="InterPro:IPR036081"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH5"
FT                   /protein_id="ACM06053.1"
FT                   /translation="MDATAIVRITERVLARLDLLNSARERALAETRQITRLSANAVRAV
FT                   HRGEFAEAGALLEEARRIKEALTAHLADYPAIYWSGYVQDAHKEYAEASLTLALVAGRP
FT                   IPSPETLQVEDAVYLNALGEACGELRRHILDLIRAGDLARAETVLAVMDEIYGVLVQVD
FT                   YPDAVTNGLRRTTDMVRGVLERTRGDLTLAVEQQKLSDALAQARRAVGLGEPGQPS"
FT   gene            complement(168348..168770)
FT                   /locus_tag="trd_0163"
FT   CDS_pept        complement(168348..168770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0163"
FT                   /product="putative protein"
FT                   /note="identified by match to protein family HMM PF00210;
FT                   match to protein family HMM PF02915"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05028"
FT                   /db_xref="GOA:B9KXH6"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH6"
FT                   /protein_id="ACM05028.1"
FT                   /translation="MDKKTLIDGLNQDLAGEFQAIIMYIHYAAAATGVDRIELAEFFQK
FT                   EIQDELRHALFLANKITALGGEPVDEPLPVPRANSNREMIERVLEAEERTIKSYVERMK
FT                   QAEEFGDYGLANDLQEIISDETRHKEECEKLLRGVA"
FT   gene            complement(168824..170290)
FT                   /locus_tag="trd_0164"
FT   CDS_pept        complement(168824..170290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0164"
FT                   /product="Glycine cleavage system P-protein"
FT                   /EC_number="1.4.4.2"
FT                   /note="identified by match to protein family HMM PF02347"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05865"
FT                   /db_xref="GOA:B9KXH7"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="InterPro:IPR023012"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH7"
FT                   /protein_id="ACM05865.1"
FT                   /translation="MRVEPLIFELSKPGRTGTSVPDLDVPEAPLPVEHVRDDLPLPEVS
FT                   EIDVVRHFTRLSQLNHAVDIDFYPLGSCTMKYNPKINELVARFPGFAHLHPLQDPRTVQ
FT                   GILRLMYELQGFLAEIAGFDAVSLQPAAGAHGELTGILIARAYFDARGEHERRTVIIPD
FT                   SAHGTNPATAAMAGFRVVEVKSDARGNVDIEQLRQLVGPDTAAIMITNPNTLGLWDENI
FT                   TEIVDLIHSVGGLVYNDGANFNALLGIARPGDFGVDIMHFNLHKTFSTPHGGGGPGSGP
FT                   VGVKAHLAEFLPGPIVVRRPGEDPEYTWHWPERSIGKIHSFHGNVGMHIRAYAYIRMHG
FT                   GSGLRRVSEDAVLAANYLLARLRDVYEVPYDRTCMHEFVLSAVRQKRHGVRAMDIAKRL
FT                   LDFGLHPPTVAFPLIVQEALMIEPTETESLETLDRFVAAMRQIAEEVERDPEFVRQAPH
FT                   QTFYKRLDEVRANRELDLRWQPERATAATP"
FT   gene            170523..171530
FT                   /locus_tag="trd_0165"
FT   CDS_pept        170523..171530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0165"
FT                   /product="hypothetical Membrane Spanning Protein"
FT                   /note="identified by match to protein family HMM PF07136"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04735"
FT                   /db_xref="GOA:B9KXH8"
FT                   /db_xref="InterPro:IPR010787"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH8"
FT                   /protein_id="ACM04735.1"
FT                   /translation="MADERTIYGGQAVLEGVMMRGVRHLATAVRLPDGRIAVWELPLAS
FT                   ERWAARLRHVPLLRGVLALWETLVLGVRALVFSAHVAVRYDPELEQTKPGTSASSWGGL
FT                   LWGTVALSLALSVGLFFLLPLGVASLLDRWVGSGWTIHALEGTIRLGILLGYLAVIGRT
FT                   PDIARVFGYHGAEHKTIHAWEHGDPLTVEGARPHSLLHPRCGTGFLLIVVALSIVVFAF
FT                   LGWPSLVWRVLSRVALIPLIAALAYEIIRLAARWFHLRPVRVLLAPSLALQRLTTREPD
FT                   DAMLETAIVALHRVLVAEGHAVPALAVSAPVIVVDEAGQEQAVFAPSGKREERA"
FT   gene            171527..172984
FT                   /gene="argH"
FT                   /locus_tag="trd_0166"
FT   CDS_pept        171527..172984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH"
FT                   /locus_tag="trd_0166"
FT                   /product="argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="identified by match to protein family HMM PF00206;
FT                   match to protein family HMM TIGR00838"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05556"
FT                   /db_xref="GOA:B9KXH9"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXH9"
FT                   /protein_id="ACM05556.1"
FT                   /translation="MTTPAKLWGGRFQKPTHELVDQLNASLPFDRRLARHDILGSLAHV
FT                   TMLAQRGIIPREDAQTIARGLRTILREIEEERFAFRLADEDIHLSVERRLHELIGPVAG
FT                   RLHTARSRNDQVALDFRLWMREALLEIAEGIVETSGALLDLAELHRDVVMPGYTHLQRA
FT                   QPVLFAHHVHAYVVMLTRDLERLRQLYQRVNRSPLGSGALAGVPYPIDRHVVAALLAMD
FT                   GVLENSIDAVSDRDFALEFLADLAILMAHLSRLAEELVLWSSSEFGFIEFDDAFATGSS
FT                   IMPQKKNPDVAELLRGKSGRVFGHLIGLLTVVKGLPLAYNKDLQEDKEGVFDAYDTVAL
FT                   LLRVLPPMLRTLRINRERLEAAAGQNFTLATDIADALVRAGVPFREAHEAVGRLVAFCL
FT                   ASGKSLDQLTADELARFHSKLAEITLPRTVWDAVRAREHLGGTGPEHVARAIAASRADS
FT                   AGARQWLESERQRIEHAFARLLSEDVP"
FT   gene            172981..173475
FT                   /gene="argA"
FT                   /locus_tag="trd_0167"
FT   CDS_pept        172981..173475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argA"
FT                   /locus_tag="trd_0167"
FT                   /product="putative acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06301"
FT                   /db_xref="GOA:B9KXI0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR039143"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI0"
FT                   /protein_id="ACM06301.1"
FT                   /translation="MTGIESETRSAQPRAIRVEPVRTPEELEIVYQIRREVFDQEQHLT
FT                   TWVHDYPEDGAGLNVLAWIDGEAVGTGRVTLWGDEAQIAWVAVRKPYRGQGVGRAIMER
FT                   LIRWAEEQGARTVTLNAQTHALEFYRKLGFRPIGRPFSMAHIEHQFMERELRPVRTKGG
FT                   Q"
FT   gene            173475..174386
FT                   /gene="lipA"
FT                   /locus_tag="trd_0168"
FT   CDS_pept        173475..174386
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipA"
FT                   /locus_tag="trd_0168"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.-"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00510"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05263"
FT                   /db_xref="GOA:B9KXI1"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI1"
FT                   /protein_id="ACM05263.1"
FT                   /translation="MPSVRQPILLQKKPDWFRVRREHGPNYLELRRLVLEEGLHTVCQE
FT                   ARCPNIYECWNQRTATFMILGDRCTRACRFCNVRWGRSGTVDWEEPRRVAEAVERLGLD
FT                   FAVITSVNRDDLPDGGAAVFAATIREIRSRIPSCGIEVLIPDFLGNWYALRTVVEARPE
FT                   VIAHNIETVPRLFRVIQPWDDYGRSLELFRRVQAMDDAIALKSGLIVGMGETWDELLAV
FT                   MRDLREVGVEILTIGQYLPPTPRHFPLHRYYTLEEFEELRRIGEEELGYVYVESGPLVR
FT                   SSYHAKEQYERYRARRLEVRRG"
FT   gene            174392..175135
FT                   /gene="lipB"
FT                   /locus_tag="trd_0170"
FT   CDS_pept        174392..175135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lipB"
FT                   /locus_tag="trd_0170"
FT                   /product="lipoate-protein ligase B"
FT                   /note="identified by match to protein family HMM PF03099;
FT                   match to protein family HMM TIGR00214"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04934"
FT                   /db_xref="GOA:B9KXI2"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI2"
FT                   /protein_id="ACM04934.1"
FT                   /translation="MPDDPVVALQLGRVDYLAAWELQRQLAAARRAGAIPDTLLLLEHP
FT                   PTFTTGRRGGTHHLRLSVDALAARGVPYYVTDRGGDVTYHGPGQLVVYVILRLGEGQRR
FT                   VRRFVESLEATVLDVLASYGITGELDPRHPGVWIGRNKIAAIGIAIHHGVTYHGIALNV
FT                   TTDLEPFDWIVPCGIPDRGVTSLAELVAGPVELADVQARWLAAFAERFGRTVELDPEPV
FT                   RSLDDVLLRLTSRWAGATRSSAIVR"
FT   gene            complement(175086..177932)
FT                   /locus_tag="trd_0169"
FT   CDS_pept        complement(175086..177932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0169"
FT                   /product="putative DNA helicase"
FT                   /note="identified by match to protein family HMM PF00270;
FT                   match to protein family HMM PF00271; match to protein
FT                   family HMM PF08148"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05962"
FT                   /db_xref="GOA:B9KXI3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012961"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI3"
FT                   /protein_id="ACM05962.1"
FT                   /translation="MTGFMDATEAVSLPESIEQFSVFYPFRFDPFQLEAMLAFLEGKSV
FT                   MVAAPTGTGKTVVAEFGVYETFRRGARVMYTTPIKALSNQKFRDLRAIYGDNVGLLTGD
FT                   VTENPHAPIVVMTTEVLRNMLLQTPWELDSVQCVIFDEIHYLADPERGTTWEESIILCP
FT                   EHIQLICLSATVSNAQEIADWISRTHRPIQLIVHTERAVPLALWYFYDRKLRLVIDHHG
FT                   RQVADYSNVGGEIRALIGRGGLTAERRREAEEAEPPPWEIIQALAAEDMLPAIYFLFNR
FT                   RDCEDYATRLAMMRVNLVRDRATRQRIAHVIESFLASLRPEDRELSQVQTIVQLAAKGI
FT                   GFHHAGLLPILKQLVEVLFSQGLMKVVFATDTLALGVNMPARTVVIGRMTKWDGRRRRL
FT                   LTPNEFQQMAGRAGRRGMDERGNVVVPYSPWISFKEVLAVATGELEPVRSAFTIRYNTV
FT                   LNLWDPPRGDRVRQLFQESLAQYQAAQRVRLLEEEILQVGHELETVPRGCLLGLDGDEL
FT                   LYDYRNIVAQLNHAKSQERHLEHDLAQLEADLDDRPWAVPSRPVLRRLIREMAPGTPLH
FT                   TRERGWVLFLNRLPYGGIALVLTREGSAELLTEYRQIDYVPHGIEPVPIPEALTLLAQP
FT                   VSDVRGIVSTEAFEEIWRAFAARPLPDLDAMLLEHRRQVEARLAPERRRIEERLQTIQQ
FT                   TLHELTQQRFRHPCHACQRRKEHQRNLQRIARLEQERAELEAQLGREIAAEERRVRELL
FT                   RGIRNVLEHFGYLHRGYPTSKADTLADVFDTNGLIICEMLDRDFFKGLEPADVAEVFSW
FT                   FAFDRETRFANHFTLPTKLVLLRRRLESLEQEVFEVERRNGLALSTGHHEGFYGAMRAW
FT                   CNGATMAEITELIELSEGDLVLTFNKSLDLMRQVREMLEKLYPDHPLRWSIATAEALAR
FT                   RDIIEQSLMIGLLPPIGT"
FT   gene            178030..179187
FT                   /locus_tag="trd_0171"
FT   CDS_pept        178030..179187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0171"
FT                   /product="mannosyltransferase B"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04637"
FT                   /db_xref="GOA:B9KXI4"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI4"
FT                   /protein_id="ACM04637.1"
FT                   /translation="MRVGLLASLLSRQAGYRRAGVSRYIEALLQYLPTVATDLELVATV
FT                   PRTVWGLAHQDFAGIEWRLTRWPTERPVVRIAWEQLWASRVLRDCAVVHGPVNVLPLAL
FT                   DRPSVVTVHDVAFLHFPEHYPPAKRWYLRVMTGLSVRRAHRVIAVSEQTRRDVIRAYGI
FT                   EPGRVVVVPNGIDAGWQRVRDEELAHWRAERGLPEHFLLFVGTIQPRKNVTTLIDALAK
FT                   LDAAIDWPLYIVGAPGWRETPVYRRVQERGLAQRVVFVGYVSPAELRYWYSAATLFVYP
FT                   SLYEGFGLPVLEAMACGTPVITSDRSALPEVAGDAAWLVDPTDPAALATAIATLARDPE
FT                   RRIALARAGFARAQAFSWERTARETAAVYRALGVGLLDERGGATA"
FT   gene            179184..180209
FT                   /gene="thiL"
FT                   /locus_tag="trd_0172"
FT   CDS_pept        179184..180209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiL"
FT                   /locus_tag="trd_0172"
FT                   /product="thiamine-monophosphate kinase"
FT                   /EC_number="2.7.4.16"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769; match to protein
FT                   family HMM TIGR01379"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05627"
FT                   /db_xref="GOA:B9KXI5"
FT                   /db_xref="InterPro:IPR006283"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI5"
FT                   /protein_id="ACM05627.1"
FT                   /translation="MTGAGRPLREVGEEELIEQIARLVGDRSNRVSIGIGDDAAAWRPR
FT                   AGHELVITTDTLIERVHFRLEWTDWEALGHKSLAVNLSDIAAMGAIPRLAVVDLAVRGT
FT                   ERDRDIADFYRGVQALARRFGVAIVGGDTTRSPLGVAVSITVIGESPRDGHRLLRRDAG
FT                   RPGDLIGVTGPIGLAAAGLRVLERGLKTLDGNPVMQEHYHRPQPRVREGLLLRRCGVRA
FT                   AMDISDGLLGDLQKLCRASGVAAIVDLERVPVPNAIKWAFPDWEEVALRGGDDYELLFA
FT                   APPAVFARVARAFARAGLLPPWKIGQLVEAGSAGPIVELRDVTGRCRPADARGFDHFRT
FT                   G"
FT   gene            180266..181693
FT                   /locus_tag="trd_0173"
FT   CDS_pept        180266..181693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0173"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit A"
FT                   /EC_number="6.3.5.-"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04861"
FT                   /db_xref="GOA:B9KXI6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI6"
FT                   /protein_id="ACM04861.1"
FT                   /translation="MDSARSELCFLSATELLDHYRRRALSPVEVVDAVLTQIERLDPHL
FT                   HAFLTVTAEEARRQALEAEYAYAHGEHRPLLGVPVSIKDVTPVAGVRWTSGSLLWKDRV
FT                   ATEDAPVVERLRAAGAIILGKTNTPELGWKGDSGNRLIGPTSNPWKLDRTAGGSSGGAA
FT                   AAVAAGMGPLAQGTDGAGSIRIPASFCGIVGFKPSFGRVPYYPPSAVELLAHVGPMTRT
FT                   VADAALMLSVMAGPDPRDRHSLPLECSDGEALERDLAGARVAWLGRVGDVPVDPEVAAI
FT                   ARRAVAVFEDLGCSVEELVEPLEDPYPVLDILWSVAMAAVHRDDLDAVRDLLDPGRLTV
FT                   IEHGLRWRGVDVGWALAERNRYVDRLRQRLERFDFVVSPTTPVTAFAAGADHPGQIAGY
FT                   PTTYLSWTPFTYPFNISGQPAISVPCGWTQEGLPVGLQIVGRWRADASVLRAAAAFERA
FT                   RPWSHQRPPLASGGETG"
FT   gene            181690..182229
FT                   /locus_tag="trd_0174"
FT   CDS_pept        181690..182229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0174"
FT                   /product="Uncharacterized P-loop hydrolase UPF0079"
FT                   /note="identified by match to protein family HMM PF02367;
FT                   match to protein family HMM TIGR00150"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05676"
FT                   /db_xref="GOA:B9KXI7"
FT                   /db_xref="InterPro:IPR003442"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI7"
FT                   /protein_id="ACM05676.1"
FT                   /translation="MSTRVPALDLVSHSPDQTRQIAATLARHVRGGDVLFLQGPLGAGK
FT                   TTFVQGLARGLGIREYVQSPTFILVMEHRGTLPDGQPVRLYHVDLYRLEEPGELATFGL
FT                   EDCLSDPAGIVVIEWADRLPPNWVEEYLVIRFEPLAESKRRLAFYPVGARAQAIIETLR
FT                   KEVSGGAKRSTAPGTR"
FT   gene            182192..182920
FT                   /locus_tag="trd_0175"
FT   CDS_pept        182192..182920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0175"
FT                   /product="putative glycoprotease family"
FT                   /note="identified by match to protein family HMM PF00814"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06082"
FT                   /db_xref="GOA:B9KXI8"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI8"
FT                   /protein_id="ACM06082.1"
FT                   /translation="MERSDQLLLALDSGGEQVAIALYDGRVVGELLYDAGREHTATVLP
FT                   RIRQLLAENRRTIRDVAAVAVTTGPGSFNGLRVGMSIAKALCYALDVPLIGVLTLDALA
FT                   YPHTALPYPIRAFVAAGRGRVVYADYRRQGEIWVRDSSLRSVRLHEVTDGLLGRTVLTG
FT                   HLAPEEEALVRSHPLVILPAPALRQLRPAWVAELAFRRWQAGESDPVAALEPIYVHGGG
FT                   AEAIPSVQLPMSYDVRPARE"
FT   gene            182898..183608
FT                   /locus_tag="trd_0176"
FT   CDS_pept        182898..183608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0176"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /note="identified by match to protein family HMM PF00583;
FT                   match to protein family HMM TIGR01575"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04974"
FT                   /db_xref="GOA:B9KXI9"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR006464"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXI9"
FT                   /protein_id="ACM04974.1"
FT                   /translation="MSDPRGSDKVEERTQQSSADPNSTVRRYVLSPMRSSDVPEVSQLE
FT                   RRCFSNPWPESAYYRELREPERNYYVVLRWETARSEEEPELVGATGTLARLLRAARPAR
FT                   TSAHPLVGFAGMWVIYGEAHVTTIGVAPEHRGLGLGEVLFLTLISEAIRRGAEFVTLEV
FT                   RVSNVTAQSLYAKYGFTRRGVRPRYYSDNLEDAYIMTSPPLRDPTYRQELVALRDRLLE
FT                   RLAAEGIEIVEEAA"
FT   gene            183605..184702
FT                   /locus_tag="trd_0177"
FT   CDS_pept        183605..184702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0177"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /note="identified by match to protein family HMM PF00814;
FT                   match to protein family HMM TIGR00329"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06291"
FT                   /db_xref="GOA:B9KXJ0"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXJ0"
FT                   /protein_id="ACM06291.1"
FT                   /translation="MIILGIETSCDETAAAVVRDGRFVLSNIIRSQVDLHQRYGGVVPE
FT                   LASRRHVTSIVPVLDLALEQAGIGPSAIDAIAVTEGPGLAGSLLVGINVAKTLAFVWEK
FT                   PLIPVNHLEGHIYANWLTLPGQDEVPEPTFPLVCLIVSGGHTELVLMRGHGDYVLLGRT
FT                   LDDAAGEAFDKAARLLGLGFPGGPAIQKAAEQGRPGRFSLPRAWLGESYDFSFSGLKTA
FT                   LLRVLEQYQRRPARRVAAGQPFPEYVAPEYGPSVPIADLAAEFQAAVVEVLAEKTARAA
FT                   REFGATMVLLAGGVAANAALRQRLREISPVPVRYPPPILCTDNAAMIAGAAYYLAQRGV
FT                   RADLDLDVHAHLPLVTRTLLRAGEA"
FT   gene            184706..185503
FT                   /locus_tag="trd_0178"
FT   CDS_pept        184706..185503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0178"
FT                   /product="inositol-1-monophosphatase"
FT                   /EC_number="3.1.3.25"
FT                   /note="identified by match to protein family HMM PF00459"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05295"
FT                   /db_xref="GOA:B9KXJ1"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR022337"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ1"
FT                   /protein_id="ACM05295.1"
FT                   /translation="MRTMATVRQVAVAAALSAGRLLRERLGRVREIRYKGAVNLVTEVD
FT                   IASERLIVETIQAAFPEHAFFTEEGTGSASLDAPALWVIDPLDGTTNYAHGYPMFCVSI
FT                   AFLCEGEPEFAVVYQPVLDELFIAERGVGAFLNGERLRVSQHADLHSALLATGFPYDRE
FT                   RRREALAAFARFTLTARAVRRDGSAALNLAYVAAGRFDGFWEQELSPWDTAAGTLLVTE
FT                   AGGRVTDYDGQPYRLTQGTCVASNGLIHDAMLDLIRRDDRGGA"
FT   gene            185500..186459
FT                   /locus_tag="trd_0179"
FT   CDS_pept        185500..186459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0179"
FT                   /product="histone deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF00850"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05592"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ2"
FT                   /protein_id="ACM05592.1"
FT                   /translation="MTTEPTVLITSRRFLEHETGDHPERPARLEAILQLLERTGRLDNR
FT                   PVIEPDPADEETIALIHDRAYIVELREFAARGGGWLDADTIVSPRSFEVARLAVGAVVQ
FT                   AVESVLSGQARRVFALIRPPGHHAEPERGMGFCLFNNIAVAAQYALERYGLRRIAIIDW
FT                   DVHHGNGTQAAFYRTDRVFFVSLHQWPLYPGTGRAEEIGEGPGRGYTLNIPLAPGSDDQ
FT                   VYLAAFANEIEPRLAAYRPELVMVSAGYDAHYADPLAAMAVTEHGFAAMASQVRAIAEV
FT                   WCDGRLVLALEGGYNLSALASSVAATLDALDTDGRAER"
FT   gene            186474..187118
FT                   /gene="hisH"
FT                   /locus_tag="trd_0180"
FT   CDS_pept        186474..187118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisH"
FT                   /locus_tag="trd_0180"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /EC_number="2.4.2.-"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF01174; match to protein
FT                   family HMM PF07685; match to protein family HMM TIGR01855"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04558"
FT                   /db_xref="GOA:B9KXJ3"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ3"
FT                   /protein_id="ACM04558.1"
FT                   /translation="MVIVVVDYGAGNLASVVNALERIGAPVIVSRHPAPLERADGVIVP
FT                   GVGAAADTMRHLEELGLVPALRAAIERGIPFLGICMGLQVLLEVSYEGGEHRCLGIVPG
FT                   VVRRLPEGITVPHMGWNEVWLRSSHPLFAGIPDGTDFYFVHSFYAEPSDSSWILGETDY
FT                   GVRFASVLARDNVMATQFHPEKSGFWGLRMLANFVDLVERTRGGLPLEAPV"
FT   gene            187115..187849
FT                   /gene="hisA"
FT                   /locus_tag="trd_0181"
FT   CDS_pept        187115..187849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisA"
FT                   /locus_tag="trd_0181"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /EC_number="5.3.1.16"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00007"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05521"
FT                   /db_xref="GOA:B9KXJ4"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXJ4"
FT                   /protein_id="ACM05521.1"
FT                   /translation="MIVIPAIDLREGRCVRLFRGDFARATVYSDDPIEMAQRWASAGAR
FT                   WLHVVDLDGARLGQPVQHELIERVIRAVPDVAVQVGGGVRTLDAVERLLVGGAARVVIG
FT                   TAALERPDMLREALARFGVERVVVAVDSRDGWVATHGWETVQAIRVEEVVHRVVLLGVR
FT                   RVLATDVTRDGTLTRPNLELMGRLAALGVTVIASGGVGSRSDLEALARVPGVEAAIVGR
FT                   ALYEGRVRFERPEDWVIGAEAA"
FT   gene            187846..188964
FT                   /locus_tag="trd_0182"
FT   CDS_pept        187846..188964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0182"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04982"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ5"
FT                   /protein_id="ACM04982.1"
FT                   /translation="MMERRPDQPDFIQQVREEERRRREEARQQAMQSQVDELRHRVREL
FT                   AARLLRLEEEVKAAEADWAEQRHALEQHRHETQQAQQARQLEEARFRQQLAELALRLDE
FT                   VARPIRTLQAQVAELLEAVRRQRDDTGQDTRRYDELRILIEHLAAHIERLSATDQSLRG
FT                   GLEAVTTEVERLGREVTRLHDAIRIVEQDVRRRVAEAMQVIETLQVQLKEGASRDSQLA
FT                   EELERVQEFLAAVPQQFDDLRSVAQRLGADIERVRSHSSERDDLLLERVEEIRQQFDQA
FT                   LRDLAAVSDQRAERVQAEFETLQAVDRELRYRIDLIEVRLDELREIDRQLRAELWRLLE
FT                   QRVRLHFEQAQQELEQFIEQRQRAERGEGPVS"
FT   gene            188964..189746
FT                   /gene="hisF"
FT                   /locus_tag="trd_0183"
FT   CDS_pept        188964..189746
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisF"
FT                   /locus_tag="trd_0183"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00977;
FT                   match to protein family HMM TIGR00735"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05847"
FT                   /db_xref="GOA:B9KXJ6"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXJ6"
FT                   /protein_id="ACM05847.1"
FT                   /translation="MLKRRIIPCLDVTAGRVVKGVQFLDLRDAGDPVELAARYDAEGAD
FT                   ELVFLDITASAEGRETMVEVVRRTAKEVFIPLTVGGGVRTPADMYRLLRAGADKVSVNT
FT                   AAVLDPDLIRVCAQRFGSQCVVLAIDARRRPEGGWEVYTHGGRRPTGLDVIEWAKQGVS
FT                   LGAGEILLTSMDTDGTQQGYDLALLRAVVDAVGVPVIASGGAGTLEHLYQALTMGGAHA
FT                   VLAASIFHFGRYSVAEAKRYLAARGVPVRHVSVEFTPS"
FT   gene            189972..191255
FT                   /locus_tag="trd_0184"
FT   CDS_pept        189972..191255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0184"
FT                   /product="cell wall-associated hydrolases"
FT                   /note="identified by match to protein family HMM PF00877;
FT                   match to protein family HMM PF08239"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05652"
FT                   /db_xref="GOA:B9KXJ7"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ7"
FT                   /protein_id="ACM05652.1"
FT                   /translation="MGKRRLPLWFVASYCAFLAAIFAFSPVLATNDLVTGALGQVSGTN
FT                   GDGVNVRAEPGLGASRVGGLPEGARVRVVEGPRAASDGTTWYRIENGGMTGWVLADYLA
FT                   RAVPVAGDTVLVTGTGGYGLRLRETAGLESRVLAIMPEGGRAVATGSPVQDAAGTSWVP
FT                   VRHEGVDGYAALAYLVVVEGDSTPVAQAQPIANTPTIRVGGNVEVVNTDGQGVNVRQGP
FT                   GYGRPVAAVAPEGAVMRVIGGPQTDGQGITWWQVDYRGLQGWAHGGYLAPTDREPGAPA
FT                   ATPAEAAPQSNPVPTTPAPPSTVGDAIVATAMQYLGRPYAWGGTTPAGFDCSGFVYFVV
FT                   NQVLGGGFPRSLEAQAVSGVSVDPNQLQPGDLVFFQNTYKWGLSHVGIYIGNGRFIHAE
FT                   NYGTGVTISELWGDYYGPRFYTARRVGT"
FT   gene            complement(191298..191447)
FT                   /locus_tag="trd_0185"
FT   CDS_pept        complement(191298..191447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0185"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04675"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ8"
FT                   /protein_id="ACM04675.1"
FT                   /translation="MPLHSSTTLRILPLRVGASVFLEREIDASLRLSIVGTVRSKVRRN
FT                   GTAR"
FT   gene            complement(191637..192536)
FT                   /locus_tag="trd_0186"
FT   CDS_pept        complement(191637..192536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0186"
FT                   /product="putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05844"
FT                   /db_xref="GOA:B9KXJ9"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXJ9"
FT                   /protein_id="ACM05844.1"
FT                   /translation="MRALIAAEWFKVTRRPMTWIALGILLAIMATLRLLLIALSFVSLP
FT                   SAPGQEMPTNLFADLVTLPGAIADSVNFLPSTGIFALLVVAASFAGTEFAWGTIVPLLA
FT                   RGASRTRFVLAKALVALVVALLYLIATTVVGLVLGAIASQLHHGQIPLEWLQRDWREFL
FT                   LALLRAYWATVPYVLAALAIALVFRSSALAMGMVLAYVIVEQVGLGVLQLLRPMIEDSG
FT                   FSWLFTLLDWTLLGQNASTLQALNTRAFLPTGLAEQATSGDLHPWRAAVVLAAYSFAFL
FT                   LAALVALRRDIPTRPTSA"
FT   gene            complement(192551..193465)
FT                   /locus_tag="trd_0187"
FT   CDS_pept        complement(192551..193465)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0187"
FT                   /product="putative ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04747"
FT                   /db_xref="GOA:B9KXK0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK0"
FT                   /protein_id="ACM04747.1"
FT                   /translation="MTSETILVVEGLTKRFGSRTAVDNLSFSLGRGELVGLLGPNGAGK
FT                   TTTLSMIAGLIRPTAGRIVLFGRPLAESREQLRRVGLTPEVASFYPYLDARQNLSVMAR
FT                   VYGADPAEIDHLLERVGLLEHARHPFRTYSQGMRQMLSLANALLADPDLLLLDEPTNGL
FT                   DPYGQQRVHDLLRELVARGKTILLSSHLLRDVQELCQRVIIIHRGRLIEDSHIERLLRP
FT                   SELPVLVRTVADDRALLLLSGPARPDWIRGVERRDDHLIVHLPSERLPELSAFLVHHEL
FT                   YLRELRPLEGDLVTAFVELTRER"
FT   gene            complement(193510..194574)
FT                   /gene="recA"
FT                   /locus_tag="trd_0188"
FT   CDS_pept        complement(193510..194574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recA"
FT                   /locus_tag="trd_0188"
FT                   /product="recA protein"
FT                   /note="identified by match to protein family HMM PF00154;
FT                   match to protein family HMM TIGR02012"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06050"
FT                   /db_xref="GOA:B9KXK1"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013765"
FT                   /db_xref="InterPro:IPR020584"
FT                   /db_xref="InterPro:IPR020587"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR023400"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK1"
FT                   /protein_id="ACM06050.1"
FT                   /translation="MDRQKALELAISQIERSFGKGAIMRMGEDPSKLQVDVIPTGAIAL
FT                   DLALGVGGIPRGRITEIFGPESSGKTTLALHVIAQAQRMGGIAAYIDAEHAFDPVYAER
FT                   LGVDLDNLLISQPDTGEQALEITETLVRSGAVDVVVIDSVAALVPRAEIEGEMGDAHVG
FT                   LQARLMSQALRKLTGAISRSKTAVIFINQLRMKIGVMYGNPETTTGGNALKFYASVRLD
FT                   IRKVDAIKEGNETVGTRVRVKVVKNKVAPPFRQAEFDIMYNEGISVAGNLLDVATDLGI
FT                   IRKSGAWYYLGEERLGQGRENAKAFLKANPELMREIEQRIRQAAPELRGRIQYDGSAAE
FT                   ESDAESAVPTLFDV"
FT   gene            complement(194660..194998)
FT                   /locus_tag="trd_0189"
FT   CDS_pept        complement(194660..194998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0189"
FT                   /product="Protein of unknown function (DUF970) superfamily"
FT                   /note="identified by match to protein family HMM PF06153"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05023"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK2"
FT                   /protein_id="ACM05023.1"
FT                   /translation="MKLLIAIVQSEDADRLIGELVNEGFRVTRIASSGALLRRENASLL
FT                   LGVEDHQVTRVLSIIRRTCRRRKEVVIPYAPALEPGLLWLPENFEVEVGGATVFVLPVE
FT                   RVERITGD"
FT   gene            complement(194995..196659)
FT                   /locus_tag="trd_0190"
FT   CDS_pept        complement(194995..196659)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0190"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06388"
FT                   /db_xref="GOA:B9KXK3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK3"
FT                   /protein_id="ACM06388.1"
FT                   /translation="MIEVEALRYRYPTSRYPALVAPHWAVEAGEFVLLAGETGSGKTTL
FT                   LRSLVSLVPHFYGGWFGGRVLVGGRDTRHHRPADLAGLVGYVGQEPETQTLLDRVWDEI
FT                   AFALENLGFPPRVVAARVEEALDLLGLAHLRNRPIETLSGGERQRLTLASVLALRPQLL
FT                   LLDEPTSQLDPWSAETVLEVLRRLVDELGITLVIAEHRLDRLLGSCTRLTLLEDGKIVA
FT                   DGSPQHVAERLPDPPILVQVSRLLGWSPPALSVAEGKRRLRGCQLLSPVQRPAPSPGPT
FT                   PLALERIACRRGERLVLEDVTLEVARGLVTGIVGRNGSGKTTLLRAALGLEGIVRGRVW
FT                   LGGRPVHETLRAGESGSIAYVPQYPGALLVGSRLRDDLELVARVRQVSTTAVDEIVDLF
FT                   ELHPLLDTHPADLSSGERQRAALAVALTGHPALIVLDEPTRGLGLRLKQRLASELRRRA
FT                   AAGAAVLLTTHDVDFAAMVADRIVLLSEGRIVNEGPPHLVLGESFSYAPIVSRLFGPSF
FT                   VTVSDVEQALRENPAPAKHARIGYTEGDYGEFDRERA"
FT   gene            complement(196656..197651)
FT                   /locus_tag="trd_0191"
FT   CDS_pept        complement(196656..197651)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0191"
FT                   /product="putative Cobalt transport protein"
FT                   /note="identified by match to protein family HMM PF02361"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05603"
FT                   /db_xref="GOA:B9KXK4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK4"
FT                   /protein_id="ACM05603.1"
FT                   /translation="MNAITWLLWALVLVLAISVTRNPFYLSLAALAVATVWIAVDTARP
FT                   LGRQAPRLPLLAAGFLLPWSTAVNALLAHIGDRVLFRLPAWPVIGGPITLNAALYGLLT
FT                   GIALTTALAGTTLLHAVIDRHQALRAIPPNQRVLATTLAIALNALPAFATAARDAVEAS
FT                   RLRGLALPRWRQLQIVVAAILYRGIDYSLATAEVLETRSFAARHRARPATQASSLAMLL
FT                   ASFAVIGGSLAGKPSLALVGVAGLSLGSALIVHSTWRNLRTLQWSLATGAAASLLLAAS
FT                   TLLVLSLRDSAADLAYSPYPALRWPGFSPLAGFAFLLLASPALFLRGSAR"
FT   gene            complement(197648..198586)
FT                   /locus_tag="trd_0192"
FT   CDS_pept        complement(197648..198586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0192"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06156"
FT                   /db_xref="GOA:B9KXK5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK5"
FT                   /protein_id="ACM06156.1"
FT                   /translation="MTRTSRLLRLLLTLLLALALAGAGSTSSRAEQPNGAGLVIRYGDG
FT                   RIVTAYVQFEEPTITGIELLQRAGVPVTVAQFGGLGLAVCAISGEGCPAEDCFCRAKSQ
FT                   PAWFWHYYGLTPDGRWVLHPVGASNRIVRDGDVDGWSWTAGESGLPALTIEEIARAHGI
FT                   ERSSGPPATTQPTAPPAPSVTSPTEPAVTSPVTPVPTSGQPAVGSSTTQPDGQQTGPAS
FT                   SPTVTPTLPTPTLGVLTPTSLAFAEAQPTVPPTAAALAGSSSTPSIGVTPSAPVADSHP
FT                   TGPPWGALLFTSLAAIVLLAYSFARWRRRSP"
FT   gene            complement(198583..200088)
FT                   /locus_tag="trd_0193"
FT   CDS_pept        complement(198583..200088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0193"
FT                   /product="Prenyltransferase and squalene oxidase repeat
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05827"
FT                   /db_xref="GOA:B9KXK6"
FT                   /db_xref="InterPro:IPR001330"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK6"
FT                   /protein_id="ACM05827.1"
FT                   /translation="MRRILAILTIFLLVLAPGASVSANQFTVGRALTGAVTWLTTQQRA
FT                   DGGFAGFTGESDPGMTVDAVLALASVGIDPGSVQQVGGASAIAYLESAAARYSEKPGGA
FT                   AKLILAAVASGRDPRAFGGVDLVARLQRAYDRATGLYDQQLFSNAYALLALAAAGVPVP
FT                   ERAVQAVLERQAADGSWAWDGSTEPGAGDSNTTALVIQALVAAGQREHPQVRQALLYLR
FT                   SVQAADGSFAYQPADQLVGDANSTALAVQALLAAGEEPQSPSWRFALDALARFANSSGA
FT                   LRWRDDAPDDNLFATVQAIPALAREAFPLRGIALPLTRARVPFETTAEGCRLFPETGHS
FT                   LCGPFLETWEQRGGVANFGYPITGPFFDPHLRLLVQYTERARFEFHLKPDGSTLVMLGR
FT                   LGAERLPAAPREPFAPAQPGDPAACTYFVETQHNLCHGFRAYWEQYGGLAVFGYPLSEE
FT                   FVEDGMVVQYFERARFEWHPGSWPERHDVLLTRLGARIVEEGS"
FT   gene            complement(200776..202062)
FT                   /locus_tag="trd_0194"
FT   CDS_pept        complement(200776..202062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0194"
FT                   /product="1,3-propanediol dehydrogenase"
FT                   /EC_number="1.1.1.202"
FT                   /note="identified by match to protein family HMM PF00465"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05889"
FT                   /db_xref="GOA:B9KXK7"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK7"
FT                   /protein_id="ACM05889.1"
FT                   /translation="MSANLTQTVIAMDLVPFRFGPGATADVTVELERLGARRVLLVTDR
FT                   HLRQHGLVEPVEAAILRAGAEVVVFDQVHIEPTDRSLRDAIAFAQRVQPDAYVSLGGGS
FT                   TIDTAKAMNLFTSYPADLFDYINKPVGRGNPVPGPLKPHLALPTTAGTGSETTAVIALE
FT                   LTDRRLKTGISHRFIRPTMAIVDPLNTVTCPPMVTAFAGLDVLCHAIESYTAKPYHVRP
FT                   RPDSPTERPAYIGSNPVADLWSAQAIRWGARYLRRAVYNPLDLEARTFMALASLTAGIG
FT                   FGNAGVHIPHAMSYPIAGLVRDFFPPNYEVDEPLIPHGLAVVVGAPAGLRFTAPAWPER
FT                   HAEVAEMLGIDTRGLPVRAAAEAVADALIQLMRDLGLPSGLAELGFTESDIPALVEGTL
FT                   AQQRILVNSPRPVDERALRAIYREAMRYW"
FT   gene            complement(202202..203071)
FT                   /locus_tag="trd_0195"
FT   CDS_pept        complement(202202..203071)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0195"
FT                   /product="purine nucleoside phosphorylase"
FT                   /EC_number="2.4.2.1"
FT                   /note="identified by match to protein family HMM PF00896;
FT                   match to protein family HMM TIGR01697"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04521"
FT                   /db_xref="GOA:B9KXK8"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK8"
FT                   /protein_id="ACM04521.1"
FT                   /translation="MDILHPWQERAAERAQILAQRYHHTPDALIVLGSGLATLPEDAHV
FT                   VARVPLDELTAIAAPAVTGHPRELVLAEWNGHPIWFCLGRYHLYQGLSAAEAAAPIALL
FT                   AHLPGPIVILTNAAGSLHPTFAPGDLVLIRDHFFVPGLAGHHPLIPPAGRVRFFSLRDA
FT                   YDRHLRAVARAAAARLGLELPEGTYAMVAGPTFETAAELRWLRAAGADLVGMSTIPEVI
FT                   LARALGLRVLAISVVTNLAIPEEPAIPTHEEVAAIGEQARPRLHRLLGFFLDQLAEESD
FT                   AVTGREPV"
FT   gene            complement(203034..203870)
FT                   /gene="recO"
FT                   /locus_tag="trd_0196"
FT   CDS_pept        complement(203034..203870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recO"
FT                   /locus_tag="trd_0196"
FT                   /product="DNA repair protein RecO"
FT                   /note="identified by match to protein family HMM PF02565;
FT                   match to protein family HMM TIGR00613"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04992"
FT                   /db_xref="GOA:B9KXK9"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="InterPro:IPR042242"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXK9"
FT                   /protein_id="ACM04992.1"
FT                   /translation="MIGERGMAETTNHRIRLYRTEAIVLRRRDLGEADRILTLFTPKAG
FT                   KLRVIAKGIRRPQSRLAGHLDLFVRTQVLLARGRELDIVTQAQLVEPFTGLRREPWRAG
FT                   WAGYLADLTDRATVDEDPQPALYDLLLECLRLLAELPDPFAVVRRFEMRLLVLLGYQPE
FT                   LVVCPHCGKQLTPGRLAFAPDHGGILCGECVGHSAGEVPLSVGAVKALRLLLADHWQEL
FT                   ARRPLSLALRGQITSALQAALQAHIGDIAASAAVATLLQEEGHDDGHPPSLAGTSS"
FT   gene            complement(203867..204508)
FT                   /locus_tag="trd_0197"
FT   CDS_pept        complement(203867..204508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0197"
FT                   /product="putative aldolase"
FT                   /note="identified by match to protein family HMM PF01081;
FT                   match to protein family HMM PF01791; match to protein
FT                   family HMM PF02581; match to protein family HMM TIGR01182"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04793"
FT                   /db_xref="GOA:B9KXL0"
FT                   /db_xref="InterPro:IPR000887"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL0"
FT                   /protein_id="ACM04793.1"
FT                   /translation="MNWIETYRLIAVIRLDDLSCAVELAEALLEGGVRVLEFTYTNREA
FT                   GRAIEQVRHRFDGSCLVGAGTVLDAETARQAMLAGAQFIVTPTLRRETIEICRRYSIPS
FT                   VIGAFTPTEILSAWEWGADYIKVNPASLAGPSYFKDVLAPLPQVKLIPSGGVTLETAPA
FT                   FLAAGAVAVAVGSHLIDRTLVARRDWAGLRERAHQWAELVAHPDIGVPAS"
FT   gene            204586..205449
FT                   /locus_tag="trd_0199"
FT   CDS_pept        204586..205449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0199"
FT                   /product="putative NAD(+) kinase"
FT                   /note="identified by match to protein family HMM PF01513"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06363"
FT                   /db_xref="GOA:B9KXL1"
FT                   /db_xref="InterPro:IPR002504"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017437"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXL1"
FT                   /protein_id="ACM06363.1"
FT                   /translation="MARRFGVVAAHGKPEAVELADRIQRWLAAHQCQIANEEALPVVWP
FT                   ELDAIIAIGGDGLIMRVAHHYPDVPILGINVGRVGFLALAEREGWERALHDLVHDRYHV
FT                   QEGPTLAVQLERGRSVLVDAWAINDVVVRAGYQLIEVELYIDGQFVNTYPGDGMIVATP
FT                   QGSTAYCMAAGGPVLTAGVHGFAVTPICPHSPIRIALVVPEQATIEQVYVSDREARLII
FT                   DGEPVASLERGDLVRVRRGKQAFRLVVLPGTNFYEAFRSKFNFQIRPEAQPSRRTRNAD
FT                   TPSGAR"
FT   gene            complement(205435..206055)
FT                   /locus_tag="trd_0198"
FT   CDS_pept        complement(205435..206055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0198"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05271"
FT                   /db_xref="GOA:B9KXL2"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL2"
FT                   /protein_id="ACM05271.1"
FT                   /translation="MEQLIAQAAHLLIALGGAYYLALWFALIVWTFQDIQTRTRSVIAQ
FT                   IFATLLVVLFSVPGALLYLLMRPRETLEEQYERALEEEYLIQDLETAGRCPHCQRPVQD
FT                   DFQFCPYCRAPLKQLCIACGRLLSLDWPHCPYCGTQQPTEEGDVTVQERRSPLEAVQRA
FT                   LGRTPGGRRPEKTLPENEATTLPPGWSRSMRENEPDTSKLPRA"
FT   gene            complement(206078..206422)
FT                   /locus_tag="trd_0200"
FT   CDS_pept        complement(206078..206422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0200"
FT                   /product="Protein of unknown function (DUF970) superfamily"
FT                   /note="identified by match to protein family HMM PF06153"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04557"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL3"
FT                   /protein_id="ACM04557.1"
FT                   /translation="MTAPSKLVIAVVQARDADRLLDALQHEGFRATRISSTGGFLREQN
FT                   VTLLMGVEAHRIGEVLRLIKAHCYTRTQYVNPLFPIVESGEFFVPQPIEVEVGGANVFV
FT                   VPIERFERLP"
FT   gene            complement(206419..207051)
FT                   /gene="tmk"
FT                   /locus_tag="trd_0201"
FT   CDS_pept        complement(206419..207051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tmk"
FT                   /locus_tag="trd_0201"
FT                   /product="thymidylate kinase"
FT                   /EC_number="2.7.4.9"
FT                   /note="identified by match to protein family HMM PF02223;
FT                   match to protein family HMM TIGR00041"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04782"
FT                   /db_xref="GOA:B9KXL4"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXL4"
FT                   /protein_id="ACM04782.1"
FT                   /translation="MSWFITFEGPEGAGKTTQCALLAARLREAGYSLLVTREPGGTPLG
FT                   ETIREWLLAGEALRPETEALLFTAARAEHVWDRIRPALERGTIVLCDRYVDSTLAYQGA
FT                   GRGLDEGWLRELHRIATGDLWPDLTILLDVPVEVGLARRRAAAATITRLDQEELAFHRR
FT                   VRAWYHAAAQRDPQRWRVVDATLPPEVVADAVWATVTEVMKRGRRSP"
FT   gene            complement(207048..208736)
FT                   /locus_tag="trd_0202"
FT   CDS_pept        complement(207048..208736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0202"
FT                   /product="ATPase-like protein"
FT                   /note="identified by match to protein family HMM PF01424"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06106"
FT                   /db_xref="GOA:B9KXL5"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL5"
FT                   /protein_id="ACM06106.1"
FT                   /translation="MPEQTITDNLEDLLAVLPPDIVEALREYNSPEDRAKLLEIVLDLG
FT                   RRPEARFEDREVYLADREITREDIAYVASRIGRFGDDNRAGIERTLHRISAIRSRSGEI
FT                   VGLTCRIGRAVYGTVAIIRDLIESGESILLLGRPGVGKTTMLRETARVLADDLRKRVIV
FT                   VDTSNEIAGDGDIPHPAIGRARRMQVPTPSLQHAVMIEAVENHMPEVIVIDEIGTELEA
FT                   AAARTIAERGVQLIGTAHGNTLENIMMNPTLSDLIGGIQSVTLSDEEARRRGTQKSILE
FT                   RKAPPTFGVLVEIQSRNRVAVHRDVAAAVDAILRGQPLRVEIRERNPDGTVSIWYEELH
FT                   GQDQRAERSMLPSGPRRTYQRIPGTPAPTRPATPSGTIVAVAPPSEPIRRTMRLFPFGV
FT                   SRNRLEDVIRQLMLPVELVRSPREADAVVTLKNYFRKRPQVLREAEQRGIPVYVLRSNT
FT                   AQQMANLFRSLFPERFAGEQEPESAADDGDENAAHDRILAAMEEAEAAAHQVLQGTRSR
FT                   IELRPQEAWIRRLQHQLAERYNLASRSRGREPFRRVEIYREDESW"
FT   gene            complement(208795..209781)
FT                   /locus_tag="trd_0203"
FT   CDS_pept        complement(208795..209781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0203"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05020"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL6"
FT                   /protein_id="ACM05020.1"
FT                   /translation="MFWWRANNAPMIADDSPDQPAAALRGDLVALPAAFHLSPIRGLLG
FT                   SAFGAATGRFVHERGQRAYAQVIAEPGRDHWFIARLVVSRAEEGQRLLDRLAREAGLRG
FT                   VIRLHTLIPEHPDLIAWWQRAGFTPFRRIHLLAGQREQLALPSQSLTIRHQQALDAWEV
FT                   QRLYERVTPRPVQFAEARTRAAWHVGQRAGWRIRGYLLTADGETRAYCRVRSRAGWHIV
FT                   ELVAEDQAASEAIAIVGAALACCARPRDQVLLLLPDEAGATRARFEQAGLTLLETRLWV
FT                   ARYTIRRIRAGFPIAEHARLAGLAEAPRVLYHHERPKVAVLERATRS"
FT   gene            complement(209812..210417)
FT                   /gene="recR"
FT                   /locus_tag="trd_0204"
FT   CDS_pept        complement(209812..210417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="trd_0204"
FT                   /product="recombination protein RecR"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF02132; match to protein
FT                   family HMM TIGR00615"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06194"
FT                   /db_xref="GOA:B9KXL7"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL7"
FT                   /protein_id="ACM06194.1"
FT                   /translation="MRARGPAEPIARLIEEFAKLPGIGPKTASRLAYHLLRCSREDALA
FT                   LAQAIIEVKERVQLCSRCFNLTDVDPCPICADPSRDQRTICVVEDPLDVLALERTGAYH
FT                   GVYHVLHGVISPVDGIGPERLRIRELVHRVQQEQPNEVILALNPNIEGDATAMYIARQL
FT                   IPLGVTVTRPASGLPVGGDLEYADEITLGRALAGRRAL"
FT   gene            complement(210497..212734)
FT                   /locus_tag="trd_0205"
FT   CDS_pept        complement(210497..212734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0205"
FT                   /product="DNA translocase ftsK"
FT                   /note="identified by match to protein family HMM PF01580"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05215"
FT                   /db_xref="GOA:B9KXL8"
FT                   /db_xref="InterPro:IPR002543"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018541"
FT                   /db_xref="InterPro:IPR025199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR041027"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL8"
FT                   /protein_id="ACM05215.1"
FT                   /translation="MARKRAKERRTRGETAPLAAGSQRRRLRAIVTRLAQVAALVPRRL
FT                   PRDLAGLFLATVGVLLTLALFGHERETGLAGWFAQTCRQLFGRGAIVVPLACWWGALEL
FT                   VASRSRAGTVRRAVGLALYGSAAVALLDARPADQVEEAGGYIGAGVAALLRLIGGDLGL
FT                   GLLALALGLAGSTLVAGIELGTLARTILTAARRTGQIVRRRSSARAVDLPASPAPAESG
FT                   RSDETVQRETTRPVIATRHTPASRSRGRRTPVSPQQRVQERPSGEPEPVAANAATPAAA
FT                   GDQVLPEISRLQRYEASLPDAEELERKAAIIQETLANFRVDARVREIYPGPAVTLFTLE
FT                   PGPGVKVRRITELQNDLALALAAPAIRIEAPVPGMARVGIEVPNSAISTVGLREVLESA
FT                   TFQRSRARLPLALGRDVHGEYVVADLTRMPHLLIAGATGSGKSVCINGIIATFLLTRRP
FT                   DELQMLLIDPKKVELAGYDGVPHLKRPVVTDMGLVVGALRRVLQEMERRYELFAQLGVR
FT                   NLEGYRLRREEDPSLEPLPYLVVIIDELADLMLTTPDEVETLLVRLAQMARATGIHLLI
FT                   ATQRPSVDVLTGLIKANVPARIAFAVTSQTDSRVILDMPGAERLLGRGDMLYLPPDAAR
FT                   PLRVQGSFIDDRDLEYVVEHWRQLYPVPQYDPSWLDLEETIQETSRGEDPLLEQARQLV
FT                   RQLGTASTSLLQRRLRIGYNRAARLMEQLEAEGIVGPAEGARGRVVYLGDE"
FT   gene            complement(212784..213476)
FT                   /locus_tag="trd_0206"
FT   CDS_pept        complement(212784..213476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0206"
FT                   /product="phage DNA polymerase-related protein"
FT                   /note="identified by match to protein family HMM PF03167;
FT                   match to protein family HMM TIGR00758"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04590"
FT                   /db_xref="InterPro:IPR005122"
FT                   /db_xref="InterPro:IPR005273"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXL9"
FT                   /protein_id="ACM04590.1"
FT                   /translation="MPRWMTRTGRRNEREEQTVSEERSARELLESIAERVRHCTRCDLW
FT                   RTRTQAVPGEGDPHAEVMFIGEAPGYHEDRQGRPFVGAAGQFLNELLGRAGLRREQVYI
FT                   TNVVKCRPPGNRDPLPDEIAACAPYLDEQIAVIRPSVIVTLGRYSMARWFPNEKISRIH
FT                   GKPRRFGDVVVVPMYHPAAALHQPALKELVEKDFDALREIIAQARAEAARTVEAQQSEE
FT                   KAQQMRLF"
FT   gene            complement(213313..215394)
FT                   /locus_tag="trd_0207"
FT   CDS_pept        complement(213313..215394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0207"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /note="identified by match to protein family HMM PF00929;
FT                   match to protein family HMM PF01541; match to protein
FT                   family HMM PF02151; match to protein family HMM TIGR00573"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05471"
FT                   /db_xref="GOA:B9KXM0"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM0"
FT                   /protein_id="ACM05471.1"
FT                   /translation="MSDQPVEPAYDRLRSRARQLLLARGGIASEEQLIEGLFGSLGNRR
FT                   LWAPFLAQLLETDAEIVRRPDGTWALRRRPLVPSRGWPRSFVALDVETTGLRPARHRII
FT                   EIGAVRYEDGCCVERFSVLVNPHRRLPVYIVRLTGIRDEDLLTAPSFVDVAAAFRVFLG
FT                   ESTVIGYNVGFDLDFLNAELRRIGQGPLPNPALDVLPLARALLTANGRYDLDAICRSIG
FT                   LARGTRHRALPDAEATAVLYLHLVERAEQVGYRSPSDLQPAATRRTIVVEPVARGRAVL
FT                   DQRLLADTPELPGVYLMRDALGRVLYVGKARNLRQRVRSYFSQPLGYTRKMDGLLESVA
FT                   EIETVVTGSELEALLLESQFVQRYKPPYNTQLRNHEAYPYVKVELGRPWPRLMLARQRD
FT                   DDDAVYVGPFRSTAAARSVVELLHQLLPLRTCHRSFRDARSYGRPCLQLTLGRCIGPCT
FT                   GCVTPDEYRALVDCALRYLSGETSVVVERAQQLLADAVERLDFERAARLRDLLRRSEEL
FT                   VFSHRLVRQTISGRPCVIVTPCPETGDRAFLLIVAGRLWARVVADPREHDAAVAARLGA
FT                   AWERAQQAAPWTLDQDSLDAAVIIARWLSEHAEDPTVFFLEHPVDWLALVRNGRSLPAS
FT                   AFAVHAPVDDENGTTKRTRGADSERGTQCEGTPGKHRRARPSLHALRSMADPHSGGAR"
FT   gene            complement(215391..215558)
FT                   /locus_tag="trd_0208"
FT   CDS_pept        complement(215391..215558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0208"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04864"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM1"
FT                   /protein_id="ACM04864.1"
FT                   /translation="MLRHPVPPSLLTRVWRSIALASIRQRPLRAAAGRQDEPSTVGRVP
FT                   YQGCGTRSAG"
FT   gene            215547..217634
FT                   /gene="ligA"
FT                   /locus_tag="trd_0210"
FT   CDS_pept        215547..217634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ligA"
FT                   /locus_tag="trd_0210"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number="6.5.1.2"
FT                   /note="identified by match to protein family HMM PF00533;
FT                   match to protein family HMM PF00633; match to protein
FT                   family HMM PF01653; match to protein family HMM PF03119;
FT                   match to protein family HMM PF03120; match to protein
FT                   family HMM TIGR00575"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05038"
FT                   /db_xref="GOA:B9KXM2"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXM2"
FT                   /protein_id="ACM05038.1"
FT                   /translation="MAEQPALQADRVPPEVRARVEELRRLIQRYNYEYYVLNAPTVSDA
FT                   EYDALMLELRRWEEQYPELVTPDSPTQRVGAPPAEGFATVQHEIPMLSLGNVFSDGEIR
FT                   AWAERVYRLSGRQDVEFVTEPKVDGLAVSLLYRDGVLVRGATRGDGYTGEDVTNNVRTI
FT                   RMIPLRLYPPEGVIVPPVLEVRGEVYMNVRDFERLNRERGEQGLPLFANPRNAAAGSLR
FT                   QLDPSVTASRPLRFAAWDIGLWEGTEPPATHLATLEFLRQLQIPVVPDYRLCRSVDEVI
FT                   AECHRWQERRDALEFEADGVVIKVNDRALYQALGVVGREPRGATAYKFPAHEKTTIVRD
FT                   VIWSVGRTGKLTPVAVLEPVEIGGVIVERATLHNEEEIRRLGLLIGDAVVVQRRGDVIP
FT                   KVVATIPQRRDGDERPVDIPRQCPVCGAHTIRLEGEVDRYCPNPNCPARLKASVRHFAS
FT                   RNAMDIEGLGEKISDLFVDLGIIRSLPDLYEIDWARVLQLEGFGPKKVENLRKAIEASK
FT                   NRPFARFLFALGIRHVGERNAQLLADHFRSIDRLMEATIDELLQIPGFGPAVAQSVFEF
FT                   FREPKNREMIERFRRLGVRMAEEEAAAVATVQGPLAGKTVVLTGRLETLTRSQAEELLR
FT                   RAGAHVTDSVSRKTDYVFAGADPGSKYVRAQQLGVPILGEEDLLRMLRESGIEVEAAAR
FT                   S"
FT   gene            complement(217629..218201)
FT                   /gene="pyrE"
FT                   /locus_tag="trd_0209"
FT   CDS_pept        complement(217629..218201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrE"
FT                   /locus_tag="trd_0209"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /EC_number="2.4.2.10"
FT                   /note="identified by match to protein family HMM PF00156;
FT                   match to protein family HMM TIGR01367"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06108"
FT                   /db_xref="GOA:B9KXM3"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM3"
FT                   /protein_id="ACM06108.1"
FT                   /translation="MHDVGALLTGHFLLASGRHSDRYIEKFALLRWPRRVEEMCRELLA
FT                   RLPWRGIDAVVGPTTGGILLAFECARQLGIQAAYAEREHEGSSRRVIRRGTRFSPGTRV
FT                   LVVDDVLTTGGSLRETLRAVGEHPVEIVGVAVLIDRSTESIDLGVPPVALLRLDIANWP
FT                   PDRCPLCQQGLPLVKPGTTALPGHASS"
FT   gene            complement(218177..219505)
FT                   /locus_tag="trd_0211"
FT   CDS_pept        complement(218177..219505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0211"
FT                   /product="vacuolar cation/proton exchanger 1a"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01699"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04649"
FT                   /db_xref="GOA:B9KXM4"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM4"
FT                   /protein_id="ACM04649.1"
FT                   /translation="MRRWLAGLLLVPLALEFLHAPPLPALLASAAVLVPLAALLGRATE
FT                   EAAAHTGPLVGGLLDSTLGKAAELIIALAALRADLHELVKASLAGSILLLILGACLLVG
FT                   GLRHGLQQFDAQLAGISAPMMMLAVVLLLAPGLFTLGPTPVQGEAVEWMSVGLALVVAG
FT                   LYALSLLATLRLPGTVTEHEHTAWPLRRAALVLAGATIGLLFMSEVLVGAVEPVVAATG
FT                   IFAFFGGVVLVLLVESVAEHFVAVQVAHRNRMDSSLGIGYGSTLQIALAVMSILVFARL
FT                   VPSRPLSLVFDVSELVALLGAALVSTLIALALAGRSDPACGLRWPGRGLFLLAMLAALR
FT                   VPGQGTVCVSDPYRSARVSTRVPDTSSYRELPVSHSRLELGARTGWTSIGEADRPFGAA
FT                   WASSQSIVRAARHHRRRERWSRFSPTSRLPRHSCETCTTSAHC"
FT   gene            complement(219515..222751)
FT                   /gene="carB"
FT                   /locus_tag="trd_0212"
FT   CDS_pept        complement(219515..222751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carB"
FT                   /locus_tag="trd_0212"
FT                   /product="carbamoyl-phosphate synthase, large subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00289;
FT                   match to protein family HMM PF01071; match to protein
FT                   family HMM PF02142; match to protein family HMM PF02222;
FT                   match to protein family HMM PF02655; match to protein
FT                   family HMM PF02786; match to protein family HMM PF02787;
FT                   match to protein family HMM TIGR01369"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05903"
FT                   /db_xref="GOA:B9KXM5"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXM5"
FT                   /protein_id="ACM05903.1"
FT                   /translation="MARQPLVSSVLVIGSGPIVIGQAAEFDYSGSQALRALREEGIRTI
FT                   IVNSNPATIMTDEDMADAVYIEPLTVEVLERIIARERPEGLLATLGGQTGLNLAVALAE
FT                   AGVLDRYGVRLLGTPLEAIRRAEDRQLFKELLLEIGEPVLESLTAYSVEDALRFAEEVP
FT                   PPLIVRPAFTLGGTGGGIAFSEDELVTLVQRGIAASPIGQVLVERSLLGWKEIEYEVMR
FT                   DANDTCITICNIENLDPMGVHTGDSIVVAPSQTLSDRDYQMLRSAALKIIRALGIVGGC
FT                   NIQFALDPRSDQYYVIEVNPRVSRSSALASKATGYPIARIAAKLAIGRTLDEIPNPVTG
FT                   KTMASFEPALDYCVVKIPRWPFDKFRHGDRRLGSQMKATGEVMAIDRCFEAALQKAVRG
FT                   LETDQTDLTWEDSRWQDPSALEQALRIPTDQRLWAVAAALRRGWTPEHVSALSGIDTWF
FT                   VRAIQRLVEMEQRLASEPLTAELLWEAKRLGFADRTIAALRTTTEQEIRAQRLALGLAP
FT                   VYKLVDTCAAEFAAETPYFYATYEDENEAPPLDSPKAVVIGAGPIRIGQGIEFDYCSVK
FT                   AAQALHRAGVAAIMLNNNPETVSTDFDASDRLYVTPLDAESVLDVLRHEASSQYDQLPP
FT                   VIVQFGGQTAINLAADLAAAGVPILGTDQDAIDLAEDRRRFERFLHELGIPQPPGAGVT
FT                   TLEEALETAERIGYPVLVRPSYVLGGRAMEVVYRREHLEQYLATSGAFASGRPVLIDKY
FT                   LDGIELEVDALCDGHEVLVPGIMQHIERAGVHSGDSFAVYPAVELPSVHVDTLVRYTTE
FT                   IALALAARGLINIQFVLHQGVVYVLEVNPRASRTVPFLSKVTGVPMVDVATQILLGRSL
FT                   GDQGYRGGLWPRQPLVAVKAPVFSMAKLQGVDVQLGPEMKSTGEAMGIDRTFEAALAKA
FT                   FLAAGLAIERGAPVLLSLADNDKSAGVELARGLLALGHPLVATEGTARYLRAHGVPVEL
FT                   TVAHIGHGHPDVLEVILERKVRGVINTPGRDEGTIQDGFLIRRAAVERGIPCLTSLDTA
FT                   RALVRALLGGGTSFSVQPLPAYRTREAVLA"
FT   gene            complement(222754..223905)
FT                   /gene="carA"
FT                   /locus_tag="trd_0213"
FT   CDS_pept        complement(222754..223905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="carA"
FT                   /locus_tag="trd_0213"
FT                   /product="carbamoyl-phosphate synthase, small subunit"
FT                   /EC_number="6.3.5.5"
FT                   /note="identified by match to protein family HMM PF00117;
FT                   match to protein family HMM PF00988; match to protein
FT                   family HMM TIGR01368"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04539"
FT                   /db_xref="GOA:B9KXM6"
FT                   /db_xref="InterPro:IPR002474"
FT                   /db_xref="InterPro:IPR006274"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR035686"
FT                   /db_xref="InterPro:IPR036480"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM6"
FT                   /protein_id="ACM04539.1"
FT                   /translation="MSIQRSRIGALVLEDGRIFPGTPFGARRPAEGEAVFTTVMTGYQE
FT                   VVTDPSFYGQLVCMTYPLIGNYGVCDEDEQSRRPWAAGLIVREYCDRPSHWKARETLAS
FT                   YLERWGIPGLAHVDTRALTRHLRTHGTMRAILVPDRTGLTDAELVAWAQRAWTPDREDV
FT                   VPAVRGEPATFGPADAPHIVLIDCGVKRNIIASLLRRAVRLTVLPYGVDAATVLALEPD
FT                   GIVVSPGPGDPTRATDAIETVRVLATSGIPFFGICLGHQLLALAAGARTIKLTFGHRGG
FT                   NHPVKEIPTGRVRITSQNHGYCVAHDSIPEQDGWQVWMINVNDGTVEGLRHRSLPVLTV
FT                   QFHPEGSPGPQDSQDLFDAFVELVQQRWRARTARPIVLAGEGA"
FT   gene            complement(223814..225205)
FT                   /locus_tag="trd_0214"
FT   CDS_pept        complement(223814..225205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0214"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="identified by match to protein family HMM PF01979;
FT                   match to protein family HMM PF07969; match to protein
FT                   family HMM TIGR00857"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06077"
FT                   /db_xref="GOA:B9KXM7"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR004722"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM7"
FT                   /protein_id="ACM06077.1"
FT                   /translation="MLRGGRLVDPSQGIDGEADLLVADGQVRAVGGRVPEPSGATVIDA
FT                   AGLVVAPGFVDVHAHLRDPGFPEKETLETGSVAAAAGGFTTICCMPNTMPPLDTPERIR
FT                   ELVERARSLPVRIFPIGTISRGRRGEELADLVGMAEAGAIGFSDDGDSTRSARVMRQAL
FT                   QLSRLLGRPIMVHCEDPTLSAGGVMHEGGVSQQLGLPGIPAAAEEIVLARDLELARLTG
FT                   GWLHVLHLTTARGLMLVRRAKREGNRVTVEVTPHHLLMTDEWVAGIRRFAGEMKPFPAG
FT                   PCPDPNAKVNPPLRPEADALALRAGLRDGTIDLIATDHAPHHEQDKPPVLERAAFGMIG
FT                   LELALPLLLRLVRTGALTVSELVEFLSCRPATLFGLPGGTLRPGSPADVVVFDPEEPWQ
FT                   VTRATLRSRSANTPLLGLTLRGRVRLTIVGGKVAYVDTAFADRCTRSGRRADLSGYSLR
FT                   STPPG"
FT   gene            complement(225611..226267)
FT                   /gene="maf"
FT                   /locus_tag="trd_0215"
FT   CDS_pept        complement(225611..226267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="maf"
FT                   /locus_tag="trd_0215"
FT                   /product="septum formation protein Maf"
FT                   /note="identified by match to protein family HMM PF02545;
FT                   match to protein family HMM TIGR00172"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05044"
FT                   /db_xref="GOA:B9KXM8"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXM8"
FT                   /protein_id="ACM05044.1"
FT                   /translation="MTLVLASASPRRRALLAVLGIPFVVDPAAIDEPLPERHSHPERIA
FT                   RALARHKATVVAARRPGDWVLAADTVVVFRGRLLGKPESAEEAHAMLRLLRGRWHRVIT
FT                   AVALARGRRRWVDHTTTWVLMRQYSDEDITASIARGEPFDKAGGYAIQDPDLRPVESWR
FT                   GCYCNVVGLSIWLTWRLLQQAGFPVSTPDERTLPPVCQQCPLAPAEVTSRTANRE"
FT   gene            complement(226264..227484)
FT                   /gene="rumA"
FT                   /locus_tag="trd_0216"
FT   CDS_pept        complement(226264..227484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rumA"
FT                   /locus_tag="trd_0216"
FT                   /product="23S rRNA (uracil-5-)-methyltransferase RumA"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF01938;
FT                   match to protein family HMM PF05958; match to protein
FT                   family HMM TIGR00479"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06285"
FT                   /db_xref="GOA:B9KXM9"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXM9"
FT                   /protein_id="ACM06285.1"
FT                   /translation="MPMGETLPTPRTLRTVPLHLEDMAYQGAAIGREDGRIVFAEYGIP
FT                   GEDVLVAIEKDRKDHSLGRVIEVRTASPERVDPPCPYFGICGGCQWQHIRYEYQLVLKQ
FT                   AVVRQQLRRIGKFDDPPVLPTVPSPQPYGYRNHARFSVDGKGNLGYISRPGHGYRFLRI
FT                   DRCLIMHPAINEVLRRLQERAHVKHQLMVRYGVNTGELLVHPDVSAIDPTIPSGQPAYH
FT                   ESLLGHRFRISASSFFQTNTAVAERLIQLVLERIAPTGNEVVVDAYAGVGTFAAFLAPR
FT                   VARVIGIEESPSAVSDAQVNLDPFDNVEYVQAKVEHVLGKLAVRPDVVILDPPRVGCAP
FT                   EALTGVLMLRPPRLIYVSCDPATLARDLRKLVDGGYRLLDVTPLDMFPQTYHIESVATL
FT                   ELAEGTP"
FT   gene            227907..228257
FT                   /locus_tag="trd_0217"
FT   CDS_pept        227907..228257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0217"
FT                   /product="S-adenosylmethionine decarboxylase proenzyme"
FT                   /EC_number="4.1.1.50"
FT                   /note="identified by match to protein family HMM PF02675"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05212"
FT                   /db_xref="GOA:B9KXN0"
FT                   /db_xref="InterPro:IPR003826"
FT                   /db_xref="InterPro:IPR016067"
FT                   /db_xref="InterPro:IPR017716"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXN0"
FT                   /protein_id="ACM05212.1"
FT                   /translation="MKSLGRHVIVELWGCQNIDSLQAVEEAIRDAVAATNATLRDLQVF
FT                   PWEPYNGVSGIAILSESHLSIHTWPELGYAAVDVFTCGEHTNPEAAIPVLRERFRPQRM
FT                   EVMQVSRGMIVD"
FT   gene            228250..229188
FT                   /gene="speE"
FT                   /locus_tag="trd_0218"
FT   CDS_pept        228250..229188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="speE"
FT                   /locus_tag="trd_0218"
FT                   /product="spermidine synthase"
FT                   /EC_number="2.5.1.16"
FT                   /note="identified by match to protein family HMM PF01564;
FT                   match to protein family HMM TIGR00417"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04595"
FT                   /db_xref="GOA:B9KXN1"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN1"
FT                   /protein_id="ACM04595.1"
FT                   /translation="MIDGGLWHTDDPEVPSQRVFLQVRDVLYRGTSPFQEIAVIETVLF
FT                   GRALVLNNVLQTAERDEFCYHEMLVHPVMIAHPAPRRVLIIGGGDGGALRRVLQHPVEQ
FT                   VTMVEIDQQVVEACREHLWNIHRGAFDDPRVELRFEDGFAYVERRSATFDIIIVDGPDP
FT                   LGPTPGMVLFSPDFYHGLADMLAPGGLVVQQTESPMLLPIQTAATHLHLREVLPIVRTY
FT                   LTTVQSYDSFWSFTVASRDVDPAALDIETVAARLRERGIDDCQYYSPEIHWAAFRLPPF
FT                   LRRFIEDSIALGRPADSHPLLPEAAARRATA"
FT   gene            complement(229339..230604)
FT                   /locus_tag="trd_0219"
FT   CDS_pept        complement(229339..230604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0219"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05453"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN2"
FT                   /protein_id="ACM05453.1"
FT                   /translation="MAIQIETSSLPVLAQPTSLEEAGLDLQLVLELALKFLYAHGTQTA
FT                   RELVEALCLPFAGLLERALSQAKREELVEITGSNGIGELGYRYALTSKGHQRAQEFLAR
FT                   NGYIGPAPVPIEQYRQIVAAQSLRHLSVTPRMIKEALGPLVFTESVLDQIGQALNSGQA
FT                   IFLFGKPGNGKTALAQRVVAMYGGAVFIPHAILVDTQIIRVFDRHHHHPLPEQPTSDRR
FT                   WMLCARPLIQVGGELTLEQLDLIYDERNRLYEAPLQLRANNGVLLIDDFGRQRVPPRAL
FT                   LNRWIVPLEQRIDILTLHTGKQVEVPFEGLVIFSTNLQPTDLVDEAFLRRIPNKIHLAN
FT                   PTVQQFAEIFRRQCAELGVPFDQRGLAYLLRTYYVGKRELRACHPRDLLRALIGAARYL
FT                   GQEPRLTPDLIDRACRSYFIDP"
FT   gene            complement(230715..231695)
FT                   /locus_tag="trd_0220"
FT   CDS_pept        complement(230715..231695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0220"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="identified by match to protein family HMM TIGR01730"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04601"
FT                   /db_xref="GOA:B9KXN3"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN3"
FT                   /protein_id="ACM04601.1"
FT                   /translation="MSERRRRSIPIILALVTVAVVAGLWLWLRRPSETVWVTQRADLTA
FT                   SVEVPGRLVSLRTLPLRASYETRVRLLAVAPGDRVRAGDIVAVLDDTPLLTRRAQAEQQ
FT                   LLQAEATLSQAEATDAPLEVRLRAEQQRREAARAFDEVTRRLADKYVLAPSDGIVTELL
FT                   VSEGAPVTTGSILARLADTSVLGVSATIDEVDARFFAEATTVRVTVDALPGWQGRGEVV
FT                   GRGESATQQAGIVGFPLLIRLAETASDLRPGMTATIHLDTIVRHDVLVVPERAIRTVGE
FT                   RAFVTVVTNGRREEREVTLGLRSSGLVEIAAGLAEGEQVLLPAGN"
FT   gene            complement(231688..234039)
FT                   /locus_tag="trd_0221"
FT   CDS_pept        complement(231688..234039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0221"
FT                   /product="putative permease domain protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05808"
FT                   /db_xref="GOA:B9KXN4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN4"
FT                   /protein_id="ACM05808.1"
FT                   /translation="MPIALLAAFAMRSLRLRRIRATLAGASIALAVFAVVAIRSAGLAL
FT                   IEAQQRTYAATGQPDIVASVHGLTPGLVAALARRDGVLEAESRLIQSSRLTVDGRWRAV
FT                   RLVGIERFDQLALDRPELVAGRWPERGEVVLDVTARHLLGIEIGTLVAFQANPGDPIHY
FT                   ARVSGFAWVPARPSATLLDQFTAYVPLRTLRQWTGSEAANTLLVRVDNPALAGRVASEL
FT                   QRFLAARQIPSSGWTVRDPDSFLGARELATLLLLLRAFAILGTLTALFIVANTTIGLVT
FT                   EERPQLGTLRALGTTRSQLVSAYLAPHIVIGTAGSVVGLLAGTAGGYVLTAYLAGLAGL
FT                   VLPPLRVAPSSVLLALGCGLGIAVAGALGPILHATRTPAAQLLRGDTRAPGDPPRWLTR
FT                   STGWLAQRSPILGMSTRDPFRRPLRAALTVLVTAVALAALLASQIVDHSLRAGIAALYD
FT                   RYRADAWLLTNPPVPPTYAHRLANSPPVRAAEPWVLTSGAIGSVRTDVWGLPAKTSVYQ
FT                   PVMLAGQWLDDAPAAYPPRAVITGNLARRLDAQVGDVLPLDLGRQRLPIQVSGIVDDES
FT                   TYLGATAIGKVFLDHQILTRLLGRDDRAALYALRFWDTVRPSDSLTTVEQYARTLRPLT
FT                   LLMAEDRAATERVLAVLTILARIVVLVITIATVFGITNALLLDLTERRREFGILRTLGT
FT                   ERATLVLLLAGQTLVIVVFGALLAVPVGFLLAVNILALVSRQLFAIPLALPSTVVLVLI
FT                   AAVALTTALAVLIPALLAVRLRPVEVLRYE"
FT   gene            234145..234294
FT                   /locus_tag="trd_0222"
FT   CDS_pept        234145..234294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0222"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04736"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN5"
FT                   /protein_id="ACM04736.1"
FT                   /translation="MPEPMRAGSRSGDDLEDGRMWGVTRVNDKGSCQGVTIPLRWMPSW
FT                   YRRE"
FT   gene            234320..236191
FT                   /locus_tag="trd_0223"
FT   CDS_pept        234320..236191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0223"
FT                   /product="peptide/opine/nickel uptake family ABC
FT                   transporter, periplasmic substrate-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05651"
FT                   /db_xref="GOA:B9KXN6"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN6"
FT                   /protein_id="ACM05651.1"
FT                   /translation="MQELERLREEIASGQATRREVLRRAAALGLSAPVIASLLAACARQ
FT                   EATPTAAPAAQTPAAAATPTPAAAATPAAQATPTQAAAKRGGGGTLRLLWWQAPTIINP
FT                   HLAQGTKDFDASNIVLEALAYFDSEDKLVPRLAEEVPSVEKGTLDPEGRWVIWKLRKGV
FT                   KWHDGQPFTAKDVKFTYEYVIDPATTATTIASYRAIESVEIVDDYTVKVTFKNPNPAWF
FT                   EPFVGGFGLIVPEHILRDYTGEKARNAPFNLKPIGTGPYKVADFKPGDVVIYEINQDYW
FT                   QEGKPYFDRVELKGGGDATSAARAVLQTGEVDWAWNLQVEAQVLLQLEKAGQGKLIITP
FT                   GPSTERIMVNFADPWTEKDGARAEPDVPHPFLTNKNIRQAIALAIRRDVIAEQLYGPAG
FT                   QVTANNLNAPARFKHPELKWEFNLEKAAQLLDEAGAKDTNGDGVREYNGKPLQILYQTS
FT                   INSIRQRTQEIVKAEMEKIGFKVELKSIDASVFFSSDPGNPDTYGHFYADLEMYTNGPS
FT                   NPFPLNWARRYHSQEVARKANNWSGVNITRYQNPEMDKVLDQLATEMNPDKQTELFRQV
FT                   NWISVTDVVEIPLVHRNSVSAATKNLTGYKPSTWASDVWDIGDWRRE"
FT   gene            complement(236244..236945)
FT                   /locus_tag="trd_0224"
FT   CDS_pept        complement(236244..236945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0224"
FT                   /product="putative ABC superfamily (atp&memb) transport
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05645"
FT                   /db_xref="GOA:B9KXN7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN7"
FT                   /protein_id="ACM05645.1"
FT                   /translation="MSHPPLVRLDCISKVYRDGQREIVALDQVTLDITAGEWVAIVGPS
FT                   GCGKSTLLNLIAGIDRPTSGRVIIAGTDLAQLDEEALARWRRSHVGIVFQFFQLLPTLT
FT                   ALENVQLPLVLAGRRDAPQRARELLERVGLAYRAHRLPSELSGGEQQRVAIARALANDP
FT                   PLLLADEPTGNLDSASGETVLELFRTAWHHGTTILLVTHDREVAARAQRIVELRDGRVV
FT                   ADSASRVSPAR"
FT   gene            complement(236968..237228)
FT                   /locus_tag="trd_0225"
FT   CDS_pept        complement(236968..237228)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0225"
FT                   /product="Transglycosylase associated protein"
FT                   /note="identified by match to protein family HMM PF04226"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04783"
FT                   /db_xref="GOA:B9KXN8"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXN8"
FT                   /protein_id="ACM04783.1"
FT                   /translation="MLPAEPRSLLGWLVIGFLAGWLAGLLTRGRGFGCLGNIAIGLLGA
FT                   VVGGYLFQLLGVRGPAGFLGSLLVALVGAGVLLLVVNLMRR"
FT   gene            complement(237215..238021)
FT                   /gene="trmD"
FT                   /locus_tag="trd_0226"
FT   CDS_pept        complement(237215..238021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="trd_0226"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /note="identified by match to protein family HMM PF01746;
FT                   match to protein family HMM TIGR00088"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05891"
FT                   /db_xref="GOA:B9KXN9"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXN9"
FT                   /protein_id="ACM05891.1"
FT                   /translation="MRFDVFTIFPGMFTGFLTESILKRAQQAGLIEIAIHNIRDWTTDK
FT                   HRTVDDTPYGGGPGMVMMAPPIVHAVESVLGQEQNSTPIIIMSPSGELFTQDIARQLAC
FT                   FPRLALICGRYEGIDDRVRIILRARELSIGDYVLTGGELAAAVVIDVVSRLVPGVIDPE
FT                   SLAEESHNSGLLEYPQYTRPPIFRGLGVPEILLSGNHAKIAEWRRMMALCRTAARRPDL
FT                   LARAALTPRDHELLQRCPPDPFAHQGPVYEGDQLERPEGGEQGASR"
FT   gene            complement(238078..239394)
FT                   /locus_tag="trd_0227"
FT   CDS_pept        complement(238078..239394)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0227"
FT                   /product="HD domain protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05977"
FT                   /db_xref="GOA:B9KXP0"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP0"
FT                   /protein_id="ACM05977.1"
FT                   /translation="MTVQRATVDLRRLLPILIPLSAANLAAWVYLTRLWPPDLTPRTLF
FT                   TAVIFVALIVLAEQLAIDLPIPHARITVSVSSAITFAGVLTLGPTLGILVAVVGTFLDD
FT                   LIDRREPLKILANANNFALQGVVAGPLYFTLADEGSPLASMRNFLAMLLAAVVSSSFQT
FT                   VLLALVLSLASGTSAWYLWRGMARGLLVEFLALPALGSLFPILAREHPLALVLMVIPLV
FT                   GPYLAFRDYRQLHHETQSTFELLADLLDRRDPYTASHSQRVAHLTMLILDEFPELSADE
FT                   RDAIIAAARIHDLGKVATSDLILRKPGRLTDDEFAVIQRHPVDGSEILRHLTPYRHIVE
FT                   IVRHHHERWDGRGYPDGLAGEAIPFGARVIAVADTYDAMTTDRPYRRALSHEEALAELQ
FT                   RGAGTQFDPVVVAAFERALARAREAVREKTAPSMSAPVS"
FT   gene            complement(239583..239732)
FT                   /locus_tag="trd_0228"
FT   CDS_pept        complement(239583..239732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0228"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04979"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP1"
FT                   /protein_id="ACM04979.1"
FT                   /translation="MTSRTGLGNFALRVIGTQVLLGPGRSQHGKGDPGEVEELEDPLIP
FT                   ASSE"
FT   gene            240059..241093
FT                   /gene="rfbB"
FT                   /locus_tag="trd_0229"
FT   CDS_pept        240059..241093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbB"
FT                   /locus_tag="trd_0229"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01073; match to protein
FT                   family HMM PF01370; match to protein family HMM PF02719;
FT                   match to protein family HMM PF04321; match to protein
FT                   family HMM PF07993; match to protein family HMM TIGR01181"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06140"
FT                   /db_xref="GOA:B9KXP2"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP2"
FT                   /protein_id="ACM06140.1"
FT                   /translation="MSDAVFRRILITGGAGFIGSHFVRLALAAGIPSVVVLDKLTYAGS
FT                   LLNLEEVLDDPRVRFLEGDIADPAAVAEAMAGCDAVVNFAAETHVDRSLLEPAAFIRTN
FT                   VWGTMVLLEQALRLGVGRFLHVSTDEVYGEVLSGSVSEDEPLRPRNPYAASKAAAEHFV
FT                   FAYWTSYGLPVLVTRGCNTYGPYQHPEKFIPLAITNLLTGRPIPLYGDGLHERDWLYVE
FT                   DHCRAIWTVLVRGEPGQAYNIGAGQHRPNIAVARALVRLLGADPSAIVHVADRPGHDRR
FT                   YAVDWSRLRALGWRPMVDFEDGLARTVAWYRARTDWWSARRDAAFAAYYARNYQGREGY
FT                   RNQP"
FT   gene            241090..241803
FT                   /locus_tag="trd_0230"
FT   CDS_pept        241090..241803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0230"
FT                   /product="putative Stage II sporulation protein E (SpoIIE)"
FT                   /note="identified by match to protein family HMM PF07228"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05304"
FT                   /db_xref="GOA:B9KXP3"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="InterPro:IPR039248"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP3"
FT                   /protein_id="ACM05304.1"
FT                   /translation="MTLTIELAVAKTHRAGNRESGDTVELIERPGGGLSVVLVDAQGSG
FT                   MAAKLLSLQVAGRVLTLLNEGVRDGAAARAAHDFLFTLRGGRVSAELDIVSVDLASRTL
FT                   VVTRNSEAPLVLIRDSDVEIVASTGGRIGLYRHTRPSVTEWTLEPGLTVIVVSDGVAHA
FT                   GAHAGKTIDLATLARQESVACETAQQLADRVLSAALAADRGHPRDDMTVVVLRLQAGGV
FT                   RQPVRRLSLTFPLTE"
FT   gene            241858..242208
FT                   /locus_tag="trd_0231"
FT   CDS_pept        241858..242208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0231"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06352"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP4"
FT                   /protein_id="ACM06352.1"
FT                   /translation="MRVVLVGPCGAGKSTIAAELAARGVEAIAVGQEHSIIRDLWRRPA
FT                   ADLVVFLDASLETVRERRGADWPAWLYEEEQRRLSEARAHADLVLDTGRLTVGEVVERI
FT                   LRALEKAGQHGT"
FT   gene            242198..243919
FT                   /locus_tag="trd_0232"
FT   CDS_pept        242198..243919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0232"
FT                   /product="putative oligopeptide-binding protein"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05452"
FT                   /db_xref="GOA:B9KXP5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP5"
FT                   /protein_id="ACM05452.1"
FT                   /translation="MGRERLLSLLLAITVLLTGCRFSLPLSRSATPTPDFVLPVEASPT
FT                   PPAPATLSVTATLLPGAVLTAPPVPTPPSSSAEQVLILAGTPEGPLTLDPALVRDVESA
FT                   FVVQQLFRGLVRFDRALVPVPELAERIEIGPDGRSYTVRLRADARFHDGDPITAADVKY
FT                   SLERACDPALADGDGRALPAWGFLRDLVGAQARMLGRRSDVPGIEVVDERTLRLHLVEP
FT                   SPTFLLRLALPVASVVKRDAVERGPDWWRQPVGSGPFRLVRWTDEEIVLGRHPQYRPAP
FT                   AYLREVRIRIGPAALSPLNQYERGQLDVAAVPVWAVDRLTAPESPYRDQLIAQPLLGGT
FT                   YVFFNPGVPPLDDLVVRRALIQAFPRAKVAGVTLQGKVPLAQGLIPEGMPGGPWEATVL
FT                   PYDPGEARRVLTGRSLRVEVASAGSDVAIMLGQVWRRELGIEVEVLQYDWPDYLTELDA
FT                   RRLPIFVFSWVADYPDPEAVIDALFAEESPNRPIDYRNAAVQELLAAARRATDPQERHA
FT                   LLLAAQQQILDDVVVLPLTFDVEYLLVAPRVRDLPVTPLGILGLERVWIAPERAAR"
FT   gene            243946..244833
FT                   /locus_tag="trd_0233"
FT   CDS_pept        243946..244833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0233"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="identified by match to protein family HMM PF00583"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06369"
FT                   /db_xref="GOA:B9KXP6"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR013653"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP6"
FT                   /protein_id="ACM06369.1"
FT                   /translation="MMVGSTLIVPLEPEDLPRLRLKWGTRYGLRDVAHLVREAPGLCLW
FT                   APTTGEYVLAGPWRHREEIVALLEVTTGNLTDQLIESLARAATEQGKQLLVATEQEERR
FT                   SGSFYQRLGFELIEEILVYEMVLYSTPPGPARLRFERVVLEDPFAMGELLDLDHDAFAW
FT                   LWWNSEQEFDAYMSDPRVDVYLGRERDGTPVSYVGITRLRGWGHLDRLAVAPAFQGRGY
FT                   GYESLIWAAQVLAARGAHRIALSTQASNQRSRQLYERFGFRRIPELDYRLYGRWLADPI
FT                   EAWDRRSWRGNGGA"
FT   gene            244839..245906
FT                   /gene="aroC"
FT                   /locus_tag="trd_0234"
FT   CDS_pept        244839..245906
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroC"
FT                   /locus_tag="trd_0234"
FT                   /product="chorismate synthase"
FT                   /EC_number="4.2.3.5"
FT                   /note="identified by match to protein family HMM PF01264;
FT                   match to protein family HMM TIGR00033"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05856"
FT                   /db_xref="GOA:B9KXP7"
FT                   /db_xref="InterPro:IPR000453"
FT                   /db_xref="InterPro:IPR020541"
FT                   /db_xref="InterPro:IPR035904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP7"
FT                   /protein_id="ACM05856.1"
FT                   /translation="MGSTFGRLFRVTTWGESHGPALGVVVDGCPAGLELNEEIIQRDLD
FT                   RRRVGQSEVTSPRQERDRVTILSGVFEGKTTGAPISLITYNADADSSKYEPLRDVFRPG
FT                   HADYTYWVKYGHRDHRGGGRSSARETWGRVAAGAIARQLLRTVAGVEVYGFVRELGGIT
FT                   IETFDRDEIDRNPVRCPDPVAAQKMVAAILEAKEQKTSVGGIVEVRARNVPPGLGEPTM
FT                   DKLDALIGYAMLSIPAVKGVEIGDGFAAARLRGHEHNDPFILDNGRVRTLTNHAGGMLG
FT                   GISTGEEIIVRLAVKPTSSIARPQRTVDIHGNERTIVVEGRHDPSICPRVVPVAEAMLL
FT                   LVLADCYLMNRAARV"
FT   gene            complement(245911..247215)
FT                   /gene="aroA"
FT                   /locus_tag="trd_0235"
FT   CDS_pept        complement(245911..247215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroA"
FT                   /locus_tag="trd_0235"
FT                   /product="3-phosphoshikimate 1-carboxyvinyltransferase"
FT                   /EC_number="2.5.1.19"
FT                   /note="identified by match to protein family HMM PF00275;
FT                   match to protein family HMM TIGR01356"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04612"
FT                   /db_xref="GOA:B9KXP8"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR006264"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR023193"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP8"
FT                   /protein_id="ACM04612.1"
FT                   /translation="MTLHRTYPPRLPIRPAEQPVDAIVRLPGSKSLTNRALVLAALADG
FT                   VSVLEGALLSEDSWVMVDSLRRLGIPVDVDEPAERMIVQGKGGTLPATRAELFVGNSGT
FT                   TARFLTAMTALGHGEYLIDGVPRMRERPIQPLLDALAQLGVQAESLLGTGCPPVRVRSY
FT                   GLAGGTIRLRGDISSQYLSALLMIGPCTRDGLRIELESPLVSVPYVEMTLAVMADFGAI
FT                   ATHEHAQVFHVPGNQRYRSRTYAIEPDASAASYFFALAAATAGRIRVVNLGTRSRQGDV
FT                   QFVDLLERMGCTVIREPDALTVIGKRPLRGIEADMNAISDTVPTLAALAPLADGPVIIR
FT                   NVQHIRYKETDRIAAVANELRRLGITVEEFPDGLRIEPGPVQPAVIRTYGDHRMAMSFA
FT                   ILGCAVPGLEIDDPGCVAKTFPDFFERLEAALGRR"
FT   gene            complement(247226..247681)
FT                   /locus_tag="trd_0236"
FT   CDS_pept        complement(247226..247681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0236"
FT                   /product="dTDP-4-dehydrorhamnose 3,5-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05860"
FT                   /db_xref="GOA:B9KXP9"
FT                   /db_xref="InterPro:IPR000888"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXP9"
FT                   /protein_id="ACM05860.1"
FT                   /translation="MIHGVEIKRLVTHVDERGSLTELIRCDDPFFEKFGQCYVSVSWPG
FT                   VIRAWHWHKKQTDYFVCIRGMIKVPLFDLRPESPTYRELNEFFLGDDNRIVLKIPPGVA
FT                   HGFKNIGTEPCYLLNFPTEPYDADDPDEYRLPYDTPEIPYSWEIKYR"
FT   gene            complement(247703..248512)
FT                   /locus_tag="trd_0237"
FT   CDS_pept        complement(247703..248512)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0237"
FT                   /product="putative S-adenosylmethionine (SAM)-dependent
FT                   methyltransferase"
FT                   /note="identified by match to protein family HMM PF02353;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04730"
FT                   /db_xref="GOA:B9KXQ0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ0"
FT                   /protein_id="ACM04730.1"
FT                   /translation="MGETIDAYEIIADYYDLEFARFSDDIEVYLAFAQRTGDPILEIGC
FT                   GTGRLLAPLARSGYTVHGVDRSPAMLARARERLRAEGLEHVQLFQADAVDLRPLADGFY
FT                   RLAIIALNGFLHLLDRTAQQRALAELHRVMTTGGLLLLDLLHPTPAQLQALEQPLSWDG
FT                   NWRLPDGSRLDRFASRSVHPSEQTITTTLFYDRTDAHSGQVTRRVVSYKLRFVHRFELE
FT                   LLLEQAGFAVEAIYGSYDLDPLTDESPQMFVVAQRQLSPAILAPRRA"
FT   gene            248683..249165
FT                   /gene="smpB"
FT                   /locus_tag="trd_0238"
FT   CDS_pept        248683..249165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smpB"
FT                   /locus_tag="trd_0238"
FT                   /product="SsrA-binding protein"
FT                   /note="identified by match to protein family HMM PF01668;
FT                   match to protein family HMM TIGR00086"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06105"
FT                   /db_xref="GOA:B9KXQ1"
FT                   /db_xref="InterPro:IPR000037"
FT                   /db_xref="InterPro:IPR020081"
FT                   /db_xref="InterPro:IPR023620"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ1"
FT                   /protein_id="ACM06105.1"
FT                   /translation="MSKGTAKSREGEKVIAVNRKAYHDYFIEEELEAGIQLTGSEIKSI
FT                   RAGRVNLRDAYARIEDGELWLIGMHVSPYPGASGKHQHDPTRPRKLLVHKRELDYLRGK
FT                   LEKRGYTLVPLRLVIRRGLAKIDLGLARGKKQYDKREAIAEREARREIERAISPRW"
FT   gene            249350..249702
FT                   /locus_tag="trd_0239"
FT   ncRNA           249350..249702
FT                   /locus_tag="trd_0239"
FT                   /product="sRNA"
FT                   /ncRNA_class="other"
FT   gene            complement(250101..250262)
FT                   /locus_tag="trd_0240"
FT   CDS_pept        complement(250101..250262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0240"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ2"
FT                   /protein_id="ACM05063.1"
FT                   /translation="MELLPIRIPVHSRIVPIPPDVPDGTTIRYAGCLFSVRRVGEAYEL
FT                   TLLRVGHV"
FT   gene            complement(250340..250693)
FT                   /locus_tag="trd_0241"
FT   CDS_pept        complement(250340..250693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0241"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06373"
FT                   /db_xref="GOA:B9KXQ3"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ3"
FT                   /protein_id="ACM06373.1"
FT                   /translation="MTRTVWRLIKGLGVALAVMVLSILPPGLHLVLGPLSPLIGGFAAG
FT                   VVGELRAGEAFVLGLVEATAAGLVVGFILPVLAHLELGTATLWFFGVGAAIYAGTLSGV
FT                   AAYFGGQQGQRAR"
FT   gene            complement(250690..251166)
FT                   /locus_tag="trd_0242"
FT   CDS_pept        complement(250690..251166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF01878"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05059"
FT                   /db_xref="InterPro:IPR002740"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ4"
FT                   /protein_id="ACM05059.1"
FT                   /translation="MAEPQYWILVGSAENLEATQAHGFTVQGFKSRHRKKAEAMRPGDR
FT                   LVYYVTGIQGFAAIARVTSDAFEDHTPIWKSKDPKKAAEDYPWRVQIEPEIALPPGVYL
FT                   PAEDIALQLHHVQKWPKDHWRLAFQGQLHRIDEHDYELIRTALVQAANRQSVAP"
FT   gene            complement(251166..251498)
FT                   /locus_tag="trd_0243"
FT   CDS_pept        complement(251166..251498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0243"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06328"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ5"
FT                   /protein_id="ACM06328.1"
FT                   /translation="MVAPSSPTWQERQSGFGRRRVNGSFLPVRPSHRNSSPRRRRIVAF
FT                   EPFREVTAWVRALLLSRANGHGEVALLSSRAARPLVARSEYPAEHPVRIRSRLVTGRTS
FT                   DAGRED"
FT   gene            complement(251598..252179)
FT                   /locus_tag="trd_0244"
FT   CDS_pept        complement(251598..252179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0244"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04968"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ6"
FT                   /protein_id="ACM04968.1"
FT                   /translation="MKSIVSERPGNQGTTRGCLPAVLLVALRTSRFASGRRQGERLHEP
FT                   ARSGMLDVHESMRQGGMAMQFDEFIGKVQHRARLASRGEAERVTRAVLETLAERLAGGE
FT                   AKDLAAQLPMIVKDYILEYPHAGEGRHMSLKEFYERVAERLHAPMPEAAFWARAVMSVV
FT                   QEAVSAGEIEDVKHQLGPDYAPLFEWEGPR"
FT   gene            complement(252176..253030)
FT                   /locus_tag="trd_0245"
FT   CDS_pept        complement(252176..253030)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0245"
FT                   /product="Amidohydrolase family"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05540"
FT                   /db_xref="GOA:B9KXQ7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ7"
FT                   /protein_id="ACM05540.1"
FT                   /translation="MPIAGVPITDTHVHFWDIERSDLYWMTPDLVEQLRPLRRSFTPDD
FT                   LDPQRLAAGVDRIVIVQAARSEWDHQWWFSLAERYPWIVAVVGWVDLAAPEVDQQLDRL
FT                   ASHPAFRGVRATAENVPDPDWLASPAVQRGIAAVAERGLTLDLLVRVEHLPHVPRLAER
FT                   FPDLTLVVDHLAKPPIASGDLQLWRERMAALVPYPTIWCKLSGLLTEAGPRPTVETLRP
FT                   VVDFALDRFGPQRLLWGSDWPVATLAADYLSTFRTYEALTAGLTTEERAAIFGGNAQRV
FT                   YRL"
FT   gene            complement(253002..254018)
FT                   /locus_tag="trd_0246"
FT   CDS_pept        complement(253002..254018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0246"
FT                   /product="D-threo-aldose 1-dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00248"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04693"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ8"
FT                   /protein_id="ACM04693.1"
FT                   /translation="MMSLPRRVLGRTGLEVSSVCAGCAPLGDMPEAFGYRVPEEQALAT
FT                   LRAIFSSPITFLDTAAAYGDGESERRIGIVLRELGGLPPGYVLATKADRDLATGRFDAE
FT                   QVRRSVQRSLRLLGLERLQLVYFHDPEHAGLSVAEAMAPGGPVEALLALRDAGVIEHVG
FT                   VAAGPIDMLIAYIETGVFEVVITHNRYTLLNRTAEPLIQRANELGVAVVNAAPYGSGLL
FT                   AKGPSAFPRYAYREARPDEIERARTIEAVCAHYGVPLAAAALQFSLRDPRISATIVGMS
FT                   RPERVTQTIQFATWPIPDALWDELNQVEPLPYDPQTGQLVATGEGGSEDADRRRADH"
FT   gene            complement(254015..254395)
FT                   /locus_tag="trd_0247"
FT   CDS_pept        complement(254015..254395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0247"
FT                   /product="Protein of unknown function (DUF718) superfamily"
FT                   /note="identified by match to protein family HMM PF05336"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05791"
FT                   /db_xref="GOA:B9KXQ9"
FT                   /db_xref="InterPro:IPR008000"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXQ9"
FT                   /protein_id="ACM05791.1"
FT                   /translation="MKCYGLTLCLRDDPDAIAAYIQYHQAVWPQVCARIREVGIHTMRI
FT                   FLRGRRLFMYIETDDAFDLARDFSRVNEDPVSAEWNRLMATLQERAPEANPDEWWAPME
FT                   LVFDLDWPQHRHGLAQEREPRS"
FT   gene            complement(254409..255161)
FT                   /locus_tag="trd_0248"
FT   CDS_pept        complement(254409..255161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0248"
FT                   /product="putative dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF01370; match to protein
FT                   family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04859"
FT                   /db_xref="GOA:B9KXR0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR0"
FT                   /protein_id="ACM04859.1"
FT                   /translation="MQLHDRIALVTGAGSGIGRAIAERFASAGALVIAADLDATAAEET
FT                   ARRAPERIVPDHVDVRDEASVRTLMERTLDRFGRLDILVNNAGIGTTKDLVETDLAEWE
FT                   NVFAVNVRGVFLCCKYALPSMLARRSGVIINIGSVAGLIGIPKRAAYCASKGAVVTLTK
FT                   QIAIAYVREGIRCNCICPGTVDSPWVERLVAREPDPVAARRALEARQPMGRLVQPEEVA
FT                   AAALYLASDEAAAVTGSILVIDGGWLAQ"
FT   gene            complement(255181..256206)
FT                   /locus_tag="trd_0249"
FT   CDS_pept        complement(255181..256206)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0249"
FT                   /product="inner membrane ABC transporter permease protein
FT                   ycjP"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05128"
FT                   /db_xref="GOA:B9KXR1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR1"
FT                   /protein_id="ACM05128.1"
FT                   /translation="MALRWQTSPTRPGPLAALVSYAILSLWAAVVLFPLYWLAITAFKL
FT                   PVHVNEGPTYLPFVDFQPSLHAWHYILVDLGNDTLRPYLNTVIVGGTSSILTLLLGAAA
FT                   TYGLSRFTYRVRLASVVVFLAGAILAGIGIQLGLPWPLAVAGALGAFVLARATALRRAA
FT                   GPQLGNADIAFWMISQRMLPPVAIVIPIYILFQRLGMLDTRTALVVSYVAANLPIAVWL
FT                   LRDYFHTIPIELEESAAIDGANRYQILWRIVLPLALPGLVATFLFIFVLAWNEYLLALF
FT                   LSSAKAQTMPLLVAAQNATRGPQWWYMSVLILLMIAPVIALALVLERYIARGLLLGAVR
FT                   G"
FT   gene            complement(256217..257395)
FT                   /locus_tag="trd_0250"
FT   CDS_pept        complement(256217..257395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0250"
FT                   /product="transporter"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05711"
FT                   /db_xref="GOA:B9KXR2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR2"
FT                   /protein_id="ACM05711.1"
FT                   /translation="MRQTRPSVLPPRTGDAVAAPTRRIPLSRERVVSWADQQAGAVLVL
FT                   PAVLVILVLSIFPLLFSLYLSLSRFQPVSGGFEIHFRGLANYRKLFVGSEQQHFLGQLA
FT                   RLDTAGWLFFLATGALTVFLLGRALRSGPLTFPRLLGHGTVALGLLLALWLISRTVVSG
FT                   GRPGTLVVTWVYVFGGVALQFLVGLLLAALCAQQLPGRRFFRVVFLLPMMITPVGVAYT
FT                   FRMLTDTGKGPFAPIANWLGYANVSWVNDPWGARIAVMIGDLWQWTPFMFIVLLAALES
FT                   QSPEPIEAAIVDGANRWQIFWHITLPQIAPVASTVILIRLIEAFKIFDMPNVLTGGGPG
FT                   TATESLTLHAYVLWRSLDYGTSAAVAYTLLFVVTFVGIAYVRLLHRRVSEAL"
FT   gene            complement(257418..258953)
FT                   /locus_tag="trd_0251"
FT   CDS_pept        complement(257418..258953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0251"
FT                   /product="putative ABC transporter solute-binding protein"
FT                   /note="identified by match to protein family HMM PF01547;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05353"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR3"
FT                   /protein_id="ACM05353.1"
FT                   /translation="MTRKLSRRQFLGTMLVAGGSALLAACRRGEATPTPAPSAGTPAAG
FT                   KQFEGVEVNVITFTGPQIAEPLQRRAPEFQKLTGAKINVITVPFADLYQKILTDFTTGT
FT                   NSYHVIVFAPQWMADYVEPGYLEDLTPRIEADPALQWDDIAPFFRNFSATYGGRIYTIP
FT                   LDGDFQMVYYRTDLLEAEGLKPPETWEDYLAIAQKFHGKDLNGDGVPDFGSGIAKRRGA
FT                   QSYWMFWSIAASFLQSQGTQQGAFFDVDTMEPLTMNEAFERALEIYKETGKYGPPDELN
FT                   WDVGDSRAAFVTGRCALTLDWGDIGTLAIDPEQSKVKDKVGAVILPGTKEVLDRKAGKL
FT                   VACDQNTCPHAINGVNHAPYAAFGGWSGAINKNAPAKVKDAGYAFLSYMSQPAQSNVDV
FT                   TIGKTGFNPYRISQFENIDLWVKAGMSEAAAKNYLGAIKASLNSPNMVLDLRIPGAQRY
FT                   QGVVLDTVLSRYLAGELTTKQAMEELTKGWNEITDELGREKQKQAYRASLSIR"
FT   gene            complement(258950..259777)
FT                   /locus_tag="trd_0252"
FT   CDS_pept        complement(258950..259777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0252"
FT                   /product="transcriptional regulator, IclR family,
FT                   C-terminal domain protein"
FT                   /note="identified by match to protein family HMM PF01614;
FT                   match to protein family HMM PF09339"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04610"
FT                   /db_xref="GOA:B9KXR4"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR4"
FT                   /protein_id="ACM04610.1"
FT                   /translation="MTMPVQSPAVWRAVASLDAVARASDGLTLSEVARAIGEPKSTLHA
FT                   VLATLVEAGLLIREETSKRYRLGPHILALAGAYARQSDLIRAFTEVARPLARELGETIQ
FT                   LAILQGREVLYIGKQEGTQWVRLASEVGTRLPAHATSLGKCLLAWLPENELGCLLAEGP
FT                   LVALTPRTITDPDALRAELAQVRAQGFAIDRGETLPDVWCFGAPVRDAHGVVVAALSIS
FT                   VPVTRIGVERVEELVRAARAAADELSRQLGFSGVDDRVIDRMGIPSSRRRVAP"
FT   gene            259996..260124
FT                   /locus_tag="trd_0253"
FT   CDS_pept        259996..260124
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0253"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04554"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR5"
FT                   /protein_id="ACM04554.1"
FT                   /translation="MDGDRPAPRVPDRVRRRVPTGTVERSLGSIERARLGGPSFSG"
FT   gene            complement(260372..261127)
FT                   /locus_tag="trd_0254"
FT   CDS_pept        complement(260372..261127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0254"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05468"
FT                   /db_xref="GOA:B9KXR6"
FT                   /db_xref="InterPro:IPR022170"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR6"
FT                   /protein_id="ACM05468.1"
FT                   /translation="MIFVTLCFLITAGVGLVCLIGYRRTRQQLRLLRLVATCPIAELHE
FT                   RIPGEMVEITGTVHCATPLRSEYTGQPCVYYRTVTERVVERHGRSKKGGRLSEVVAQNE
FT                   QRIAFEVDDGTGRVAVDPVGAEIDGRKLLDRFEPVENGEGATLRIAGMSVEVRAAEWRT
FT                   LGYRKIEEAVLVGYPVYVLGVLQDDGSIGRPPEGSRLREFLISARSEEELATSLRRRSY
FT                   LFLAGAITSFVVAGMLLIALLVQSVISIS"
FT   gene            complement(261743..261919)
FT                   /locus_tag="trd_0255"
FT   CDS_pept        complement(261743..261919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0255"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06078"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR7"
FT                   /protein_id="ACM06078.1"
FT                   /translation="MLDRLRTAAKFFTWGLALGLLFAPASGRELRRRLLRWVMARLEAC
FT                   VARVRERLTGQPT"
FT   gene            complement(261926..262222)
FT                   /locus_tag="trd_0256"
FT   CDS_pept        complement(261926..262222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0256"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05918"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR8"
FT                   /protein_id="ACM05918.1"
FT                   /translation="MRRGFIRSFLSGFLIGTAIGALAIWLSSSERRAGSVAWRQRASQL
FT                   AQQARSQGEQIAALARERLASARGLLETRFSAGEQSASAVRSATSEVTVSTES"
FT   gene            262924..263499
FT                   /locus_tag="trd_0257"
FT   CDS_pept        262924..263499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0257"
FT                   /product="putative amino acid ABC transporter, periplasmic
FT                   amino-acid binding protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05010"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXR9"
FT                   /protein_id="ACM05010.1"
FT                   /translation="MVRGLELALDEVDGQAAGRAIIVRVEDSAGNPEQAVAKARQRVER
FT                   ERVHILAGVTLSSEAGALRDSVVAAGIPLLVRNAGLPGLTRDPKRRSPLIFRVFFANGQ
FT                   HEAPFGRYADEKLGDRRVVLTGLDYSAGHDKLGAFGRHFQAAGGRIVGEVFAPVDTADY
FT                   GPYLQRIRQHDADAVFAFYSGVDAVRFV"
FT   gene            complement(263545..263673)
FT                   /locus_tag="trd_0258"
FT   CDS_pept        complement(263545..263673)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0258"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06049"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS0"
FT                   /protein_id="ACM06049.1"
FT                   /translation="MAPLDELAVFGRVVQYRLVRGTDEPQPGLTLFRKDALVDRLT"
FT   gene            263731..263964
FT                   /locus_tag="trd_0259"
FT   CDS_pept        263731..263964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0259"
FT                   /product="putative ABC transport system, substrate-binding
FT                   protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05275"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS1"
FT                   /protein_id="ACM05275.1"
FT                   /translation="MMTEALRAVDGAVEERGRFLAALRAVEFTGPTGRFRFYPESQGAV
FT                   ITVFVRRVERLPNGELGNVMLDRVRDVDDVSF"
FT   gene            264320..265780
FT                   /locus_tag="trd_0260"
FT   CDS_pept        264320..265780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0260"
FT                   /product="glycolate oxidase subunit glcD"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05610"
FT                   /db_xref="GOA:B9KXS2"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS2"
FT                   /protein_id="ACM05610.1"
FT                   /translation="MDRATIRSRLVEIVGSDGVLDDPEELLVYEYDASDEVFAGHHRPD
FT                   FAVLPRTAEQVSAVVRLANEFGIPVVPRGAGTGLAGGALALRGGIVVVVTRMNRILEVN
FT                   EQDGYAIVEPGVINLELTQALQPRGYFFAPDPASQRACTIGGNVGNNSGGPHCLKYGVT
FT                   TNHILGLEVVLPDGERIWTGGPVPETPGVDLTGVLVGSEGTLGIVTKVMVRLTRLPEAV
FT                   SVLLAAFPNIESASHATSAIIAAGMLPAALEMMDQLTIKAVEDAFHAGYPREAGAVLLV
FT                   ELDGLQEIVAENTSRVAELCRQHGAWEVRVARTKEERDLLWLGRKSAFGAMGRLAPNYY
FT                   LVDTTVPRTKLPATMRRVEELSREYRLSIANVFHAGDGNLHPLVLFDRQRPGEVERVLE
FT                   CTTEILRYCVDAGGTLSGEHGIGFEKRDYMTLVFTTEDLCAMAGLKRSFDPRELFNPEK
FT                   VLPTGFRCGEVAALRQQAIAQRLGLEYV"
FT   gene            265790..267085
FT                   /locus_tag="trd_0261"
FT   CDS_pept        265790..267085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0261"
FT                   /product="glycolate oxidase subunit glcE"
FT                   /note="identified by match to protein family HMM PF01565;
FT                   match to protein family HMM PF02913"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05816"
FT                   /db_xref="GOA:B9KXS3"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS3"
FT                   /protein_id="ACM05816.1"
FT                   /translation="MTGTTRLAPGVAMERLAELGAPHDPRAYRVDGLEPLVALAPETPE
FT                   AVAEALAVCAAAGLVVIPWGGGRQMGLGNLPERYDVALDVRSLSAITHYEPDDLTIAVQ
FT                   AGRSIASLSSELAAHGQMLPIEAADPERVTIGGLVATGIGCPRRFGYGSLRDLIIGITV
FT                   ALPDGTLARGGGIVVKNVSGYDMMRLHFGALGSLGVIIQANFKVLPAPEAQRTLLLSFR
FT                   ESDQSAAAALTLRTSQLAPTALVVLAPPVAKRLADLERWVLAARCEGPEGAVERQVERL
FT                   RASVETASGESVVLDDRKTLAFWSSVQGELEATPFDRELRVRIGELPSRLGELAAQLER
FT                   RYGSALRSLVLDSGSGLAYVTVSGEPVELRAFWGELRELGRHATLLGAPIEVKAGEDVF
FT                   GRHPEGIPVMRRLKETFDPERILNRGRFIAHL"
FT   gene            267107..268456
FT                   /locus_tag="trd_0262"
FT   CDS_pept        267107..268456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0262"
FT                   /product="4Fe-4S ferredoxin, iron-sulfur binding:Protein of
FT                   unknown function, cysteine-rich region"
FT                   /note="identified by match to protein family HMM PF00037;
FT                   match to protein family HMM PF02754"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05509"
FT                   /db_xref="GOA:B9KXS4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012257"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS4"
FT                   /protein_id="ACM05509.1"
FT                   /translation="MTTASAPARLRGFSGRDAPSYDAIRKCVHCGFCLPSCPTYRVTWR
FT                   ERSSPRGRIWLMKSVAEGRLDLLDPVFAEEMQLCLNCRACEAVCPSGVHYGEILEASRA
FT                   QLVQHREQSWRERLFRLAGFRILLGDMRRFRAANALLRWYQRSPLRPLVRRSGVLRLLG
FT                   LEQAEALLPAIADRFVVADGRFVPAQGERRGRVALFTGCVMSTAYAHVHEATIRVLTRN
FT                   GFDVVLVSGQQCCGALHVHSGEPELGRRLARQNIEALESPYLDAIIVNAAGCGAMLKEY
FT                   PALLRQDHDYAERARQLAGKVRDVLEFLVERGLTAQPGPLPWTVTYQEPCHLAHAQRIT
FT                   QQPRVLLRTIPQLRLVEMAESALCCGSAGIYNLLQPDMASTLLARKLDNALATGADVIV
FT                   SANPGCMLQLEAGLRARGVRLPVLHLVEVLDRAYAAAEGRPADILAAVAD"
FT   gene            268496..269674
FT                   /locus_tag="trd_0263"
FT   CDS_pept        268496..269674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0263"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05213"
FT                   /db_xref="GOA:B9KXS5"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS5"
FT                   /protein_id="ACM05213.1"
FT                   /translation="MVRRGLGRSFLFVWLAFMLSALPAHAQEGNGAISGRVQNGTAGGG
FT                   PVSSLTVTLRHFAGMQLAEERQTQTGPDGSFRFDGLPTSPQDAYLVVVRYAGVDYVSGM
FT                   VQLHQQPEQTVDLTVYETTTDPSAMRIASRSLVIAGASPELRAVDIMDILIVENSGDRT
FT                   YLGDRSGVVLRIPLPRGAQEISPQPGFDYGQPRLEDGVLLTTGPLPPGSQTVVLSYTVP
FT                   YEGTRATLSIGTAMPTSTLRVLVRDGTYRLSSRSLIDTGTVEVSGVTYRVLAVDAPVVG
FT                   DMHVVQVSGLPRTGLLFDLPTGPIIALVVGLAGLVAAAVLTVIVLRRRRVGTETSRAAI
FT                   DERLQLAAELNRLDEARAAGELDETAYQEQRSAVLARLRQLVAREQGVERSG"
FT   gene            269677..271650
FT                   /locus_tag="trd_0264"
FT   CDS_pept        269677..271650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0264"
FT                   /product="acylamino-acid-releasing enzyme (ec)
FT                   (acyl-peptide hydrolase) (aph)"
FT                   /EC_number="3.4.19.1"
FT                   /note="identified by match to protein family HMM PF00326;
FT                   match to protein family HMM PF01738; match to protein
FT                   family HMM PF07676"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06075"
FT                   /db_xref="GOA:B9KXS6"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS6"
FT                   /protein_id="ACM06075.1"
FT                   /translation="MKRSVRAEDLALLQLASDAQIAPDASAVAYVVTTMDLEADRYRSA
FT                   IWLARTDGSPPRRFTSGTHRDTMPRWSPSGEELAFLSDRTGSDQLWVIPRNGGEARQLT
FT                   NFVEPVTGFAWSPDGQRIAVVTRAQQAEGKVDPETDVVRLTRLRYRFDGQRGFLHERRS
FT                   HIWVVDLRTGTLERATDGDWDDDWPAWSPDGSQLVFTSNRTEEREWNAASELWLLRFDA
FT                   AGRTVDLSCVTGGPSAAFGRPSWSPDGRLIAAVGHFESWAGSARHKRLWVMTPDGNERW
FT                   NLSADFDATLEDSLLTDAFGPSKPGLLWSPDGRWIFTQVSEQGAVRLYRFPVSGGAPEC
FT                   IIGGARRVLDFSLSADGRWIAAVIAGPVDPGSVWLMAADGSSSRCLADPNAAWKEEVEI
FT                   LGPEEMWVSSPVDGRPIHAWVLRPANAGDERVPLVLSIHGGPHGMYGWAYCHEFQVLAA
FT                   EGYGVVYANPRGSQGYGETFLACTRGAWGEADMPDLMAVVDAVLAQGWADPGRLGVCGG
FT                   SYGGYMTNWIIGHTDRFRAAVSMRCVSELVSMYGTSDIGVYFSEWEIGATPWDDPERYR
FT                   RLSPLTYAPNIRTPLLLLHAEEDWRCPIAQAEQLFTWLRRLGRTVELVRFPGEGHNLTR
FT                   SGRPRHRLEHLEHELRWFRTYL"
FT   gene            complement(271657..272916)
FT                   /locus_tag="trd_0265"
FT   CDS_pept        complement(271657..272916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0265"
FT                   /product="putative nuclease SbcCD, D subunit subfamily"
FT                   /note="identified by match to protein family HMM PF00149;
FT                   match to protein family HMM TIGR00619"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06125"
FT                   /db_xref="GOA:B9KXS7"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS7"
FT                   /protein_id="ACM06125.1"
FT                   /translation="MLRLIHFADLHLGVETHGQFRPDLGHSSRIQDFLDAFDQIIDAAI
FT                   EERFDAVLFAGDAFKHAEPSPTLQRRFAERIQRLLAAGIPIVLLVGNHDRPRSVVRSTP
FT                   IDIYAALRLPGVIVANRPERFTIATPSGPLQVVALPWIPPRLLLADDALREAGTPELER
FT                   RYKEVIASALAPLLAALDAATPAVFLGHLSMEGGRFGSERSVILGNDPLFGLDELGLNS
FT                   APIDYVALGHLHSHQVLHERPPVVYAGSVERIDFGEEREDKGYVAVRIAAGPYPRDVSW
FT                   EFRPLRTRPMRTFRLDILTDTPMDEIRRALERHATLIPEAIVRVTITTTPERAAAIRPL
FT                   EVRRWLSELGAAHVAGITVQTERVARPRVELERSSRHDPVSLLERWVNLHRLSDQLAKA
FT                   VIQRGREIIERVESRSSEPR"
FT   gene            complement(272933..274558)
FT                   /locus_tag="trd_0266"
FT   CDS_pept        complement(272933..274558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0266"
FT                   /product="Domain of unknown function domain protein"
FT                   /note="identified by match to protein family HMM PF01935"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05029"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS8"
FT                   /protein_id="ACM05029.1"
FT                   /translation="MSLDGQHNAHVTDHVSDNAFLGVVTDGRFSQGLRVRLLDPAAVER
FT                   LRVGSFVVIEGIERRYFGMITDLSLDTTDAALLADPPIRSPFLSRIVRGTHAYATAEIR
FT                   PSLVLEPESDQPQPARSIPPHFARLRQATADDFALVFGQEDSTHFALGTPPAMEIPVPL
FT                   DLAELVKRSNGVFGQSGSGKSVLTRLLLVGLVLADQVSILLFDMHNEYARAPTDQPELV
FT                   GLLELFGPSRVQIYTLDDRTERSASARTIQIGLDQIEPDDIELLAEELNLNPTFATVAH
FT                   HLRARYGPQWIRQTLEFDTEAVKEFCASTGVAEASVNALRAKLDRLAKRPYICETLDTS
FT                   VIDEIIGKLQRGTHIIVQFGRCDSFLDYMLVANLLTRRIHDRYTEDVLEAQQAGGQSNL
FT                   RPLVIVLEEAHKFLTPEAARQSIFGTIAREMRKYRVTLLIVDQRPSSIDREILSQLGTK
FT                   VIGPLSDQHDIEAVLTGVADRSGLRSLLANLSPRQECVIVGHAVRMPVAIRTRQYRREE
FT                   ILALVRGWGKTMDDERHLRLLLGQ"
FT   gene            274641..276347
FT                   /locus_tag="trd_0267"
FT   CDS_pept        274641..276347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0267"
FT                   /product="probable two component sensor kinase"
FT                   /note="identified by match to protein family HMM PF01590;
FT                   match to protein family HMM PF02518; match to protein
FT                   family HMM PF07568"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04955"
FT                   /db_xref="GOA:B9KXS9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXS9"
FT                   /protein_id="ACM04955.1"
FT                   /translation="MLDNEWETLAELLKAPVDPSRRVLAGPVGRLQALHWITRAATSSL
FT                   DLDEMLSTVTRVLRETMRVDSCGVFLYDESSGTLTLRAVDGVAPDRPGGFTLPLGVGIT
FT                   GQAALTRRLQIAFDAPRHPAYVDYPHVDDRPFASQVSVPLIARQPGRLLGVLNVLTLEP
FT                   REFWPEEIDFLETAAGEIAIAIENALLYQETDAELRRRIAQLELLQQLWRAVASTLDLD
FT                   ELLGTIADRALELSGARGVAIFRQSRASGGELELLRAAPVELATRLTEGLETVFRQVVQ
FT                   EVLDSGAAVWRDPLADQLALYALPMITGRRAVGALCLVYSAGRPRPIQTGLLHAFTDTA
FT                   AIAIENAELYEEARRGLTRASALLRELHHRVRNNLQTVAALLSLQARRAGPEARAVLQD
FT                   AVSRIRSLTVVHDLLSGRELPEVSLTELARIVVTQAVHSLYGDELAVEWSVEGEEVTVS
FT                   SRQTTVLALLLNEFVTNAVRHGFADGPGHLVVRIQREGDRALLEVEDDGRGLPSDFDPL
FT                   RGRGLGLQIARTLVEVDLRGDLEMRSGARGGTVVRVRFVPEGRVAATQPVS"
FT   gene            276447..277205
FT                   /locus_tag="trd_0268"
FT   CDS_pept        276447..277205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0268"
FT                   /product="putative short chain dehydrogenase"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05680"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT0"
FT                   /protein_id="ACM05680.1"
FT                   /translation="MILGASSGFGAATARELARAGMHICGVHLDRRATLPMAEAVKADV
FT                   EAAGVEALFVNANAADAETRRQVASALRERGARVRVLMHSLAFGTLRPYIDEDAAQEVT
FT                   QKQLEMTLDVMANSLVYWTQDLFHAGLFAPDARIYAMTSEGSTRVWRGYGPVSAAKAAL
FT                   EAHVRQLAVELARYGIAVNAIQAGVTPTPAQAKIPGAEEMLREAERRNPSGRLTSPEDV
FT                   ARAIRALSAPGLGWITGNVIRVDGGEALVP"
FT   gene            complement(277218..278267)
FT                   /locus_tag="trd_0269"
FT   CDS_pept        complement(277218..278267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0269"
FT                   /product="putative aminopeptidase from family M42"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF05343"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05563"
FT                   /db_xref="GOA:B9KXT1"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT1"
FT                   /protein_id="ACM05563.1"
FT                   /translation="MRERIAEVLTELMALPGPTGREEPVLAWLERAWAPHVKRLWRSRI
FT                   GNLLAYVGGAGPRLLLTAHADELSFVVRSIDSSGLLWLTTGQVRGEPQERFPVGQPALV
FT                   LGRDVAIEGMFVLATGHVVPEERRSKPVTFADLFVDIGANSKQEVLERGITVGSSVVWN
FT                   PPTRRLGSRLYGKAIDDRVGLALLTLLVRQIDAQQLDCALYLAATVQEENGLLGASSLR
FT                   ADLDVDWAIALDVGLVGDLPTIGEQWMPATLGGGPQLVHKDAATHYDQRLLWRLADLAD
FT                   RNGLPVQHVVFDRYGSDGAALIRQGIPTALVAVGARHTHAPFEAVDLADVEATLHLLEH
FT                   VVYEGPTDQ"
FT   gene            278471..278995
FT                   /locus_tag="trd_0270"
FT   CDS_pept        278471..278995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0270"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04643"
FT                   /db_xref="GOA:B9KXT2"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT2"
FT                   /protein_id="ACM04643.1"
FT                   /translation="MGRERTRSDRTLIVRRSRLRGLLIAALALAFFVAAVWFAWHAGSW
FT                   LERLFAVSMAVFLGLVTVVSTLIALDRNPVLEIDEEGLTDRGSPVRAGRVPWQSIRRIE
FT                   AKSVGTRRYLVVQVYRPQRFIADLDPERRKAAEELIQRHGTPIVIPWEALDQPLDAVVE
FT                   QAEALRQSTAT"
FT   gene            279132..279254
FT                   /locus_tag="trd_0271"
FT   CDS_pept        279132..279254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0271"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05742"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT3"
FT                   /protein_id="ACM05742.1"
FT                   /translation="MIETGQRLPPLGRQSMVAVDCGRIGGIPIDHGTIDPFRER"
FT   gene            279298..280035
FT                   /locus_tag="trd_0272"
FT   CDS_pept        279298..280035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0272"
FT                   /product="macrolide-specific ABC-type efflux carrier"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05817"
FT                   /db_xref="GOA:B9KXT4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT4"
FT                   /protein_id="ACM05817.1"
FT                   /translation="MGTTREQERTPIVEATNVVKIYDTGRVKVPALRGVSLTVYGGEMV
FT                   AIMGPSGSGKTTLLNCLSGLDTIDEGMILIAGKELARLPDDVRSEFRARHMGFVFQLFN
FT                   LIPVLSALENVELPALLAGIRPSEARRRAWAVLEQVGLADRAGHKPAELSGGQQQRVAI
FT                   ARALVNQPDIIWADEPTGNLDTETADEVMALLRRLNRENGQTFVIVTHDPRIGSMCDRV
FT                   IQMRDGLIIDDGLASFRAAAGGE"
FT   gene            280042..283005
FT                   /locus_tag="trd_0273"
FT   CDS_pept        280042..283005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0273"
FT                   /product="putative ABC transport system integral membrane
FT                   protein"
FT                   /note="identified by match to protein family HMM PF02687"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05911"
FT                   /db_xref="GOA:B9KXT5"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT5"
FT                   /protein_id="ACM05911.1"
FT                   /translation="MNEIFGVSLALVLRILLVAFGVILALTLGLWIWRPVLGRMALRNI
FT                   PRRPIQTALIVIGLMLSTLIFSASLTTGTTLQHSITGQVLRLAGPADELVVQASGDARF
FT                   AGPQPGVYLPSELVDRLDALQASEPRLRAVIPALWQPVAVIDLRTKQSEPALNLIGVPP
FT                   DRLAQVGGLTDRDGRAVDLGTLGDDEVVLGQEAAKRLDAEVGDRLQVFIQGRPVELRVA
FT                   AIAPDSFFTGTLNVGDAGGLTVSLARAQELLGLADRVSFVALNNRGGLADSQAVTDAVN
FT                   AALEGTPYRAVAVKQRAVEQAERAGETFTNLFLLSGLFSVAAGILLIFLIFALLAAERK
FT                   TEMGTMRALGMKRWHLVALFALEGMGYNLVAAAVGAVAGVAVAFTIAGFMGQLVGEFFT
FT                   IEPSWRPRDLVLAYLLGVVVTFVTVVIAAWRVSRLNIVTAIRDLPEPRLPRASRRWLIA
FT                   GLAGLLLGGGLTWLGLREESLAWFALGVSLLPLSAAAVLRRFGVPARPLYSVASLIVLA
FT                   YWLLPDHWHERLFGPMSGGFEMFVLSGLMMVAALTVFLVWNIEVAVGLVGRLGRAFRRW
FT                   LPAVRIAIAYPMASRGRTGLTVAMFSLILFALVVMSTIYANVVALFAGPLASAGWDVEV
FT                   TVVGGRAIPDLEGVLKEGGVDVSAIVASGGTMSVPWTRASVRVAGTEKEWARYPVRGID
FT                   GDFASAVEAPLQLRSPDYATDREAWEAVARDPSLAIVDANVLQQRGGDPANLYLPDLRE
FT                   GFRPLELEIRDNTSGQSGTVRVIGVIDGRVSSLQGVFVAEQAVSTIFGRPTTVDYYVRL
FT                   TDAADARSFARAVEAALLPYGAQAEATADLIGRATGIIRGFIRIIQGFMALGLVVGIAA
FT                   LGVVSYRAVIERRQQIGALRAIGYRRAMVALGFLLESALVTSAGIAGGTALGVLLARNV
FT                   VTGQEDLAGRFEQFSLVIPWGQLALFAGLALGIALLMAYAPARQASRVSIVEALRYE"
FT   gene            283014..284168
FT                   /locus_tag="trd_0274"
FT   CDS_pept        283014..284168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0274"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07907"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05111"
FT                   /db_xref="GOA:B9KXT6"
FT                   /db_xref="InterPro:IPR012507"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT6"
FT                   /protein_id="ACM05111.1"
FT                   /translation="MLVRFVLVTVAVSVLVAAAQSVAAQEPARQAQTHTVSARVLSILE
FT                   EGVTQVGPVTQPYQRLLVELTSEPEKGRTVEVSIGVRDLNTAGQRFVPGDRIFLSVSTG
FT                   PDGRQAYTLLDRDRTTPLAVLAVLFAGAIVALGRWKGLRALLGLVFTFVMLVWVLIPLI
FT                   LRGYPPVAVAIIVSFVVFAVTLVVTHGLGRMALAALAGTSLSLILTGALAALFVAAAGL
FT                   TGLADEEASFLQVVLGDRAMNPRGLLLAGMLVGALGVLDDITVSQSSLVFELRRANPFW
FT                   SGWELFAAGVRVGRDHIAATVNTLVLAYAGAALPLLLLFSQLDEPLLWVLNREIIAQEV
FT                   VQTLVGSLGLIAAVPLTTGFAAWLAVRTPVEALSELDHGHWHHH"
FT   gene            284180..284518
FT                   /locus_tag="trd_0275"
FT   CDS_pept        284180..284518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0275"
FT                   /product="methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06243"
FT                   /db_xref="GOA:B9KXT7"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT7"
FT                   /protein_id="ACM06243.1"
FT                   /translation="MRARACDRRTIELCAPSGHFDVYGWERGLLAVVLTDEDRARVRAR
FT                   LTACSSGDRAHALRFVADAASLPLVGEQRDEYVAGTRQDFALDLDPLGTPSSAMIGDSW
FT                   LRSRTGRP"
FT   gene            284595..284711
FT                   /locus_tag="trd_0276"
FT   CDS_pept        284595..284711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0276"
FT                   /product="methylated-DNA--protein-cysteine
FT                   methyltransferase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05349"
FT                   /db_xref="GOA:B9KXT8"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT8"
FT                   /protein_id="ACM05349.1"
FT                   /translation="MLIAIPRHRVVGQSGKPTGDAGGLQCKAWLLEHERMHV"
FT   gene            complement(284720..285475)
FT                   /locus_tag="trd_0277"
FT   CDS_pept        complement(284720..285475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0277"
FT                   /product="putative integral membrane protein"
FT                   /note="identified by match to protein family HMM PF01694"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05330"
FT                   /db_xref="GOA:B9KXT9"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXT9"
FT                   /protein_id="ACM05330.1"
FT                   /translation="MFPIGDDNSGRQSFPIVNTILIALNVLVFLYQLLLLAQSPLALEN
FT                   FVFKYGAIPYELTRGVDLPPTVGFPIYLTIFTSMFLHGGFAHLIGNMWYLYIFGDNVED
FT                   SMGHFRYLIFYLLGGIAAAWAQTLLDPASRIPMIGASGAISAVMGAYLVLYPGGLIRTV
FT                   AFFGFIPFFFYLPALILIGLWFVFQFFAGIASLGVPTAPTGGVAYWAHIGGFVAGLVLV
FT                   WFFRDPERVERQRLARRAHRAFQRLERGW"
FT   gene            complement(285545..285820)
FT                   /locus_tag="trd_0278"
FT   CDS_pept        complement(285545..285820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0278"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06271"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU0"
FT                   /protein_id="ACM06271.1"
FT                   /translation="MAETHPFRLHPDEVARRAREYFTDQLGIPLVRDMAGYMRFEDVHG
FT                   FVELDIRGDANNQSRVTFQYQGYEREVHEFRRLLAEQAQEETRQGE"
FT   gene            285848..285976
FT                   /locus_tag="trd_0279"
FT   CDS_pept        285848..285976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0279"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05723"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU1"
FT                   /protein_id="ACM05723.1"
FT                   /translation="MHDDTRLRLRLASGGETRILVGREGLWRASRERCGTAITVFW"
FT   gene            complement(286116..286829)
FT                   /locus_tag="trd_0280"
FT   CDS_pept        complement(286116..286829)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0280"
FT                   /product="phosphoglycolate phosphatase"
FT                   /note="identified by match to protein family HMM PF00702"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04520"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU2"
FT                   /protein_id="ACM04520.1"
FT                   /translation="MPLLVLFDIDGTLLRAGDPLHAQAMREALHEIVGEPVPLDGIPLA
FT                   GMLDRQIARLALLRHDLDETAISELLPRIMERTGALYATRLRPGERQDWVLPGVRPLLL
FT                   QLAARGHLTGVLTGNVELVARAKLAAAGLAEHLPFGAYGDQADERHQLVALARATVRER
FT                   YRLVIPPEQTILVGDTPRDIAAAQASGVRILAVATGRFGVAELAACLADAVLPDLADTA
FT                   AVLRTLEALAGTHPR"
FT   gene            complement(286829..288175)
FT                   /locus_tag="trd_0281"
FT   CDS_pept        complement(286829..288175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0281"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04834"
FT                   /db_xref="GOA:B9KXU3"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU3"
FT                   /protein_id="ACM04834.1"
FT                   /translation="MTDCGIDWNALQDEVTRHLQALIRFETVNPPGNETPFAEYLAGVL
FT                   RREGIAAEVVESAPGRGNLVARLRGRGHGRPLLLMAHSDVVSVERDKWTRDPFGGELVD
FT                   GRVWGRGAVDTKGLVACELGVMLTIQRLGLPLERDLIFAVFADEEAGGQYGACWMWEHR
FT                   RDLIDAEFAINEGGGMALTLGGQRFYLCQTGEKGAARLRLTARGQPGHASMPIPDTAMQ
FT                   HAARAILTLSTHTFPTVLTPTVTRFLHEIGRALGGSVRQQIESALADPTWERLAALPLG
FT                   PGERRLLYAMTRNTAVPTIVRGGHRINVIPSEVVVEVDGRILPGQEPEAFAAEVQRLVG
FT                   PHVEVELTTRGRGLEADPDSPLFRTISETMAELDPGARVVPYLIPGGTDAKCLPGITVY
FT                   GFMPMRDHPEEFELAHAHDERISVSTLGFATRALFEIVTRFCAPRSRSR"
FT   gene            complement(288172..289101)
FT                   /locus_tag="trd_0282"
FT   CDS_pept        complement(288172..289101)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0282"
FT                   /product="putative integral membrane protein"
FT                   /note="identified by match to protein family HMM PF00892"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06244"
FT                   /db_xref="GOA:B9KXU4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU4"
FT                   /protein_id="ACM06244.1"
FT                   /translation="MTAGWRARVERRWLVGIDRIGAGAVVLSALGFGTLATLTKLAYGA
FT                   SVPVPTLIAWRFGIAALLVIMALPLEQWRRGQLFGRQPWTDRRRLATAAAVACFVGNTI
FT                   LYLVALQRVSVATAAILFYVYPLVVLALRLVGWREVPTRRQLAALLAGFSGVTLTLGWR
FT                   WHTIDLTGSLLMLASASLYAAYIVFGHRGFRDASPVLATACTFSATAVVALALLSVERA
FT                   PLLIDRSALLPVLGIVVLATVLPVQLFLIGTLRLGPTPAAILGTLEPVASVFVAMMVLS
FT                   EQLTLVQLVGGLLVLTAAAVISGQGGKP"
FT   gene            289333..289791
FT                   /locus_tag="trd_0284"
FT   CDS_pept        289333..289791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0284"
FT                   /product="curved DNA-binding protein"
FT                   /note="identified by match to protein family HMM PF00226"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04888"
FT                   /db_xref="GOA:B9KXU5"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU5"
FT                   /protein_id="ACM04888.1"
FT                   /translation="MTRVHDFDPTMDYYQILGVPVTATSDEIRRAYRQLIRHCHPDRIR
FT                   DPDKRRIAEERAKLLNAAYAVLSDPARRRAYDERLRQRAVADLLFQRYIAPAPSPFRPA
FT                   PTRRARAWFAADVAAFVQLLAVTIIFVAVLVLLLVASSALTTLLQGLS"
FT   gene            complement(289788..290636)
FT                   /locus_tag="trd_0283"
FT   CDS_pept        complement(289788..290636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0283"
FT                   /product="beta-lactamase-like protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05688"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU6"
FT                   /protein_id="ACM05688.1"
FT                   /translation="MPVTLAGYTVEPLVDVEGAFFPLAIVFPDVPLESWEPYRDRFPDT
FT                   FAREDMLYTRVTCYLIRGHGRTVLVDAGIGAGPDPLFGHQRGRLLQELAQRGLAPGDID
FT                   TVILTHLHPDHIGWAAQSGQPTFPRARYLVHARELETFQREDVRAAMHQIAPGYLDRCL
FT                   DPLQQAGVLATVDDDTEIAPGLHLTISPGHTPGMMRVVLRGTPGSLWLVADTFTHPAQV
FT                   TEPTWCSAFDMDRSQAIATRFEVLGRAHEEDALVMASHFPTIPGRIRQENGSFRWEPIS
FT                   D"
FT   gene            290753..291568
FT                   /locus_tag="trd_0286"
FT   CDS_pept        290753..291568
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0286"
FT                   /product="putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05706"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU7"
FT                   /protein_id="ACM05706.1"
FT                   /translation="MRRPNARRTMSVSSFFTLVMLFAGLALAACGAATNASDRGATGGP
FT                   PNPGSPAVMEPTADPVATTERRGIFFRHVTLRDAPYSNQTELVIDLTLPDACTELHHAV
FT                   TIDGKRIRVEVWGVGPSDQMCAQVLREETLVIPLGVVVSDDWIVELNRVEIDVNSVARE
FT                   EPGSGSHEYGYAMIEQVEVRVGDERPRQVVADVQGALPDACAELVESPEITFDGAKVTV
FT                   TLQWQRPRDLMCAQVLRPFTTSVDLGELEPGTYTLVVNDLETTFTVETN"
FT   gene            complement(291565..292383)
FT                   /locus_tag="trd_0285"
FT   CDS_pept        complement(291565..292383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0285"
FT                   /product="enoyl-CoA hydratase/isomerase family protein"
FT                   /note="identified by match to protein family HMM PF00378"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04654"
FT                   /db_xref="GOA:B9KXU8"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU8"
FT                   /protein_id="ACM04654.1"
FT                   /translation="MKGSSLDRPERVDAMEQPVLLVAHHAGIVTLTLNRPTVRNALDLA
FT                   LARAIATTAQELAQDASLRLVVLRGTPPAFCAGADLTERSKMSPRERTAHTDAIAAAVE
FT                   AIAELPVPTIAAISGACLAGGAELALACDLRFADTTARIGFPEVRRGIFPGAGGVLRLP
FT                   QLVGRGRAADLLFSGRTLDAQEAFRIGLIDQLCEPGHLDTMLDHWITELRQAAPGAVRA
FT                   VKAALQRVLTTDAVTLADIRSLRRALDESPEYEEGLRAFAERRPPSWANG"
FT   gene            292603..293775
FT                   /locus_tag="trd_0287"
FT   CDS_pept        292603..293775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0287"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04901"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXU9"
FT                   /protein_id="ACM04901.1"
FT                   /translation="MIDFGKLVMAGQAAPMAIWLRDRGTERPTMLAELFAAAEDWRHSG
FT                   KRLDLGRALAQVDPSLVDPLTGLPRGSPFGLYRELLGIHFFQDIIDQLRPLSETQGAIA
FT                   LASMLGLEPWYVFATVYPRRVRREEQDPTELDVPEEVIQWIGNWALGLQMIDVAGQAVL
FT                   PEYIGRPVTAEPMVWPALLALRERIPHPLLIDEPERTDFIAAVEQWDRRIDERMFLIER
FT                   ASLAWVERYGEPPRSFARLRSGRPWRPWHYPDTFDPADGVLPQLLRAAVALVKGWGDQT
FT                   PTLFSSAKVLEIWESSRAALGPLVESAYARTVARVLDIEWALRPSRTSQSVSDDLVWRL
FT                   VLLEAILRESAGAVRALVAEPLEWIAEYRDVMEQFVEWTARFLRIGTQSG"
FT   gene            293821..295017
FT                   /locus_tag="trd_0288"
FT   CDS_pept        293821..295017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0288"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05778"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV0"
FT                   /protein_id="ACM05778.1"
FT                   /translation="MSESERTFQIAQRVHRAFVESTMADARRDRLIGEYARAARAWQAR
FT                   GQSLGLEVAMQRSGLDARIRESWLDAVAFDFFRAVVTELQPLLETQLALRLAGLVGIEP
FT                   WVVIALREREEGGLPGTRRARVPWEVVRRFSRWSLGSISVALAVLELEDHVRGRCDADR
FT                   FSLDWPLLWHLRDRIPHPFGLDGQATAEFASACARSRGELPISDCFLEQLRRDTTASWR
FT                   AMATREVDERSLAGRSMAPRGSTGQLDDYPRDEVASAVLTAAALAAWFDSDTIAAELAD
FT                   RVATMFAKQSDEPLPPVFHLLGIGTQERWHQAAGPLTALLPTTYARTCAVGLGLPGVPE
FT                   RDAGWLDGSLAVGGKLLLFEGVLREACGALYALAIDPLDHLERTRDYAHALLGSLDPL"
FT   gene            294804..295229
FT                   /locus_tag="trd_0289"
FT   CDS_pept        294804..295229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0289"
FT                   /product="bkrf1 encodes ebna-1 protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06015"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV1"
FT                   /protein_id="ACM06015.1"
FT                   /translation="MCSGARTSWGPGTRCWMARWVTSGRGQAPAVRGRSTRSLRRTVRP
FT                   GHRSARSSGADARLRARASGVARSVVMGEPRPNRSSGFGLFGSPRGGEGVVGRRDQVAT
FT                   DHSRRTGAAGGEESSRNAGTRLATIAPLPARQRGSDE"
FT   gene            complement(295418..295493)
FT                   /locus_tag="trd_0290"
FT   tRNA            complement(295418..295493)
FT                   /locus_tag="trd_0290"
FT                   /product="tRNA-Gly"
FT   gene            295993..296068
FT                   /locus_tag="trd_0291"
FT   tRNA            295993..296068
FT                   /locus_tag="trd_0291"
FT                   /product="tRNA-Ala"
FT   gene            296156..296428
FT                   /locus_tag="trd_0292"
FT   CDS_pept        296156..296428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0292"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05141"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV2"
FT                   /protein_id="ACM05141.1"
FT                   /translation="MKTRTFQLIGRRSSQPDVLLVRDQEGRYYLRPGCNGRLVRVTARD
FT                   AERLLRNYEYRPILSATWLSFEELIRTDCPLPAESTPSLTSHERA"
FT   gene            complement(296495..298453)
FT                   /locus_tag="trd_0293"
FT   CDS_pept        complement(296495..298453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0293"
FT                   /product="metalloprotease FtsH"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF01434; match to protein
FT                   family HMM PF06480; match to protein family HMM PF07728;
FT                   match to protein family HMM TIGR01241"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06215"
FT                   /db_xref="GOA:B9KXV3"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXV3"
FT                   /protein_id="ACM06215.1"
FT                   /translation="MSDNKWLRNGFVWMILIIAAIAVWVTFVQGGRGGATITTQEMAAD
FT                   IKAGKVERLVMTSGSDEIQVQYIGTNEVRTLRLPPNVDIFELLKTFGIDPQQVDIQTHR
FT                   ASQWGNVLGTLTFLLPTLFLIGVIIFMMRQAQGTNNQALSFGKSRARVFTSNRPTVTFD
FT                   DVAGVDEAKEELQEIVEFLKYPEKFAALGARIPRGVLLVGPPGTGKTLLSRAVAGEAGV
FT                   PFFSISGSEFVEMFVGVGASRVRDLFDQAKRNAPCIVFIDEIDAVGRQRGAGLGGSHDE
FT                   REQTLNQILVEMDGFDSSTNVIVIAATNRPDVLDPALLRPGRFDRQVVLDRPDLHGRLA
FT                   ILKVHTRGKPLESDVDLEDLARQTPGFSGADLENLVNEAAILAARRNKKTIGRRELYEA
FT                   IDRVVAGPERKSRRISEREKLMTAYHEAGHALVARMLPHADPVHKVSIVARGMMGGYTR
FT                   VLPEEDRFFWTKKQFEAQLAVFMAGLVAEELVFQEVSTGAANDIERATTLARRMVTEFG
FT                   MSERLGPLAFGRKEELVFLGREIAEQRNYSDQVAYEIDQEVRRLIDQAYQTAKQILLDH
FT                   MDKLEKIATLLVEKETLDGHEIEALFDEPRPRPELVGPPLTRPAALIATPETARPDSPS
FT                   EARPAAPVPHIKPQPAS"
FT   gene            complement(298529..298705)
FT                   /locus_tag="trd_0294"
FT   CDS_pept        complement(298529..298705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0294"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04722"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV4"
FT                   /protein_id="ACM04722.1"
FT                   /translation="MNRAHPAWPTRASSFASEITGEARTILPRVSLAWWRFSDRSADAP
FT                   ARGSRRHMPRIDR"
FT   gene            complement(298788..300875)
FT                   /locus_tag="trd_0295"
FT   CDS_pept        complement(298788..300875)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0295"
FT                   /product="putative bifunctional protein tilS/hprT"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00156; match to protein family HMM PF01171; match to
FT                   protein family HMM TIGR01203; match to protein family HMM
FT                   TIGR02432; match to protein family HMM TIGR02433"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05611"
FT                   /db_xref="GOA:B9KXV5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV5"
FT                   /protein_id="ACM05611.1"
FT                   /translation="MVRIRPPAPNGAAQVAPLSLLGENHSSDSPIWGRTLVRRSNSAIS
FT                   AVLRVVRTALEEAGLSGHDRIIVGFSGGPDSLGLLWSLQHLAHRGLAPTPIPVHIDHGL
FT                   QSSSSTMAERAIALGSELGLVVRVVQVNVSLWPEYKEGGLEAGARAARYAALAQVARAE
FT                   GTSWITVGHTRDDQAETVLLRLLRGAGLDGLAAMRPVTELRIPLDPLHREFASIRLIRP
FT                   LLRIRRSVVRAAVELLGLQPLEDPTNLLLSYERNAIRRRVLPILEQLRPGTTDALAQVA
FT                   EQLREDAEFLQRVARETSAQVFRPEADFLILDRAAFRALDPALQRRILQTALREHWDPT
FT                   WSLSRERLVALRKALVEGQTGRAIELGHGLVAVISYTEAVLGPGNRIEQYLRNRSGRPL
FT                   IQPGSVLPLRSGTTLALENEWELAILRAPAEGWVVRTRRPGDRLVRPGQPVPVRLQDWL
FT                   VNEKVPSYLRDWLPLVASDGIVHWIPGLQGERYRSPDGTVVLELVRKGGVRGVSETAQA
FT                   PSGELERVLIDEATLQRRVAELGEEIARAYQGKRPVLIGVLTGAFVFMADLVRHLPIDL
FT                   DIDFMAVSSYGQATVTSGVVRIIKDLDRPIEGRDVLLVEDIIDSGLTLQYLLDVLQRRN
FT                   PRSLRVVVLLRKQKPGAVSVRADWVGFDIPDEFVVGYGLDAAGRFRNLPFIAVYRNAAQ
FT                   G"
FT   gene            complement(300849..300923)
FT                   /locus_tag="trd_0296"
FT   tRNA            complement(300849..300923)
FT                   /locus_tag="trd_0296"
FT                   /product="tRNA-Met"
FT   gene            complement(301208..302023)
FT                   /locus_tag="trd_0297"
FT   CDS_pept        complement(301208..302023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0297"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /note="identified by match to protein family HMM PF00106"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04507"
FT                   /db_xref="GOA:B9KXV6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV6"
FT                   /protein_id="ACM04507.1"
FT                   /translation="MGRLTGLVALVTGAGGGEMGGGGAGIARVLAREGAIVAVNDLHED
FT                   YARATVDQITRNGGQSFALAGDVSDPRQANELVSSVIARCGRLDILVNDAARLGRTPAV
FT                   ERMSDEEWHSYIAVNLSGPFYMSRAAIPHMMQREYGRIINIASLAALRASLNGGAGYTS
FT                   SKRGLLGLTRQLAAEFYTYNITVNAVLPAGILSGRLRAEMGEHAEALVATRRWALPDDI
FT                   GQICAYLASPEAHLISASVIVVPGVNATGLGDFAQYRAMARQIGKDIGE"
FT   gene            complement(302041..302862)
FT                   /locus_tag="trd_0298"
FT   CDS_pept        complement(302041..302862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0298"
FT                   /product="putative 3-oxoacyl-(acyl carrier protein)
FT                   reductase"
FT                   /note="identified by match to protein family HMM PF00106;
FT                   match to protein family HMM PF08659"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06004"
FT                   /db_xref="GOA:B9KXV7"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV7"
FT                   /protein_id="ACM06004.1"
FT                   /translation="MQRQQRFDLNGMVALVTGAGGGSRGGLGPLIARALAESGSRIAIN
FT                   DRTPERARETVAELRAAGYDAVEAFPADVANSAQVDRLIAQVVERFGQLDILVNKAEAH
FT                   GSGRRSDQVSDDEWESLLAVNTHAPFYLSRAAVRHMRQRRFGRIIHVSHITASRTSALN
FT                   GVAYVAAKEALYGLIRHLSIEVAQHGITVNAILPGFIVTPKLLHGWEEERVQRLAETIP
FT                   IRRAGTPEEVAALVVFLASHEASYITGAAIPIDGAVSVVPGGRTDPASAFA"
FT   gene            complement(303248..304294)
FT                   /locus_tag="trd_0299"
FT   CDS_pept        complement(303248..304294)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0299"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04712"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV8"
FT                   /protein_id="ACM04712.1"
FT                   /translation="MSVHQMAEPTLEAVRHAREAIEYCYERGWTDGLPVVPPAEEFVAE
FT                   FLAQTDRDPEEVVIEQEHLGRKCTVRLAAANAVMAGCKPDYFPVVLAALEALDRVPGSR
FT                   GLLQSTTGQAVFVVVNGPIRHRLGFNARDNVFSPGDRPNATIGRAIRLVIMNALGIRPH
FT                   EFDQSTHGQPGKFSLCIAENEEESPWEPLHVERGFAQDESTVTVGLVRGTIQVEQRDSQ
FT                   HPEVILETIADSMSYAGTYFPTPRGHAGIVVMGPEHAQLIAAAGWSKTRARQYLWEHFG
FT                   RPAGVLRRLAKDALLDASLPDDAFVRFAHSPETILIVVAGARNAGISTVCPTFIGQQIT
FT                   IPIRTKSS"
FT   gene            complement(304272..304841)
FT                   /pseudo
FT                   /locus_tag="trd_0300"
FT                   /note="conserved hypothetical protein; an automated process
FT                   has identified a potential problem with this gene model;
FT                   the current end5 and/or the end3 may need to extended or
FT                   the current gene model may need to be merged with a
FT                   neighboring gene model; the current gene model (or a
FT                   revised gene model) may contain a premature stop"
FT   gene            complement(304841..305113)
FT                   /locus_tag="trd_0301"
FT   CDS_pept        complement(304841..305113)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0301"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04559"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXV9"
FT                   /protein_id="ACM04559.1"
FT                   /translation="MSASPTVLRAIDRALDRIREGLAPDGFELRVERVTDEGIVELVLQ
FT                   ALPDACLDCLVPDQLLDAMLRQAIAPVYPALREVRLEKRLPEEGR"
FT   gene            complement(305169..305861)
FT                   /locus_tag="trd_0302"
FT   CDS_pept        complement(305169..305861)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0302"
FT                   /product="3-oxoadipate CoA-succinyl transferase beta
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02428"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05247"
FT                   /db_xref="GOA:B9KXW0"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW0"
FT                   /protein_id="ACM05247.1"
FT                   /translation="MPLTREGIAYRIAHDLPDGSFVNLGFGMPSLVTHFLPLGKTVLIH
FT                   SENGILGAGPKAPPGQEDPDLVNANGDFVTLVPGASLFDHALSFTIVRGGHLTHAVLGA
FT                   LQVSRRGDLANWRIPGARVPGVGGAMDIAVGAQRVWVAMTHTTDHGEPKIVEECTYPLT
FT                   APRCVQRIYTDLAVLSVVGGELLLEEVAPGVTVQDVTARTGASLTIPSRVPTMDIPAEL
FT                   AGIQLVTV"
FT   gene            complement(305873..306571)
FT                   /locus_tag="trd_0303"
FT   CDS_pept        complement(305873..306571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0303"
FT                   /product="IpsJ protein"
FT                   /note="identified by match to protein family HMM PF01144;
FT                   match to protein family HMM TIGR02429"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04786"
FT                   /db_xref="GOA:B9KXW1"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW1"
FT                   /protein_id="ACM04786.1"
FT                   /translation="MDRVVASCDEAVADIPNGASIMIGGFGPPGVPVNLVRALRQRGLH
FT                   DLVLIYCGGGTEEDGIGGLIADGAVRKLITSFPVHPGAHAVRERYLQGEIELEVVPQGT
FT                   FVERIRAAGAGLGGFYSPTGVGTELAAGKEVRLIDGRAFVLELPLPADYALIKAFRADQ
FT                   WGNLVYRRTMRNFNPIMATAARMVIAEVDEVVPVGSLSPEEIETPCLFVDRVVEVPRDW
FT                   FRHATSAERR"
FT   gene            306683..306796
FT                   /locus_tag="trd_0304"
FT   CDS_pept        306683..306796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0304"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05992"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW2"
FT                   /protein_id="ACM05992.1"
FT                   /translation="MRRGIEDHAAGSRSRDHHPFVYQHYLVFLGILMGNAG"
FT   gene            306839..309154
FT                   /locus_tag="trd_0305"
FT   CDS_pept        306839..309154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0305"
FT                   /product="ATP-dependent DNA helicase pcrA"
FT                   /EC_number="3.6.1.-"
FT                   /note="identified by match to protein family HMM PF00580"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05998"
FT                   /db_xref="GOA:B9KXW3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW3"
FT                   /protein_id="ACM05998.1"
FT                   /translation="MLEERGNARGEPGSEDRSVTGEPERGGPFQMAGERLVPFSGMERI
FT                   LIGLDADQCVAVTTTEGPVLVVAGPGSGKTRVLTHRVAYLIGSGRARPWQIVAVTFTNK
FT                   AAREIRERLGGLLGTESAQLVQAGTFHSLCVRILRRDGYRIGLEPAFTIYDEEDQLALV
FT                   KQALRDLGLDPQRFSPRMLLGRLSRAKNDQHSPSDLQSMAQSYWDEVAARVYERYAQYL
FT                   QRAQAVDFDDLLLRTVELFTEYPDVLAHYQDRWRYLQVDEYQDTNRLQYQLVRQLASGH
FT                   RNLCVVGDPDQSIYSWRQADIRNILEFQRDFPDATVIRLGRNYRSTPQIVAAADAVIRV
FT                   NRQRIERPLWTENPPGPPIRLLACWDEQQEAEMVVSEIDRLVRTGNARYRDIAVLYRIN
FT                   AQSRSVEEALVRRQIPYQVIGGVRFYERKEIKDALALLRVLVNPRDWLSLRRVLSETAF
FT                   GRGIGEKTLLQLEQWGQRQQCSPADVLLLLVEEREEAPALAAATVRRLRELGGELVRLR
FT                   AAMVEHPASQLFDLALERSGLAARYRDASDPTERERWENLVQLRSVLERYDTVPAAEGL
FT                   PLFLEEAALVAAIDEAEMSGDQVTLLTLHAAKGLEFPVVFLIGVEEGLLPHARALESEA
FT                   ELEEERRLFYVGITRAKERLYLSYCSSRNRFGLRERCLPSHFLDDLPPDVVEAGSRASE
FT                   RVPRVAPPAGGHAGPVESSAPVVPRLRAGQRVFHPAFGDGFVVAVREQAGDQEVTVQFK
FT                   RHGTKTLLASLAKLVVEE"
FT   gene            309221..311869
FT                   /gene="ppdK"
FT                   /locus_tag="trd_0306"
FT   CDS_pept        309221..311869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ppdK"
FT                   /locus_tag="trd_0306"
FT                   /product="pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="identified by match to protein family HMM PF00391;
FT                   match to protein family HMM PF01326; match to protein
FT                   family HMM PF02896; match to protein family HMM TIGR01828"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04849"
FT                   /db_xref="GOA:B9KXW4"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW4"
FT                   /protein_id="ACM04849.1"
FT                   /translation="MVSVATGRRWVFLFREGNAQLRDLLGGKGANLAEMTRIGLPVPPG
FT                   FTVSTRACVAYLQGGRRMPEGLWEEVLEGLRDIEQQIGRRFGDPVQPLLVSVRSGAKFS
FT                   MPGMMDTILNVGLTDETVLGLAAMTANERFAYDCYRRLIQMFGKVVLDIPSERFEDALD
FT                   ELKRELGVIHDYEIPAEHLQRLVQAYKEIVQQATGTPFPQDPFEQLRRAILAVFESWNN
FT                   RRAIDYRNAHGIPHDLGTAANVQAMVFGNLGPDSATGVAFTRNPSTGEKGIFGEYLTNA
FT                   QGEDVVAGIRTPQPIQEMAKDPLLRGAYEQLLDVADRLERHYRDMQDLEFTVERGKLWM
FT                   LQTRTGKRTGRAAVKIAVDMVHEGLIDPREAVLRVSPDHLDQLLHPMLDPSWKGEPLAK
FT                   GLPASPGAASGKVVFDADEAKVLGDRGEAVILVRLETSPDDFHGMLAARGILTARGGMT
FT                   SHAAVVARGIGKPAVVGCSALVVDYERQEFRVGDVVVRRGDVITIDGSTGAVLLGEVPT
FT                   IPPSVGGDLAELLDWADQFRRLRVRANADTPEDAAKARELGAEGIGLCRTEHMFFQGDR
FT                   IWAMREMIMATTPEERRAALAKLEPMQREDFVGIFKAMAGFPVTIRTLDPPLHEFLPKH
FT                   EEEIQAMAERLGVSPEAIRAKVQALTEANPMLGHRGCRLGITAPEITEMQARAIFTAAL
FT                   QCAAEGIEVHPEIMVPLVSDVRELMVQREIIDRVARQLFAEAGREIPYSIGTMIEVPRA
FT                   ALTASEIAREAEFFSFGTNDLTQMTYGISRDDAGRFLPYYLEHGIYPADPFQTLDRAGV
FT                   GRLIEIARDGGRATRPAIKLGICGEHGGDPASIRFCHEVGLDYVSASPYRVPIARLAAA
FT                   QAALGLREGDV"
FT   gene            312107..313069
FT                   /locus_tag="trd_0307"
FT   CDS_pept        312107..313069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0307"
FT                   /product="putative aromatic metabolite ABC transporter"
FT                   /note="identified by match to protein family HMM PF00903"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05763"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW5"
FT                   /protein_id="ACM05763.1"
FT                   /translation="MPEREILGIHHVTAVTGRATENVRFYTRVLGLRLVKKTVNQDDVS
FT                   AYHLFYADAVGSPGTDVTFFDWPNLPPHRSGSGEIARIALRVDNAAALEWWVEWLQQHG
FT                   VPGVEWGNYAGRQAVFFRDFEGQRLALVDDGGTVGGTPRDRSPVPPAYQIKGIFAVSLV
FT                   VRSLEPTARVLTEVLGFRLRQEERSHARTALFEVGPGGPGALIVVEERPDQPRAQLGTG
FT                   GVHHVAFRVSDDAAHQAWRARIAQAGIPVTPQIDRFYFRSLYFREPGGILFELATDGPG
FT                   FAIDEDLEHLGERLSLPPFLEPRRAEIEANLRPLEPIEA"
FT   gene            complement(313147..313764)
FT                   /locus_tag="trd_0308"
FT   CDS_pept        complement(313147..313764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0308"
FT                   /product="superoxide dismutase (Mn)"
FT                   /EC_number="1.15.1.1"
FT                   /note="identified by match to protein family HMM PF00081;
FT                   match to protein family HMM PF02777"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04672"
FT                   /db_xref="GOA:B9KXW6"
FT                   /db_xref="InterPro:IPR001189"
FT                   /db_xref="InterPro:IPR019831"
FT                   /db_xref="InterPro:IPR019832"
FT                   /db_xref="InterPro:IPR019833"
FT                   /db_xref="InterPro:IPR036314"
FT                   /db_xref="InterPro:IPR036324"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW6"
FT                   /protein_id="ACM04672.1"
FT                   /translation="MPYELPPLPYPYDALEPYIDARTMEIHHTGHHGAYVRNVNAALEK
FT                   HPEIPGMPIEELLRRINEVPEDIRTAVRNNGGGHANHTIFWQIMGPNAGGEPTGELAQA
FT                   IAETFGSFQQFKEQFSAAAAGVFGSGWAWLVLDQNGKLQIITRPNQDSPYMDNLYPVMG
FT                   LDVWEHAYYLKYQNRRPEYIANWWNVVNWDAVAQRYREGLKR"
FT   gene            complement(314011..315609)
FT                   /locus_tag="trd_0309"
FT   CDS_pept        complement(314011..315609)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0309"
FT                   /product="biuret hydrolase"
FT                   /note="identified by match to protein family HMM PF01425"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04596"
FT                   /db_xref="GOA:B9KXW7"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW7"
FT                   /protein_id="ACM04596.1"
FT                   /translation="MDDTASVALARQNLAALGIPVSDEDLEKAHAAGFFSTAQVFQVMV
FT                   QRDSEVDDLPDFLTDRLPAPRSWAATGEESPSAAPEILELARALRNGETSSRALVERAL
FT                   EQITRRDQELNAFQLLLPEQALADAEARDAELARGIDRGPLHGLPVALKDLIDLAGTPT
FT                   TAGSAILANAVASRDATVVQRLRAAGAVIVGKTRLPEFAYSGASNNPHYGPVPNPRDRR
FT                   RDSGGSSSGSAAAVAAGLVVMAVGSDTGGSIRIPAAYCGIVGLKPTFGRVSARGVYPLA
FT                   WSLDHIGPLTRTVTDAAVSLEAMAGPDEDDPRTRAVPLPDLVSATQVERLELRVGVVRS
FT                   TGGDQPLAAPDAVAACERAVAALADAGADLIPLVLPELETLRIVSAAIAQLEAAALHAP
FT                   TARERWTHYGEFFRLRLLGCFAYPCWGYVAAQRLAKKARARVTSLLEEHDIALLALPTT
FT                   PTTAPPLGQWTARASWLTAPFNLLGWPALSVPAGLGDDGLPIGLQLVARPWREDLVIAA
FT                   GALVERAARSSRGSN"
FT   gene            315703..316428
FT                   /locus_tag="trd_0311"
FT   CDS_pept        315703..316428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0311"
FT                   /product="probable transferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06204"
FT                   /db_xref="GOA:B9KXW8"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW8"
FT                   /protein_id="ACM06204.1"
FT                   /translation="MMPVEGRERTEEGRAMPQAPLAPEVLRALQTLTTPTVANAIETFD
FT                   VRPRNVGFMDTSIKCMFPHLGTMVGYAVTAKIRAAQPPRPGESVPRRAMWEYILTIPEP
FT                   RIVVIEDLDDPPIGSFWGEVNANIHRALGCIGTVTNGGVRDLDEVERLGFHFFASQVQV
FT                   SHAYVHVVEFGTPVTVGGLTVHPGDLLHGDKHGVIQIPLEIAPELYRAAKEVEARERRI
FT                   IEACQAPGFTIDRLAELYG"
FT   gene            complement(316419..316862)
FT                   /locus_tag="trd_0310"
FT   CDS_pept        complement(316419..316862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0310"
FT                   /product="OsmC-like protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   premature stop; identified by match to protein family HMM
FT                   PF02566"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05378"
FT                   /db_xref="InterPro:IPR003718"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR036102"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXW9"
FT                   /protein_id="ACM05378.1"
FT                   /translation="MRAVARQQDSPLRCMVETTGGTIVSEAHPGVGGPGTASCSGDLLL
FT                   AALAACAQITCQMVATALGIPLTRVSATAEGDLDLRGTLGVSREVPVGFGAIRLFIDIE
FT                   APDATPEQLASLREKTEQFCVIFHTLRQPPELSVQWSSSNAQP"
FT   gene            complement(316986..317900)
FT                   /locus_tag="trd_0312"
FT   CDS_pept        complement(316986..317900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0312"
FT                   /product="putative halocarboxylic acid dehalogenase DehI"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05114"
FT                   /db_xref="GOA:B9KXX0"
FT                   /db_xref="InterPro:IPR019714"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX0"
FT                   /protein_id="ACM05114.1"
FT                   /translation="MRVASERSGDDVLEQLSEIWPKAAPARVQPVFEDLRTALRVPDIP
FT                   FPFRLLAHWPPYLAFAVRQFSPFIRSLAFEAAADALRARAATSIGSPPRSERLAAARAL
FT                   ILREHELAPKIVLILTAFAVGLRGRARESAPPLGTTLPAQEPITVRPAELPRTVDERIA
FT                   PLPDLSTVLERGRVLLADLAALRGSPALDDFSRALAVSEPAAFAELLALRRSIEADRLA
FT                   QVRSELLAQAERAVRRFTLPGARVLPDFMVPEPALAAIDAVVDRLRTIAAEAFLDVTLA
FT                   RVALDGFDAASSAPYPVHVAVDQ"
FT   gene            318057..319172
FT                   /locus_tag="trd_0313"
FT   CDS_pept        318057..319172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0313"
FT                   /product="putative conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05133"
FT                   /db_xref="GOA:B9KXX1"
FT                   /db_xref="InterPro:IPR026898"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX1"
FT                   /protein_id="ACM05133.1"
FT                   /translation="MVVASSLGLCCVLSLALLETSPTAFLVGLVLAGILAPVYAAYLLF
FT                   LDPLEHEPPWLLGLALAWGAGVATLSGGAATALLEAMTGTVLALDSDVSDTLGTIIFAP
FT                   LTEEAAKGAFVFALFLLARHEFDDVLDGIVYGGLVGLGFAVVEDLIYYAAAFLEEGLSG
FT                   VGLPFLVRGVLTGFGHPLFTAVTGLGLGLAVQARSSALRWLAPFAGLVGAILLHALWNG
FT                   GVTLAQYDESGLLALLMLLGYPLLVLLPGAIGLAVLAVAQARRRARDVRRYLAEAVQLG
FT                   LADTEDLAVLTSPWRRRARQLRYLTRYGGRAFWLRRRMDIALVDWAYRHWHRERGERLP
FT                   RYLATFEAEAIAARIRRWRLELSTLLAAGTG"
FT   gene            319193..320332
FT                   /locus_tag="trd_0314"
FT   CDS_pept        319193..320332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0314"
FT                   /product="radical SAM enzyme, Cfr family"
FT                   /note="identified by match to protein family HMM PF04055;
FT                   match to protein family HMM TIGR00048"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05359"
FT                   /db_xref="GOA:B9KXX2"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX2"
FT                   /protein_id="ACM05359.1"
FT                   /translation="MKSSGSITMMTVTEWTTPRPTGRVQRETLHDYTLGELEAWVEGRG
FT                   LPRYRARQLFHWAYQQLVLEYESMSVLPKAVRSELSETLPISGLVPVRQRVSDDRETIK
FT                   LLFRTRDDHFVETVVMFYPDRTTVCVSCQIGCAIGCSFCATGLSGLIRNLSAGEMVSQV
FT                   VHAARLARERERRISNIVVMGMGEPFHNYDAVMRFVAIVNDRQGLGIGARHITLSTAGV
FT                   VPFIDRLAEEPYQVKLAVSLHAPNDALRSQLVPINRRWPIDELLAACRRYVARTGRRVT
FT                   FEYVLIEDVNDDERTAAELARRLRGLLCHVNLIPYNPTPAAPLFRRPGPERIERFRAVL
FT                   ERYGIPATVRYSRGVEIAAACGQLRAQEEARSRRRRATS"
FT   gene            320345..321565
FT                   /locus_tag="trd_0315"
FT   CDS_pept        320345..321565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0315"
FT                   /product="conserved hypothetical protein TIGR00299"
FT                   /note="identified by match to protein family HMM PF01969;
FT                   match to protein family HMM TIGR00299"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05343"
FT                   /db_xref="GOA:B9KXX3"
FT                   /db_xref="InterPro:IPR002822"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KXX3"
FT                   /protein_id="ACM05343.1"
FT                   /translation="MRVAYVDPFSGASGDMLLGALVDAGVPPEELADRLASALDVDGYR
FT                   LVVERVVRRGLAGTQVRVIVEAAQPARDWAEIRDLLSASALPPRVKERALAVFRRLAEA
FT                   EASVHSVPLESVHFHEVGAVDSIVDVVGVVWGFELLGVEEITCGPLPLSRGWVETAHGR
FT                   LPVPAPATALLLAQAGAPLVPLDIEAELVTPTGAALLVELARFVRPAFLPERVGYGFGT
FT                   RELPWPNALRLWIGEAFAVPSRLDEAELLLEANLDDMNPQFIEPLVDQLFAAGALDVYL
FT                   TPIVMKRSRPAVIVSAICRAKDRPVLERVLFEHSTTFGVRGIPIERTKLARRSVAVATR
FT                   WGEVAVKLKIVQDRIVDAVPEYRDCLAIHQRTGLPIREIWNEAARLAAVWIGQRVGEED
FT                   QEATLPE"
FT   gene            321726..322550
FT                   /locus_tag="trd_0316"
FT   CDS_pept        321726..322550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0316"
FT                   /product="ZIP zinc transporter family protein"
FT                   /note="identified by match to protein family HMM PF02535"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06179"
FT                   /db_xref="GOA:B9KXX4"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX4"
FT                   /protein_id="ACM06179.1"
FT                   /translation="MLDWFWSLDPILQALLGGLLTWGATAAAAALVLLGRSIPRWLLDA
FT                   MLGFAAGVMIAASVWSLLIPAMEVTERNGGIAWIPAATGLVAGALALRIVDRFLPHLHL
FT                   FLPREAAEGVSTTWRRTTLLILAITLHNVPEGLAVGVAFGAAARVTDPLLALSLASGAT
FT                   ALAIGIALQNVPEGLAIAVPLRREGFSPFRAFWYGQLSAIVEPLAALLGAAAVLFVEPL
FT                   LPYALAFAAGAMLYVVVEELIPESQRGDHGDLATSGTIIGFTVMMVLDVALA"
FT   gene            323225..324049
FT                   /locus_tag="trd_0317"
FT   CDS_pept        323225..324049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0317"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04532"
FT                   /db_xref="GOA:B9KXX5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX5"
FT                   /protein_id="ACM04532.1"
FT                   /translation="MVETPGASSAPTEARTVVVRVSDVIKHFVHGKRQLRALDGVSFEL
FT                   PEGRFLVVVGPSGCGKTTLLRILAGLEQQDSGEVWMRPSRDGHPPFAMVFQEQSVFPWL
FT                   TVRDNVAYGLKLRRVRGRQVEERASHWIRKVGLSGFERAYPHQLSGGMKQRVSIARAFA
FT                   VDPDVLLMDEPFSALDEQMRTILQQEVSSLCEEQQKTVIFVTHSIDEALTLGDEVLVMT
FT                   HRPGRVKRVIPVPFPRPRDVVEVRADPRYGELYEEIWGLIAEEVRRGPQEHR"
FT   gene            324046..324879
FT                   /locus_tag="trd_0318"
FT   CDS_pept        324046..324879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0318"
FT                   /product="putative ABC transport proteins, inner membrane
FT                   component"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05895"
FT                   /db_xref="GOA:B9KXX6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX6"
FT                   /protein_id="ACM05895.1"
FT                   /translation="MMVEGGASVERTTMQRGRWLPQAGVKTEAAIQLLSPVALLALWEA
FT                   AARAGWVDQRFFPAPSTIVGAFWDAITTGVLLHHLKITLWRVLLGTVIGGVPAVLIGLA
FT                   MGMWRWLRLTLDPIIAATYPLPKSALFPLLLLIFGLGEGSKVSMVAIGVFYLAVTNAME
FT                   GVLAINPVYFDVAKTFGARRWDVIRTVALPGAMPLVLAGLRLGVGTGLILGVLAEMLGA
FT                   RDGLGYLLWSAWQTFSVSLLWATLFVTAILGFASVQLVDFLRRVLVPWQRGTARR"
FT   gene            324876..325067
FT                   /locus_tag="trd_0319"
FT   CDS_pept        324876..325067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0319"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05794"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX7"
FT                   /protein_id="ACM05794.1"
FT                   /translation="MTGASATGRERSSALLPGVGDPPLACQCVAALREPPLGAGEEALR
FT                   LCGISAFERESAIASEVR"
FT   gene            complement(325771..325884)
FT                   /locus_tag="trd_0320"
FT   CDS_pept        complement(325771..325884)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0320"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06133"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX8"
FT                   /protein_id="ACM06133.1"
FT                   /translation="MHASSIMQSLALHLRAGISTPYLSWSTTRDRISCEDA"
FT   gene            complement(326254..326460)
FT                   /locus_tag="trd_0321"
FT   CDS_pept        complement(326254..326460)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0321"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05320"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXX9"
FT                   /protein_id="ACM05320.1"
FT                   /translation="MPMLEIVVARKEPLTTDQKRAFAREAVEIFHRVLGTPPGRLRLAF
FT                   YELRPEESLDLLTDESSEDAHRH"
FT   gene            complement(326592..327587)
FT                   /locus_tag="trd_0322"
FT   CDS_pept        complement(326592..327587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0322"
FT                   /product="catechol 2,3-dioxygenase"
FT                   /note="identified by match to protein family HMM PF00903;
FT                   match to protein family HMM TIGR03211"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06208"
FT                   /db_xref="GOA:B9KXY0"
FT                   /db_xref="InterPro:IPR000486"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR017624"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY0"
FT                   /protein_id="ACM06208.1"
FT                   /translation="MSTNGHAEPLFEVAQLAHVEIYTPDLDGTLWFFKELLGLEETERV
FT                   GDSVYLRAYEDWYHHTLKVTKREKPGLGHVAWRTTSPQALERRVRALEEAGFGEGWIEG
FT                   DRGHGRAYRFHTPDGHPMELLWEVEYYKTPAEAKTKLINRPQRRPLRGVPVRRIDHVNL
FT                   LASDVTQNKQFLMDLLGFRLRENIQLNNGREAGAWLSVSPLVHEIAFMMDQSGAKGRLH
FT                   HVCYWYGYPQHLNDIADVFSEVGIKIEAGPGKHGISQAMFMYVIEPGGNRVELFGDAGY
FT                   LIFDPAWQPITWREEELDKGIIWFGSPLPAEFFLYGTPPVEAAEPARADD"
FT   gene            complement(327744..329000)
FT                   /locus_tag="trd_0323"
FT   CDS_pept        complement(327744..329000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0323"
FT                   /product="pyoverdin chromophore biosynthetic protein pvcC"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF03241"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06192"
FT                   /db_xref="GOA:B9KXY1"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="InterPro:IPR024677"
FT                   /db_xref="InterPro:IPR024719"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY1"
FT                   /protein_id="ACM06192.1"
FT                   /translation="MTYGWLGRSPDYKASFLGTLGANAPFYEPFSANARRWYQLGQERV
FT                   LYWNHAIVNPPVDRNRPPDEVGDVYMHVERETDGGIYVSGAKVVATGSVLTHYNFIAHY
FT                   GPLPIKDKKFALIFTVPMDAPGVKLISRPSYEYTAAVMGSPFDYPLSSRLDENDAVFIF
FT                   DNVFVPWENVFVYGDVDKVNNFFPASGFIPRFTFHSCTRFAVKLDFIAGVLLKAVAATG
FT                   TKDYRGVQAQVGEVIAWRNLFWAITDAMARNPIPWTDGYVHPNLEYGMAYRVLAPTAWS
FT                   RVRQIILDNVASGLIYIPSHALDFQNPAERPYLEKYVRGAGGMDAHDRVKLMKLLYDAT
FT                   ISEFAGRHELYERNYAGNHENIRLETLIVAEAVGTAERMRGFAEQCMAEYDLEGWLTPD
FT                   LVNNEDVSFVLRRFRETQG"
FT   gene            complement(328997..329305)
FT                   /locus_tag="trd_0324"
FT   CDS_pept        complement(328997..329305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0324"
FT                   /product="pyoverdin chromophore biosynthetic protein pvcC"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05938"
FT                   /db_xref="GOA:B9KXY2"
FT                   /db_xref="InterPro:IPR004925"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR024674"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY2"
FT                   /protein_id="ACM05938.1"
FT                   /translation="MAQAVATRPFTGEEYLESLRDGREVYVYGERVTDVTTHPAFRNAA
FT                   RMVARLYDALHDPAKKDILTVETDTGNGGFTHPFFRAPPARSRTSSAPATPSPNGRV"
FT   gene            complement(329372..329521)
FT                   /locus_tag="trd_0325"
FT   CDS_pept        complement(329372..329521)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0325"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05613"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY3"
FT                   /protein_id="ACM05613.1"
FT                   /translation="MLRSDLARKLFGETGFFIPATCQEWIQQIAPFSVRNAGTFRLMIL
FT                   HDNL"
FT   gene            complement(329563..329775)
FT                   /locus_tag="trd_0326"
FT   CDS_pept        complement(329563..329775)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0326"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05409"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY4"
FT                   /protein_id="ACM05409.1"
FT                   /translation="MLSPELTNLLAIGRCTDAEPAALSSARVMGPCIAMGVAAAHAADL
FT                   ASIAQFSFRNTDLPHLQERLQPNLS"
FT   gene            complement(329757..330116)
FT                   /locus_tag="trd_0327"
FT   CDS_pept        complement(329757..330116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0327"
FT                   /product="putative membrane protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05857"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY5"
FT                   /protein_id="ACM05857.1"
FT                   /translation="MISLCHPIRRYPVAFWQVTWLARIEAARAAQLLRDHYPAVFGRAR
FT                   LRRLGYPGIRQTRTIVGEYMLTVEDVLAGRRFPDAIARVAWPIELLTQRRATIGSHSRT
FT                   VTFTPSPIAPCSHPS"
FT   gene            330454..331647
FT                   /locus_tag="trd_0328"
FT   CDS_pept        330454..331647
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0328"
FT                   /product="transcriptional regulator, ArsR family protein"
FT                   /note="identified by match to protein family HMM PF01022;
FT                   match to protein family HMM PF01978; match to protein
FT                   family HMM PF08279"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04811"
FT                   /db_xref="GOA:B9KXY6"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY6"
FT                   /protein_id="ACM04811.1"
FT                   /translation="MGELLIGRPALKLEVAISVPLDLTSVISLVFRATDARRFERWLVE
FT                   ARKALGAEWEHDLDTLLGFSGRLLYYVEELLMSFDPFRPEHREAGFEDYIAHLKRLPAW
FT                   AYRSMAIQAVLRVALDRGVLEAPPESEDAAAWRSFIEPGLTRADADEVVRLVLAPEQLK
FT                   ERTVRLLERFWRELYAAEFERALPAMRRALRQAKATTFASVAAAFEELSGHRLPDEVQL
FT                   ALPRVERVTFCPSYYLGNFVQFILYPPELILYFNCQRTSAATQPEVESVISPDLLPGLR
FT                   ALGDGTRLRIIELLRNGERYAQEIVGMLGISQSAVSRHLAMLEAAGIVTVRPANGMKYY
FT                   AINSQRLRQIAEELERIGSVESFSTEHDKSNGLRAGFSRASGRSLLAEEKPPHSTVG"
FT   gene            complement(332689..333156)
FT                   /locus_tag="trd_0329"
FT   CDS_pept        complement(332689..333156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0329"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05909"
FT                   /db_xref="GOA:B9KXY7"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY7"
FT                   /protein_id="ACM05909.1"
FT                   /translation="MRNPFDWDYLTAPLWQMPTWGPLSITYVVVFSLGFLTCLWIYNDP
FT                   RRLIRKRDPLLADFLQRIAGWGLIVFGIGLFFFLFRLGRISAFDLYKRIWLYLSALLVL
FT                   VWTAYAAHLLLRVYPPLARQRAEELRRKQYAMTPKRAARRATSAASPRKPR"
FT   gene            complement(333169..333864)
FT                   /locus_tag="trd_0330"
FT   CDS_pept        complement(333169..333864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0330"
FT                   /product="succinate dehydrogenase iron-sulfur protein"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM TIGR00384"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05997"
FT                   /db_xref="GOA:B9KXY8"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY8"
FT                   /protein_id="ACM05997.1"
FT                   /translation="MQVTLRIQRFNPETDTKPYYREYTVEVEPTDRVLDALNYVKWYQD
FT                   GSLTFRRSCAHGVCGSDAMRINGRNRLACKVLIKDLGPKITIEPLLGFRIIRDLVVDME
FT                   PFFAQYRTVMPYLINEEPPPVRERLQSPEERALYDDTTKCILCACCTSACPIFWTNEWL
FT                   GPAAIVNAHRFLFDSRDRATEERLAILNQRFGVWRCRTIFNCTEACPRGIQVTNAIEQV
FT                   KRRILFEQS"
FT   gene            complement(333866..335596)
FT                   /gene="nadB"
FT                   /locus_tag="trd_0331"
FT   CDS_pept        complement(333866..335596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadB"
FT                   /locus_tag="trd_0331"
FT                   /product="succinate dehydrogenase, flavoprotein subunit"
FT                   /note="identified by match to protein family HMM PF00890;
FT                   match to protein family HMM PF01266; match to protein
FT                   family HMM PF02910; match to protein family HMM PF07992;
FT                   match to protein family HMM TIGR01812; match to protein
FT                   family HMM TIGR01816"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05198"
FT                   /db_xref="GOA:B9KXY9"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXY9"
FT                   /protein_id="ACM05198.1"
FT                   /translation="MVFHRFDAVIVGAGGAGLMAAAQLAGKCNVAVVSKLYPVRSHTGA
FT                   AQGGIAAALGNVEEDHWIWHMFDTVKGGDYLVDQDAAEVLAREAIDAIIELEHWGFPFN
FT                   RTPDGRIDQRRFGGHTRNFGEGPVRRACYAADRTGHMILQTLYQTALKRQVTFFDEFMM
FT                   LDLLLTDDGVCTGIVAMDIETGDIHVFHAKAVLLATGGFGRVFKVTSNALAATGDGVAI
FT                   AFRRGIPLEDMEFYQFHPTGIYKMGILLSEACRGEGGILRNGLGERFMERYAPTLLDLA
FT                   PRDMVSRAIYQEIRAGRGVDGKDYVWLDLTHLPAEVIETKLPDITDFVRTYLGLDPVKD
FT                   LIPIQPTAHYAMGGIPTDVDGRVTIDAQNTPIPGLYAAGECACVSVHGANRLGTNSLVD
FT                   LVVFGRRAGRHMARFVQENDFHPLPKDPAYRARAEIEWIRENDGTERVAQIRAELQEAM
FT                   MTDAGVFRTGDGLKRLQQKLGELRNRYTQIRIDDKSRTFNMELMEAIELGFLLDCAEAI
FT                   AASALAREESRGAHYREDFPARDDANWLKHTLIARTSGGLQLFYKPVVITRFEPKERVY
FT                   "
FT   gene            complement(335600..336013)
FT                   /locus_tag="trd_0332"
FT   CDS_pept        complement(335600..336013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0332"
FT                   /product="succinate dehydrogenase, membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06311"
FT                   /db_xref="GOA:B9KXZ0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ0"
FT                   /protein_id="ACM06311.1"
FT                   /translation="MTIARPHLGRERPSGGFELYSWYYFRISGLLLILLAVGHVVIMHV
FT                   VNTVDEIDWQFVADRWNSPFWRVYDWLLLFLALTHGLNGARLAIDDYVRPHGWRVFAHS
FT                   VLWTLALLFLVIGSIAIVTFDPSKFEVVAQAGG"
FT   gene            complement(336032..336451)
FT                   /locus_tag="trd_0333"
FT   CDS_pept        complement(336032..336451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0333"
FT                   /product="succinate dehydrogenase, cytochrome subunit"
FT                   /note="identified by match to protein family HMM PF01127;
FT                   match to protein family HMM TIGR02970"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05216"
FT                   /db_xref="GOA:B9KXZ1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR039023"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ1"
FT                   /protein_id="ACM05216.1"
FT                   /translation="MTVTRAQESRSATTRGISAYRGYRPPPGMISWAFHRITGLGVLLF
FT                   LLLHIVDIFLVNYGPEVFNELLFLYRHPVFRIGEIILVGAVYYHAANGVRIMLIDFWPA
FT                   AYRYERQLFYGVMAVFLLAFIPTAFLMIRAIIQAG"
FT   gene            336641..337762
FT                   /locus_tag="trd_0334"
FT   CDS_pept        336641..337762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0334"
FT                   /product="peptidase, M20/M25/M40 family"
FT                   /note="identified by match to protein family HMM PF01546;
FT                   match to protein family HMM PF07687"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06350"
FT                   /db_xref="GOA:B9KXZ2"
FT                   /db_xref="InterPro:IPR001261"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ2"
FT                   /protein_id="ACM06350.1"
FT                   /translation="MLLSKEDSVIREACVRTINVACQIALVPAPTFEEGERAELVCELF
FT                   RERGASPFIDDVGNVVVRRRGEGEKRALLLAAHLDTVFPRTTPLTIERGEGWVRGPGIG
FT                   DNALGVAALLTLWDFLESFGVVLPGDLVLAANVGEEGLGNLRGMRALVDQFGRELGAAV
FT                   AVEGHNLGRVTHIAVGSIRLRLIVRGPGGHSWGNFGTPSAIHELARIICALTELPVPRS
FT                   PKTTYNVGMIDGGVSVNTIAPFAQAVIDLRSIDPRELQRLSRAVEELAARQRAAGVEVE
FT                   LELLGERPAGETPVDAPVVRTALQVLRALGIEPVLDASSTDANAAIAAGIPAICIGLTR
FT                   GRGSHTLEETIEIAPLELGLRQLLQLVRAFPVI"
FT   gene            337789..340737
FT                   /locus_tag="trd_0335"
FT   CDS_pept        337789..340737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0335"
FT                   /product="exonuclease family"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05975"
FT                   /db_xref="GOA:B9KXZ3"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006310"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ3"
FT                   /protein_id="ACM05975.1"
FT                   /translation="MPRIYVALDIEATGMDPERDEIIEVAAIKFREEEVLERFETLVQP
FT                   RRPVPLAVASLTGLTMRDLRRAPSFQQIAPRLRQFVRNYPIVGQSPDYDLQMLSAHGLE
FT                   LRNPVYDTFRLATILLPDLPAYSLAGIAARLGISVAQQHRAMADVETTMAVFLGLCDLL
FT                   RAYDPETLRRLADYSAQAGLPEAEVFEAIYHELVTQGIGQLGDALAERVRSSVPGANHA
FT                   AELVFLLPSDRPPRLEPTGEAPVFDLDWIGRLYGPEGPFARSLPGYEFRAGQVRMAQAV
FT                   TNVLNQGGQLLVEAGTGTGKSLAYLLPAVLHAVARGETVVVSTDTLALQDQLFAKDLPL
FT                   LRRALEAAAEHDPRLADAARFRATVLKGRSNYLCLRRWFLRQREPFTSRAEALLAAKIT
FT                   AWLAQTETGDRAELHLSNEEQLAWAQVAESEGACLPSRCLFHRRNQCFLYRARATAEGA
FT                   HIVIVNHALLLSDLLAESRVLPSYRHLIIDEAHHLVDEATQQFGFQIAHEDMRELVRRV
FT                   LGLDHLGRYTGVLGELWSVLAQRPDGSARAVARELGQRLTDLWPRVETLHQHTEMLFHL
FT                   LAEVAQRHPVENGGYDRQIRITGALRQETIWGTVEELGQTVTSHLRTVLSALQWVSHRL
FT                   EDLPAAIRDELSELVTELDVLERRARELHGRLQEILFSPRVERVYWLTWRAQPLSVSLN
FT                   MAPLDVAPLLQEMLFSRVDTLVLTSATLTVDRSFDYIRQQLGLADADELVVESPFDYAS
FT                   STLLCLAEDMAEPGEPGYQRQVNEALLALLRVTRGRALVLFTSHSALQAAYRAIKRPLE
FT                   QEGILVLGQRLDGSPRQLVERLKARPATVVLGTNAVWEGVDVPGEALSVLVIAKLPFAV
FT                   PSDPVFAARCESYSDPFQEYAVPQAVLRFKQGFGRLIRSTRDYGVCVVLDRRVTTRRYG
FT                   QLFVQSLPPCTVKRVPVAQIPRLAQDWLVRQQDRLAARVPAEGGSGDGSAGS"
FT   gene            340718..341725
FT                   /gene="glpX"
FT                   /locus_tag="trd_0336"
FT   CDS_pept        340718..341725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glpX"
FT                   /locus_tag="trd_0336"
FT                   /product="fructose-1,6-bisphosphatase, class II"
FT                   /EC_number="3.1.3.11"
FT                   /note="identified by match to protein family HMM PF03320;
FT                   match to protein family HMM TIGR00330"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05080"
FT                   /db_xref="GOA:B9KXZ4"
FT                   /db_xref="InterPro:IPR004464"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ4"
FT                   /protein_id="ACM05080.1"
FT                   /translation="MDQLDRNLAMELVRTTEAAALAAAQWVGRGDKNAADAAAVQAMRR
FT                   MLSTVHMKGIVVIGEGEKDQAPMLYIGEEVGTGEPPESDLAVDPIDGTRLCANGMPGAV
FT                   SVVALAERGSMYYPPGIVYMNKIAVGPEAAHAIDIRLSPTENLHRIAEAKRMSVRLLTV
FT                   VVLDRPRHQALIEEIRRAGARIRLITDGDVAGAVMTAFPESGVDVLMGIGGSPEAVVAA
FT                   AALKCVGGAIQCTLYPRDEEERQRARELGLELEKVFTADDLVRSDNVFFAMTGITTGDL
FT                   VEGVRFTRHGAETHSIVMRSRTGTIRRIAAEHRLAKVQEYQTIAFDTDGRVMVE"
FT   gene            342050..343354
FT                   /gene="rho"
FT                   /locus_tag="trd_0337"
FT   CDS_pept        342050..343354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rho"
FT                   /locus_tag="trd_0337"
FT                   /product="transcription termination factor Rho"
FT                   /note="identified by match to protein family HMM PF00006;
FT                   match to protein family HMM PF07497; match to protein
FT                   family HMM PF07498; match to protein family HMM TIGR00767"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06000"
FT                   /db_xref="GOA:B9KXZ5"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004665"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="InterPro:IPR011113"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036269"
FT                   /db_xref="InterPro:IPR041703"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ5"
FT                   /protein_id="ACM06000.1"
FT                   /translation="MDPVAPTTTTVEEVKETPTLTAAELQDKSLEELQTIARDFGIPNA
FT                   QRLRKMELVNKILRAQIEREGGIFGEGVLEITEDGFGFLRGERYLPGPNDVYVSQSQIR
FT                   RFGLRQGDWVAGQVRPPKENEKYYSLLRVDAVNGMDPELARRRPSFDTLTPIFPMELIN
FT                   LETEPHILSTRLVNLVAPIGRGQRGLIVSPPKAGKTVLLKHIANGITTNYKDIHLIVLL
FT                   IGERPEEVTDMRRSVDGEVISSTFDEPVEDHIRVAEMTLERAKRLVECGMDVVILLDSI
FT                   TRLARAYNLSVPPSGRTLSGGIDPVALYPPKRFFGAARNIEGGGSLTIIATCLVDTGSR
FT                   MDDVIYEEFKGTGNMELHLDRKLAERRIFPAIDIQRSGTRREELLLDEQTLRQVWTMRR
FT                   MVSMLGGTDGTELVLGRLARTQNNAEFLATLHKDL"
FT   gene            343394..343816
FT                   /locus_tag="trd_0338"
FT   CDS_pept        343394..343816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0338"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04916"
FT                   /db_xref="GOA:B9KXZ6"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ6"
FT                   /protein_id="ACM04916.1"
FT                   /translation="MRSPEREWSDRDILMLVAVAATAVLWPIGLLLTWASVRWRLRDKL
FT                   IATILPLAGLILSLVILPAGARGIGLSGPSGLAWTVEVGHYAGLVGAPLLAALYLGIRA
FT                   RLPARLLGGLVLLALAILALGQLAFFLGGRLHPGGA"
FT   gene            complement(343822..344580)
FT                   /locus_tag="trd_0339"
FT   CDS_pept        complement(343822..344580)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0339"
FT                   /product="putative hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06221"
FT                   /db_xref="GOA:B9KXZ7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ7"
FT                   /protein_id="ACM06221.1"
FT                   /translation="MPFCDLSHVRLYYSRAGTGPPVILLHQYFGTSESWLAIFDTLRRS
FT                   FDVIAPDLRAHGRSSDPGGRLTLPGFTTDIAELVRRLGIESAHLVGASLGAMVATRLAV
FT                   EGAIHPRSLVLIGPPNFAAPSTAAYTRQIIEEQFPSNEAEYAHLHRAHGPHHARDRLLA
FT                   NFIRDSKEQPPEMREWQAGVESLTCPVLLMSGDNDPVAPAPWLVDIASRLPAGELCLLP
FT                   RAGHFPHRLLPHIAGLVLLDFLLRAERASS"
FT   gene            344668..344865
FT                   /locus_tag="trd_0340"
FT   CDS_pept        344668..344865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05147"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ8"
FT                   /protein_id="ACM05147.1"
FT                   /translation="MRDVSALRTILRRIDRRGYKAYEELRGFFRLGDIILAIDHVQGDP
FT                   YAPPSRVRVIVERSRLVFPP"
FT   gene            344889..346388
FT                   /locus_tag="trd_0342"
FT   CDS_pept        344889..346388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0342"
FT                   /product="predicted ABC-type ATPase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05488"
FT                   /db_xref="InterPro:IPR019195"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KXZ9"
FT                   /protein_id="ACM05488.1"
FT                   /translation="MEDFLARRARRAIDRVGRRRTGTGRSGIIQVDAGGQEVLERTACR
FT                   ISDDRVELRLSVGLPAAGRTVLGDVAEDLLTAALPEIARYALWLDRTALQEAERFIAVV
FT                   EDAEALREQLPRAGLVAFIGRGAILPRRSGVSQEPLTDGVVPFEPPPSLEVELATPHSG
FT                   RLRGMGIPEGVTLIVGGGFHGKSTLLEALARGVYNHIPGDGRERVVTRADAVVIRAEDG
FT                   RRVVGVDLSPFIRDLPLGRSTTCFTSEDASGSTSQASNILEALEAGARVLLMDEDTCAT
FT                   NFMIRDHLMRELVPAEAEPIVPFIDRVRQLHREAGVSTILVMGGAGDYLHVADTVIWMH
FT                   AYHPRDVTARAHELARQHGNGVFAPPNPWPGVVQRVPIPESIDPRRRERTRIKAHGTEE
FT                   VTFGYESIDLRHVEQLVDPSQVRAIGLALAYAVEHDIIDGKRALSAILDLVDEIVDREG
FT                   LDILSPYRGHPGDLARPRRYELAAALNRLRSLEVRQVRLAP"
FT   gene            complement(346339..347136)
FT                   /locus_tag="trd_0341"
FT   CDS_pept        complement(346339..347136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0341"
FT                   /product="conserved hypothetical protein TIGR00046"
FT                   /note="identified by match to protein family HMM PF04452;
FT                   match to protein family HMM TIGR00046"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04615"
FT                   /db_xref="GOA:B9KY00"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY00"
FT                   /protein_id="ACM04615.1"
FT                   /translation="MSRRGHRFFVTEHLELGARVTLPRRVSHQLVRVLRLRPGDRVLLC
FT                   DGRAIDFVAELIELDPERTVAVLVDAQPARPLPPPPIVLLQALLRHDHFDLVVEKATEL
FT                   GIVRIVPLHTQRTVVHLALRDVTQRLARWQRIAMEASEQCGRGTLPEIDTPSTLDRALA
FT                   TVRTARLLVFWEAPEAEAIAHASFSPDQTVTVAVGPEGGWTAEEIALFRRHGAEFRSLG
FT                   PLILRAETAAISGIAAVQARTRPTRPQFREPGEPAAPPGSSAG"
FT   gene            complement(347133..348053)
FT                   /gene="prmA"
FT                   /locus_tag="trd_0343"
FT   CDS_pept        complement(347133..348053)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prmA"
FT                   /locus_tag="trd_0343"
FT                   /product="ribosomal protein L11 methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="identified by match to protein family HMM PF05175;
FT                   match to protein family HMM PF06325; match to protein
FT                   family HMM PF08241; match to protein family HMM TIGR00406"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04704"
FT                   /db_xref="GOA:B9KY01"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY01"
FT                   /protein_id="ACM04704.1"
FT                   /translation="MPARWLEVAVETDAEVADAVAELFARFGYQQGAAVFHPVAQDPDG
FT                   ENATIDPATPVLIATYLPLDEQVDATVERLRHGLWHLSQLGRIGELRLRTLAEEEWAEA
FT                   WKSHFPVTRIGHRIVIRPSWIPYESRDDEIVVHLDPGMAFGTGLHPTTQHCLLWLERLV
FT                   TPGMSVLDAGAGSGILSIAALALGARSVTAWEIDPVAGEVLRENLERNGVADRATVRIG
FT                   DVTEDLTDREAYDLVVANIVARVLIEAGPRLVRAARPGAHLVLSGIIDTAEEGVRRRYH
FT                   DLGTELVERRQDGDWVSLLLRRNRP"
FT   gene            complement(348058..349050)
FT                   /locus_tag="trd_0344"
FT   CDS_pept        complement(348058..349050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0344"
FT                   /product="putative glucose-1-phosphate
FT                   thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06059"
FT                   /db_xref="GOA:B9KY02"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY02"
FT                   /protein_id="ACM06059.1"
FT                   /translation="MHVVIPVAGLGTRLRPHTWSKPKPLVTVAGKPILGHVLDRLNRLP
FT                   LQRVVFVTGYLGEQIEEYVRTHYRFDAVFVEQPEPLGQSHALLQAKGLVHGPTLVVFPD
FT                   LVFDANLEAVLTCPWDGIVFVKEVDDPRRFGVVIVEDGRIAQLVEKPAQPVSRLAVVGV
FT                   YYFRDFGDLIAAIEQQIAEGRKRGNEYYLAEAIQILIDRGRTIVAQPVSVWEDCGTVEA
FT                   LLETNRFLLDRQAGPQPSFPTAVVVPPVVIDPTARIEHAVIGPYVSIGPGAVVSHAIVT
FT                   DSIIDEEATINGVMLHRSIVGRRARVLGDFVRVNVGDSSEITFSGRDGA"
FT   gene            complement(349225..349301)
FT                   /locus_tag="trd_0345"
FT   tRNA            complement(349225..349301)
FT                   /locus_tag="trd_0345"
FT                   /product="tRNA-Glu"
FT   gene            349381..349992
FT                   /locus_tag="trd_0346"
FT   CDS_pept        349381..349992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0346"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04961"
FT                   /db_xref="GOA:B9KY03"
FT                   /db_xref="InterPro:IPR019206"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY03"
FT                   /protein_id="ACM04961.1"
FT                   /translation="MDHPHFAPTPTAVVRADRVEAVVNRSVAFWARHWLAGLNLLAGVF
FT                   AFLPLLAPWLLAQGHTTLAYGIYFAYRFVCHQKPERSFFLFGHQMAYCQRDLAIYLGVF
FT                   ALGMVYAVVRRWLRPLSWRGAFLLSMPMAIDGLTQLVGLRESTWQLRVFTGVSFALATV
FT                   WFVYPRLESGFAEVRAVLAARSLQIERGAEGTSCGQGAGE"
FT   gene            349970..351181
FT                   /gene="coaBC"
FT                   /locus_tag="trd_0347"
FT   CDS_pept        349970..351181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="coaBC"
FT                   /locus_tag="trd_0347"
FT                   /product="phosphopantothenoylcysteine
FT                   decarboxylase/phosphopantothenate--cysteine ligase"
FT                   /EC_number="4.1.1.36"
FT                   /EC_number="6.3.2.5"
FT                   /note="identified by match to protein family HMM PF02441;
FT                   match to protein family HMM PF04127; match to protein
FT                   family HMM TIGR00521"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06383"
FT                   /db_xref="GOA:B9KY04"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR005252"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY04"
FT                   /protein_id="ACM06383.1"
FT                   /translation="MARVLANKRVVVGVTGGIAAYKTVELVRRLIQGGAIVDVVMTEAA
FT                   TAFVGSLTFQAITRRPVQVTTVGVWEGEQAGHVTLGAAADVMIIAPATADALAKLAHGL
FT                   ADDAVTLTALACPAPLIVAPAMDQYMYLHPATQENLERLRRRGVTVIGPHRGPLASGMV
FT                   GEGRMAEPEELFGAVRAVLGRAGPLAGCRVVVTAGPTREAIDPVRFLSNHSSGKMGYAL
FT                   AEVARDRGAGTTLISGPTCLPAPFGVRFVAVESAAEMAAAVEEAISDADVLVMCAAVAD
FT                   FRPRQVSAEKIKKRTASLLLELEPTPDILASVARPGLLKVGFAAETERLLEHGHEKLVQ
FT                   KGIDLLVINDARRTMGAETARVTLLRRGREPEGLPDLPKEEVAERIWDAIQELLAERER
FT                   VAQG"
FT   gene            351178..351519
FT                   /locus_tag="trd_0348"
FT   CDS_pept        351178..351519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0348"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05482"
FT                   /db_xref="GOA:B9KY05"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY05"
FT                   /protein_id="ACM05482.1"
FT                   /translation="MSDRPPLRARRVRRRGTVAVQLANWIPVLISVYWSILLARWFVWV
FT                   LANAVGGQFTQLLVLHRWLAWPFTDLPGASRWPLLADIAAVVLSGVAALGLLGVAAGWW
FT                   REAERRRPS"
FT   gene            351648..351770
FT                   /locus_tag="trd_0349"
FT   CDS_pept        351648..351770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0349"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04606"
FT                   /db_xref="GOA:B9KY06"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY06"
FT                   /protein_id="ACM04606.1"
FT                   /translation="MVRNLVRGVLNLVLAAVATWLANYLVERLFGPEEAVSEHS"
FT   gene            351819..352988
FT                   /locus_tag="trd_0350"
FT   CDS_pept        351819..352988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0350"
FT                   /product="putative peptide chain release factor subunit 1"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05819"
FT                   /db_xref="GOA:B9KY07"
FT                   /db_xref="InterPro:IPR004403"
FT                   /db_xref="InterPro:IPR005142"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR041202"
FT                   /db_xref="InterPro:IPR042226"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY07"
FT                   /protein_id="ACM05819.1"
FT                   /translation="MEITRREVEGLGALRSDEWPIISLYLRVDKEHITDDHYSIRLKNL
FT                   LKELERAREQIGLNRAQSQAVDEDVERIRAFFRDHGDEFGQGVALFASSRAGLWRVYHV
FT                   PREVGNEADLDFRPVIGRLVRVVELFEPICTCVISRDRARIFRGHLVNFQEVAVRLDEE
FT                   VPGQHGQGGWSQARFARHIEDHVRQHFQRVGQVLFQLFEQDPFRFLVVAGPDEVVADFV
FT                   DGLHPYLRERYVGSFNCLMEATAKEIREETKRIVTAWQEQERQRYVDLVLEEALSQDMA
FT                   VVGLDRVVEVVQMQNVNSLVVDDQLSAPGRYCLRCGALQPIGSEASECVFCGGLTRMRE
FT                   NIVPEVYAEAYRQNANLVFLSERDLRARLEPFGGIGAILRYRIGAPATS"
FT   gene            352985..353893
FT                   /locus_tag="trd_0351"
FT   CDS_pept        352985..353893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0351"
FT                   /product="Diacylglycerol kinase catalytic domain (presumed)
FT                   protein"
FT                   /note="identified by match to protein family HMM PF00781"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04651"
FT                   /db_xref="GOA:B9KY08"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY08"
FT                   /protein_id="ACM04651.1"
FT                   /translation="MKAFPTLALIVNSGAGRVRPSSVARVREELARRFRVTVHVGSSPD
FT                   EVARLARQAAREAEVVVAFGGDGTASRVAAGVVGSDAVFSALPGGSTNHVARLLGFPAD
FT                   PVRAARLLAGPARFRFLDVGRVDAERILLFLGGTGIDGTIVRDAPPSAKRFFAWRTYLV
FT                   PGLRHLLDGPWPFTVEVDGIQHVVRARSVLLANGSFLVHPYFRLGPAIDPSDGLLDVLI
FT                   LHPPHLVGWLELFAWTALGRLWRSRYVASYRGRRVVVRAATPVPAEIDGDSWIGITELA
FT                   VTVEPRALRALVPAFVRGVGE"
FT   gene            complement(353916..354782)
FT                   /locus_tag="trd_0352"
FT   CDS_pept        complement(353916..354782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0352"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06062"
FT                   /db_xref="GOA:B9KY09"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR025194"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY09"
FT                   /protein_id="ACM06062.1"
FT                   /translation="MSEFGELLRNARAYRGVTLLDAERATRINRRYLAALEQEAFEQLP
FT                   PLTYARGIVRLYAQYLGLDPVTVLAKFEEAHGQRSMGFRVVPSVQPVREPLMHWAPNFA
FT                   VIVFMLALSAIVFALVYTTYLVPRETSPTPEASSVATSAEAVMPTVTGVVSAPAATATT
FT                   VPTAPPGTVPVNPAANATASPASAASTEAKPEHSPTPGTSGTPAPAGPATTEHTFEIVT
FT                   MGRVWVQVTVDGRTVLAEVLNEGDRRSFRGKTMTVSSGNAPLVRIIVDGQDRGPLGQRW
FT                   DATASYP"
FT   gene            complement(354793..355554)
FT                   /locus_tag="trd_0353"
FT   CDS_pept        complement(354793..355554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0353"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04938"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY10"
FT                   /protein_id="ACM04938.1"
FT                   /translation="MQRRCGTCRYFEEGGLAGSGWCRHPQRQGLQHVVFVRRGELACRT
FT                   NWDQDLWEPREAGNRPALSVIAGSWVERADSPSPALHPEATPVSPPSVSAASAGPVHHQ
FT                   RTRPASQSYRTNGQSGETEPFPTVEEHAAPEPTEPSHLIEPQLDDVQPAAHASLAALPR
FT                   ICRTCRDFRPVGDGRHGWCANRYAFPERTLVAAETLGCHSTLGSWWLPTDDWWLQEVDI
FT                   SHHGQPTPLVDELLRQLLSMRQQERRRRASS"
FT   gene            355758..357134
FT                   /gene="miaB"
FT                   /locus_tag="trd_0354"
FT   CDS_pept        355758..357134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="miaB"
FT                   /locus_tag="trd_0354"
FT                   /product="tRNA-i(6)A37 thiotransferase enzyme MiaB"
FT                   /note="identified by match to protein family HMM PF00919;
FT                   match to protein family HMM PF01938; match to protein
FT                   family HMM PF04055; match to protein family HMM TIGR00089;
FT                   match to protein family HMM TIGR01574"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06284"
FT                   /db_xref="GOA:B9KY11"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY11"
FT                   /protein_id="ACM06284.1"
FT                   /translation="MQLIQLQPAPASIVDAVPGVKRFHIWTIGCQMNEAESAKAAALLR
FT                   QAGYVPAVREWDADIVIVNTCVVRQQAEDKALGYIGALARLKRRRPDVRIAVTGCLVTG
FT                   QERRLAERFPWVDLWYGPSEFERLVSLVPELADVDIDLVELPHYYDEGQADPEVTAFVP
FT                   VIYGCNFVCSYCIVPYRRGRERSRPVEQVVAEVEKLAARGVREVTLLGQTVNAYGHDLP
FT                   GQPDLADLLERVHDVPGIERIRFLTSHPKYFSDKLIRAVADLPKVCEHVNLPVQSGDNE
FT                   VLRRMRRHYTVEEYRERIARIRELIPDVTLSTDIIVGFPGETEEQFLNTYRLLEEIRFD
FT                   KVHVAMYSPRPGTLSARWPDDVPREEKRRRHRAVEQLQERIARERNERYVGRTVEILVD
FT                   GLARGRWRGRTRGNTLVFFEAPGDWRGRFVEVRVTQASPWYLLGEPVTVGAAEPAILTR
FT                   "
FT   gene            357159..358052
FT                   /locus_tag="trd_0355"
FT   CDS_pept        357159..358052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0355"
FT                   /product="TPR domain protein"
FT                   /note="identified by match to protein family HMM PF00515;
FT                   match to protein family HMM PF07719"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04930"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY12"
FT                   /protein_id="ACM04930.1"
FT                   /translation="MSMLTNQGSHERRLLRRLTQAAKQAAFQGNWERAVQLNQRITELS
FT                   PRDVAAWNRLGHALAELGRVADARAAYQRVLEIEPGNAIAQRNVTRLEWLVSQTSDGTI
FT                   PVPVRRPAPRADVFMEEMGRTYVTDLLRPAAPAVLAQLFPGQEVFLDIRDDAVIVLDAD
FT                   GTRLGQLEGRLARRVARLTREGNQYRAFVIQLTGDTLRVILREVFRTPHLLDTPSFPPQ
FT                   PKIAPPRPYLPEAFGRGEEIIEEEEFFPEEEEAEALEVEEEELVESEEEITEEPLSAVD
FT                   EEALVVEFDIDETISE"
FT   gene            complement(358117..358383)
FT                   /locus_tag="trd_0356"
FT   CDS_pept        complement(358117..358383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0356"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06149"
FT                   /db_xref="GOA:B9KY13"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY13"
FT                   /protein_id="ACM06149.1"
FT                   /translation="MGRVNTTKARRKTSKRTARASAPVPAGSVSPSPDKPSGSRSATQP
FT                   QGIISPWGRVDEEYALIKADLTRLLWVTALLLGLLLLLAIVLR"
FT   gene            complement(358425..359237)
FT                   /locus_tag="trd_0357"
FT   CDS_pept        complement(358425..359237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0357"
FT                   /product="Protein of unknown function superfamily"
FT                   /note="identified by match to protein family HMM PF01887"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04990"
FT                   /db_xref="InterPro:IPR002747"
FT                   /db_xref="InterPro:IPR023227"
FT                   /db_xref="InterPro:IPR023228"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY14"
FT                   /protein_id="ACM04990.1"
FT                   /translation="MLTTWRPSGIVTFTSDYGVRDSYVAQVKGVILERAPTSTIIDVTH
FT                   EIAAQDILEGAFQLATAWRAFPVGTIHLAVVDPGVGSERRAVSILADGHAFVLPDNGLA
FT                   TFVLAEAHQVAAWSLDRSEWFRQPVAPTFHGRDIFGPICGLLASGMSLAEVGTPLDPAS
FT                   LVKLPIQPVIASGGSVVGPIVSIDRFGNCRTLIRREQLPDESETLCIRCGQLELLGIVR
FT                   TFADVAPGMPLAYFGSHGGLEIAVRDGNAAATWHLERGMLVEVRRAVK"
FT   gene            complement(359250..360881)
FT                   /gene="ggt"
FT                   /locus_tag="trd_0358"
FT   CDS_pept        complement(359250..360881)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="trd_0358"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06303"
FT                   /db_xref="GOA:B9KY15"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY15"
FT                   /protein_id="ACM06303.1"
FT                   /translation="MTARAIATFAERAGRPLLMGRCWAVSSGHSLASWAGARVLERGGS
FT                   AADAAVAVAAALNVVEPQMSGIGGDLFALVYEAGTSTVWAVNGTGPAPLDATPERFRDG
FT                   IPERGPLAASVPAAARAWDLLVQRWGRLPLSITLAPAIELARDGFPVSHNLATYIETYA
FT                   DVLASYPETARTFLPTGSPPCPGDVLRQPDLARTLETVAAEGVNALYEGDLAERLTRAV
FT                   LAAGGLLTRESLRLARATIVEPLQLAYRDWTICVPPPNSSAHTLLEMLGILQYFPLARW
FT                   RPLSPELLHVMIEAKKLAFLDRERFTGDPDFVGPFPPDVLAPERLQRLAAAIDLTRAKP
FT                   VLTTRPAREDHTTSFSVMDHEGNLVVVTASLNMAFGSAFIAGDTGILLNNRMTYWHLEP
FT                   KHPNQLQPGKRVRHTLSPVLLTRPGERLGLGTPGSDAQVQILVHVLVHWLEYGFDLQTA
FT                   IELPRWRHRGPGHESNWPHGSLDLVQVEGRLPNATIEGLQARGHRVERLARWGPIGSCQ
FT                   GIHWRDAERVVEAAADPRSDAYALAW"
FT   gene            complement(360878..361528)
FT                   /locus_tag="trd_0359"
FT   CDS_pept        complement(360878..361528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0359"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05246"
FT                   /db_xref="GOA:B9KY16"
FT                   /db_xref="InterPro:IPR013482"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY16"
FT                   /protein_id="ACM05246.1"
FT                   /translation="MEASIAVLAGGQSRRMGQDKALLDFCGEPLLARVLRRVRHLTDDL
FT                   FVVASDRPAYAQFGVPIVPDRLPGSGPLGGIYSALLAARHEYCLVLSCDLPFVSPDLLA
FT                   ALLAVPRDYDVLVPTRAERTGQGGMLTYETLHAVYSKRCLRAIERQLAAGNLKIVSFFA
FT                   EVRVVPVPESHLRTIDPELLSFANTNTPEAYRAALERAKGTEQCLESPVEGSA"
FT   gene            361887..362201
FT                   /locus_tag="trd_0360"
FT   CDS_pept        361887..362201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0360"
FT                   /product="SWIM zinc finger domain protein"
FT                   /note="identified by match to protein family HMM PF04434"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06356"
FT                   /db_xref="GOA:B9KY17"
FT                   /db_xref="InterPro:IPR007527"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY17"
FT                   /protein_id="ACM06356.1"
FT                   /translation="MFMVGQARRDGPEGGWIMNSSLIGKIEKARRYAAEPERVQVQSLH
FT                   VRFRGEHDVYDVHFADGSWSCTCHSFEALGLGTCSHIMALERLLGPIAPQAVGQAERVS
FT                   "
FT   gene            362492..363154
FT                   /locus_tag="trd_0361"
FT   CDS_pept        362492..363154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05292"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY18"
FT                   /protein_id="ACM05292.1"
FT                   /translation="MTFDVTWYAQSAFRIDVAGLRLYHDPFQIPDGEPTADVILISHEH
FT                   FDHCSPPDIARIRDVHKTFVVANPTAANTRELEPPVHVIRPGGEVQYGRLSIRAVPAYN
FT                   LNKFRSPGVPFHPREKEHVGFICRAEGVTWYFAGDTDAIPEMAQFGPVDYAFLPVSGTY
FT                   VMTAEEAAEAVRMLQPRVVIPMHYGTVVGSVEDARRLAALVGDVAEVRILEPRGRPS"
FT   gene            complement(363159..364061)
FT                   /locus_tag="trd_0362"
FT   CDS_pept        complement(363159..364061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0362"
FT                   /product="polysaccharide deacetylase family protein"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05662"
FT                   /db_xref="GOA:B9KY19"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY19"
FT                   /protein_id="ACM05662.1"
FT                   /translation="MTRDLPSEPSDERPPYSITGSLHLVGNLRGIVGNPPESLFTDSAH
FT                   HSLHFFQDSTRPTRDSTPVADTSQPKPYRKPVPILMYHYIRPRPGPDDPIGRALSVEPA
FT                   EFAAQIHWLSTHGYTPITLSELEAIRRGDQPAPAKPIVLTFDDGYRDFYEHAWPILRQY
FT                   NFHATIFVITGLLDSPRYLTWEMVRELDRSGAIEIGAHTVHHVDLTQVSDAQLRAELTE
FT                   CATALREALGHPVLSFAYPAGKIDQRVKAATAAAGYRMAVTTQPGRAGADDDPLALPRL
FT                   RVSGEMTLEQFAALLTVSS"
FT   gene            364325..365935
FT                   /locus_tag="trd_0363"
FT   CDS_pept        364325..365935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0363"
FT                   /product="probable acetolactate synthase large subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04855"
FT                   /db_xref="GOA:B9KY20"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY20"
FT                   /protein_id="ACM04855.1"
FT                   /translation="MRVTGGEAVVRTLERLGVEVVFGIPGVHTLAIYDALYSSPIRHVL
FT                   ARHEQGAGFMADGYARVSGKPGVAIVITGPGVTNIATAIGEAYADSSPVVVIASNVEQA
FT                   WQGQMLGHLHDCKDQLGIMRVVTKWADRARSVEDVPRLLRTAFAEAISGRRRPTHLEVP
FT                   LDVLHGSGDIELAHLAPLSMERSQPRRSAIELAARMIEEAERVVLYCGGGVVASGATAE
FT                   LSALAERLGAAVITSLQGKGAIPEDHPRCLGNLWEPENAVERVLRESDLVIVIGSKLGA
FT                   QDTANGRLPLPDRRIRIDIDAQEILRNYPPTLPIVADARETVRALLSELTSRGITKQGW
FT                   PVDVLQATKREALATAWGAGQAEWLRAIRAVLPRDGILVSDMTMMAYVGNRHYPVYEPG
FT                   TYLFPTGYGTLGFALPAAIGAKIARPEAAVVALVGDGGYQFTMQELATAVQFRIGIPII
FT                   LFNDASYTAVKDEQARSFGGRFIAVDLVNPDFQKLAAAYGIPSEYVTSPQTLEGAIARA
FT                   LERDLPTLIEVPIDFPLGA"
FT   gene            366056..366169
FT                   /locus_tag="trd_0364"
FT   CDS_pept        366056..366169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0364"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05877"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY21"
FT                   /protein_id="ACM05877.1"
FT                   /translation="MVCPASLTLAILSIIIAIIRPRVAGHAALGRSVAGQA"
FT   gene            366185..367873
FT                   /locus_tag="trd_0365"
FT   CDS_pept        366185..367873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0365"
FT                   /product="2-isopropylmalate synthase/homocitrate synthase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF00682;
FT                   match to protein family HMM PF08502; match to protein
FT                   family HMM TIGR00977"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05033"
FT                   /db_xref="GOA:B9KY22"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005675"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY22"
FT                   /protein_id="ACM05033.1"
FT                   /translation="MTMRRPPRRGEAAERFREGRRERMSENGERRVVIYDTTLRDGTQG
FT                   SGVSLTTEDKLKIARALDELGVAYIEGGWPGSNPKDMAFFERARHQQWRHARITAFGST
FT                   RRAGGTVEEDVNLRLLLEAETPAVTIVGKASPFQVRVILGTTLDENLRMVAESVAFLKA
FT                   AGREVIFDAEHFFDGYAEDPDYALAVLRAACDAGADAVVLCDTNGGTLTDPLVRAVRHA
FT                   LSSVSCTVGIHTHNDCELAVANTIAAVLAGAMHVQGTMNGLGERIGNANLCSIIPILEY
FT                   KLGYRCLPPGNLRKLTETSRYVAEVANLAHDPRLPFVGAFAFTHKAGLHVNAIAKHPSA
FT                   YEHIPPEVVGNTRHVLVSELSGRSNIVVKARSFGIELGDKPEVVRRVLEQIKELEFHGY
FT                   WFEDADASLELLIRRNLPDYRPPFEVLDYTVLTEYRNGRGMLAEAMVKLRIGQHVFHTA
FT                   AEGNGPVNALDRATRKALQEFYPEIAAVDLEDYKVRVLDDHHGTGAKVRVWIRSGDAHG
FT                   SWNTVGSSENIIEASWLALADSLAYPLVTRPELAARIPELVSAVS"
FT   gene            complement(367919..368971)
FT                   /gene="asd"
FT                   /locus_tag="trd_0366"
FT   CDS_pept        complement(367919..368971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="asd"
FT                   /locus_tag="trd_0366"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="identified by match to protein family HMM PF01118;
FT                   match to protein family HMM PF02774; match to protein
FT                   family HMM TIGR00978"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06345"
FT                   /db_xref="GOA:B9KY23"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005676"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY23"
FT                   /protein_id="ACM06345.1"
FT                   /translation="MSDRIDVAILAATGSVGQRFVQLLAGHPWFRIAELVASDRSAGKR
FT                   YAEAVNWRISAAPPEEVRDLVVKHIEEPINSPIVFSALPGGVAGPIEEALAAEGKKVFT
FT                   NARDHRMDPDVPLLIPEVNPDHARAIERQRQLRGWREGFIVANPNCSTIHLVLALKPIH
FT                   DAFGIERGIVTTLQASSGAGYPGVPSLDLIDNVIPYIGGEEEKIEAESRKILGRWIDGT
FT                   FEDAPIVLSAHCNRVPVRDGHLETVSLDLHRSATPAEVIDVLRAFRALPQELELPSAPR
FT                   HPVIVLEEPDRPQPVLDRDAERGMASVVGRVRPCSVFDIRFVVLGHNTIRGAAGASVLN
FT                   AELFYREGLL"
FT   gene            369259..370257
FT                   /locus_tag="trd_0367"
FT   CDS_pept        369259..370257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0367"
FT                   /product="homoserine dehydrogenase"
FT                   /EC_number="1.1.1.3"
FT                   /note="identified by match to protein family HMM PF00742;
FT                   match to protein family HMM PF03447"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05552"
FT                   /db_xref="GOA:B9KY24"
FT                   /db_xref="InterPro:IPR001342"
FT                   /db_xref="InterPro:IPR005106"
FT                   /db_xref="InterPro:IPR019811"
FT                   /db_xref="InterPro:IPR022697"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY24"
FT                   /protein_id="ACM05552.1"
FT                   /translation="METVGIALLGVGTIGSAVLRMIREERERIAERTGLFLDVRWGLAR
FT                   HRERVVQAGLSERAATTSIEPILADPSVQVVVEVLGGEEPAAAYMKRALEAGKHVVTAN
FT                   KEALSKHFAELVAAAREHQRALLFEASVGAGIPLMVSLRQLLTTNRLHRIRGIVNGTTN
FT                   FILTLMAEEGVPYQEALRQAQELGYAEPDPTADVEGYDAAYKLSILASLAAGRHIRPEV
FT                   VERRGITTVTPDQILDARTRGGAMKLLAEAELADETWRLRVRPVFVPASDLLAHVRLNL
FT                   NAIELTGDRVGTIVLYGPGAGPSPTASAVIADVLDAVRFGPALLPNLEPAT"
FT   gene            complement(370374..371618)
FT                   /gene="metX"
FT                   /locus_tag="trd_0368"
FT   CDS_pept        complement(370374..371618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metX"
FT                   /locus_tag="trd_0368"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="identified by match to protein family HMM PF00561;
FT                   match to protein family HMM TIGR01392"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06099"
FT                   /db_xref="GOA:B9KY25"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY25"
FT                   /protein_id="ACM06099.1"
FT                   /translation="MRRRKPLHHVVGGLPFSPSTQVDEVVTGASGAGRFHDVPEGGIPV
FT                   TSTLPVTYQIARIATPEQPFVTEHGDVLPVVDIAYETWGTLSPTGDNVVLICHALTGSS
FT                   HVAPHGPGDQPGWWDPMVGPGRFIDTDRYFVICANVLGSCYGSTGPRSIDPRTSRRYNL
FT                   RFPLITVRDIVRSQAMLLDQLGIERVYAVIGGSLGGMQVLEWAAMYSDRVERIVPIAAG
FT                   ASFSDQGIAYNEVQRRVIMLDPAWQNGEYEDGEGPRYGLAIARMLGMITYQSDELMSAR
FT                   FQRRTGARYTEWPEFLGRYDVEGYLHYQGDKLVRRFDANSYLYLTRAMDSHDLGRGRGG
FT                   YHAGLSRIRARTLAIGIRSDILFWPNQVRSLAEDLRALGVDARYWELDSPNGHDAFLKD
FT                   FDQIGPVIAAFLAEP"
FT   gene            complement(371849..372949)
FT                   /locus_tag="trd_0369"
FT   CDS_pept        complement(371849..372949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0369"
FT                   /product="putative AttH"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05253"
FT                   /db_xref="InterPro:IPR010791"
FT                   /db_xref="InterPro:IPR023374"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY26"
FT                   /protein_id="ACM05253.1"
FT                   /translation="MRRRAFLGTLALGLLACRSSNGPQSQEPMGPTPSASPRPASLFLT
FT                   PPPAPGPVVFPRDFGSHDVLTEWWYDTGHLRSAAGERFGFEFVIFQVQRFGYPVVYAAH
FT                   AALTLVDRQAFLWDERLIAVPQRQESWPLALAVGDWTLTSDGESDRITVRSGSFGFTLE
FT                   LQNLRPPLLHDEDGYFSWAPETGSYYYSRTRLATRGVVSVGGHDVSVSGVAWNDHQWGN
FT                   FLLGGGGWDWFAIQLEDGTDLMLWQSRDAAQRVIQRSGTLLRADGSIRWLHDAEIGLHA
FT                   TGSWQSPHSGAIYPSGWQIELPPDMTLTVTPLVLDQELQTVRSTGVIYWEGAVSVIAAQ
FT                   AGVKTIGQGYVELTGYATPSVPVTPP"
FT   gene            complement(372950..375160)
FT                   /locus_tag="trd_0370"
FT   CDS_pept        complement(372950..375160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0370"
FT                   /product="putative membrane protein mmpL3"
FT                   /note="identified by match to protein family HMM PF03176"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04900"
FT                   /db_xref="GOA:B9KY27"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY27"
FT                   /protein_id="ACM04900.1"
FT                   /translation="MVFERIGRFSFRYRWFVLALWLVVVLAVLPTLPRATGRLEVGGFS
FT                   SPHTEAARTRELLRERIPGYSPSSLLVLFSHPTLSPSDPAFVEQAQRALSAVPSIPHVT
FT                   GIRWFTENPSQIAPDGSLAYAVIELDLQPEEAQRVLDEIQEAIIRTDLQVQLAGAPAFY
FT                   ADLERVTERDLRRAELIAFPFALAALLFVFGSAVAAAVPLFIGGVTVALVLGIVYGLTH
FT                   LTELSIFTLNVASLLGLGLSIDYSLFLVSRFREELASHDLADAVARTTATAGRAVFFSG
FT                   LTVLIGLSGLGFFEFLFMRSVGIAGMLVVLVAVSASLTLLPAVLGILGRRIDALRVIRR
FT                   DTETGRFWHWITEFVMQRPWQVALPVVALLVLLGLPFRHVELSSPDATILPTSTPSRQA
FT                   LETFRRAFGDGELSPIVIAVETERPVNDPQTLAALYDFTRRLAADPRVTKVTSIVTIDP
FT                   RISLAQYQLLYADPERIPEPLLQRVYRELAGDHLTAIYVYTDALPASDRAKALLHDIRA
FT                   MDPGPGLKLWVDGGTAEIVDVVDRMYSEFPLAASTVILATYIVLFLLLRSVFLPLKAII
FT                   LNVLSLTASYGALVFVFQEGHFSSLLRFSPLGFTEASLPIVMFCILFGVSMDYEVFLLS
FT                   RMRESWDQTQDNRLAVATGLARSGRIITGAALILVVVAAAFVTADVVLIKALGLGIALA
FT                   IALDASIVRTLLVPATMRLLGQWNWWVPRRLARTLDTVRIGH"
FT   gene            complement(375234..376826)
FT                   /locus_tag="trd_0371"
FT   CDS_pept        complement(375234..376826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0371"
FT                   /product="trehalose-6-phosphate synthase"
FT                   /note="identified by match to protein family HMM PF00982"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05986"
FT                   /db_xref="GOA:B9KY28"
FT                   /db_xref="InterPro:IPR001830"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY28"
FT                   /protein_id="ACM05986.1"
FT                   /translation="MAHQRAGQHRDGQLDVQLPDYARELLERSTLIIVSNRGPVEFHQT
FT                   NDGEIATKRGTGGVITAMSAAARFADAIWVACAMTPTDRVIAEEMRQRREALLTIPDLP
FT                   GFRLRFVVPDTEAYRGYYNRIANPLLWFLQHYLWDTPRAPDIDHETWQAWHEGYVAVNR
FT                   LFAEEVVAAAAAAPRDPIVLLQDYHLYLAPTFIRELRPDLLLHHFVHIPWPDQDYWRLL
FT                   PLPMRRAICEGLLANDIVGFQTPRHARSFLNTVDANLPEAEVDYRRREVTYRGHTTRVR
FT                   VYPISIDPELVRAVAESEDARRHREHLEAFRNEYTIIRVDRAEPSKNVVRGFLAYDRLL
FT                   EKHPELIGRVNFLAFLVPTRMEVAEYINYLDEINAVVGRINAKYANAAEIEGIHWEPVH
FT                   LFVGDDYPRALAAMKFYDVLLVNAIFDGMNLVAKEGALLNERNGVLILSEGAGAYQQLG
FT                   QWALTVSPTDIEGTAEALWQGLIMPAAERAWRAEQLRRHVVEHDLRRWLVDQLHDIADL
FT                   RAERAPHRLIAPS"
FT   gene            376818..376940
FT                   /locus_tag="trd_0372"
FT   CDS_pept        376818..376940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0372"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04680"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY29"
FT                   /protein_id="ACM04680.1"
FT                   /translation="MCHRCPPLWSSQLWSVAKSWRCRSWTDRRSDRSTATHAGR"
FT   gene            complement(377108..377581)
FT                   /locus_tag="trd_0373"
FT   CDS_pept        complement(377108..377581)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0373"
FT                   /product="halocyanin precursor-like protein"
FT                   /note="identified by match to protein family HMM PF00127;
FT                   match to protein family HMM TIGR01409"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05689"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR028096"
FT                   /db_xref="InterPro:IPR028871"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY30"
FT                   /protein_id="ACM05689.1"
FT                   /translation="MQELLERLLRSEEARIMRRDATERLTRRGFMRRAGAVAIAVPAVS
FT                   ALLAACGGGGGGGGTSGGGGGKLTIEMGEYYYKPATITVSPGASVTVTLKNAGTLQHDF
FT                   HCDQINPTTSSLVDPGKSLDFTFTAPSQAGTYDFWCTVPGHKELGMVGKLEVK"
FT   gene            complement(377712..378350)
FT                   /locus_tag="trd_0374"
FT   CDS_pept        complement(377712..378350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0374"
FT                   /product="polysaccharide deacetylase"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05392"
FT                   /db_xref="GOA:B9KY31"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY31"
FT                   /protein_id="ACM05392.1"
FT                   /translation="MQSVARVITRLETTQAVIALTFDCGADRGYAEEILDELARHGIRA
FT                   TFGMTGAWARANPDLVARMLREGHRLINHSDTHPSFTGRSTGSPPLSVDQRAAEIRRAE
FT                   QAVAAVSGSETTMRPYFRPPYGDYDEALLTLLPELGYSVVVMWTVDSLGWRGIPPEEVV
FT                   TRVLAAAQPGAIVLLHVGAQSTDAAALPQLIAALQERGYGFVTTDAQLG"
FT   gene            378367..378576
FT                   /locus_tag="trd_0375"
FT   CDS_pept        378367..378576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0375"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05921"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY32"
FT                   /protein_id="ACM05921.1"
FT                   /translation="MGDDSDGEVGVVSGVGSMGGVGGGGVGFGVGNGVGRGNGTGEAIG
FT                   VVAAVGADSVGDGVAVPVGSVTVG"
FT   gene            complement(378659..379072)
FT                   /locus_tag="trd_0376"
FT   CDS_pept        complement(378659..379072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0376"
FT                   /product="Domain of unknown function domain protein"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04983"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY33"
FT                   /protein_id="ACM04983.1"
FT                   /translation="MIGTKGRDPMQKRSDDLARRLFGDSTTEGGEMAKFTEDDVRERLK
FT                   QVIDPELGVDVVNLGLIYGIDLIDREDGKTDVLITMTLTTFGCPLGPILTEEVNYALRD
FT                   LPDLGNVEVNLVWSPPWTPDMMSEEAKDALGIW"
FT   gene            complement(379069..379449)
FT                   /locus_tag="trd_0377"
FT   CDS_pept        complement(379069..379449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0377"
FT                   /product="SUF system FeS assembly protein, NifU family"
FT                   /note="identified by match to protein family HMM PF01592;
FT                   match to protein family HMM TIGR01994"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04838"
FT                   /db_xref="GOA:B9KY34"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY34"
FT                   /protein_id="ACM04838.1"
FT                   /translation="MAELYREHILDHYQHPRNYGTLERPDRTFEDSNPLCGDRIRIDLK
FT                   LENDRIADIRFTGRGCAISQAAASILTEMVKGKTLEEVKQLGAQDLLEELGVPISPARR
FT                   KCALLSLKVLKAAAYGLNEWPT"
FT   gene            complement(379472..380731)
FT                   /locus_tag="trd_0378"
FT   CDS_pept        complement(379472..380731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0378"
FT                   /product="cysteine desulfurase"
FT                   /note="identified by match to protein family HMM PF00266;
FT                   match to protein family HMM PF01212; match to protein
FT                   family HMM TIGR01979"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05280"
FT                   /db_xref="GOA:B9KY35"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR010970"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY35"
FT                   /protein_id="ACM05280.1"
FT                   /translation="MTSFTGTQPLDVERIRGDFPIFQRTVRGGRPLVYLDSAATSQKPA
FT                   SVIEALAGFYRTSNANIHRGIYELSEEASVLYEEARAKVARFIGASRAQEVVFVRNTTE
FT                   AINLVARTWGTTALQPGDVVVTTILEHHSNIVPWHQLAVERGIIVRFVDIDEHGRLRLD
FT                   QLEELLDAYPVKLVAVTHVSNALGTINPIPEIVRLAHRTGALVLVDGAQSVPHLPVNVR
FT                   ELGADFLAFSGHKMLAPFGIGVLWARYDLLTSLPPFLGGGGMIRTVTTDGFSPGDVPAR
FT                   FEAGTPSVADAVALGAAIDYLESIGMAAIRQHERALLAYALPRLEEIPGIRLYGPVGDD
FT                   RSGVISFTIGDVHPHDVAAVLDQHGIAVRAGHHCTQPLMRRLGVVATTRASFYLYNAED
FT                   DVDRLIEALREVRRVFGVAG"
FT   gene            complement(380728..382065)
FT                   /gene="sufD"
FT                   /locus_tag="trd_0379"
FT   CDS_pept        complement(380728..382065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufD"
FT                   /locus_tag="trd_0379"
FT                   /product="FeS assembly protein SufD"
FT                   /note="identified by match to protein family HMM PF01458;
FT                   match to protein family HMM TIGR01981"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06080"
FT                   /db_xref="GOA:B9KY36"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR011542"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY36"
FT                   /protein_id="ACM06080.1"
FT                   /translation="MSTRVAERTRGFTREAVEELSHLLDEPAWLRERRLAAWEIYERTP
FT                   MPSRTDEEWRRTDIRRLPIDQVVPFAGVGQRVSGPDVLPSALFEILGDAALRSGLLVQV
FT                   DSSVVFTQLDPQLAAEGVVFTDLLTAARDMPELLQRVFMTEAVKPEDNKFAALHGAFWS
FT                   GGTFLYVPEGVEVALPLRSFVWAETPGSAIFAHTLLVAEPGASVVLIDTWASPTVEEPL
FT                   IASNVVEIITGEGAQVRYIQLQDWGRSVWNFTTQRALLRQDVTVNTLNVSLGSRLSKAF
FT                   IASNLVGPGATAEMLGLYFADDAQHLDHQTRQWHVAPYASSDLLYKGALKDRARTVFSG
FT                   LIKVFPQAQRTDAYQANRNLILSPTARADTIPNLEIGANDVRCTHGATVGQVEEEYIFY
FT                   LMSRGISRPEAVKLIVDGFFDEVIERVPVTEVQETVRAAIARKIGL"
FT   gene            complement(382121..383536)
FT                   /gene="sufB"
FT                   /locus_tag="trd_0380"
FT   CDS_pept        complement(382121..383536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufB"
FT                   /locus_tag="trd_0380"
FT                   /product="FeS assembly protein SufB"
FT                   /note="identified by match to protein family HMM PF01458;
FT                   match to protein family HMM TIGR01980"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04549"
FT                   /db_xref="GOA:B9KY37"
FT                   /db_xref="InterPro:IPR000825"
FT                   /db_xref="InterPro:IPR010231"
FT                   /db_xref="InterPro:IPR037284"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY37"
FT                   /protein_id="ACM04549.1"
FT                   /translation="MTTPEVELKRLGSEYAEKYGFRDPEQYVFKARKGLDREVVEQISW
FT                   IKNEPEWMREFRLKALEYFLRRPMPTWGADLSELNFDEIVYYIKPTERQGTSWEELPEH
FT                   IRRTFDRLGIPEAERRFLAGVGAQYESEVVYHSLREELKRLGVIFCDMDTAVREYPDLV
FT                   KQYFGTIVPPNDNKFAALNSAVWSGGSFVYVPEGVRVDVPLQAYFRINAENVGQFERTL
FT                   IIVEPGAYVHYVEGCTAPIYSAASLHSAVVEIIVKEGARCRYTTIQNWSKNVYNLVTKR
FT                   AAAYRDATMEWVDGNLGSKVTMKYPAVWLMEPGARGEVLSVAFAGDGQHQDAGGKMVHV
FT                   APYTSSQIISKSISKGTGRASYRGLVKVHRGAHHVRANVVCDALLLDEQSRTDTYPYME
FT                   IEEEQVSIGHEATVSKVAEEQLFYLQSRGLTEAEAMSMIVNGFIEPITKELPLEYAVEL
FT                   NRLIALEMEGSVG"
FT   gene            complement(383566..384393)
FT                   /gene="sufC"
FT                   /locus_tag="trd_0381"
FT   CDS_pept        complement(383566..384393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sufC"
FT                   /locus_tag="trd_0381"
FT                   /product="FeS assembly ATPase SufC"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01978"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06387"
FT                   /db_xref="GOA:B9KY38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010230"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY38"
FT                   /protein_id="ACM06387.1"
FT                   /translation="MTDGVDGTKEGRNSMTEHTPLFVIENLRAGIEGKEILRGVNLVIE
FT                   RGEIHALMGPNGSGKSTLAYVIAGHPNYEVYEGRILYKGENVLELPPDERARMGMFLAF
FT                   QYPTAIPGVTMANFLRLAVNSVRKARLGEDKALSPREFRRLLREKLEMLRMDESFASRY
FT                   LNEGFSGGEKKRAEILQMAMLEPEFAVLDETDSGLDIDALRTVSEGVNRLFNPNMALLV
FT                   ITHYQRILNYIRPHYVHVMLDGKIAVSGGPELAEELEEKGYDWVKEQFAEAAS"
FT   gene            complement(384466..384897)
FT                   /locus_tag="trd_0382"
FT   CDS_pept        complement(384466..384897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0382"
FT                   /product="transcriptional regulator, Fur family"
FT                   /note="identified by match to protein family HMM PF01475"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04482"
FT                   /db_xref="GOA:B9KY39"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY39"
FT                   /protein_id="ACM04482.1"
FT                   /translation="MIPAGFRMTPQRMAILAEVQNAERHLTAAEIYERVRRKYPTIAYG
FT                   TVYRTLHLLAKHGLIQEFPFGDNASRFDRRTDRHDHVHCVVCGELVDVEVPTALLARQV
FT                   AAEKTGFEILDHQTVFAGICPSCQEKRDRTVQEARAGRR"
FT   gene            385014..385484
FT                   /locus_tag="trd_0384"
FT   CDS_pept        385014..385484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0384"
FT                   /product="NifU family protein"
FT                   /note="identified by match to protein family HMM PF01592"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05779"
FT                   /db_xref="GOA:B9KY40"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY40"
FT                   /protein_id="ACM05779.1"
FT                   /translation="MEQIVEHYRRPRHRHALPDADVVMPGGNPGCGDIVTIYLKVDEQG
FT                   HLIAEASFEGEGCTISQAAADILLDVVNEERWTLEQVLEADYHLMEELIGEEAVKLRPR
FT                   CATLALGTLKAAVTKYLRDQLRREAGLEVVERENERFGIVTGELPSAEASHS"
FT   gene            complement(385481..385852)
FT                   /locus_tag="trd_0383"
FT   CDS_pept        complement(385481..385852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0383"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05666"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY41"
FT                   /protein_id="ACM05666.1"
FT                   /translation="MDEKQRDDAETATAREQLTVEMTRTTFQRRVATRASPDAVLERAI
FT                   AYFTARGYRAGRTGRPNQVYVIGKREGVLPRVTAEILVQPNVGRGRATLVTVSGFGPQL
FT                   REHLAAFVEELRRERRSTN"
FT   gene            complement(385915..386487)
FT                   /locus_tag="trd_0385"
FT   CDS_pept        complement(385915..386487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0385"
FT                   /product="putative DNA polymerase III, epsilon chain (EC )"
FT                   /EC_number="2.7.7.7"
FT                   /note="identified by match to protein family HMM PF00929"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05484"
FT                   /db_xref="GOA:B9KY42"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY42"
FT                   /protein_id="ACM05484.1"
FT                   /translation="MDRRRCAQAWARAICSSSGVVILDTETTGIRSQDQVIELAVLDTH
FT                   GNVLLETLVKPSCPIDPAALRVHGLSEAHLAHAPEWPVVYRELRVIFDRARLIVTYNAP
FT                   FDRRLIEQTCRCYGLSLPDLSWDCAMRRFAEYAGPPPTESWRNYHRLSEALQRLGIPHP
FT                   GAHRAAADAEACRRLVRAMAAGQPLRF"
FT   gene            complement(386502..387188)
FT                   /locus_tag="trd_0386"
FT   CDS_pept        complement(386502..387188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0386"
FT                   /product="metallo-beta-lactamase domain protein"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05549"
FT                   /db_xref="GOA:B9KY43"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR022877"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY43"
FT                   /protein_id="ACM05549.1"
FT                   /translation="MAVTVRYLGHAAFAVEAEGKQVVIDPFLTGNPRAAAKPDELHPVA
FT                   ILLTHAHADHVGDALALSKRTKAPVIATFELASFLQQQGAEAIPANHGGTVRFDGGTVK
FT                   LVPAWHTSSYGEQFLAPGVPAGLVVRMGGKTLYFAGDTCLFGDMALIGEEGLDLAALPI
FT                   GDHFTMGPADAVKAVKLLAPKVVVPCHYNTFPLIEQDPHAFAKAVEEQTSARCVVLQPG
FT                   EQLVLE"
FT   gene            complement(387231..388841)
FT                   /locus_tag="trd_0387"
FT   CDS_pept        complement(387231..388841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0387"
FT                   /product="Amidohydrolase family"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04956"
FT                   /db_xref="GOA:B9KY44"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY44"
FT                   /protein_id="ACM04956.1"
FT                   /translation="MVCDLILHNANILTLDPAQPRARAVAMSHGRILAIGDDPEILGYR
FT                   TAQTRVLDLGGATVLPGFDDAHCHPLGLGLSLEWVDVSPVAAPTLERLLDEIRKAAQEL
FT                   PPDRWLLARGYDDTRLDVQRHPTRWELDRVTGNRPTIVIRTCGHMLVANSAALARAGIT
FT                   RETPDPEGGRIVRDETGEPTGLLQERAQELVRRLVPEPTVRDLEQALRRAGDRFLALGI
FT                   TSVTEAGISRPEELLAYQNLHQRGELPVRARIMLLIDHLLEPAERLGLRSGFGDAWLRI
FT                   GPFKLFQDGAGGARTAAMSIAYPEEPDNYGLAYYTQDQLDEAFRRVARLGAQAAAHAIG
FT                   DRAIEMVLTAYERALQAHPIHDHRWRIEHCGMLRPDLLERMARLGVVAVPQPAFGYYLG
FT                   DAYRRNFSEEWLALAYPTRAWLERGIAVAFSSDAPVISPDPWVGIRAAVLRQTLTGEPF
FT                   GPEQRVTVLEAIRLYTAGGAYASFEEHQRGRITPGFLADLLVVDRDPLAIDPEELPTLR
FT                   TLLTVVDGRIAWKAADAVF"
FT   gene            complement(388866..390470)
FT                   /locus_tag="trd_0388"
FT   CDS_pept        complement(388866..390470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0388"
FT                   /product="Amidohydrolase family"
FT                   /note="identified by match to protein family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05783"
FT                   /db_xref="GOA:B9KY45"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="InterPro:IPR033932"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY45"
FT                   /protein_id="ACM05783.1"
FT                   /translation="MHADIVLVNGTVLTASSHTPVAEAIALRGEWILAVGAERVVHHFV
FT                   GPATEVIDLQGRTVTPGFNDAHCHPIALGMSLREVDARTPPNRSIEEIVQRIAQRAASQ
FT                   EPGTWIVARGYDQAHLAEGRHPTRDDLDRATQRHPVLLIRACGHIGVANSLALAIAGIG
FT                   PETPDPPGGTIDRGPDGQPTGVVREAALQLVRARLPQPSVEDLAEAIRLAGETFLSFGV
FT                   TSVQEAGIRRAEEFLAYQSLAQRGTLPVRTSLMILINDLLEPCRELGLRTGFGDAWLRI
FT                   GPAKLFLDGSIGGRTARMSQPYLDRDTLGLWMDEPDTMKRKIVEAHCAGFQCCAHAIGD
FT                   AAIELLLDAFEEALRRQPRPDHRHRIEHCSILRPDLVDRIARLGAVPIPGTTFLYDFQE
FT                   VYLSGLGHERLRYAYALRTFLDRGIVAAASSDTPVCSPNAMLGIQTMVTRRNAAGNVLW
FT                   PEESITLEEAIRVYTLNGAYASFEERIKGTLEPGKLADVVVLETDLRSVQPEELGRVRV
FT                   DYTIVGGRIVYARPGAA"
FT   gene            390465..390638
FT                   /locus_tag="trd_0389"
FT   CDS_pept        390465..390638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0389"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05193"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY46"
FT                   /protein_id="ACM05193.1"
FT                   /translation="MHRLSPSSRQMQTSTGNESKLWLASVLRSWYRAGTGHAPERIRVI
FT                   RGCRNDFFQHFA"
FT   gene            complement(390688..391527)
FT                   /locus_tag="trd_0390"
FT   CDS_pept        complement(390688..391527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0390"
FT                   /product="putative saccharide deacetylase, slightly"
FT                   /EC_number="3.5.1.-"
FT                   /note="identified by match to protein family HMM PF01522"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05166"
FT                   /db_xref="GOA:B9KY47"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY47"
FT                   /protein_id="ACM05166.1"
FT                   /translation="MNERTPPTWPAGHRAALVVSIDVDGEYGVIAQHGASDWYWRTQAQ
FT                   YDLDAGLIRLLELLADYDIRATFCWVGRVAEERPDAVRSVSAAGHEIATHGWDHQIYTR
FT                   MTREEQREDLIRTREYLATLTGTVPVGHKSPFWHSTPDTVPLLQELGFQWNMDVALGDL
FT                   PVVQRPDPTREPIIQLPPSRWWDDYTFFIEQALPPRLVAEFWEEDFAVVRAEGKLMCLT
FT                   VHPWITGRPGPSRALARFLDFVVTLGDVWIARADHVALWWRERERDLDQSATSSTES"
FT   gene            complement(391527..392723)
FT                   /locus_tag="trd_0391"
FT   CDS_pept        complement(391527..392723)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0391"
FT                   /product="cysteine desulfurase"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM PF00266; match to protein
FT                   family HMM PF01053"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06010"
FT                   /db_xref="GOA:B9KY48"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY48"
FT                   /protein_id="ACM06010.1"
FT                   /translation="MQESDKVAAIRAAMPAVREYVYLNTGTFGPLPTLVQEAMQREAER
FT                   EFLHGRITSESYERATDLKRRAREEVARLLGCRPDQIALTRHTTDGINLAVMGLDWQPG
FT                   DEIVTTDMEHPGAQGPVFNVARRYGVVVRTARLGTGAGDVAGTLARLIGRRTRMVVLSH
FT                   LTWNTGAILPIAEIATLAHQHGALIVVDGAQSAGSIPTDVRALGADVYAIPGQKWLCGP
FT                   EGTGAVYFSDEALDRLQLTIVGYASLAPNGLEPIGGYFLPKPTAERFEVGGVNVPAIAG
FT                   QVAALRWLREDIGYSWIFQRVAALGRRAADRLASLDGVDVLTPPDRMAGLVSFTVRDGD
FT                   PQALVAALAQRNVIVRWITHPYSLRVSTGFYNTEDDIERLVDALEDARRATAASRSMV"
FT   gene            complement(392910..394118)
FT                   /locus_tag="trd_0392"
FT   CDS_pept        complement(392910..394118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0392"
FT                   /product="methionine gamma-lyase"
FT                   /EC_number="4.4.1.11"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM PF01212"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05672"
FT                   /db_xref="GOA:B9KY49"
FT                   /db_xref="InterPro:IPR000277"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY49"
FT                   /protein_id="ACM05672.1"
FT                   /translation="MDDQRRLHFRFATRAVHAGERPNPRDFIPTATPIYPTSTFLYQNI
FT                   EQMDAALGGAVGVFVYGRYGNPTTEALETAVASLEEQEAALAFASGMAALHATILSCVE
FT                   AGDRIVASRDLYGQTITLLRTIFGSLGVRVEFVDILDLAQVEAALRRGGVRLLLCETIS
FT                   NPLLRVTDLPSLAEIAHRYGARLAVDNTFATPYLVRPGTLGADYVIHSATKYLSGHGDV
FT                   TAGIVATTADRRWELNEINKTIGSILGPFEAFLVLRGLKTLPLRMHRQCENASRIACWL
FT                   AEHPLIERVHYPGLPTHPSHETAARLLPPGLYGAIVSFEIRHGTRERVTAFLERLRLIL
FT                   PATTLGDVYSEILYPVMASHRGLSPEERQAMGISDGLVRLSVGIEDPEDIIADLEQALA
FT                   SLA"
FT   gene            394095..394280
FT                   /locus_tag="trd_0393"
FT   CDS_pept        394095..394280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0393"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06216"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY50"
FT                   /protein_id="ACM06216.1"
FT                   /translation="MESALIVHRLPALFAARQPALRQVSRGSIKPRATLARSAACVFRI
FT                   RHDRLTRGGSGSRVTP"
FT   gene            394307..396139
FT                   /locus_tag="trd_0394"
FT   CDS_pept        394307..396139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0394"
FT                   /product="putative ABC transporter, substrate binding
FT                   protein (oligopeptide)"
FT                   /note="identified by match to protein family HMM PF00496"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04538"
FT                   /db_xref="GOA:B9KY51"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY51"
FT                   /protein_id="ACM04538.1"
FT                   /translation="MHVRNEVHRAMSAVSQDRRVWLLEDVRCEMKRGRIRALLRLVSVL
FT                   ALALPILAACARGQATPTPAPSGATPTAGQTPAAVSSPTQAAVTTPTGEKVLRIHEYTY
FT                   PDVFDPQKSSFSNEIAVLHMNYEGLTRLDKDLNTVPAAAESWEFNQDGTVVTFHLRAGL
FT                   KYSDGTPLTAERFRYAVERTCDPKTAGEYQSILFDIVGCEEFAGTDPNDQAAYEAARQK
FT                   LGVEAPDDRTLIVRLTHPAPYFPTIASLWVFYPARKELIEQGGENWWKDPKLQIGNGPF
FT                   QMVEVVEDQRIRFVANTNYWEGRPKLDAVEIIYQKESSVALEAYKAGQLDMFSPDPSQL
FT                   PAIKSDPELSKQLVTYPAATTIQLSFNLTKEPFTDKKVREAFAYAFDRKTYCEQIRNGD
FT                   CTPTLEWIPPGIPGHIGTDKYGFDPAKAKQALAESKYGGPDKLPEIKLTFNSDDPAARP
FT                   RVEWIAGQYRDILGVNITLEPVDGKTLVAMRKDPSTYPQMTMAGWIQDYPDPQNWLSVY
FT                   WKCDATFAQRFGYCNKQFDELVTKADQELDQQKRIELYKQAHQILIDDVPGPFLYNPLN
FT                   IWLVKPSVTGYSPTPSDDAFPGEFASLMTLDIKK"
FT   gene            396199..397209
FT                   /locus_tag="trd_0395"
FT   CDS_pept        396199..397209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0395"
FT                   /product="oligopeptide transport system permease protein
FT                   oppB"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05221"
FT                   /db_xref="GOA:B9KY52"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY52"
FT                   /protein_id="ACM05221.1"
FT                   /translation="MLLSFIVRRVLWLIPVVLAVTTITFFLMHQTPGGPWDREKPVAKA
FT                   TLEALNAKFGLNKPVWVNVAAVRERWNSGERNPLRLTLAFLDSQYFRYLWGLVRLDLGP
FT                   SYRSKGTESVQSILWRKFPTTAKVGLVATAFAVVVGIPLGVLGALRQNSWIDYLSLTVA
FT                   TLGVSVPSFVIGVLVVIGLSQLFGVKPIRAPEEWRGFSAAYLAPGIVLGLGTMSYLTRL
FT                   TRSSMLEVIRQDYVRTARAKGLSEFRVVTRHMIRNALIAVVTVLGPAVAGLVTGSFIIE
FT                   TIFNVPGMGREYVVAIAARDYSMIMGTTLLYALFVAIANIWVDVMYGFLDPRIRG"
FT   gene            397223..398212
FT                   /locus_tag="trd_0396"
FT   CDS_pept        397223..398212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0396"
FT                   /product="oligopeptide transport system permease protein
FT                   appC"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05274"
FT                   /db_xref="GOA:B9KY53"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY53"
FT                   /protein_id="ACM05274.1"
FT                   /translation="MTTVTTPRQLDRDLALRRPPRSLWSDAWRRFRKNWLALLGLGYIA
FT                   FLAVVAVAAPIIAPHNPVKSDVARAGVFRQAAWVRDPNPMRTGSWEYPLGTDSVGRDVF
FT                   SRLVYGTRVSLVVGFVPMVFTVSIGMLIGLVAGYLGGRIDNLLMRFTDVVYAFPDLLLF
FT                   IIMQVAFQDAWIGKLLNGLVLLFITLSLVSWVTVARLVRGEVLAVKQKEFVEAARAIGA
FT                   NGLQVVLRHIVPNTLGPVIVVAAYIVPGAIISEAILSYLGIGIRPSVRLDAPFPTSWGS
FT                   MILEGSKAWESQPWMLIAPTLAVASITLAFTFIGDGLRDAFDPRQAER"
FT   gene            complement(398238..398369)
FT                   /locus_tag="trd_0397"
FT   CDS_pept        complement(398238..398369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0397"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05965"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY54"
FT                   /protein_id="ACM05965.1"
FT                   /translation="MVEELRCGAVPALALPRSGSEGWSTERRPLSAPAHPWHPLRRA"
FT   gene            398445..399278
FT                   /gene="thiD"
FT                   /locus_tag="trd_0398"
FT   CDS_pept        398445..399278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiD"
FT                   /locus_tag="trd_0398"
FT                   /product="phosphomethylpyrimidine kinase"
FT                   /EC_number="2.7.4.7"
FT                   /note="identified by match to protein family HMM PF08543;
FT                   match to protein family HMM TIGR00097"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05096"
FT                   /db_xref="GOA:B9KY55"
FT                   /db_xref="InterPro:IPR004399"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY55"
FT                   /protein_id="ACM05096.1"
FT                   /translation="MSMRVPKALTIAGSDSGAGAGIQADLKTFSALGVYGSTVITAITA
FT                   QNTLGVTAVHEIPTDIVAAQLDAVMEDIGADAAKTGMLSSAAIIETVASGVRRHRIDRL
FT                   VVDPVMVAKSGDRLLREDAISALRETLLPLAFIVTPNAPEAEVLCGRPVRNEEEMREAA
FT                   RIIHGFGARYVVVKGGHVEGDQVVDLLFDGAHFERFALPRVATPHTHGTGCTFSAAIAA
FT                   FLARGFDVPTAVWEAKQYLHRALEAAFAIGRGRSPVHHFHAWWAPAPETQEVRDG"
FT   gene            399271..400080
FT                   /gene="thiG"
FT                   /locus_tag="trd_0399"
FT   CDS_pept        399271..400080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiG"
FT                   /locus_tag="trd_0399"
FT                   /product="Thiazole biosynthesis protein ThiG"
FT                   /note="identified by match to protein family HMM PF05690"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04715"
FT                   /db_xref="GOA:B9KY56"
FT                   /db_xref="InterPro:IPR008867"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033983"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY56"
FT                   /protein_id="ACM04715.1"
FT                   /translation="MAETAERAWTTIEDEPLKIADREFRSRLILGTGKWRSNEEMLAAL
FT                   EASGCEMVTVALRRIDFDDPKSRSILEVIDWTKYQILPNTAGCRTAEEAIRVARLARAM
FT                   GLSNWVKLEVIPDPKYLLPDPIGTLEAAKVLVKEGFVVLPYINQDPVLAKQLEEIGCAT
FT                   VMPLASPIGSGQGLPDFRWIQIIVEQASVPVIVDAGIGAPSDAALAMELGADACLINTA
FT                   IAQAGDPVKMARAMRLAIEAGRLCYLAGRIPKKPYASASSPLEGVVR"
FT   gene            400091..400759
FT                   /gene="thiE"
FT                   /locus_tag="trd_0400"
FT   CDS_pept        400091..400759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="trd_0400"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04795"
FT                   /db_xref="GOA:B9KY57"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY57"
FT                   /protein_id="ACM04795.1"
FT                   /translation="MTTWRGVRLREALRLYVITDRALARGRPDIEIAREAIAGGATALQ
FT                   LRWKAGPLSEALQVGHALRALCREAGVLFVVNDRVDLALALEADGVHVGVSDLPVPETR
FT                   KLVGESMVVGFSPETLEQALAAEAAGADYLGVGPVYPTTTKPDAGPAVGLEHLAQIAGA
FT                   VGIPVVGIGGITAVNAAAVIRAGAVGVAVISAVVGAEDVREAARQLREVVDAALAERGR
FT                   "
FT   gene            400763..401389
FT                   /gene="thiE"
FT                   /locus_tag="trd_0401"
FT   CDS_pept        400763..401389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiE"
FT                   /locus_tag="trd_0401"
FT                   /product="thiamine-phosphate pyrophosphorylase"
FT                   /EC_number="2.5.1.3"
FT                   /note="identified by match to protein family HMM PF02581;
FT                   match to protein family HMM TIGR00693"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05154"
FT                   /db_xref="GOA:B9KY58"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022998"
FT                   /db_xref="InterPro:IPR034291"
FT                   /db_xref="InterPro:IPR036206"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY58"
FT                   /protein_id="ACM05154.1"
FT                   /translation="MRVPRLHLVTDPEVCPFDRLLALLPALVAAGVDGVHLRAPDRAAA
FT                   ELLAVAQVARRVVVPPAVLLVNDRIDAALLSEADGVQLPERGLPPEGARRLLGRGRFIG
FT                   CSVHSVTAAERAAQAGADFLLFGNVFETASKPGRAAAGLEALRAVTRAVPCPVIAIGGI
FT                   TPERVPEVVATGAHGVAVIRGILAAPDPVAAVHAFRAALDRVGAV"
FT   gene            401386..401592
FT                   /gene="thiS"
FT                   /locus_tag="trd_0402"
FT   CDS_pept        401386..401592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="thiS"
FT                   /locus_tag="trd_0402"
FT                   /product="thiamine biosynthesis protein ThiS"
FT                   /note="identified by match to protein family HMM PF02597;
FT                   match to protein family HMM PF02824; match to protein
FT                   family HMM TIGR01683"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05984"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR010035"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY59"
FT                   /protein_id="ACM05984.1"
FT                   /translation="MTIRVILNGKRVELDGARTIFDLLRSRGLDPRLVAVERNGEIVPR
FT                   DRYEECELRDGDVIEVVHFVGGG"
FT   gene            complement(401646..402005)
FT                   /locus_tag="trd_0403"
FT   CDS_pept        complement(401646..402005)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0403"
FT                   /product="putative 6-O-methylguanine DNA methyltransferase
FT                   family protein"
FT                   /note="identified by match to protein family HMM PF01035;
FT                   match to protein family HMM TIGR00589"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05387"
FT                   /db_xref="GOA:B9KY60"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY60"
FT                   /protein_id="ACM05387.1"
FT                   /translation="MGTAKRSQQSSPFAERVYAIVRRIPPGRVTTYGRIARAAGLTRSA
FT                   RMVGWLLHEAPADVAAVAHRVVNRNGELTGGWAWGHPSVMRALLEEEGVTFVDEYRVDL
FT                   ERHLWEPEDEFSERS"
FT   gene            complement(402010..402396)
FT                   /locus_tag="trd_0404"
FT   CDS_pept        complement(402010..402396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0404"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05395"
FT                   /db_xref="GOA:B9KY61"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY61"
FT                   /protein_id="ACM05395.1"
FT                   /translation="MTESRSVLDRLLPLAHRSELIAAGLATHLAFNVVAALAFRLAAQS
FT                   SSWLAFLLWQVVGNLAGFLTVVALTVLLRFVPLSVAYPITTGLSVIAVQVVAARLLLHE
FT                   PLPLRVWFGAILIVLGILFVGGRI"
FT   gene            402472..405117
FT                   /gene="secA"
FT                   /locus_tag="trd_0405"
FT   CDS_pept        402472..405117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="secA"
FT                   /locus_tag="trd_0405"
FT                   /product="preprotein translocase, SecA subunit"
FT                   /note="identified by match to protein family HMM PF00271;
FT                   match to protein family HMM PF01043; match to protein
FT                   family HMM PF02810; match to protein family HMM PF07516;
FT                   match to protein family HMM PF07517; match to protein
FT                   family HMM TIGR00963"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05339"
FT                   /db_xref="GOA:B9KY62"
FT                   /db_xref="InterPro:IPR000185"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="InterPro:IPR011115"
FT                   /db_xref="InterPro:IPR011116"
FT                   /db_xref="InterPro:IPR011130"
FT                   /db_xref="InterPro:IPR014018"
FT                   /db_xref="InterPro:IPR020937"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036266"
FT                   /db_xref="InterPro:IPR036670"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY62"
FT                   /protein_id="ACM05339.1"
FT                   /translation="MGTGAVNASARPIVGDESMRNVLKKILGDPNERELKRLRRIVDEI
FT                   NALEPDYQRLSDEQLRAKTDEFKARLEYGETLDDILVEAFATVREAARRTLNMRHFDVQ
FT                   LMAGIVLHEGKIAEMKTGEGKTLVATLPLYLNALLGRGCHLVTPNDYLSRVGGGWMGPI
FT                   YHFLGVSVGVITHEFAGIYDPTYIQPDPSPDDRLNHWRPVSRREAYLADITYGTNHEFG
FT                   FDYLRDNLVYRPEDIVQRELYYAIVDEVDNILIDEARTPLIISGQARETVDRYYQFAQI
FT                   ARQLRRDVHYTVDLKHRTVTLTEAGIDRVERLLGIPEGHSLYDDRYSDAVHYLEQALKA
FT                   KELYLRDRDYIVRDGEVIIVDEFTGRMMPGRRYSEGLHQAIEAKEGLRVRQETVTQATI
FT                   TYQNYFRMYEKLAGMTGTAATEAEEFQTIYNLEVVVIPTHKPMIRIDYPDVIYRTEEGK
FT                   FRAVVREIEEMHAIGRPVLVGTTSIEKSEYLSDLLKRKGIPHEVLNAKHHEREALIVAK
FT                   AGQRGAVTIATNMAGRGTDIVLGPGVAELGGLHVIGTERHEARRIDNQLRGRAGRQGDP
FT                   GSSRFYVSLEDELLKRVGTERIQGLLEKLGMDDEHPIESPLVSRMIEEAQKKIEGYNFD
FT                   LRKHLVEYDSVINKQREVIYGDRRKIVMGENMREHVLGMVRRQLEKAVKQAFESADEPD
FT                   PESVLRAFAGIVGDSDGLTPRDLEERDENELTELLWQRALARYERREQEFGPETMRVIE
FT                   RLVLLQVMDRLWIEHLTEMEHMRHEVGLQAYGQLDPLVVYKREGYRMFQQLLENIEYDV
FT                   ARLIYRVQLAPALQRPVMQIGTPNRGGDGAGPARKKQKVGRNDPCPCGSGKKYKHCCMK
FT                   AESGVRAGAG"
FT   gene            405428..406129
FT                   /locus_tag="trd_0406"
FT   CDS_pept        405428..406129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0406"
FT                   /product="glycerol uptake facilitator protein"
FT                   /note="identified by match to protein family HMM PF00230"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04781"
FT                   /db_xref="GOA:B9KY63"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR022357"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY63"
FT                   /protein_id="ACM04781.1"
FT                   /translation="MRELTAEFIGTMLLVLLTDGTVATARLARSHGVGGNWLTIAVGSA
FT                   IAVSIAVGLAGPISGGHVNPAVTFALAAWGLFPAERVAAYVGAQLAGGFSGAVLVWLLF
FT                   WRHWEATSDPAVKRGVFCTGPAIRYWPANLATECVGTAVLALGVGAAVAGRVPGAVVPW
FT                   WIGGLVLAIGLALGGTTGFALNPARDAAPRLAYTLLPIAGRGDADWRYGWIPIVGPVLG
FT                   ALLGIGVWRLL"
FT   gene            complement(406434..408200)
FT                   /locus_tag="trd_0407"
FT   CDS_pept        complement(406434..408200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0407"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05607"
FT                   /db_xref="GOA:B9KY64"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY64"
FT                   /protein_id="ACM05607.1"
FT                   /translation="MLAGSGDAALHGGIARPSVLAGTPRNMPLASASFRPAPTLASRVL
FT                   DAALRCTARWETPVTHCFLERTLRVPSPREMTASSEPVPLTRPIPLLFSIRKTSTLLAE
FT                   RLLGAIRMHVGPRHRQRPPVSWLILGLLLLAACNRAVTTTPTQSPQPAIAQRWVATGPV
FT                   APVDAGSSSVVLTIRAPAETSVSEIELRITPPEGQPQTLGPYSVQPGQTIQVEVDLTQL
FT                   SGTATAGEWRAEWIDRAQPDRVLAVVSFTTRSARTITWQSSVPRTSIPAGDCRTNRTIV
FT                   ELGIRARGADSDESFMVYAVIESPSGQKLSLPPIEISGDQWSTLRASLCSVVPRAEQLS
FT                   GTWTVRWYRSDQPTRPILSDSFGVVPAPTPTATPMPTLEWRVPTEPVQPYDCGAAVDIQ
FT                   VRNTAPGNQVTPVIVQAIPPGKGPVDLARVELRGNEWVTVSLVYCQAAGGAEIAGSWAV
FT                   RAVDAAARQVEFGRATFEVRAIPAPTQPPAPKPQPQPQPAPPPPPPPRASVDTDGDGLP
FT                   DDEELSFGTDPYNSDSDGDGLSDGSEVYVYGTDPRKRDTDVDGYTDFEEILQGSDPWDP
FT                   CSPNQFAYNCQL"
FT   gene            complement(408270..408974)
FT                   /locus_tag="trd_0408"
FT   CDS_pept        complement(408270..408974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0408"
FT                   /product="Protein of unknown function (DUF461) family"
FT                   /note="identified by match to protein family HMM PF04314"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05009"
FT                   /db_xref="InterPro:IPR007410"
FT                   /db_xref="InterPro:IPR036182"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY65"
FT                   /protein_id="ACM05009.1"
FT                   /translation="MLLDRQQSTEEVMKMRTVLDRIRGWFVLALTVVLASLVVSACRGT
FT                   EPTPTPAPSPTPAAAVQPSPTPQPTPTATPTPTPMPTPTPMAATPTMGHGMSGHGMGSA
FT                   MPGVSNEFRAGTLVIRNVWARAASQADALSAVYMVIENTGDQPDRLLHAHCDVAGTVEL
FT                   HETKMEGGVMKMQPVDGIDIPAKGTVELKPGGLHIMLIGLTRDLNPGDEIELELHFDKA
FT                   GHVPVKAVVQKP"
FT   gene            complement(408977..409597)
FT                   /locus_tag="trd_0409"
FT   CDS_pept        complement(408977..409597)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0409"
FT                   /product="putative SCO1/SenC family protein"
FT                   /note="identified by match to protein family HMM PF00578;
FT                   match to protein family HMM PF02630"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06113"
FT                   /db_xref="GOA:B9KY66"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY66"
FT                   /protein_id="ACM06113.1"
FT                   /translation="MPTRPWLRRLVVAELAAIAIVLAVVGWYVWQSRAAPSLNGMLLDP
FT                   PQEIPAIQLTGSDGQPHALTDFQGKVTVVFFGYTHCPDVCPMTASTMARARAMLGNQAD
FT                   RVQLVFVSVDPERDSPERLASYLAKYDPTFLGLTGDEDRIRELATVFGVHYAKVESTSA
FT                   LGYLVEHTSSSFVLDTQGKLRAVLPFGLTPEQVASDLRALLRR"
FT   gene            complement(409609..410256)
FT                   /locus_tag="trd_0410"
FT   CDS_pept        complement(409609..410256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0410"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04744"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY67"
FT                   /protein_id="ACM04744.1"
FT                   /translation="MFVDRGWFIMVRRLALIVVLLLATLSIVWSALAAPRVLPRLRLAP
FT                   GFGLEDPSGKLVSSDSLRGQILVVTFGSAECGTDCASRGQLLATAVAGTETTGRVELIW
FT                   IASEPVSREQLAVLSETLAQHGHPWRVLGSSDRRELDLTLSGFRVPRHPDGTVDPIIVI
FT                   VDPLGIVRAEYRIAPSPEMLTRDLEALEREIRESQGMRRYLYEAAHLFRCYV"
FT   gene            complement(410304..410660)
FT                   /locus_tag="trd_0411"
FT   CDS_pept        complement(410304..410660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0411"
FT                   /product="lustrin A"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05011"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY68"
FT                   /protein_id="ACM05011.1"
FT                   /translation="MFRGFASLVTIAVLFGAALAATVVPTTCTCGAAAPHPHALFELPG
FT                   HYHGSPAEHASTSDLPDGPVVTAPAMPFALGTLVPVVATAILTLQLGIRRSPLFVTGTI
FT                   PPGVDHRPPIPPPR"
FT   gene            complement(410967..411905)
FT                   /locus_tag="trd_0412"
FT   CDS_pept        complement(410967..411905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0412"
FT                   /product="Luciferase-like monooxygenase superfamily"
FT                   /note="identified by match to protein family HMM PF00296;
FT                   match to protein family HMM TIGR03560"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05259"
FT                   /db_xref="GOA:B9KY69"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY69"
FT                   /protein_id="ACM05259.1"
FT                   /translation="MPGMQFGIHVGPQNTTTDELRQLWRFADAHGFSWFSVWDHFYART
FT                   SDRIPHYEAVALLAALACDTQRIRFGCMVFAVQFRNIGLLAKSIVTIDHLSNGRLEVGL
FT                   GAGWHEPEYRAFGYPFLSDRERLDQLEEGITALRRLLQEDAVTFEGRWIQLREARVYPK
FT                   PLQPRLPLWIGGAGERRTARIAARHADGWNIPYVSPEGFRQKRAALEHWCEVEGRDPAT
FT                   LQIAVQVGLYMATEDDERTVSRLRERLVEQVGPQALEQPGWLIGGPDRISALLAEYHAA
FT                   GADWINVTVRPPVDFEALQAFVERVMPHFAS"
FT   gene            complement(412021..412797)
FT                   /gene="dapB"
FT                   /locus_tag="trd_0413"
FT   CDS_pept        complement(412021..412797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapB"
FT                   /locus_tag="trd_0413"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number="1.17.1.8"
FT                   /note="identified by match to protein family HMM PF01113;
FT                   match to protein family HMM PF05173; match to protein
FT                   family HMM TIGR00036"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06161"
FT                   /db_xref="GOA:B9KY70"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KY70"
FT                   /protein_id="ACM06161.1"
FT                   /translation="MLRLALTGVTGRMGRAVLELAASAPDIQLVCGLIRPARDPHEVAA
FT                   QLPAPLALTSRVAELVQGADVVVDFSHPAVTVAVAEAAAHAGIPLVSGTTGLSEHDQAV
FT                   ILRAAQHVPVVQAANFSLGIALLHWLLPELVARLPTWDVELIERHHRHKRDAPSGTALA
FT                   LARTLLAAREPAPSPLVYGRGPGTAPRQPGEVGIHAVRAGGEVGRHTVLLATDDEAIEV
FT                   THWVQSRRAYAQGALEAARRLIGRPPGLYSLQDLVT"
FT   gene            complement(412797..413705)
FT                   /gene="dapA"
FT                   /locus_tag="trd_0414"
FT   CDS_pept        complement(412797..413705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapA"
FT                   /locus_tag="trd_0414"
FT                   /product="dihydrodipicolinate synthase"
FT                   /EC_number="4.3.3.7"
FT                   /note="identified by match to protein family HMM PF00701;
FT                   match to protein family HMM TIGR00674"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05517"
FT                   /db_xref="GOA:B9KY71"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KY71"
FT                   /protein_id="ACM05517.1"
FT                   /translation="MLRGTFVALITPFAGEEIDEPRLRDLVDWLIANRVDGLVPCGTTG
FT                   ETPSLSDTEWQRVAAVVIEQAAGRVPVIVGTGTNSTMVTIQRTRVARELGATAAMVVTP
FT                   YYNKPQQDGLYRHVAAIADAVDLPLVIYNVPSRTGVNLAPETARRLLDIAPVIAFKDSS
FT                   GSLDQVSELVLAVGDRSSVLSGDDSLTLPIIAVGGQGVVSVLANIAPAATATMVRAALD
FT                   GDLARARQLHGELFPLARALFIETNPVPVKTAAELLGLCSATVRLPLAPLAPANRERLL
FT                   AALASCPHTASLLARPMGEAA"
FT   gene            413704..413859
FT                   /locus_tag="trd_0416"
FT   CDS_pept        413704..413859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0416"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06318"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY72"
FT                   /protein_id="ACM06318.1"
FT                   /translation="MLFPPRCITQNDSSPRRSTAMSALFPGTYLPAHRRVPDEMSIGCC
FT                   LECLSS"
FT   gene            complement(413849..413971)
FT                   /locus_tag="trd_0415"
FT   CDS_pept        complement(413849..413971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0415"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04827"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY73"
FT                   /protein_id="ACM04827.1"
FT                   /translation="MQEMSERARALDRMTSAQQSRCSARAPRRVYPLKRCSLTS"
FT   gene            complement(414082..414807)
FT                   /locus_tag="trd_0417"
FT   CDS_pept        complement(414082..414807)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0417"
FT                   /product="conserved protein"
FT                   /note="identified by match to protein family HMM PF03483"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04985"
FT                   /db_xref="GOA:B9KY74"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY74"
FT                   /protein_id="ACM04985.1"
FT                   /translation="MAVFCVSSEVFEQFPDYLVIVLVADRVENRRHVERARTLLAESAR
FT                   LACERWRAIDPKALPEIDVWRRAFRRLGWSASTYQSSVEALVRRTLKGNPPPSINPAVD
FT                   LANAASLRFLVPIGAHDLATAPNGLTVRASLPGDRFLPLGDGAPEEPEVGEIVYVHDHD
FT                   VRTRRWVWRQSRTGLVTPDSRTILFPIDAFQGVTAAAAVAAADWLSEQLQSLLGATVQR
FT                   GLVDLNQPVFDSALGDAIS"
FT   gene            complement(414826..416133)
FT                   /locus_tag="trd_0418"
FT   CDS_pept        complement(414826..416133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0418"
FT                   /product="putative glycosyltransferase"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04566"
FT                   /db_xref="GOA:B9KY75"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY75"
FT                   /protein_id="ACM04566.1"
FT                   /translation="MEPTREHREFFPAPGIQRVAMLSVHTSPLAQPGIGSAGGMNVYIR
FT                   ELSRHLAQRGVAVDIYTRRDHPAVPPLVEPFPGVRVYALDAGPATALPKEQLFCYLPTF
FT                   VSELAYLVHRQQLSYDIVHAHYWLSGWAAHLLQRYWDVPFVHMFHTLAVLKNSVQASPP
FT                   ESVLRLQVEQGLARVADAIIAANPDERETIVNELGAPPSRLCTVPPGVDAEHFRPLDRA
FT                   AARSRLGIPLDRPVALFIGRIDPVKGIDVLLRAWQRIAQELAPRQPLLLFLGGGFDSSA
FT                   GLRPDAALSRVIADARELGIAETVRFLGSRPQGELPLFYNAADVCLIPSHYESFGLVAV
FT                   ESMACGTPVVASQVGGLRFSVEHEVSGLHVPPNDPAALATATVRVLTDHQFRTRLQVGA
FT                   RQAALRFSWHRVTTVVARLYEQVARRGILQPCGTTG"
FT   gene            complement(416215..416291)
FT                   /locus_tag="trd_0419"
FT   tRNA            complement(416215..416291)
FT                   /locus_tag="trd_0419"
FT                   /product="tRNA-Arg"
FT   gene            416393..416467
FT                   /locus_tag="trd_0420"
FT   tRNA            416393..416467
FT                   /locus_tag="trd_0420"
FT                   /product="tRNA-Pro"
FT   gene            416518..417936
FT                   /gene="selA"
FT                   /locus_tag="trd_0422"
FT   CDS_pept        416518..417936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selA"
FT                   /locus_tag="trd_0422"
FT                   /product="L-seryl-tRNA selenium transferase"
FT                   /EC_number="2.9.1.1"
FT                   /note="identified by match to protein family HMM PF01053;
FT                   match to protein family HMM PF03841; match to protein
FT                   family HMM TIGR00474"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04748"
FT                   /db_xref="GOA:B9KY76"
FT                   /db_xref="InterPro:IPR004534"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR018319"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY76"
FT                   /protein_id="ACM04748.1"
FT                   /translation="MGDEKSAPTRVEQQRLRALPSVSSLIQHPAIAPYAREVGARSLTR
FT                   LAQLVLEEARQAILAGRATGDVVAVLQRRLQKLSQPRLRSVINATGVIIHTNLGRAPVS
FT                   DEAARAMAEVAGRYTALEIELESGRRGGRMSELSQLLSLLTGAEAGLVVNNNAAAVLLV
FT                   LSTFCAGRAVLVSRSQAVEIGGGFRIPDVLRQSGARLVEVGTTNRTYVRDYAEAISDDT
FT                   AAILSVHWSNFRIIGFTVQPELGELAELAHARGLLLIEDLGSGALLDTAAYGLAHEPTV
FT                   QEAIAAGADLVCFSGDKLLGGPQAGIIVGRRELIEQVERHPLARALRADKTALAGTAVT
FT                   LRHYLRGEAIDKIPVWRMIATPLAALEARCQTWQSALRDLVETEIVATDATVGGGSLPG
FT                   ETLPSRALALGAEAIAEVVPGLTVEELARRLRTGQPPVVGRVEADRLLLDARTVLPEQD
FT                   EALVEALRRSLAIS"
FT   gene            complement(417929..419779)
FT                   /locus_tag="trd_0421"
FT   CDS_pept        complement(417929..419779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0421"
FT                   /product="DNA primase"
FT                   /EC_number="2.7.7.-"
FT                   /note="identified by match to protein family HMM PF01751;
FT                   match to protein family HMM PF01807; match to protein
FT                   family HMM PF08275; match to protein family HMM TIGR01391"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05656"
FT                   /db_xref="GOA:B9KY77"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY77"
FT                   /protein_id="ACM05656.1"
FT                   /translation="MGRQDVERVREAIDIVDLIGGYIQLRKAGKNFKALCPFHQEKTPS
FT                   FYVFPETQSFYCFGCGASGDAISFLMRIEQLDFRDALERLAERAGITLSPPRPEERAED
FT                   EQRRRLAELNRLAAAWFAHVLWGTSFGEAARSYLERRGIDRPTAERFGLGYAPDAPSAL
FT                   ARYLSQHGAGPEELVTAGLVVRRDDGSLVDRFRNRLIFPIRDRHGTILGFGGRTLGEAQ
FT                   PKYLNSPQTPLFDKGSVLYAIDLAEESIRQQRTAIVVEGYLDAITAHQFGYSNTVASLG
FT                   TALTERQGRHLRRLAERILLALDADVAGRQATLRGLELLRHALAEGERAVVDPRQLIRF
FT                   ERTLDVELAVVVLPEGLDPDDLIRQDRTRWDEALAHAVPLVDYYLDVLLGEQPPANPRA
FT                   ATALLQRIAPLLLELGDLVQVDLYTRSVAARLRLPEETVRRLLASLRRQPTREPSPKTT
FT                   AAAILRPLSTEQQFVGLLLRYPEAAAHLVGEIDLESITDARYRELVSLLLAGQPLDDAA
FT                   LAEDLRDDIGQLRQRFATQPDLPVPLARQAIREAFRRLRRERHDERLRSLLSEVRDAEE
FT                   RGDRDELRRALELIEALKQRFPEFYPERSPYFRDTRDPVN"
FT   gene            complement(419784..420866)
FT                   /locus_tag="trd_0423"
FT   CDS_pept        complement(419784..420866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0423"
FT                   /product="deoxyguanosinetriphosphate
FT                   triphosphohydrolase-like protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR01353"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05838"
FT                   /db_xref="GOA:B9KY78"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY78"
FT                   /protein_id="ACM05838.1"
FT                   /translation="MRDEMEETALPTIRFLLEEREAKWLHPRATSSRHAKRQQPEPECP
FT                   FRTPYQRDRDRVIHSKAFRRLKHKTQVFIAPPGDHYRTRLTHTLEVTQIARTIGRALRL
FT                   NEDLIEAIGLAHDLGHTPFGHTGERALAAVFPGFRHNEQSLRVVDRLERDGQGLNLTEQ
FT                   VRDGILRHSKTIESISSPIAGWPSTPEGQVVKISDGIAYINHDLDDALRAGMITLTDAP
FT                   ADVLDTLGRTHGERIHRLVADVVATSAPLLDECTPGQPVIRLSPEMERAANQLRRFLFE
FT                   RVYEPLNRLEETRKAERIIQFLFEHFVTHPDEMPATFRQMLENESVERIAADYVASMTD
FT                   RYALACFEAIWLPRFWTFLG"
FT   gene            complement(420997..422406)
FT                   /locus_tag="trd_0424"
FT   CDS_pept        complement(420997..422406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0424"
FT                   /product="putative aminomethyltransferase"
FT                   /note="identified by match to protein family HMM PF01571"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05373"
FT                   /db_xref="GOA:B9KY79"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY79"
FT                   /protein_id="ACM05373.1"
FT                   /translation="MTSETPRTLQEVLERAPSVQELLYHNPTGARVYPVVPPEFTNWRD
FT                   EQHAWRDTVCLFDLSYHMTDLFLRGPDAFALLRQLGINSFEGFQPGQAKQYVPVSPEGY
FT                   VIGDVILFYLEDGTFQLVGRPSVHNWVQFHAATSGAAVSFERDEWSVTDPHKPRKTFRF
FT                   QIQGPNAPMLLEKLLGGPPPDLPFFHFTRVSIAGKRVSLLHHGMSGVAGAEFFGDFADG
FT                   PAVKAAILEAGKEFGIRHVGSRAYATNTLESGWIPNPLPAIYTSPALEAYRRWLPATAY
FT                   EAIGSLGGSFVSPRIEDYYLTPWDLGYGRLIKFDHDFVGRAALERLKDQPHRKKVTLVW
FT                   DPDEAARVISSLVTHPKGQRYKYFDLPLAQYATWMYDAVLNDAGEVVGFAMFTGFSSNE
FT                   ERVLSLATVRSEYAQEGTRLRVVWGEPNGGSRKPSVERHVQTEVWVTVGPAPYAEPARR
FT                   YREQVARARRS"
FT   gene            422786..422911
FT                   /locus_tag="trd_0425"
FT   CDS_pept        422786..422911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0425"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06223"
FT                   /db_xref="InterPro:IPR027392"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY80"
FT                   /protein_id="ACM06223.1"
FT                   /translation="MNVFVCPKCFGRMTIVERHRVVFERCTECGGIFLHRGGSSR"
FT   gene            422869..423045
FT                   /locus_tag="trd_0426"
FT   CDS_pept        422869..423045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0426"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05691"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY81"
FT                   /protein_id="ACM05691.1"
FT                   /translation="MRWNLSPPWGLEQVIRGETQYYKRQAVRDGEENAFEKRRDDRRKR
FT                   KFRHFLEEFLEFD"
FT   gene            423042..424919
FT                   /gene="uvrC"
FT                   /locus_tag="trd_0427"
FT   CDS_pept        423042..424919
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrC"
FT                   /locus_tag="trd_0427"
FT                   /product="excinuclease ABC, C subunit"
FT                   /note="identified by match to protein family HMM PF00633;
FT                   match to protein family HMM PF01541; match to protein
FT                   family HMM PF02151; match to protein family HMM PF08459;
FT                   match to protein family HMM TIGR00194"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05036"
FT                   /db_xref="GOA:B9KY82"
FT                   /db_xref="InterPro:IPR000305"
FT                   /db_xref="InterPro:IPR001162"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004791"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR035901"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR038476"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY82"
FT                   /protein_id="ACM05036.1"
FT                   /translation="MTLDMVRDMRKTSEQVIQERLAALEPAPGVYLMKDAQGRVIYVGK
FT                   ASSLRQRLRSYFSSHSSMDAKTRELVSQIADFEVIRTDTPTEALILENELIKRYRPRFN
FT                   IMLRDDKTYPFIRITNEPFPRVIATRRIVRDGSRYFGPYPSAGAVHRTLDLLKRLFPYR
FT                   ACDIEITGTASRACLYYHIGRCAGPCIGAVSQEEYRGIIDNVVLFLEGRAEAVVARLQA
FT                   AMEEAAERLEFERAARIRDELRAIQHVLQQQKIVTGTDESFDVLAVAQSAGGDACVQIG
FT                   FVRNGKLLGSEHYLMVGARIDDPPGAILTSFVQQYYAQASTVPPELVLQHPLDDGETIA
FT                   AWLAARRDGPVRLTVPDDGFRRELVEMIAKSAVQNLEQHRVRWLNDEQRTTLALEELAD
FT                   ALGMDRLPRRIECFDVSQLQGTNVVASMVVFEHGKPKKSDYRKFQIKTVEGQDDYAALR
FT                   EAVLRRYRRALSAEQTEAWQALPDLVLIDGGKGQLSAAREALVELGLDLPIAALAKEHE
FT                   ELYIPDQSEPIVLPRDSQALFLVQRVRDEAHRFAVTFHRARRTRSTIRSLLDEIPGIGP
FT                   RRRRELLRRFGSVEGIRQASIEEIAAVPGISRALAERIKKELDEARAPR"
FT   gene            424916..425545
FT                   /locus_tag="trd_0428"
FT   CDS_pept        424916..425545
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0428"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="identified by match to protein family HMM PF01300;
FT                   match to protein family HMM TIGR00057"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05881"
FT                   /db_xref="GOA:B9KY83"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY83"
FT                   /protein_id="ACM05881.1"
FT                   /translation="MKVLRADEPGSVEIAAQVLREGGLVVFPTDTVYGVGAVVDRPDAV
FT                   ARLYVAKGRPLDKPIPVLIADLDQLEKLAREVTPEVQLLAQHFWPGALTIVVPAQPWLP
FT                   REIVRETGAVGLRMPDHPVALGIISGAGGAVATTSANRSGEREACTVEEAIGALGDAVD
FT                   LYIDGGRTPGGIPSTVVAFEGSRLVVLRRGALPVEVIEEVLRSRSH"
FT   gene            425631..426896
FT                   /locus_tag="trd_0429"
FT   CDS_pept        425631..426896
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0429"
FT                   /product="putative UDP-glucuronosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04791"
FT                   /db_xref="GOA:B9KY84"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY84"
FT                   /protein_id="ACM04791.1"
FT                   /translation="MVLSEWLLVGVASTFAAAGGVAQRQQRLRHLQRVTRSLSFPDGAP
FT                   RVLILSASIGGGHNAAAAVLRHDLERLGSHACILDGFALATPLLSRCFASAYPLQLRYT
FT                   PWLYELQFRSSHLRTWTRMWRRIYAGLGGVAFRRLIEELHPDVVVSTYPLVTQALGVLR
FT                   STGRLLTPVAATVTDYGVHRLWIAPGVDLHLVPSRVSAEQVEDATGEVRVMQPLVREAF
FT                   RQSRNRAAVRQRYGFAADDFVALVVAGAWGIGHVELIVRDVVECGVRVVVVCGKNQELA
FT                   EQLRREYAGCSTVQVWGWTDQLPELMTAADCLIQNAGGLTCLEAIACGLPVLMYRPIAG
FT                   HGVFNAAAMERAGAARWIRSADELRMVLRGAAAGRIQLPVPKIDEDAVPAAEAILTLVA
FT                   GRGARIGTGRTFAAQLVRSGSS"
FT   gene            426893..427753
FT                   /locus_tag="trd_0430"
FT   CDS_pept        426893..427753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0430"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05621"
FT                   /db_xref="GOA:B9KY85"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY85"
FT                   /protein_id="ACM05621.1"
FT                   /translation="MIATRALATRIILASLLGAAMLAALAVLAVKTQPPVGLVPLIARE
FT                   GRSFWLAGLAVCLLGALIFQVVDRLPELARATALQRGVRYDPVPEWPTAWILPFVTLAS
FT                   GTLLLCAYHSLIVALAVTLFGFISLVIGQFARLALYSAEERIRSLGRLVHTLLLYGVGF
FT                   VSYAMIYVHKLRSLYSATAIFLLAVLLLLQLTEGADVQLDRRVLYAMTGALVLAEATWV
FT                   LNYWPATGWLGGAVLLAVFHVLAGLTLARVERALSWRTIAEYGIMASLAIIVIVWGTIR
FT                   TRGGP"
FT   gene            427750..428031
FT                   /locus_tag="trd_0431"
FT   CDS_pept        427750..428031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0431"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05254"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY86"
FT                   /protein_id="ACM05254.1"
FT                   /translation="MSEPEQHELYQLLLAMDVLEELLEDLEESGLTSLEDLASRLASDA
FT                   EATDLLELIAQLIARGIRTSEDLAGFLSELEQRIEEPEVMDSDWVNPN"
FT   gene            428047..429399
FT                   /locus_tag="trd_0432"
FT   CDS_pept        428047..429399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0432"
FT                   /product="ATPase, aaa family"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06354"
FT                   /db_xref="GOA:B9KY87"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR021886"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032423"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY87"
FT                   /protein_id="ACM06354.1"
FT                   /translation="MENLFESHRRSLRERCAPLAERMRPRTLDEVVGQEHVLGPGALLR
FT                   SLIERDQLVSLILWGPPGCGKTTLARLIAKHTRSAFVPLSAVSASVADIRRVVQEASDR
FT                   FAQHGQRTIVFIDEIHRFNRAQQDALLPAVEDGTIVLIGATTENPSFEINAPLLSRCRV
FT                   VVLEPLSDQAIQTLVERALVDRERGLGELGLRIEPEALRLLVGLANGDARMALNTLEVA
FT                   AAGAQEGTITVELVHQAAMRRGSVYDRAGDAHYDTISALHKAIRGSDPDAALYWLARML
FT                   EHGDDPLYVARRLVRAASEDIGLADPHALVVAVAAQQAVHFLGMPEGALALAEATVYLA
FT                   LAPKSNAVYRAYEAARRDVVQTRNEPVPLHLRNAPTTLLRQLGWGVGYRYPHDEPDGIG
FT                   RQDYFPPLLRGRRYYEPSDRGWEVRLRERLAAIRAARGQRAGPTESGGGSG"
FT   gene            429396..430127
FT                   /gene="rph"
FT                   /locus_tag="trd_0433"
FT   CDS_pept        429396..430127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rph"
FT                   /locus_tag="trd_0433"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="identified by match to protein family HMM PF01138;
FT                   match to protein family HMM PF03725; match to protein
FT                   family HMM TIGR01966"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05361"
FT                   /db_xref="GOA:B9KY88"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY88"
FT                   /protein_id="ACM05361.1"
FT                   /translation="MNELAIPVRHGRANDELRPVEIVPHYIPYAEGSALIMLGNTHVLC
FT                   AATVEERVPSFLVGSGQGWITAEYGMLPRSGRERIPRERMGPGGRTAEIQRLIGRSLRA
FT                   AVDLAALGERTIIIDCDVLRADGGTRTAAITGGWVALHLALQHLLAEGRIESLPVVRQV
FT                   AAVSVGVVAGQPRLDLEYAEDSCAEVDMNIVMTDRGEFVELQGTAEGQPFGREVLEQLL
FT                   RLAERGISELMLVQRRALGLS"
FT   gene            complement(430134..430742)
FT                   /gene="hisB"
FT                   /locus_tag="trd_0434"
FT   CDS_pept        complement(430134..430742)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisB"
FT                   /locus_tag="trd_0434"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /EC_number="4.2.1.19"
FT                   /note="identified by match to protein family HMM PF00475"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04665"
FT                   /db_xref="GOA:B9KY89"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY89"
FT                   /protein_id="ACM04665.1"
FT                   /translation="MTEIRRASIRRTTTETDVSVDLIIDGTGRSSVATGIGALDHFLTL
FT                   FARHGRFDIDIQARGDLHVDAHHTVEDVALCLGQALRRALGDWRGIRRMADAAVPMDEA
FT                   LAQVAVDLSGRGSFHYRDPWPGGAVGQLEADLVRHFLETLAREARITIHVVTLYGSNVH
FT                   HQIEAIFKALARALDAATELDTRIAGQLPSTKEHLEIQG"
FT   gene            complement(430766..431848)
FT                   /gene="hisC"
FT                   /locus_tag="trd_0435"
FT   CDS_pept        complement(430766..431848)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisC"
FT                   /locus_tag="trd_0435"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /EC_number="2.6.1.9"
FT                   /note="identified by match to protein family HMM PF00155;
FT                   match to protein family HMM TIGR01141"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06173"
FT                   /db_xref="GOA:B9KY90"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY90"
FT                   /protein_id="ACM06173.1"
FT                   /translation="MAARRAVRASIENAVEYLPVESRETIAERLGVPPEQVAKLDANEN
FT                   PYGPPPAVIAALASLPDLHLYPDPDQRRARAALADYTGMPAERILLGNGSDELIDLLLL
FT                   VTIEPGDEVVVPVPSFGVYLSRPPLFGARVITVPRREDFDLDLETIEDAITPRTKLLFL
FT                   ASPNNPTGNLVTPQQLSRLLRTGILVVLDEAYYEFAGQTLAPFAREFENLVILRTFSKW
FT                   AGLAGLRIGYGIFPPHLAAALWRVKQPFNVSTAAQAAVEAALADRTWLMQRVLHVRLER
FT                   GRLYRALRRYPFLTPYPSHGNFILCRVHDGRAHQLHAHLLQHAIVVRRYDDEWLRDYLR
FT                   ITVGTPEQTDRILAALDTFR"
FT   gene            431933..433027
FT                   /locus_tag="trd_0436"
FT   CDS_pept        431933..433027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0436"
FT                   /product="beta-lactamase"
FT                   /note="identified by match to protein family HMM PF00144;
FT                   match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05129"
FT                   /db_xref="GOA:B9KY91"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY91"
FT                   /protein_id="ACM05129.1"
FT                   /translation="MASVLMLALLGTTTRAVAVVPEVSSRPAPSSAYQPAERPTLTARA
FT                   SFAVDITAGVELWAQEADRPLPPASTTKLMTALVVRRWLRPDESITIRSDDLVDPAVYA
FT                   NAGFQPGDRVTVTDLLAAMLIASAGDAALALARVAGERIDPEHDVPRTAFIDAMNQEAA
FT                   RLGLRHSWFATPDGRDVPGQTVSARDLAIIAAAVLSDPLLAELVATRTREIEIAGPQSR
FT                   RITVVNTNQFLTEPDALGVKTGTSVAAGQCLVAAVRRGNDIVVLVLLSSRDRYADARAL
FT                   LTYLDRQYRWFTLDGRSFAELARLAREGIVPALVPTVVVANETADQVRVIIDRQHSSAD
FT                   VVGTVRLRIGTSDLFIVPLLRVER"
FT   gene            433028..433876
FT                   /locus_tag="trd_0437"
FT   CDS_pept        433028..433876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0437"
FT                   /product="possible pseudouridine synthase"
FT                   /note="identified by match to protein family HMM PF00849;
FT                   match to protein family HMM PF01479; match to protein
FT                   family HMM TIGR00093"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04975"
FT                   /db_xref="GOA:B9KY92"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY92"
FT                   /protein_id="ACM04975.1"
FT                   /translation="MSVTMTEQRLQRVLAAHGVASRRKAEELILAGRVTVDGVVVRELG
FT                   RKVDPERQEICVDGKPLHSEPRRYIVLHKPVGYITTTADEYGRKTVLDLVQVPERVVPV
FT                   GRLDRDSSGLLLLTNDGDLIYRITHPRYELEKEYEVLVDGFPPPEVEEALRRGVPVDGR
FT                   PVRIRRLEAIRVEPQGTVYRVVIHEGRNRIIRRVFERVGYPVLRLQRVRVGPLRLGDLP
FT                   PGRWRDLTASEVAALRRAVGLPEFPEGAVGRERKARGGRGMPARRGDRRPSGVRKEHRR
FT                   R"
FT   gene            433800..434546
FT                   /gene="cmk"
FT                   /locus_tag="trd_0438"
FT   CDS_pept        433800..434546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cmk"
FT                   /locus_tag="trd_0438"
FT                   /product="cytidylate kinase"
FT                   /EC_number="2.7.4.14"
FT                   /note="identified by match to protein family HMM PF02224;
FT                   match to protein family HMM TIGR00017"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06064"
FT                   /db_xref="GOA:B9KY93"
FT                   /db_xref="InterPro:IPR003136"
FT                   /db_xref="InterPro:IPR011994"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY93"
FT                   /protein_id="ACM06064.1"
FT                   /translation="MVAGACQLVVAIDGPAGSGKSTVGAEVAKRLGALYFDTGVVYRVL
FT                   ALLALERGIAPDDAERLAQLAQNLSIRVGPPSIQDGRLYDVWLDGRDVTWAIRTPEIDR
FT                   LASLVSAHPPVRRALLRLQRELARNGRVVIAGRDIGTVVMPEAPVKIWLHASLEERARR
FT                   RQRDLARRGIVRSLEEIVAELADRDRRDATRAIAPMRPAEDAVIIDTDDRTIEEVVETV
FT                   LAVVRERCECANHGSDSAGVAPLAAP"
FT   gene            434503..435264
FT                   /locus_tag="trd_0439"
FT   CDS_pept        434503..435264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0439"
FT                   /product="Acyltransferase domain protein"
FT                   /note="identified by match to protein family HMM PF01553"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05639"
FT                   /db_xref="GOA:B9KY94"
FT                   /db_xref="InterPro:IPR002123"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY94"
FT                   /protein_id="ACM05639.1"
FT                   /translation="MDRIPPEWRLSRRRKIKTWIFLTARVFVVPLLRLLIRFRIEGLEH
FT                   VPRVGPALVAANHLHNADPVLIIAAFPRPVLFMAKRELFGVPVIRWFVRQSGAFPVDRG
FT                   RPDRQALRHAERLLHEGMLVGIFPEGTRSVTGTLQPPHPGVGLLIRRNPSVPVLPVAIW
FT                   GTEVLPFNGAKGRRPLRGWPRVTVRIGPPVTIALQAPEGRERSPEELADEVMLAIARLL
FT                   PDQYRGVYRERLVREPSSLVGVPTGDPGRVG"
FT   gene            complement(435753..436961)
FT                   /locus_tag="trd_0440"
FT   CDS_pept        complement(435753..436961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0440"
FT                   /product="Domain of unknown function (DUF362) family"
FT                   /note="identified by match to protein family HMM PF04015"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04778"
FT                   /db_xref="GOA:B9KY95"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY95"
FT                   /protein_id="ACM04778.1"
FT                   /translation="MADFPGKGKVAVLRTTPETVLADIGRAMLMAGYREALPRDRETIL
FT                   KINITWDTWYPGCSTTPWQLEGVIRRLKADGYGHLIAAHNRTVVVDAYKGERNNKHKYV
FT                   VDKYGVENVHLYEPHVEWVPYEPKSELLVLHKIFPEGIRIPKLFIGRNIIHLPTVKTHV
FT                   FTTITGAMKNAFGGLLNERRHWTHAVIHETLVDLLTIQQEIHPGIFAVMDGTFAGDGPG
FT                   PRAMRPHEKDIILASADQVAIDAISAKLQGFDPLSIPFIRIAHERGLGIGDPRKIEVIG
FT                   EDISNESWGFVAGDTFASRGQKLIYHGPLKPLENLLLRSPLVPWSYVASNVYHNVYWYP
FT                   VHGRRRVKEALQTKWGQLFLSYDDGKVVLPGPDPLGTAIVVGGLAALVAGTISVARWLR
FT                   RDH"
FT   gene            437184..438695
FT                   /locus_tag="trd_0441"
FT   CDS_pept        437184..438695
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0441"
FT                   /product="penicillin-binding protein dacF precursor"
FT                   /EC_number="3.4.16.4"
FT                   /note="identified by match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06283"
FT                   /db_xref="GOA:B9KY96"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY96"
FT                   /protein_id="ACM06283.1"
FT                   /translation="MQAETETPSIVAAAAIAIEAESGRVLYAKEPDAPRAPASLTKLAT
FT                   ALTAVELAPRDTVLTVQAQDLVGESSMGLRPGEQITLEAALYGLLLASGNDAAMTIARN
FT                   LSGLPGDTPEAAVNRFVKQMNLLAQRLGLERTTFRNPHGLDQEGHVTTARDLALLTRAV
FT                   LQRPELRRILQTPSYDDGVHAVQTTNRLLGRYPGLIGGKTGITEAAGYSLIEAAERDGT
FT                   TVIVVVLGSTRDAWYADAVQLLDYAFAQLAPAPAAGLAGSAAEASARDISASRPIGDAA
FT                   MTVGGPRALILEAPTPLPASNELWFWPASAVTTAVAAGVLASGFPAIMAVVIARRRAGR
FT                   RATLDRGQRRGRRPGPHSVRPARVRTDRRRSAVLPARDEGTQDASGRIVPFDPAVHVAQ
FT                   RAVRAARRGDIAVAEHEFLHALRLNPNFDLTRAPEFWTLSPAGVIAAAQAYRRVGRLRD
FT                   ARTLLTVARLSFGDLPAIRTALAELSAATNSPQLVIGRFSQRFET"
FT   gene            438760..439116
FT                   /locus_tag="trd_0442"
FT   CDS_pept        438760..439116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0442"
FT                   /product="HspR"
FT                   /note="identified by match to protein family HMM PF00376"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04475"
FT                   /db_xref="GOA:B9KY97"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY97"
FT                   /protein_id="ACM04475.1"
FT                   /translation="MRRSEPLYVISVAARLLELHPQTLRKYEREGFVTPSRTRGNLRLY
FT                   SAEDLERLRQVKYLVEERGVNLAGVQLALALTEQLQRLRERCLAISEQYDRVFDSVVAE
FT                   IDSMLQLLGSTPES"
FT   gene            439167..441779
FT                   /locus_tag="trd_0443"
FT   CDS_pept        439167..441779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0443"
FT                   /product="chaperone clpB 1"
FT                   /note="identified by match to protein family HMM PF00004;
FT                   match to protein family HMM PF02861; match to protein
FT                   family HMM PF07724; match to protein family HMM PF07728"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06295"
FT                   /db_xref="GOA:B9KY98"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017729"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR020849"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY98"
FT                   /protein_id="ACM06295.1"
FT                   /translation="MGRPQFTEKAQEALVTAQRTAAERQNSQLDVEHLLYALVTQHDGV
FT                   VPQVLLRLQLDPRRVAQELERVLETLPRLQYAAEPTISPVLRRVLERAQSEAQSFGDQY
FT                   ISTEHLLLAALDAAPRSPAVQALARLGVQRERVLEALSQIRGAQRVTSPNPESTYQALE
FT                   RYGRDLTALARQGKLDPVIGRDDEIRRVIQVLLRRTKNNPVLIGEPGVGKTAIVEGLAQ
FT                   RIVRGDVPEGLRDKRIVQLDLAAMLAGAKYRGEFEERLKAVLDEIRASEGEIIVFIDEV
FT                   HTVVGAGAAEGAMDAANMLKPMLARGELHAIGATTLDEYRKHIEKDPALERRFQPVFVD
FT                   EPSVEDTISILRGLRERYELHHKVRILDSALVAAAVLSHRYITNRFLPDKAIDLVDEAA
FT                   ARLRMEITSMPAELDELTRRITQLEIEREALRKERDEASRQRLAELERELANLREQEQV
FT                   LRSQWEQERQALERINALKEQIEQTRIEIEQALRAADYTRASELQYGRLVELERQLREE
FT                   ERRLADVQRQGRLLKEEVDADDIAEIVSKWTGIPVAKLMEGEMEKLVHMEERLHERVVG
FT                   QDEAVRAVSNAIRRARAGLQDPNRPLGSFIFLGPTGVGKTELARALAEFLFDDERAMVR
FT                   IDMSEYQERHTVSRLIGAPPGYVGYEEGGQLTEAVRRRPYSVVLFDEIEKAHPEVFNVL
FT                   LQVLDDGRLTDGQGRTVDFRNTVIIMTSNLGSEYIQALLPHREEEAYERVMQAVRAHFR
FT                   PEFLNRIDEIIMFRPLTREQLSQIVDIQLRQVRQRLKQRNITLQVTLRAKEWLAERGYD
FT                   PVYGARPLKRVIQRELLDPLANMLLRGEVRDGETVLVDVDEHGNLSIRSMLAEAEVVA"
FT   gene            441842..441970
FT                   /locus_tag="trd_0444"
FT   CDS_pept        441842..441970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0444"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05163"
FT                   /db_xref="GOA:B9KY99"
FT                   /db_xref="UniProtKB/TrEMBL:B9KY99"
FT                   /protein_id="ACM05163.1"
FT                   /translation="MDAVAEIAKLIVIAALIVFVPFLFMLIFDLAAHLGELFGRRS"
FT   gene            441988..442212
FT                   /locus_tag="trd_0445"
FT   CDS_pept        441988..442212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0445"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05850"
FT                   /db_xref="GOA:B9KYA0"
FT                   /db_xref="InterPro:IPR021320"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA0"
FT                   /protein_id="ACM05850.1"
FT                   /translation="MESLQAFGRLLIVMGLLLAILGVLLVLAGRIPFIGRLPGDIVYQR
FT                   GNFTLYIPLMSMLILSLLLTILLNLLFRR"
FT   gene            442267..443244
FT                   /locus_tag="trd_0446"
FT   CDS_pept        442267..443244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0446"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05974"
FT                   /db_xref="GOA:B9KYA1"
FT                   /db_xref="InterPro:IPR025645"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA1"
FT                   /protein_id="ACM05974.1"
FT                   /translation="MRLRAAFEWLLAAFVGLVALFLGIQGLSRSRWRLDTGQHFRRTGE
FT                   PEDEDDDRAFARAPFLSESSRERLLYFLPAERPLEPREAPEMLEHTRAIRYEARVRLLV
FT                   TDVDAVAVRIQEFAASVGGYTIDADVSSGTCSPSGRITVAVPAAQLSAFLDQLASFPGV
FT                   RAVEERSLRGQDVTGEVIDVEARLRAARTAEQRYLSLVERAERVQDVLRVEEELRRIRA
FT                   EIERLESQQRFLQERVSFAVVTVALRSARSLGQRVESAFRAGWDRGIGVMVDLANLGGR
FT                   LAALGSVIVPAGVVLVAFLRWFVSRLVMERQGVSSDRISEQPRD"
FT   gene            complement(443334..444425)
FT                   /locus_tag="trd_0447"
FT   CDS_pept        complement(443334..444425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0447"
FT                   /product="putative Methionine synthase, vitamin-B12
FT                   independent"
FT                   /EC_number="2.1.1.14"
FT                   /note="identified by match to protein family HMM PF01717"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05922"
FT                   /db_xref="GOA:B9KYA2"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA2"
FT                   /protein_id="ACM05922.1"
FT                   /translation="MYYRSDVVGSLLRPAYLIEARQQYEAGQLSAAEFKRLEDRAVDEA
FT                   IQLQEEVGLEVVTDGEQRRYAFFGHLVEAIEGFDKFGGWAIPFRDEEGRENLVRRPIVV
FT                   EKLRWKRNMCAEEFTYLRARTNRVGKVTLVSTMQAAVYWDKNKSTSAYPTIDSYLADIV
FT                   DITRREIEELIRLGCTYIQIDAPQYAALLDPKIREGYRIRGIDPDRIVDQTIELDNAVL
FT                   DGFDKQGIVFGLHICRGNNQSMFYASGGYDPIAEKVFRKTKFHRFLLEYDDERSGTFEP
FT                   LRFVPEDRIVVLGLVTTKKMRLESQEELIQRIKEAAKYVPLERLALSPQCGFASTWEGN
FT                   RITPEVQRQKLELVARTARLVWG"
FT   gene            444837..445871
FT                   /locus_tag="trd_0448"
FT   CDS_pept        444837..445871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0448"
FT                   /product="alcohol dehydrogenase, class III"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00107; match to protein family HMM PF08240"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04547"
FT                   /db_xref="GOA:B9KYA3"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR023921"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA3"
FT                   /protein_id="ACM04547.1"
FT                   /translation="MKVLVKLVATGLCHSDWHFAKGEAPVRFPMVVGHEGAGIVEKVGP
FT                   GVSEVQPGDHVVLCYIPACGKCRWCLSGLAAICDRGILIGQGTQLDGTFRLHNQRGEDV
FT                   AQFALVSAFSEYTVCPVDSVIKIDPDLPLDRACLVGCAVPTGWGAAVNRARVRPGETVA
FT                   IFGTGGVGMNAVQGAAMAGAEKVIAIDLVDWKLEKAKEFGATHTINPTREDPVQRVLDI
FT                   THGVGADVVLLTVSLVTADIIGQGVRATRKAGRTVIVGASDRRMDRMNITPYDFMLLAK
FT                   EIVGTIFGHNVPRVDIPRLLELYRDGKLKLDELVTKRYRLDEINQAFLDLEEGRLLRGV
FT                   LVFD"
FT   gene            446227..447270
FT                   /gene="aroF"
FT                   /locus_tag="trd_0449"
FT   CDS_pept        446227..447270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aroF"
FT                   /locus_tag="trd_0449"
FT                   /product="phospho-2-dehydro-3-deoxyheptonate aldolase"
FT                   /EC_number="2.5.1.54"
FT                   /note="identified by match to protein family HMM PF00793;
FT                   match to protein family HMM TIGR01361"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05568"
FT                   /db_xref="GOA:B9KYA4"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006268"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA4"
FT                   /protein_id="ACM05568.1"
FT                   /translation="MGREDRAMIVRLRPETDEQESEALAAALRRAGLDVTLLTLGGTPL
FT                   LSVNGRAVPPEVEQELLRHPAVEKLLRPDRPYCLAARSSRPDGTVVRVGPVEIGAKQPV
FT                   IIAGPCTVENRDQLLRIAEAVRDAGASMLRGGAFKPRTSPYSFQGLGERGLELLAEARE
FT                   ETGLPIVTEVLDTEQVELVARYADMLQIGSRNMMNFALLRKVAATGKPVLLKRGFAATI
FT                   EEWLLAAEYLLAGGNDQVVLCERGVRSFEPATRFMLDLNAVPLVRQLSHLPIIVDPSHG
FT                   TGLRELVPPMSFAAIAAGAHGIIVEVHTSPEAALVDGRQSIDPTTLASIVRRVRMLRDM
FT                   VEELVAV"
FT   gene            complement(447272..448252)
FT                   /locus_tag="trd_0450"
FT   CDS_pept        complement(447272..448252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0450"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06214"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA5"
FT                   /protein_id="ACM06214.1"
FT                   /translation="MSAQSSPLWPLLERALAQLYPGRRVRLVRMSAQPHVHRGFWHLEA
FT                   HLSPTHEQLAFAVLVLDREGTDRAAPERYAAVAANALPAPVLLATAADPDRLVLLFQVP
FT                   QGTNLDDELRRAAAPWRVSAAAISLARFFARLHSTPVHAFEPITTLQPASPTDEQRLSQ
FT                   LAAMAHDFDDPLRSSVERALDWIDQELDHSPALVPTVGCLRLPTLYEDSGEIATAFCWE
FT                   HLALRPAAVDLACLLPELRFLPAEGRAHFLAVCLAAYADVAPVAIDDVAPRALLDLIER
FT                   VLIVQSARASAATTSRDRAPDQEAVAFLDRAMRAARDGLPALALL"
FT   gene            448375..449580
FT                   /locus_tag="trd_0452"
FT   CDS_pept        448375..449580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0452"
FT                   /product="glycosyl transferases group 1"
FT                   /note="identified by match to protein family HMM PF00534"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05035"
FT                   /db_xref="GOA:B9KYA6"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA6"
FT                   /protein_id="ACM05035.1"
FT                   /translation="MRILVVSPVLPYPDRSGGAIRIAQLLRALAREHELTLLASKPARV
FT                   DPEEARAALDPITLIPVSAGWVIGEGPTTAKRLWQARSLVSSRSALYWILAGPLLDALR
FT                   RLDWQRFDIVQVEYSLLGLLPFPRSLPLVVDAHNLEYRVLERISQRSGWLRGLWVRREC
FT                   QRVRREEITAWRQAALCLAVSRVDAEEMRRFAARRVAVIPNGVDVRQTPFLPLDAAEPD
FT                   HIVFVGNLRYWPNVDGVLWFVRKVWPAVRARIPSARFSIVGYDPPSALGMLSAIEGVRL
FT                   VGTVPAVTPWLARASVIVVPLLAGSGTRLKILEAFAAGRPVVTTSLGLEGIDAEPGRHV
FT                   MVADDAASFASAVVDLLASSQRRAALAEAARRLVEQLYDWDRIGEQLRAVYRAFVGEER
FT                   IG"
FT   gene            complement(449544..450359)
FT                   /locus_tag="trd_0451"
FT   CDS_pept        complement(449544..450359)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0451"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06353"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA7"
FT                   /protein_id="ACM06353.1"
FT                   /translation="MRIMGIDFSAARDASRKIWLAFGNAVSDQLHIETLAPLETLADRP
FT                   LANASAVLARIIASSGPSIIACDACFGLPVPSSAAPWHTWLLSYPSRFADAEQLRQEGR
FT                   DAHGRERKRLTDRVARAPFAPTNLRIYRQTDSWLRSVLHPLVAADAVAVAPFERLREDR
FT                   PCLLEVCPSVSLREFGLPNLRYKGSDHLRRQCRCDILTGLTRLGLDLPSSLASRALDDP
FT                   GGDALDALIAAITAWLVVRQDLLACPLPAEAFIEGWIYYPILSSPTNAR"
FT   gene            complement(450364..450756)
FT                   /locus_tag="trd_0453"
FT   CDS_pept        complement(450364..450756)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0453"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05829"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA8"
FT                   /protein_id="ACM05829.1"
FT                   /translation="MNQWEALASDFADRVAEMTGQHLDFTLASLAILDDLLDEWLHLSQ
FT                   VYGSERPDDLSRLVLPLVSYVGETLRHAYGGTWIERPSGPVLCIAQTIELDLRPLVQAT
FT                   LAQQHPPAFARLAAALDRELEDRLGE"
FT   gene            complement(450728..450964)
FT                   /locus_tag="trd_0454"
FT   CDS_pept        complement(450728..450964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0454"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04734"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYA9"
FT                   /protein_id="ACM04734.1"
FT                   /translation="MTRVVQITVERPTRDPLHQNAPTELSSQAQFERHTISAVEHGWMC
FT                   PDPHCTALRRTTTSPQGTLQRGCRDEPVGSACQ"
FT   gene            451014..451928
FT                   /locus_tag="trd_0455"
FT   CDS_pept        451014..451928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0455"
FT                   /product="malyl-CoA lyase"
FT                   /note="identified by match to protein family HMM PF03328"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04753"
FT                   /db_xref="GOA:B9KYB0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB0"
FT                   /protein_id="ACM04753.1"
FT                   /translation="MHPERSVLSVPGGRPELFEKALRSDADLVFLDLEDSVVETAKAEA
FT                   RRNVVRAVNELDWRGRPRAVRINAVDSPYCYRDLMDLLEGAGNRIDLIIVPKVERPEQV
FT                   HALDILLDQLEAAGGIGHRVQLEVQLETASGILHAGSIAGACERLRALVFGPGDYAASV
FT                   GMPMSAIGMEDEWDAAYGAPRLQYPMHQLLVAARAYGLRAIDGPYADYRDNEGLRRAAR
FT                   RARALGYDGKWCIHPAQIPIVNEVFTPTEAEIAWAKEVLKAYHEAERQRRGALAIGSTM
FT                   IDAASVRMAESTLSRARAAGRGF"
FT   gene            452020..452238
FT                   /locus_tag="trd_0456"
FT   CDS_pept        452020..452238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0456"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06091"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB1"
FT                   /protein_id="ACM06091.1"
FT                   /translation="MRGLAKPGSVAGSLQLHLRVSGRLDGRLFAARPLLVPRRRAASGT
FT                   TEGLGRYDCPLGEIMVGYEQGAHAGKR"
FT   gene            452280..452738
FT                   /locus_tag="trd_0458"
FT   CDS_pept        452280..452738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0458"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04644"
FT                   /db_xref="GOA:B9KYB2"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB2"
FT                   /protein_id="ACM04644.1"
FT                   /translation="MSFDLWLWLLVLVSALLLVTIELTEDYLEQGWPRIRRPADGWASS
FT                   DSVHLLWTAVGMLVFPGIVLLLMNLAVIVWRELGMTLVLLLGSILLAFGWAAYLLLISQ
FT                   IGGVDQYLESIGITLPLAIVAVLLVGDLLLLVSLISVLPDVSLRGIVP"
FT   gene            complement(452695..453408)
FT                   /locus_tag="trd_0457"
FT   CDS_pept        complement(452695..453408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0457"
FT                   /product="redox-sensing transcriptional repressor rex"
FT                   /note="identified by match to protein family HMM PF02629;
FT                   match to protein family HMM PF06971"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05751"
FT                   /db_xref="GOA:B9KYB3"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR009718"
FT                   /db_xref="InterPro:IPR022876"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB3"
FT                   /protein_id="ACM05751.1"
FT                   /translation="MRNGPVPDIVVRRLPLYLRTLRQLQREGHRTISSEELAQLLGVTA
FT                   AQIRRDLSYFGRFGKQGYGYAVAALIHELEVILHLDRLWNVALVGYGKLGQAIAHYGEF
FT                   EPNGFRITAIFAKSPEHIGQIVNGIVVLPETEIDRVVREQGIRIGIIAVPPDAAQEVAD
FT                   KLVAGGVRAILNYAPTVLHVPPGITVREIDPISALQSMTFYLHDRHDASGNGQDEQSFA
FT                   DIMERSPVGKRPAAH"
FT   gene            complement(453510..455270)
FT                   /locus_tag="trd_0459"
FT   CDS_pept        complement(453510..455270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0459"
FT                   /product="glutamine-dependent NAD(+) synthetase"
FT                   /note="identified by match to protein family HMM PF00795;
FT                   match to protein family HMM PF02540; match to protein
FT                   family HMM PF06508; match to protein family HMM TIGR00552"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06323"
FT                   /db_xref="GOA:B9KYB4"
FT                   /db_xref="InterPro:IPR000132"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB4"
FT                   /protein_id="ACM06323.1"
FT                   /translation="MVEEMTRDTWRIALAQIDPTVGDFSGNVRLIRERAREAAQLGAHI
FT                   VAFPELVITGYPPEDLLLKVSFIDAARRALHLLLDAIPDRVLIVGVPWVESGILYNGAA
FT                   ILARGEIVAVVPKHHLPTYGVFDEDRYFARGSHTFRFLWGNLRFGVTICEDIWYPIGPA
FT                   SSLATRGIDLLVNINGSPYHRGKWIQRQVMLQTRAADAGCYLAYVNMVGGQDELVFDGN
FT                   SIVLDPNGTILARGTSFEEDLIVVDLPITRVLSSWLHDPRRRWLARAESQPALPVVDRE
FT                   IPLPVPGEQLPPLPESVQRPRTPLEGVAEVYQALVTGVRDYVRKTGFRTAVIGLSGGID
FT                   SSLTACIAADALGPENVTGLSMPSRYSSRHSIEDAEELARNLGIRFLIVPIEPVHRVFR
FT                   EVLAPLGNQPEEPDVADENLQARIRGTILMTYSNRFGPIVLTTGNKSEMACGYATLYGD
FT                   MAGGFAVLKDVPKLLVYQLARYRNSISPVIPERVFVKPPSAELRPNQKDVDTLPPFEIL
FT                   DPLLELYVEQDLSREELIRHGFDPEIVDRVIMMVDRAEYKRRQAAPGVKLTPRAFGRDR
FT                   RLPIANWFHG"
FT   gene            455404..457146
FT                   /gene="recN"
FT                   /locus_tag="trd_0460"
FT   CDS_pept        455404..457146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="trd_0460"
FT                   /product="DNA repair protein RecN"
FT                   /note="identified by match to protein family HMM PF02463;
FT                   match to protein family HMM TIGR00634"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05250"
FT                   /db_xref="GOA:B9KYB5"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB5"
FT                   /protein_id="ACM05250.1"
FT                   /translation="MLLQLTIRNIAIIREVQLEFGPGLTALTGETGAGKSILIDALGLV
FT                   LGARASSDLVRSGTPRAWVEAIFDLTGLEQATDLQAMLSAHGIDLEDGQLILSREIQAN
FT                   GRSVARVNGQAIPASVLAVLGARLVDIHGQSDHLSLLRADRQLELLDRFAGVLPLRNEL
FT                   ARLVREFRAVRRELEQLRMRTREREHRRDLLRYQVDEIARARLRVGEEEELVAERARLQ
FT                   NAERLASLATEVASSLDGDEFAPLDALRRAVLRLEELGRLDPEQRGLAEQLREALYTVE
FT                   EVVRTVRTYAESIEADPDRLTVIEERLDLLRRLKRKYGATVEEILAYAEEAQRELAALE
FT                   TGEETIAELERRADELARAVVEHARELSARRRAAARALEQAMSAAMRDLRLGQGAFAVA
FT                   FEQPDETGNEQERAAVCGETGWDRIEFLIAPNPGQELRPLARVASGGEMARLMLALKSS
FT                   LSEVDETPTLVFDEVDVGIGSRSAHVVGERLWQLSRAHQVIVISHLPQIAAFADRHYKI
FT                   NKTVVNGQTETAVHHLEGEARLEELAAMLDGIPVTPESLANARAMVERLERRKLQLVGA
FT                   GTGT"
FT   gene            457207..457512
FT                   /locus_tag="trd_0461"
FT   CDS_pept        457207..457512
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0461"
FT                   /product="conserved hypothetical protein TIGR00103"
FT                   /note="identified by match to protein family HMM PF02575;
FT                   match to protein family HMM TIGR00103"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05281"
FT                   /db_xref="GOA:B9KYB6"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB6"
FT                   /protein_id="ACM05281.1"
FT                   /translation="MQPNMRLLKQVQEQLAKMQAELAELVVEGSAGGGAVRVELDGLRH
FT                   VRRVSIDPTLVEAGDIEMLEDLVAAAVNDALRRVEEAVTTKMGALAGGLGLPLSGL"
FT   gene            457522..458490
FT                   /locus_tag="trd_0462"
FT   CDS_pept        457522..458490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0462"
FT                   /product="putative oxidoreductase"
FT                   /note="identified by match to protein family HMM PF00296;
FT                   match to protein family HMM TIGR03560"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06124"
FT                   /db_xref="GOA:B9KYB7"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR019952"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB7"
FT                   /protein_id="ACM06124.1"
FT                   /translation="MRIGLMIEGQEDVTWERWLRGIELAERLGFESLWRSDHLFSVLGV
FT                   PERETLALWPSLTVVALRTQCITFGQLVSPVSFRHPVELAQHAVALDHASGGRYVLGIG
FT                   AGWYEREHQAFGFPLLSVRERMDRLAEALEVIQLLWTGEEVSYEGQYFRLECAQLRPRP
FT                   QRGDRVPIVIGGRGEQRTLRLAARFADEWNVTNVDLDDHRRKIGLLREYCREQGRDPDS
FT                   IVCSWMVAHIIGRDQTELFERARRLAAWFPQWGDWPPEAILAEARRRNWLVGKPEEVVE
FT                   QIRARARIGVQRIMLQTFDLDDTDALALFASEIVPAVADAA"
FT   gene            complement(458554..460119)
FT                   /locus_tag="trd_0463"
FT   CDS_pept        complement(458554..460119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0463"
FT                   /product="flavin containing amine oxidase"
FT                   /note="identified by match to protein family HMM PF01266"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05048"
FT                   /db_xref="GOA:B9KYB8"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR018203"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB8"
FT                   /protein_id="ACM05048.1"
FT                   /translation="MTGPQYDAIVIGSGHNGLIAAGYLAKAGKQVLVLERRPIIGGATV
FT                   TEEHFPGYRLSTCSYVCSLLLPEVVRDLEMPKYGYEVRPFDPQYFVPFPDGRYLMVYLD
FT                   ERRTHAELAKFSRRDAERWHDYWAMWNRMIARFRPFILRPAPTLGELEQAFAGPDGLED
FT                   LRTLLLKSIAEVLDTFFESEEIKAPLCTGGVIGVNLGPKSPGTAYVKFHHLLGNLNGHQ
FT                   GAWGFVRGGMGSIAEALAGFCRDHGVTILTDAEVAEIDVSDGAARGVRLTDGRRFSARV
FT                   ILSNADPQRTFLQMVPANALPASFRDAITRMKVKGSVVKVLLGLNQLPNFRCLPGTEIG
FT                   PQHTGGIVINPSIDYLERAWEDCKHGRPSARPFMDCYIQSATEDGLAPPGKHVMSLYVQ
FT                   YAPYDLAEGTWEERKDEIGRNIIDTLAEYAPNMWDAIEHMSVLGPRDIEDVIGITGGNI
FT                   FHGEITPDQMFVFRPAPGFSGYESPIERLYLCGSGAWPGGAVFGAPGRNCALQVLADLE
FT                   RRGG"
FT   gene            complement(460476..461069)
FT                   /locus_tag="trd_0464"
FT   CDS_pept        complement(460476..461069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0464"
FT                   /product="putative cytochrome c subfamily"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04921"
FT                   /db_xref="GOA:B9KYB9"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYB9"
FT                   /protein_id="ACM04921.1"
FT                   /translation="MARSPIRSKTARRLVLGLLAGTALALLGSACVSSNTYPIDFFSEM
FT                   HYQKSFRAQEPPRLDVPAGVVPITGGEPQYTLEEARNLQNPLANDPQAAARGQQLYAVN
FT                   CVACHGPQGDGKGPLSVYWGLVQGAVPPSNLKDPAVVSRTDGELYWILTNGYTSPQNQV
FT                   QYPHNLTNMPAFGKLLTPEQRWALVSYIRQLQKQ"
FT   gene            complement(461093..461632)
FT                   /locus_tag="trd_0465"
FT   CDS_pept        complement(461093..461632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0465"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04674"
FT                   /db_xref="GOA:B9KYC0"
FT                   /db_xref="InterPro:IPR021776"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC0"
FT                   /protein_id="ACM04674.1"
FT                   /translation="MAIREVLGLYRDLDSAVAAADALRDAGFSRSEFEVLSNAPYPEGT
FT                   FGEESGIHRLFVFPLIGAACGFAAGLLITGGTQLSYPLLTGGKPLLSIPPMIIIMYEGT
FT                   MLGALIFTVLGVLFESRLPWIGRALYDPRITQGYIGILVRTAPEREARAIEALRKANPE
FT                   DILTESGNAGRQPARS"
FT   gene            complement(461666..463039)
FT                   /locus_tag="trd_0466"
FT   CDS_pept        complement(461666..463039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0466"
FT                   /product="probable molybdopterin oxidoreductase, membrane
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF03916"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05716"
FT                   /db_xref="GOA:B9KYC1"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC1"
FT                   /protein_id="ACM05716.1"
FT                   /translation="MQERHRLGEEEITRELLRPLMTTPAMMWVGFIGLGAVLAIFVFAV
FT                   SWMFYWGLGVTGLQRPNMWGFMIVNFVFWIGISHAGVMISAILRLTQAEWRRPVTRAAE
FT                   VMTIFSLMTAMLHPVIHTGRPWRTLYWVFPYDFWRNLWPDVRGPLVWDPSAILTYLTGS
FT                   TLFLYTTMIPDMALARDRTTGWRRVLYTILALGWRGNERQWKMQTIAGFLLSGLILPVF
FT                   VSVHSIVSWDFAVSLVPTWHATVFAPYFVIGAIHSGVSAVVTLMALMRWLFRFENYIRL
FT                   EHFDAIGRLLIAVGTGWLWFFLLDIFFAIYPQEARELEIMQFRLFEWPFNVLTALIFIF
FT                   GYFIPVPIWVFQRFRRNVKIMFWTSILVNVGMWAERYWLIKPGLMRKYEFTFDWNWYRP
FT                   SIVEISIVLGSFALVGFLLLVFSKIFPPISVWEEKEGQHFAQQLRVGKRVVNAIVREF"
FT   gene            complement(463085..464479)
FT                   /locus_tag="trd_0467"
FT   CDS_pept        complement(463085..464479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0467"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04801"
FT                   /db_xref="GOA:B9KYC2"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC2"
FT                   /protein_id="ACM04801.1"
FT                   /translation="MATHGHAHGHELQRTWELAPADVLGSALRWMRSTAAALRRPLVIA
FT                   AILFVIGIVAIVAFPLRQGFANRQAWTYVAAAFLYLMSTAAAAPALSTALRVARSHWRR
FT                   PVNRASEIWAVTLVIPFLLYLLLLPTFPGTEDRLSVWFGWPLSPWLWGAILLLTLTGAG
FT                   YLFAWFSSLPDLAIVRDHGEPAQRGLAAWLSRGWVGSHRQWRIYEKVVNNIGVLYVLIY
FT                   VPVMTVLASDFIIALIPGYFTAVFPAYFTITSFQAGIALTIVTMAVLRRWGGQADYLGR
FT                   EQFWALGKMLLAFSLLWFYFWWSEFIIFWYGRTPREIDILRFLMFETYLWPFILSFAMN
FT                   FALPLLILMWNPIRRSIAGPTVVAAIVLLGNLIDRIRLASAAFSQPDKALLGHAHALKA
FT                   IPPAYIPGIGDMLILIGMLAGALALVLWTARYLPFPSVAEVVGGLWLRAHQPFKHARLI
FT                   VIGKTE"
FT   gene            complement(464509..465234)
FT                   /locus_tag="trd_0468"
FT   CDS_pept        complement(464509..465234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0468"
FT                   /product="oxidoreductase, iron-sulfur cluster-binding
FT                   subunit"
FT                   /note="identified by match to protein family HMM PF00037"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06076"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC3"
FT                   /protein_id="ACM06076.1"
FT                   /translation="MPRWGMVIDLDRCIGCGACVVACQAENNVPINTEDVYHQRRAIAW
FT                   IRLERYWEGEYPNIKARYIPVPCMQCTNAPCEPVCPVYATYHTNEGINMQVYNRCIGTR
FT                   YCAVNCHWHVRFFNFWEPKWPDSLKNQLNPDVTVRSRGVMEKCNFCVHRLVKAEQKAKT
FT                   EKRSLRTDEVTTACAQACPTSAIVFGDLDDPNSAVSKLLAQAEQEGRVYRLLEDLGTDP
FT                   KVYYLKKIDLEAAEHAATH"
FT   gene            complement(465271..467526)
FT                   /locus_tag="trd_0469"
FT   CDS_pept        complement(465271..467526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0469"
FT                   /product="putative 4Fe-4S ferredoxin, iron-sulfur binding"
FT                   /note="identified by match to protein family HMM PF00384;
FT                   match to protein family HMM PF01568"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04581"
FT                   /db_xref="GOA:B9KYC4"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC4"
FT                   /protein_id="ACM04581.1"
FT                   /translation="MEMGMRRRDFLKVAATSATGAVLFAGCGRIGDGVPESEFKIAQPV
FT                   FNTNDWVYGRDAWFATAAPPDQGGYGLIVRVFEGRAKKVDGNPDFPGIHGKSDARAQAL
FT                   VQELYHPDRLSGARRATSRGSGQFQTIPWDSALQEVAQILREVGGEHAVLITGRLNASQ
FT                   AAIVAAFRKATGIRQAVLEPDEFVVLRTAIRRLFGVSTLPIPDLANARFLLNFSADFLH
FT                   GWIAPVALAHAYGEFRQGKPGQRGLYYHVGPRLSGTAANADRWFPIIPGSEGLVALAIA
FT                   QVLSTEGKAPQDRLDPYLTALGLDATRLASDYAPERVAPATGLSAEQIRELAHALVEHQ
FT                   PAVVIAGTSAAAATNGLFNLVATFGLNWILGSVNQPGGLLLNPEPPLPDLRVPDDAILS
FT                   LRGWTELFEQIRSGTISTVLVYRANPVYALPSASGAREALQAAKHVVSFSPFLDETTTL
FT                   ADLVLPDQAWLEQWGLSVPDPGPGFAAVAIQQPVVAPFLDARAFGDVLLDLLRLLGQDQ
FT                   PWSTQEQATKALALQLRSLGRGSVTATNDKEFLVTLQARGGWWDEQSRATGSAPSTAAV
FT                   QPREPAFAGEQNQFPYVLHPYPLPSLGYGELAHLPWLQGLPEPISTNVWQTWIEVSQAT
FT                   ADELGLQTGDLVRVLTPQGVAELPVYVNPATQPGIIAIPFGQGHTAYTRYAEGRGVNPA
FT                   TLVAPETEPDTGTFAWAATRCRIEKTGRRARLARFEGMVPAFQLEEFPIVRVMAPKA"
FT   gene            complement(467567..468100)
FT                   /locus_tag="trd_0470"
FT   CDS_pept        complement(467567..468100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0470"
FT                   /product="chaperone protein HtpG"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05904"
FT                   /db_xref="GOA:B9KYC5"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR020942"
FT                   /db_xref="InterPro:IPR029467"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="InterPro:IPR039118"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC5"
FT                   /protein_id="ACM05904.1"
FT                   /translation="MRYVRLILFVLIVLVVMAVPLALVLARSYFLAPTAQPVKAQPIQF
FT                   PHSVHVQAVGLDCTYCHRNATTSAQATLPPLELCMQCHKIIPTQGRPELEKLVAAFQQG
FT                   QPILWNKVHQLPDHTHFVHSVHLSFGFQCSTCHGDVGAMGKPGVKQVRDLRMGDCITCH
FT                   QQNGARTDCSVCHY"
FT   gene            complement(468159..468449)
FT                   /locus_tag="trd_0471"
FT   CDS_pept        complement(468159..468449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0471"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06236"
FT                   /db_xref="GOA:B9KYC6"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC6"
FT                   /protein_id="ACM06236.1"
FT                   /translation="MTPAVVTAEQWQQIHQTLIWFWAFLGCIVVFAANMLVAYAIIPSL
FT                   VSTRDLPAKVAAIRPVLFALAAIFLIAAVFAFVNVVNGIQVLYEIWPQRWI"
FT   gene            468663..469055
FT                   /locus_tag="trd_0472"
FT   CDS_pept        468663..469055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0472"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05657"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC7"
FT                   /protein_id="ACM05657.1"
FT                   /translation="MARPSDAYVTICARYARWLGKGLQPEPGDWLVNQEGHPHAVTLVT
FT                   SPQRAAGEEEILVPSLERLLAELAKECASFVIDYSGGEFACVAFDEQGRSLANVVASDA
FT                   SAAVAQALVFIRAERAAQERATRSPQ"
FT   gene            complement(469082..471022)
FT                   /locus_tag="trd_0473"
FT   CDS_pept        complement(469082..471022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0473"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05991"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC8"
FT                   /protein_id="ACM05991.1"
FT                   /translation="MRPLLVVLHDRPLQSLRAAGRFWEIAPTESAAELTGLLYPILTDA
FT                   WQVALALERLGELAEAALCILAERRLPLSPNEIARALGRDEGATIAVLRQLYVAGLLAS
FT                   EPSGEGPRVFLPNEVARVIQRLEHERSDPIGPDGPLPALFGQLTDHELLELAERYGLAV
FT                   IPSVTSRDQALGYLVSRLVDPTVLYRICTGLSPRARQLLTHLESRRAPIPLSELLRDRR
FT                   WTFGELRRTVSELARYGLVWRTFEGSARCLMVLPTLTLGTSSTPTPQPIDDVSVTTQAP
FT                   PQAAVLDLLLLLACSLRSGTAWPRESRPPRPLVAAIARQHWFWEDASDSLAYFIFLRRC
FT                   AGSLGLLTPQGELARPRLAAWLRASFAEQGRRLFRVWSATSDPRDRELLPALVRQLRTL
FT                   RVGAWYAWNEVVRESLGGTSSEREEARLQELEWLGIVQRGRTADGTRAIRLTSWGSWAL
FT                   GILRSVPQIDMRALFQTENGLTLELPVLTPEITWIASQLGTLQSSRPVPTWLLSARTVE
FT                   DFVRTELRSGSFSLSLTDLPTAVIELLERALGSPLPSSWQESVRAWLAHSRPAVVRPAL
FT                   AVRFASTSDRDQAWALLEKVVESITPLDDTTLVAWLPETRVRRTIESVLRKGGFLVELQ
FT                   DHAGTDHRTKR"
FT   gene            complement(471206..472387)
FT                   /locus_tag="trd_0474"
FT   CDS_pept        complement(471206..472387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0474"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05397"
FT                   /db_xref="GOA:B9KYC9"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYC9"
FT                   /protein_id="ACM05397.1"
FT                   /translation="MHGDEQHLLASVHGRYTEWRVSRPGHWYDRRFSPNPVLRARADDA
FT                   GPNGVARARPFMIGGDTMRRGVLVFVIAGVFSFVAWSFRDPEMVTGTLERLSPRVVLAL
FT                   LLVLSANEAIKAIRWAWYLRAAQLPLRFRDSITSYLAAQAASALPGGSILSARLAEEHA
FT                   KGRIGLRHTAPPLIAQGLGDVFAVALLALIGIAASPQPNAQLVAPVAALILALLLITIA
FT                   RSERSGTALVGVLRRWRLTRRLVPVEEDARRTLVALLNGRALIPGTMTSIASSLCAVAI
FT                   LIMLANALTVRGLAPLEGLYVHGMSMLAHLFLPVPNGFGTTEISLVGLLNWIGIGFGRA
FT                   TAIAITYRALGIGFRTLIGLAVLLLRYHHLIQLRSPAQPVPTTLLDVASEASD"
FT   gene            complement(472399..473826)
FT                   /locus_tag="trd_0475"
FT   CDS_pept        complement(472399..473826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0475"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05537"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD0"
FT                   /protein_id="ACM05537.1"
FT                   /translation="MRERTRPFLHCVCAVLLLIMLPIQSVRAVSTLTVGQPATVMGTNG
FT                   DGLNLREGPGYDFTVIVVMPEGATVRVIGGPQPDARGNLWWNVQWGEKSGWALANYLAP
FT                   SNDENRPSSSFQMRATFRIFAHSLGLVGERTANGHVIQPNDFFVTLPCTCALSSRGGHE
FT                   FQVLVEYKGRSLVLPVWDVGPWNVDDDFWNPPEVRRWKGLPQGVPAAQAAYFHGYNGGK
FT                   DGWGRPVRSPAAMDIADGAFAALGMTQSDWVTVTFLWLVKDPPSPLPAPPRGYEEIVTV
FT                   HPGERPPLDPVAAADPARYIYMPETGHNVPVFLHTAWQQGGGWQRYGLPISEFFREVGI
FT                   DGTVRFVQYFERAVLLYDPASGNVSELPVGYYAAAPFEAWQPVELFPDSTDRLYFRETR
FT                   HSLSNGFKAYWSANGGRAVFGLPITEEFRVDLPDGRWYIAQLFERARLEWWPDRIGQPD
FT                   EITRGRIVAEIVAAQYP"
FT   gene            474162..475004
FT                   /locus_tag="trd_0476"
FT   CDS_pept        474162..475004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0476"
FT                   /product="transketolase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00456"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04905"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD1"
FT                   /protein_id="ACM04905.1"
FT                   /translation="MTVIETRLTPDRLEELESLARRLRRTVLIMTTEAGSGHPTSSLSA
FT                   VEIMVALYFGGLLRYDPARPDWPDRDRFILSKGHAAPILYAVLAEAGYFAKDLLRTLRK
FT                   LGSPLEGHPNMRRLPGVEASTGSLGQGLSIGLGHALAARLDGRDYHVFVLLGDGEIEEG
FT                   QVWEAAMAAAHWRVSNLVAIVDHNGYQQTGPVAAVTDPREYAMKWRAFGWHVEEVNGHD
FT                   LEAVHEVLRFARAYRDGPVCIIAHTVKGKGVSFLERDFTWHGRAVPRDRLERALEELA"
FT   gene            475001..475963
FT                   /locus_tag="trd_0477"
FT   CDS_pept        475001..475963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0477"
FT                   /product="Transketolase, pyridine binding domain protein"
FT                   /note="identified by match to protein family HMM PF02779;
FT                   match to protein family HMM PF02780"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05738"
FT                   /db_xref="GOA:B9KYD2"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD2"
FT                   /protein_id="ACM05738.1"
FT                   /translation="MNIGTRAGLRMGKATRDAFGEALRDLGGVYPDLVVVDGDVSNSTR
FT                   TEYFAQAFPQRFFNVGIAESNLIGVASGLAASGKRVVAASFACFLLCNAFDQIRMGVAY
FT                   PRLNVKLVGSHAGISIGEDGPSQMGIEDVALALSLPGVAVLVPADEHATRAATRAMLEW
FT                   EGPTYLRLGRPPVPVIYEPPVDFVIGRAFRLREGNDVTIIANGLMVAMALDAAEELAAR
FT                   GVQARVLDMATVRPLDVDAVIAAARETRGIVVAEEHLHYGGLGSVVAMAVSQHHPCPMR
FT                   FVDLDDRYAESGAPDDLLRAYGLTSERIVAAALELTERI"
FT   gene            475966..476679
FT                   /gene="rpiA"
FT                   /locus_tag="trd_0478"
FT   CDS_pept        475966..476679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="trd_0478"
FT                   /product="ribose 5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="identified by match to protein family HMM PF06026;
FT                   match to protein family HMM TIGR00021"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04945"
FT                   /db_xref="GOA:B9KYD3"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYD3"
FT                   /protein_id="ACM04945.1"
FT                   /translation="MGTERAKERAARFAASLVEDGMIVGLGSGSTAELAVRALGERLHD
FT                   GLRLIGVATSQRTAALARRVGIELRDPDSVDRIDLAIDGADEVEERSLGLLKGRGGALV
FT                   REKLVARMARRLVIIIDDSKLVAALGARFPLPVEVVPFGWRWCARWLEDLGGRPTLRCR
FT                   PTGHPFRSDNGNLILDVAFGAIADPAWLDRTIKMLPGVIDHGLFLDMADLVIVGSETGI
FT                   RLLERSRTVSETSKS"
FT   gene            476967..478361
FT                   /locus_tag="trd_0480"
FT   CDS_pept        476967..478361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0480"
FT                   /product="LysM domain protein"
FT                   /note="identified by match to protein family HMM PF01476"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04489"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="InterPro:IPR039564"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD4"
FT                   /protein_id="ACM04489.1"
FT                   /translation="MPSRAIPQLFLRRDCQVSLAPLRALRYSVRTQCPFTVAEKGEAVT
FT                   MGLVERYVERERWRRRLQLEMAPAQDPEPLVRFGRSALPRARGGRRRWLAGLGVIAALA
FT                   AERADATTLHVVQPGETLSQIATRYGVSVPDLARANELSNPDRILVGAVLRIPASLLVS
FT                   ERVHRVRPGERLTSIAQRYGVSVESIRQANRLPDPDRILVGQMLVIPSVPETAMDTSAS
FT                   SSARRYVVQPGDTLSALAVRFGVPLSTLVKANGITDPDRLLAGQTLVIPRRELGAGVLL
FT                   AGVPAYRQSLPLSCESAAVSMVTAYWGKPVSEWVFIENLPSHPNPHRGFRGNMSGTFGG
FT                   TDDYGVYAEPFIPILERYGFRAQAVYARGDVSVLREELSLGRPVVVWMTNLASVQPRLI
FT                   GEADGERFILVPQEHAFVVYGYDEERVYVVDPGDGQYRSFGWEDFLRSWGYFDGMLLRI
FT                   LPAPWG"
FT   gene            complement(478358..478855)
FT                   /locus_tag="trd_0479"
FT   CDS_pept        complement(478358..478855)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0479"
FT                   /product="putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05767"
FT                   /db_xref="GOA:B9KYD5"
FT                   /db_xref="InterPro:IPR008457"
FT                   /db_xref="InterPro:IPR032694"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD5"
FT                   /protein_id="ACM05767.1"
FT                   /translation="MSEWVWALVRWVHLVAMAIWLGGQLFLFLVVRPVLRSQLDRPTQT
FT                   QLTAAFGRRYSPLAWISLIVAILTGFAIGEHRGVAWSALVSFPSAYGTLLIMKMTLVAL
FT                   ILVLTLLHGRFIGPQLTELARSLDPRDRQRYRQLLDLSVLISTANLLLTLLIVLLSARL
FT                   VA"
FT   gene            478881..479021
FT                   /locus_tag="trd_0481"
FT   CDS_pept        478881..479021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0481"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04487"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD6"
FT                   /protein_id="ACM04487.1"
FT                   /translation="MFLPYVSVSDAVRSMRAGPVEAQAVTAVRSGSGHPTLALAQVCCM
FT                   E"
FT   gene            479213..480406
FT                   /locus_tag="trd_0482"
FT   CDS_pept        479213..480406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0482"
FT                   /product="NAD(P) transhydrogenase subunit alpha part 1"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF01262; match to protein family HMM PF05222"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05374"
FT                   /db_xref="GOA:B9KYD7"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD7"
FT                   /protein_id="ACM05374.1"
FT                   /translation="MLYERAAVVQQASSGPGLVIGVPRERAPRERRVAATPETVARYLK
FT                   RGFRVIVEQEAGLAAGFPDEEYRQAGAEIVAEPGDLYRRASVIIKVQRPLPEEIEFLQP
FT                   GHVIIAFLQPLIAPELVAVLAERGVVAVSMDTIPRITRAQPMDALSSMSTVAGYKAVLL
FT                   AANELPKFFPLMMTAAGTIRPAKVLVLGAGVAGLQAIATARRLGALVEAFDTRPVVKEQ
FT                   VESLGAKFLELDVTTEEVGGYAKELAEEHLRREQELIHRHCLEADVVITTALVPGRRAP
FT                   LLVRETTVREMRPRSVIVDLAAEMGGNCELTVPGETVVRYGVTIMGPLNLPSEMAYTAS
FT                   QMYARNVATLLEHLAPKGEFVWNLEDEITRGVVLTKDGTILHGPTLERLKEIKEEVR"
FT   gene            480403..480756
FT                   /locus_tag="trd_0483"
FT   CDS_pept        480403..480756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0483"
FT                   /product="NAD(P) transhydrogenase, alpha-2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06332"
FT                   /db_xref="GOA:B9KYD8"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD8"
FT                   /protein_id="ACM06332.1"
FT                   /translation="MNQEFLLGLYVLILTIFLGFEVISRVPTLLHTPLMSGTNAIHGIV
FT                   LLGGILVAGTAENPLTLLLGFLGCLFGAGNLFGGIVVTDRMLEMFKKKEPAARQAGERS
FT                   TAKAPEKEVVGQR"
FT   gene            480753..482156
FT                   /locus_tag="trd_0484"
FT   CDS_pept        480753..482156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0484"
FT                   /product="NAD(P) transhydrogenase, beta subunit"
FT                   /note="identified by match to protein family HMM PF02233"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04966"
FT                   /db_xref="GOA:B9KYD9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYD9"
FT                   /protein_id="ACM04966.1"
FT                   /translation="MIENLRDAVVDLVYLVCAVVIILGLKRLSSPRTARSGNKLVAAGL
FT                   LVAVGVTLLDPHIHWRPANIAVMLIGTVVGAAGSIYLARVVPMTAMPQMVALFNGMGGA
FT                   TAALVAVAEFQRFVASGAVTAGERVSVAFGTTVGSVAFTGSVIAFLKLQELMTGRPVRF
FT                   PLQIPLNVAVVAGIVAMWAWLLGFAGSSASVWIMFGLALLFGILLVLPVGGADMPVVIS
FT                   VLNSMTGLAAAAAGFVLENQILVVAGALVGASGSLLTILMSRAMNRSLANVLFGAYRTR
FT                   AAGAAVAEAKPIRETTVEDTAVLLAYANLVIIVPGYGLAVAQAQHELAELANELEKRGV
FT                   EVKFAIHPVAGRMPGHMNVLLAEANIPYDKLYEMEQINEEFQRADVALVVGANDVVNPA
FT                   ARTDPSSPLYGMPILNADQAKNVIVLKRSMRPGFAGVENELFHMPQTRMLFGDAKETLK
FT                   RLVEAVKSV"
FT   gene            complement(482356..482514)
FT                   /locus_tag="trd_0485"
FT   CDS_pept        complement(482356..482514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0485"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05318"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE0"
FT                   /protein_id="ACM05318.1"
FT                   /translation="MRPIDTPGLSFEIHLREGTLDPPRQPYTVFLDLTVMTVWFLSFAI
FT                   SRTAPNE"
FT   gene            482607..483002
FT                   /locus_tag="trd_0486"
FT   CDS_pept        482607..483002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0486"
FT                   /product="conserved hypothetical protein"
FT                   /note="chain A, Crystal Structure Of Tm1620 (Apc4843) From
FT                   Thermotoga Maritima; identified by match to protein family
FT                   HMM PF02627; match to protein family HMM TIGR00778"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06120"
FT                   /db_xref="GOA:B9KYE1"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE1"
FT                   /protein_id="ACM06120.1"
FT                   /translation="MRAEKGDGTTMTQQSRLEQFRAYRARMNQRIGEIGHREINRFFAL
FT                   DSATYRDGALDARTKELLGLVASLVLRCNDCVDYHLDRCVALGWSDAELYDAMQVALMV
FT                   GGSIVIPHLRHAVETLDLLRAERHERD"
FT   gene            483080..484351
FT                   /locus_tag="trd_0487"
FT   CDS_pept        483080..484351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0487"
FT                   /product="carboxyl-terminal processing protease"
FT                   /note="identified by match to protein family HMM PF00595;
FT                   match to protein family HMM PF03572; match to protein
FT                   family HMM TIGR00225"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04592"
FT                   /db_xref="GOA:B9KYE2"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE2"
FT                   /protein_id="ACM04592.1"
FT                   /translation="MRAETRPKRNSGSSRGPWVLLSLALFLAGFAIGQEWPRPLATPTP
FT                   AIMPTAAVMPTPVAVFSEAWSLLHEHYVDPAALDDQRLLAGALRGLADAVGDNGHTRYL
FT                   TAEELAQHSEQLSGEYSGVGIEISEQDNTIVVRDVFAGSPAARAGIQPGDVLVAVDGIP
FT                   VSELGLDGVVQRVRGPEGTVVTLVIQQVGKASPLEVRLVRSKVRFSGVRWAVLAERVGL
FT                   LRVSSFAAGTAEDARQGLSELAAAGARGVILDLRGNPGGLVDQAVDVAGLFLPPDTVVL
FT                   RSRDRSGKETVYRTKPDAQPVTLPLVVLVNRETASAAEIVAGALQDHRRAVIIGERTFG
FT                   TGTVLAEFRLRDGSALLIGTQVWVTPNGRVIWRNGIEPDITVAPAAEDVTIVPRRGEIL
FT                   PAEQIRSDSQLLAAWEYLLERDRA"
FT   gene            484378..484782
FT                   /locus_tag="trd_0488"
FT   CDS_pept        484378..484782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0488"
FT                   /product="hypothetical conserved protein"
FT                   /note="similar to BH1559 unknown conserved protein in B.
FT                   subtilis; identified by match to protein family HMM
FT                   PF03745"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05462"
FT                   /db_xref="InterPro:IPR005500"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE3"
FT                   /protein_id="ACM05462.1"
FT                   /translation="MREPDVSGNRASPPDAWRVASELYQAGDLFGCHEILEHVWRATEG
FT                   SLREFYRGLIQVVVGLYHAQRGNRVGARAVLARGLARIEQYPEDCLGMDWGPFRRSARC
FT                   YLEWLESGMEGAEPARPVWPRERYLDPTVQ"
FT   gene            484795..485535
FT                   /locus_tag="trd_0489"
FT   CDS_pept        484795..485535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0489"
FT                   /product="uncharacterized proteins, LmbE homolog"
FT                   /note="identified by match to protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06299"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE4"
FT                   /protein_id="ACM06299.1"
FT                   /translation="MVRVPERPESVLVIMAHPDDAEFICAGTVARWASQGSQVIYVLVT
FT                   SGDKGSNDPTMTPERLAALREAEQREAARILGVEHVEFLRYRDAEVVADLGLRREIVRM
FT                   VRRFRPSAVICQDPTARYYGQSYIQHPDHIAVGEATLAAVFPSARDRLTFPELLAEGLE
FT                   PHIVAHVYLAGAREPDVFVDITPFFEKKLAALKAHRSQLGDWDPEPMLRLWAQDTAAEA
FT                   RRRGWPGSEEMLLAEAFKYFAIGE"
FT   gene            485878..486864
FT                   /locus_tag="trd_0490"
FT   CDS_pept        485878..486864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0490"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03706;
FT                   match to protein family HMM TIGR00374"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05003"
FT                   /db_xref="GOA:B9KYE5"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE5"
FT                   /protein_id="ACM05003.1"
FT                   /translation="MRRVVLGIIVSLVFLGLALRGQDFPALGAALRAADYWWLLPAIAV
FT                   YFCGVVVRALRWATLLAPVRRLTWRQLFPVVAVGYMANNVLPFRTGEVVRAYAVSRQFG
FT                   VSKTATLATIVLERLLDGLTMLAFILVAASAVALNSALRHVAIVAAAIFVPAFGLLVLS
FT                   ARSGRVVRFVYWIVRLVPRGVRQRTERSVESGFQGVAVFRSSAALGRVAGLSVLAWLAE
FT                   AAMYAAVARAFGLELSAAIVLLTTAVANLATLIPSSPGYLGPFEAGVLLVLAGLAGVPR
FT                   TIAFSYAIVLHAALYFPITLVGLLYWSKLQLDWVAIRRAESEEAVRL"
FT   gene            486861..487697
FT                   /locus_tag="trd_0491"
FT   CDS_pept        486861..487697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0491"
FT                   /product="putative undecaprenol kinase"
FT                   /EC_number="2.7.1.66"
FT                   /note="identified by match to protein family HMM PF02673;
FT                   match to protein family HMM TIGR00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06101"
FT                   /db_xref="GOA:B9KYE6"
FT                   /db_xref="InterPro:IPR003824"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYE6"
FT                   /protein_id="ACM06101.1"
FT                   /translation="MNVWQAAVLGIVQGTTEFLPISSSAHLIVLPWLFDWPEPGLAFNV
FT                   ALHLGTLSAVLAYFWRDLIQIGRAWFAGLIRLRPLEDSASRLGWAVIIGSLPAGLAGFF
FT                   LNDVIDHFFHSGGGGDTAIVFTSLLLIVLGFVLWLAERYGTRWRSLGELGLRDGLVVGL
FT                   AQALALLPGVSRSGSTITASLFLGFARPAAARFSFILGIPAIAGAGLLETLKLVETGLP
FT                   AEQRVLFVTGVASAAITGFLAIAFLLRFLQRYSTSIFIVYRIALGLVLLLVVSFAR"
FT   gene            complement(487703..489337)
FT                   /locus_tag="trd_0492"
FT   CDS_pept        complement(487703..489337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0492"
FT                   /product="putative transport protein"
FT                   /note="identified by match to protein family HMM PF07690;
FT                   match to protein family HMM TIGR00711"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04777"
FT                   /db_xref="GOA:B9KYE7"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE7"
FT                   /protein_id="ACM04777.1"
FT                   /translation="MTAAPRTRWLGLASLALGLAMIIVDATIVNVAIPSIIEDLGLQLT
FT                   DAEWVNTVYSLVFAALLVTVGRLGDLYGRKRIYLGGLALFVGASLLCASAPSGTLLIAA
FT                   RALQGIGAACILPSTLSSVNAMFRGRERALAFGIWGSVIGGMAALGPLVGGWLTTDFSW
FT                   RWAFYINLPIGLVAGTIALLTVPETRDPSAAPGIDLIGIVTSAIGFAALVFGLIEGERY
FT                   GWWRPTDTFRIGSWEWPFATLSPVPVALALAALFLPTFALYELRRVRANRPVLLDLRLF
FT                   RYRTFRWGNLAALIVSLGEFGIVFVLPLYLQAVLGYTAFQTGLVLLATAIGAFLGGPAA
FT                   ANLAQRFGARQVIRAGMLFEAVGLLLIVPFLAPDTTGWRLAPALFLYGLGVGLATAQLT
FT                   SVILAEVPTAQSGQASGTQSTTRQVGAALGIALLGTILAAGLGSGTKSRLIDQLGIPPQ
FT                   QAAALARAAKQSAGQILVQLQTQPGTQPIVQAIEAAFTDAARRTALVAAAFILVGFIAS
FT                   WLIPDIRPERGPTAVSEPATAESRPTG"
FT   gene            complement(489566..489910)
FT                   /locus_tag="trd_0493"
FT   CDS_pept        complement(489566..489910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0493"
FT                   /product="protein csaA"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM TIGR02222"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05839"
FT                   /db_xref="GOA:B9KYE8"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR008231"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE8"
FT                   /protein_id="ACM05839.1"
FT                   /translation="MEAKPPIELADFQRVDLRVGRIVAVEEFPEARRPSYKLTIDFGPL
FT                   GVKRSSAAIRPWYAPEDLIGRLIIAVVNLPVRRVAGFPSEVLVLGAIQPDGRVILLQPD
FT                   QPTDPGNPIA"
FT   gene            489981..490727
FT                   /locus_tag="trd_0494"
FT   CDS_pept        489981..490727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0494"
FT                   /product="hydrolase, NUDIX family protein"
FT                   /note="identified by match to protein family HMM PF00293"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04519"
FT                   /db_xref="GOA:B9KYE9"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYE9"
FT                   /protein_id="ACM04519.1"
FT                   /translation="MQYRRETTDPQDEIFDVLTQDGELTGERAARWLVHQNGLWHPAFH
FT                   LWIAWATPEGLRVLLQRRSLTKDTMPGRVDVSVGGHFKAGEFVPGQPLAPLMLAAIVRE
FT                   VNEELGFRLEPSVIQWLGTRWSEAVQANICDREVQYLYFWLRDEPLVAIEPDPREVAAL
FT                   LAVSVRGLLELLEQERMSVEAPVLWSSESGAGSTRSVQAVTFADLVPGRQRYWRVVLHL
FT                   LEQNAAKGEVPTEPLVLHGKSEADAG"
FT   gene            complement(490918..492486)
FT                   /gene="aceB"
FT                   /locus_tag="trd_0495"
FT   CDS_pept        complement(490918..492486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="aceB"
FT                   /locus_tag="trd_0495"
FT                   /product="malate synthase A"
FT                   /EC_number="2.3.3.9"
FT                   /note="identified by match to protein family HMM PF01274;
FT                   match to protein family HMM TIGR01344"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05463"
FT                   /db_xref="GOA:B9KYF0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006252"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR019830"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF0"
FT                   /protein_id="ACM05463.1"
FT                   /translation="MGDVRIVGRMTPEFAQILTEPALDFVASLHREFNLRRKQLLERRA
FT                   ERQQAIDAGHFPDFLPETAHIRESEWRVAPTPPDLEDRRVEITGPVDRKMMINALNSGA
FT                   RVFMADFEDALSPTWDNVVQGQINLRDAVRRTISFESPDGRVYRLADKTATLVVRPRGW
FT                   HLVERHVLVDGEPISASLFDFGLYFFHNAHELLARNTGPYFYLPKLESHLEARLWNDVF
FT                   NFAQDRLGIPRGTIRATVLIETILAAFEMDEILWELRDHAAGLNAGRWDYIFSVIKKFR
FT                   RHREFLLPDRAQVTMTVPFMRAYTELLVRTCHRRGAHAIGGMAAFIPSRRDPQVNEIAL
FT                   AKVREDKEREAKDGFDGTWVAHPDLVPVALEVFDRVLGEQPHQKHRLREDVQVTARDLL
FT                   DVRVPGGRITEGGLRNNVSVALQYLDSWLRGQGAAAIFNLMEDTATAEISRAQLWQWRF
FT                   HRAELDDGRPVTAELYVQIRDEELTKLGGEVAGRLREAREILDRLVLDDEFTEFLTYLA
FT                   YEYID"
FT   gene            complement(492595..493773)
FT                   /locus_tag="trd_0496"
FT   CDS_pept        complement(492595..493773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0496"
FT                   /product="isocitrate lyase"
FT                   /note="identified by match to protein family HMM PF00463"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04880"
FT                   /db_xref="GOA:B9KYF1"
FT                   /db_xref="InterPro:IPR006254"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR039556"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF1"
FT                   /protein_id="ACM04880.1"
FT                   /translation="MKGEFVMWSLPQAVTDPNELRETPLLPPGYRVPASRWIHPSTRLR
FT                   QLLETLPYVFAPGVYDPHGAQLVMYYGFPAVYFSGYSFAIGHLGTTDMDLYSSVEIADA
FT                   ARRIVAGLRKFQLTMAVGDPEKGIPPKHLHIPPVVADMDTGYGNLFNVQRTTELYVTAG
FT                   VAGAHIEDQVMPKRCGHIAGKALIPAQEMVGKLKMMRAVANDLGNPDFVIIARTDGVSA
FT                   VDAPEAKRGLPLAIERALRYLDSGVPDLVWCEFPTSERGPLETFVEEVRKRFPDARFAF
FT                   NWSSSFKWFTDPNPISFRELGEMGVRFIFITLAAQHAMGLGFSELLQHLAARQERAYID
FT                   LQKREWAEGTDFPTRSHHFFSGVPYHHLLGQVYDAPRLGTQFEEELPEEAVV"
FT   gene            494099..494998
FT                   /locus_tag="trd_0497"
FT   CDS_pept        494099..494998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0497"
FT                   /product="RuBisCO operon transcriptional regulator"
FT                   /note="identified by match to protein family HMM PF00126;
FT                   match to protein family HMM PF03466"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05752"
FT                   /db_xref="GOA:B9KYF2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF2"
FT                   /protein_id="ACM05752.1"
FT                   /translation="MDVSLRQLQVFRSVARHRSFSRAAEDLVISQPAVSAQIKSLEQVL
FT                   GVPLFQRTGRGVELTEAGRQLLPYAERLLNLLDEALAAVHELRCAQRGQVRVAASTTAG
FT                   IYVVPKALGAFHRAYPGVELSLDVLNRFAVHQRLLAGDADVAIMGLIEDPQDLEIEQFL
FT                   PNELVVIASPRHHLARRHQIPLDEIAREPFLVREIGSGTRADMERIFAEAGLSPRVAME
FT                   LRSNGAIKQAVAADLGVAVMPRDAIGLELETGRLIVLDVQGFPVRRWWSLVRRAGRQPS
FT                   AAADALWNFLLQYRLQAR"
FT   gene            complement(495002..495841)
FT                   /locus_tag="trd_0498"
FT   CDS_pept        complement(495002..495841)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0498"
FT                   /product="Protein of unknown function superfamily"
FT                   /note="identified by match to protein family HMM PF01904"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04913"
FT                   /db_xref="InterPro:IPR002763"
FT                   /db_xref="InterPro:IPR036520"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF3"
FT                   /protein_id="ACM04913.1"
FT                   /translation="MGRLLVGTSSWTDHEGFYPPGIEARERLRFYARYFPIVEVNSTYY
FT                   AIPSRRVVQGWVERTPPGFVFDVKPPRQLTATPEQPGGEAPVPDADIAHRFLDAIEPLI
FT                   TAGKLGAITFQFPPSYRNTEEHREYLRLLPELFPDLPLSVEFRRRDWLDARHAQATLEL
FT                   LRESGLSYTMVDEPQVGIGCVPPIYAVTNPRLAVVRFHGRNAETWYRFTGKTGERFNWE
FT                   YRREELEEWRPKLLRAAAEAQEVHVFFNTNYGNQGPRNAVLLMDLLGIEHPPLPGIG"
FT   gene            complement(495863..496153)
FT                   /locus_tag="trd_0499"
FT   CDS_pept        complement(495863..496153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0499"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05565"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF4"
FT                   /protein_id="ACM05565.1"
FT                   /translation="MTRPQREKSRFHADHASLPISDELWFPRPTTVATRAPPYSARVAD
FT                   VHLVGRHNAETGSSLPARLSVKKTTGLRKIHRGTRSRTRHRERPAGNWSLC"
FT   gene            496356..497057
FT                   /pseudo
FT                   /locus_tag="trd_0500"
FT                   /note="glutaredoxin related protein; an automated process
FT                   has identified a potential problem with this gene model;
FT                   the current end5 and/or the end3 may need to extended or
FT                   the current gene model may need to be merged with a
FT                   neighboring gene model; the current gene model (or a
FT                   revised gene model) may contain a premature stop;
FT                   identified by match to protein family HMM TIGR02187"
FT   gene            497077..498597
FT                   /locus_tag="trd_0501"
FT   CDS_pept        497077..498597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0501"
FT                   /product="P49 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06377"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF5"
FT                   /protein_id="ACM06377.1"
FT                   /translation="MREAWDAVTVGAGPNGLAAALALARNGRRVLVLERAQRAGWGLRT
FT                   DKSIVPGCVHDHCASVLPLALASPFFRSVGVIDRVHWCWSPAALAHPFDDGTAVLLWRD
FT                   LERTAVELGPDAPRYRGLMKPWLSAGTVLLAALLSPLPGVVRLPGSRLPLVELLCFARE
FT                   GVRSARVVIEHFVGERARALFAGLAAHSTLPLEQAPSAAFGLILAACGHLVGWPLLAGG
FT                   TERLAEALVGEIEQHGGTVRYGVPVERLDDLPPARALLLDSSPRIALRIAGARFTPAYR
FT                   RQLARFRPGPGVFKIDWVIRGTVPWRAPECALAATVHLGGSWEEIAAAERAVSQGRMPE
FT                   RPFVILVQPGQADPGRAIPDYAVMWAYCHVPSGWDGDATEAIEQQVERFAPGFRERIVA
FT                   RRAWKPGDFERANPNLVGGDLSGGWPTLDQLFTRPAFWPWPPYRTSDPAVFLCSAATPP
FT                   GGGVHGMCGYWAARWAERWLDRLDRGRLSPASGKPVSKAAVSAELTAR"
FT   gene            498859..500007
FT                   /gene="ribD"
FT                   /locus_tag="trd_0502"
FT   CDS_pept        498859..500007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribD"
FT                   /locus_tag="trd_0502"
FT                   /product="riboflavin biosynthesis protein RibD"
FT                   /EC_number="3.5.4.26"
FT                   /EC_number="1.1.1.193"
FT                   /note="identified by match to protein family HMM PF00383;
FT                   match to protein family HMM PF01872; match to protein
FT                   family HMM TIGR00227; match to protein family HMM
FT                   TIGR00326"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04728"
FT                   /db_xref="GOA:B9KYF6"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR004794"
FT                   /db_xref="InterPro:IPR011549"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF6"
FT                   /protein_id="ACM04728.1"
FT                   /translation="MMQELDTDRYWMQRAIALARRAQGRVAPNPAVGAVIVREGEVVGE
FT                   GCTQPPGGPHAEIVALQRAGERARGATLYVTLEPCAHYGRTPPCVEAIVQAGIRRVVAA
FT                   ILDPFPAVAGRGFTLLRQAGVDVTVGIEAEAAAEVNAGYLKRLRESLPEVTLKYAMTLD
FT                   GHIATRTGHSKWITGQEARRYAHQLRDQHDAILVGVETVLTDDPELTTRLDPRDAGDGG
FT                   PHSPLRVVIDTRARTPPSARLLDSRLPARTLVITTEAAPPERVAALWKAGAELAFVPLR
FT                   CGHVDLAAALRVLAERGINRVLVEGGGRVLGSLFEQGLADAVVAFIAPVLVGGTAAPVP
FT                   LAGEGVARMEDAPRLTGVRVRQVGDDLVIEGRLRPIWVPEGA"
FT   gene            500004..500672
FT                   /gene="ribE"
FT                   /locus_tag="trd_0503"
FT   CDS_pept        500004..500672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribE"
FT                   /locus_tag="trd_0503"
FT                   /product="riboflavin synthase, alpha subunit"
FT                   /EC_number="2.5.1.9"
FT                   /note="identified by match to protein family HMM PF00677;
FT                   match to protein family HMM TIGR00187"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06130"
FT                   /db_xref="GOA:B9KYF7"
FT                   /db_xref="InterPro:IPR001783"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR026017"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF7"
FT                   /protein_id="ACM06130.1"
FT                   /translation="MMFTGIVEEIGRVLAIQPVSGGGLRLRIGCRTVVEGTRLGDSIAV
FT                   DGVCLTVTDLAPDSFQVELQPVTVRRSTLGRIAVGDLVNLERALPVGGRFGGHYVQGHV
FT                   DTVGRIVMMYRDGAALIVRIAAPAEAMRYVVERGFIAVDGASLTVQRRFPSEFEVSLVA
FT                   YTQEHITLPRKRPGALVNLEVDIIAKYVEQFLALGASGALSLESLHRAGFVSARTEVES
FT                   "
FT   gene            500669..501922
FT                   /locus_tag="trd_0504"
FT   CDS_pept        500669..501922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0504"
FT                   /product="riboflavin biosynthesis protein ribA"
FT                   /EC_number="3.5.4.25"
FT                   /note="identified by match to protein family HMM PF00925;
FT                   match to protein family HMM PF00926; match to protein
FT                   family HMM TIGR00505; match to protein family HMM
FT                   TIGR00506"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04899"
FT                   /db_xref="GOA:B9KYF8"
FT                   /db_xref="InterPro:IPR000422"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR016299"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF8"
FT                   /protein_id="ACM04899.1"
FT                   /translation="MTRFARVERAIEAFRAGRFVIIVDDADRENEGDLAIAAQFCTPEA
FT                   VNFMAREARGLICVPMAAEWVDRLGLPLMVPPGTNGSRFGTAFTISVEAREGVATGISA
FT                   YDRSVTIRKLADPSATLADFVMPGHVFPLRARPGGVLERDGQTEASVDLARLAGVHPVA
FT                   VVCEIMSADGTMARLPELERFAAEHDIPLVHVADLIAYRLVHERPAQCVAETTLPTRYG
FT                   RFQLRAYRRLGGDQIDLALVHGDVSGDEPVLVRLHSECLTGDVFGSQRCDCGPQLEAAL
FT                   DRIAAVGRGVIVYLRQEGRGIGLLNKLRAYHLQDMGLDTVEANLHLGFPADLRDYREAA
FT                   IILRDLGIERVRLLTNNPRKIAALEELGFEIVERVPLELPPTEHNHRYLRTKRDKLGHL
FT                   VLLEELAAVGDEKRGGTR"
FT   gene            501919..502434
FT                   /gene="ribH"
FT                   /locus_tag="trd_0505"
FT   CDS_pept        501919..502434
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ribH"
FT                   /locus_tag="trd_0505"
FT                   /product="6,7-dimethyl-8-ribityllumazine synthase"
FT                   /EC_number="6.3.3.-"
FT                   /note="identified by match to protein family HMM PF00885;
FT                   match to protein family HMM TIGR00114"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06044"
FT                   /db_xref="GOA:B9KYF9"
FT                   /db_xref="InterPro:IPR002180"
FT                   /db_xref="InterPro:IPR034964"
FT                   /db_xref="InterPro:IPR036467"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYF9"
FT                   /protein_id="ACM06044.1"
FT                   /translation="MMSLNGQAIRVVEGKLTGRGRRFAIVVSRFNEFISRQLLHGAIDA
FT                   LVRHDVEPQAIEVVWVPGSFEIPLVAKRLAESRRYHAVICLGAVIRGATPHFDYVAAEV
FT                   SKGIAHVALQTNVPVVFGVLTTDTIEQAVERAGTKMGNKGAEAALVAIEMANVLAELDR
FT                   LAVTPLEA"
FT   gene            503041..504690
FT                   /locus_tag="trd_0506"
FT   CDS_pept        503041..504690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0506"
FT                   /product="serine-type D-Ala-D-Ala carboxypeptidase"
FT                   /note="identified by match to protein family HMM PF00768"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06325"
FT                   /db_xref="GOA:B9KYG0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG0"
FT                   /protein_id="ACM06325.1"
FT                   /translation="MSGRIVRCVLGLLIVALAIPIPVRADSLPEVVAQHWIIMDAETGQ
FT                   IVAERAARQPVAIASLTKVMTAVVALERGALDQPVTIVPEDLIGESSAGLRAGQVVTLR
FT                   TLLYGLLLRSGNDAAMAIARAVGGSPDAEDPAARQRFVTWMNAKAVELGLQATSFRNPH
FT                   GLDEPGHVSSAYDLARLTRVALADPVFVEIFGAASYHGEGFSWRHTNRLPERYPGIIGG
FT                   KTGWTDEAGLCLIEVAERAGKTAIVVLTGSTLAAWYDDAAKLLDYGWTKLDRLTGSADA
FT                   ERLFDWWWRRTEDPVARGLVVRTWLWGPALGPVEWEAYADAPDGKRLVRYYEKGRMELT
FT                   HPDRAVDARWRVTGGRLAWELLTGWQQIGDETYVQRKPAAIAVAGDPGNPVTYALLGTM
FT                   LAAPSGPADEPVTARLFPDGTVVHDVELARYGVRYGAVFRETNHSVASIFANWLEQRGS
FT                   VWAGYRLREEPLFSPWIAVVGYPITEPYWVRVPVRGVEQDVLVQCFERRCLTFTPANPP
FT                   GWQVEMGNIGVHYRQWVQRDRGVLLQNLSRSS"
FT   gene            complement(504765..505607)
FT                   /locus_tag="trd_0507"
FT   CDS_pept        complement(504765..505607)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0507"
FT                   /product="MitC"
FT                   /note="identified by match to protein family HMM PF02585"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04871"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG1"
FT                   /protein_id="ACM04871.1"
FT                   /translation="MTLVSVMCELTADAIFLSPHFDDVPLSCGGTVALFAASGRKPVIL
FT                   TLFGGEPSEPLSFFAQQQHRWRGMDDRTAVQLRREEERAAAAELGATAHWFDVPDAIYR
FT                   DARYNSDDELFGPLHPDDLVLVDELLDLVEEVIRSHAESPAIFVPLALGNHVDHQIARL
FT                   LGTRLVERGFSVWAYEDQPYSAMPGSQAERDCTIQRWTAGPPWLVFLSEELFQRRLRAI
FT                   SHYRSQIAFVFRDLGPFDRVLRSYTLEVGRGQLAERFWELQPLSTVERAPEQRRGELC"
FT   gene            complement(505582..507474)
FT                   /gene="selB"
FT                   /locus_tag="trd_0508"
FT   CDS_pept        complement(505582..507474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="selB"
FT                   /locus_tag="trd_0508"
FT                   /product="selenocysteine-specific translation elongation
FT                   factor"
FT                   /note="identified by match to protein family HMM PF00009;
FT                   match to protein family HMM PF03144; match to protein
FT                   family HMM PF09106; match to protein family HMM PF09107;
FT                   match to protein family HMM TIGR00231; match to protein
FT                   family HMM TIGR00475"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05501"
FT                   /db_xref="GOA:B9KYG2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004535"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015190"
FT                   /db_xref="InterPro:IPR015191"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG2"
FT                   /protein_id="ACM05501.1"
FT                   /translation="MARQTFVIGTAGHVDHGKSTLVKALTGIDPDRLREEKEREMTIDL
FT                   GFAWMTLPSGRRLSIVDVPGHERFIKNMLAGVGGFDAALLVVAADEGPMPQTREHVAIL
FT                   DLLEIRHGLVALTKSDLVEPDWLELVIVEVEELLRDTALAGVPIVPVSAVTGYGLDALV
FT                   RVIDQVLDQVPPHARSGKPRLAIDRVFTVAGFGTVVTGTLRDGELEVGQEVEILPRGLR
FT                   ARVRGLQSHRTRVDRALPGSRTAVNLSGVEVEDLVRGDVLTVPGWLRPTMLLDARLRML
FT                   PDAPEPLEQNDEVDFFVGASETLARVTLLDAERLEPGMVGWVQLRLQEPVVAVRGDRFI
FT                   IRRPSPSATLGGGIIIDTAPRRHRRFRPEILRTLELLASGSPEALVLHALERGIAEWRD
FT                   VLQRTNLDETTATRAITQLIQQGQIVCLENAEGALNPGSALAERTALERITAQLLDLLR
FT                   DYHARYPLRRGLPREMARSRLGLSPRFFELLVHWLTQAGAVIQDDDVLRLPEHRIQLTE
FT                   EQENRARAYEAALLREPFSPPSPSEYGIEPELVQALADLGRVVRVNDEVVFAPSAWAEI
FT                   KKRVLALIDAHGSVTLAQVRDALGTSRKYAQALLEYLDQQRVTRRIGDARVRYV"
FT   gene            507559..508482
FT                   /locus_tag="trd_0510"
FT   CDS_pept        507559..508482
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0510"
FT                   /product="putative amidase"
FT                   /note="identified by match to protein family HMM PF03069"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05178"
FT                   /db_xref="GOA:B9KYG3"
FT                   /db_xref="InterPro:IPR004304"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG3"
FT                   /protein_id="ACM05178.1"
FT                   /translation="MSVSPYRIPRSSRYAALDATALPALRVETGAVVEFETSDEPYEML
FT                   ARGILVEEIGLDRFNQVTGPLAVKGARPGDTLRVDILSISIERAWLVFIRSFGPLGRLL
FT                   PKTVCERLDVHGGRLVVSERLQLPLRPSIGCIGVAPARGASSTFRPVWPWGGNLDLVEL
FT                   HAGSTIWLPVQRPEAFLFLGDVHAAIGAGEPAHVAIEAAARVTVQVAVDHRLRLPGPLV
FT                   RSDDELLVFGLGPDISSAQQAALENAVALVRRAFELTTREAYAFVCACLSYRFGGPAGP
FT                   VVVAALPLAPVTQLSGSAIPSWLASS"
FT   gene            complement(508437..510500)
FT                   /locus_tag="trd_0509"
FT   CDS_pept        complement(508437..510500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0509"
FT                   /product="Protein of unknown function, DUF255 family"
FT                   /note="identified by match to protein family HMM PF03190"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06021"
FT                   /db_xref="GOA:B9KYG4"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG4"
FT                   /protein_id="ACM06021.1"
FT                   /translation="MPNRLANEKSLYLRQHADNPVDWYPWCEEAFRVAREQDKPILLSI
FT                   GYSSCHWCHVMERECFENPEIAQLQNELFVNIKVDREERPDLDELYMNALQAMTGSGGW
FT                   PLNVFLTPDGKPFYGGTYFPPEDRGQLPAWPRVLLAVAQAYRERRADVERAAEDLVSYL
FT                   QQQSRPPLQAAPLREQFLDEAARNLVPHYDREHGGFGTAPKFPSPLQLEFLLRTFRRAG
FT                   APRALEMVLQTLTAMARGGIHDQIGGGFHRYTVDEAWLVPHFEKMLYDNALLARVYTLA
FT                   HLASGNRLCRTIAEETLVYIQREMRGDHGAFFAAQDADSEEGEGAFYLWTPEEIAAVLG
FT                   NDDAGLACRYFGVTPRGNFEGKSILHVAEDPVTIASEFGLSLDELEQRIGSIRARLYEA
FT                   RDQRPHPARDEKVIVAWNALAIRAFAEAGTALDRPDFVALAERAATFLRDQLWDGKTLY
FT                   HVWEEGEARFPGFLDDYADLVNALVSLYEATFDPFWIAWARQLTEAILAKFIDPVAGDF
FT                   YDTASDGEQLIVRPKTFIDQGTPSGNGATAEALLRLGTLLGEHRFIDQARTLLERYAQL
FT                   AVEHPIACGQLLLAMDFALGQPFEVAIIGDPTQPETRALLRVVQASYLPNRVLALRRPE
FT                   DEIAASIVPLLAERSLVDGHPAAYVCRNFACQRPVTTPQELASQLGIALPDS"
FT   gene            510499..510849
FT                   /locus_tag="trd_0511"
FT   CDS_pept        510499..510849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0511"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06237"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG5"
FT                   /protein_id="ACM06237.1"
FT                   /translation="MVNLALLCTLLRRFPAFAGSFDDTRFVSEDAALPRRSNHVWVLLA
FT                   VPAVDRPEMERALRSILGPGGTGTLGTREKWLLEVGDRVIAHGVSSGERPNPFLPVTAQ
FT                   RAPLSVDEGGSA"
FT   gene            511057..511686
FT                   /locus_tag="trd_0512"
FT   CDS_pept        511057..511686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="identified by match to protein family HMM PF07920"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05360"
FT                   /db_xref="InterPro:IPR012467"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG6"
FT                   /protein_id="ACM05360.1"
FT                   /translation="MEAKGACKVTRSAEATEAYIRRIEEYRKRRDEFFKSNENSPLLPE
FT                   QRERFRGLRYYPVKPEYRFVVELQRDGVSQERVILGTTTGEPKEFIVAGRVTVEIEGKP
FT                   VTFTVYREVGRGRYFLPFRDATAGSETYSVGRYLDPQETPDGKLVIDFNMAYNPYCAYN
FT                   DRWTCPIPPRENIVDVPIRAGEMAYPDYVSITEQEKPSGPMPLIGG"
FT   gene            511688..513181
FT                   /locus_tag="trd_0513"
FT   CDS_pept        511688..513181
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0513"
FT                   /product="PepB protein"
FT                   /note="identified by match to protein family HMM PF00883;
FT                   match to protein family HMM PF02789"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05564"
FT                   /db_xref="GOA:B9KYG7"
FT                   /db_xref="InterPro:IPR000819"
FT                   /db_xref="InterPro:IPR008283"
FT                   /db_xref="InterPro:IPR011356"
FT                   /db_xref="InterPro:IPR023042"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG7"
FT                   /protein_id="ACM05564.1"
FT                   /translation="MGLEVTASTTPLAVVEATVVLPIGQDGQLERIAGIEPGVAERLAR
FT                   AARSIGLAGRVGQAGLLPPIDGLAAERFIVVGMGAEHQRSLADVRRGAALAGKLAGEVG
FT                   ASVLAWPIVAVSGSSSAQVVQAIVETTAMASYRFHRYRSGEGGTRLRQLVVLGEGAEVE
FT                   EGIQRGRLTSDAVCFARDLTNEPANVLDPERLSGIAWEIAQETGLACSVYDRALLEELG
FT                   AGAILAVGQGSRREPRLIHLVYRPDGDVLGRVALVGKAVTFDSGGLSLKPAEGMERMKG
FT                   DMAGGAAVLAVLRALPALRLPVEVHGVVAAAENLPDGEAFRPGDILRTLSGKTVEVIST
FT                   DAEGRLLLADALTFAVQQGADLLVDIATLTGACAVALGRSGSGLFASDDSVGQLILQAA
FT                   NEVGERMWALPLWDDYRELLKSEHADLKNTAGRWGAAINAALFLREFTEGRPWAHLDIA
FT                   GPAWSEQATLFGPAGATGHGVRTLLRFVELWAERRGAAE"
FT   gene            513178..513603
FT                   /locus_tag="trd_0514"
FT   CDS_pept        513178..513603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0514"
FT                   /product="conserved hypothetical protein TIGR00149"
FT                   /note="identified by match to protein family HMM PF01894;
FT                   match to protein family HMM TIGR00149"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04692"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG8"
FT                   /protein_id="ACM04692.1"
FT                   /translation="MSRAFARRFQVATGGRDQMLDLTPQVRETVEASGIREGLVCVFVA
FT                   HSTAAVSVSEYEPGLMQDVRIVAERIAPQGAAYAHNRLNADDNAHSHLRSLVVGPSVTV
FT                   PLVSGELTLGTWQRIVLLDFDTHPRTRTVWVQVLGAT"
FT   gene            513593..513943
FT                   /locus_tag="trd_0515"
FT   CDS_pept        513593..513943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0515"
FT                   /product="possible DNA binding protein"
FT                   /note="identified by match to protein family HMM PF01381"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06182"
FT                   /db_xref="GOA:B9KYG9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYG9"
FT                   /protein_id="ACM06182.1"
FT                   /translation="MRRDVVRTIAELLTDLRARRGWPLRELAQRSGLSIAYLSELERGR
FT                   KLPTLEALDQLAAAFDCNLAAFLRLLADRLEEPTTEVRHDAEFQDLDPAERSELACYAE
FT                   YLRWRRSHCVQR"
FT   gene            513967..514854
FT                   /locus_tag="trd_0517"
FT   CDS_pept        513967..514854
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0517"
FT                   /product="3-mercaptopyruvate sulfurtransferase"
FT                   /EC_number="2.8.1.2"
FT                   /note="identified by match to protein family HMM PF00581"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05678"
FT                   /db_xref="GOA:B9KYH0"
FT                   /db_xref="InterPro:IPR001307"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH0"
FT                   /protein_id="ACM05678.1"
FT                   /translation="MVSERLTAHFVDTGWLAERLGNPLVRIVDCRYYFDGRDGYEEYRK
FT                   GHIPGARYLDWTVVTVDPHDPVAYRLAPSQYIAGRLGELGIGDEHLIVGYDDEGGHFVA
FT                   RLWLALAYYGKADRLRILEGGWTRWVAEGRSTATDEPVWPRAAFHLPSTPVHPELVADA
FT                   RDVLEALAFGKSVVLDVRRLSEYTGEEVRARHGGHVPGARHWFWQRSLDWDGLRMFRPP
FT                   EEVRAGLAELGVTTSTPVITYCHGGVRAAHAALALARAGFRHVRVYVGSWAEWGNRDDL
FT                   PRALGLPHGDGRES"
FT   gene            complement(514849..515475)
FT                   /locus_tag="trd_0516"
FT   CDS_pept        complement(514849..515475)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0516"
FT                   /product="methyltransferase, UbiE/COQ5 family"
FT                   /note="identified by match to protein family HMM PF01209;
FT                   match to protein family HMM PF08241; match to protein
FT                   family HMM PF08242"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05534"
FT                   /db_xref="GOA:B9KYH1"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH1"
FT                   /protein_id="ACM05534.1"
FT                   /translation="MHDQRTVRELARQYDRLAGQYDAAMDRIERWLLGDWRAWAAHQAI
FT                   GWTLEIAIGTGRTLPSYRPGIVLVGIDVSLGMLRVAHRRARAHGRPVTLLRADAQALPL
FT                   RDASVDTVLSILSLCTIPDVQQALREAYRVLRPGGRLILVEHVRSDRRLLGLAQRLIEP
FT                   LSVRFAHDHLAREPLPMVVANGFQVLQEQRRLAGIVQRILAVKPS"
FT   gene            515563..516075
FT                   /locus_tag="trd_0518"
FT   CDS_pept        515563..516075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0518"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04545"
FT                   /db_xref="GOA:B9KYH2"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH2"
FT                   /protein_id="ACM04545.1"
FT                   /translation="MWLIVPVIFLLSWRMTRRWGQALNETVAWIVGYLATAGVLWLTDV
FT                   GGLDLVETRPNSPGAILAILGGFLGMLVSRWRWKRRGGHLEPRTDWRKALIRGAARVSA
FT                   RRSAGGGTAAGSRTGSAVGSDVAAIAGRLLGRAAANLFVPEMRRRNPWFRAMRALISPD
FT                   EARQRRQ"
FT   gene            516100..516717
FT                   /locus_tag="trd_0519"
FT   CDS_pept        516100..516717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0519"
FT                   /product="uncharacterized domain HDIG protein"
FT                   /note="identified by match to protein family HMM PF01966;
FT                   match to protein family HMM TIGR00277"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05971"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH3"
FT                   /protein_id="ACM05971.1"
FT                   /translation="MERSLPTREEAWQLVREFTSQPHLLRHMRAVEAAMRAYARRFGEN
FT                   EELWGLVGILHDFDYERYPDISTEGHPVVGARILRERGYPEEVIRAILAHASEVTGVEP
FT                   ESLLEKTLVAVDELTGFLVAVALVRPTKSILDVEVSSVKKKWKAKEFAAAVNRQEIERA
FT                   AAALGVPLEEHIRIVLDAMKEIAHELGLERRPVEAARPALEG"
FT   gene            complement(516833..518038)
FT                   /locus_tag="trd_0520"
FT   CDS_pept        complement(516833..518038)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0520"
FT                   /product="spermidine/putrescine-binding periplasmic protein
FT                   precursor"
FT                   /note="identified by match to protein family HMM PF01547"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04774"
FT                   /db_xref="GOA:B9KYH4"
FT                   /db_xref="InterPro:IPR001188"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH4"
FT                   /protein_id="ACM04774.1"
FT                   /translation="MNRPELIQRWIRDWQQGRLSRRELLRRVTLLGMSSFALANLLTAC
FT                   ARSQPTPTPASTEASPRVGAAIPDYIDRSKLDKELNFYNWSEYIDPDILTEFQETYGVK
FT                   VTMDTYASNEDLLAKLQGGATGYDVIVPSDYMVSIMINLGLLEPLDYSVIKTIANIDPE
FT                   NLKPYYDPDNTYSVPYMWGTSGYSYDTSVLGEDLASWKEVFEPRPEVRGKVVMLDDQRE
FT                   VIGAALMYLGYEINETSDDALAKAKQLLLTQKPYVLAYSSQNNDDLLVAGEALIAHIWT
FT                   GDALMSEQEKPTLRYVIPTEGCTVWQDNLCVPKTAPHKYTAMVFIDFLNRPDIAGRNAN
FT                   YIMYGSPNKAAREQGYIDQEVLNNPGVYPPPEVWKRLQWIKDVGEEGALKLDRLWTEIK
FT                   TG"
FT   gene            complement(518054..518914)
FT                   /locus_tag="trd_0521"
FT   CDS_pept        complement(518054..518914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0521"
FT                   /product="ABC-type spermidine/putrescine transport system,
FT                   permease component II"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05130"
FT                   /db_xref="GOA:B9KYH5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH5"
FT                   /protein_id="ACM05130.1"
FT                   /translation="MSSMATARPATTMRSKRRFSFGWAVLNLNVLLTFIFLYAPIIVMS
FT                   IFSFNASRQMQVWMGFTLDWYARMIADERVRVAAQNSLVIALVSTIVSTVIGTLSALAL
FT                   ERTRFRVKRMYEAAMYLPIIVPEIVMAIALLVFFNLAFTWLDQFFGLKLKFGLGTITIA
FT                   HIAFSFPFVAVVVRARLADFDRTLEQAAQDLGANEWQTFRHITLPLLMPGIIAGALLAF
FT                   TLSIDDFVITFFTAGVGSTTLPLEIYGRVRRGITPDVNALSTVMLLASIVLVLGSLLFQ
FT                   RRRSF"
FT   gene            complement(518911..519825)
FT                   /locus_tag="trd_0522"
FT   CDS_pept        complement(518911..519825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0522"
FT                   /product="spermidine/putrescine transport system permease
FT                   protein potB"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06030"
FT                   /db_xref="GOA:B9KYH6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH6"
FT                   /protein_id="ACM06030.1"
FT                   /translation="MSAIDRVRVQERSLGWHERASERIRQSERVRALFLAGPGGLWLLL
FT                   FFLLPTAIVFAYSFARRGPYGAVAWAFTLENYARLFDWLYIRVFLMSVWLALLTTVICL
FT                   VIGYPFAFVIARSPRRWRNALLVLVLIPFWTNFLVRTYAIMLLLRADGLINNALQWLGL
FT                   IDRPLSLLFTPFAVVLGLVYGYLPFMILPIYASIEKFDFTLVEAAQDLGANAWHVFWRV
FT                   LLPLTLPGVLAGSILVFIPSVGAFVTPDLLGGGKVVMIANLINQQFLTVRHWPFGSAIS
FT                   FVLMAIVLAATMLYFRIGETRRI"
FT   gene            complement(519844..521013)
FT                   /locus_tag="trd_0523"
FT   CDS_pept        complement(519844..521013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0523"
FT                   /product="ATP-binding component of putrescine transport
FT                   system"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM PF08402; match to protein
FT                   family HMM TIGR01187"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05384"
FT                   /db_xref="GOA:B9KYH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017879"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH7"
FT                   /protein_id="ACM05384.1"
FT                   /translation="MTMTPTILAIETVCASGMGGMEPLERPIDVELLDVTKVFENGVVA
FT                   VDRVSLQIYQGEFFSLLGPSGCGKTTTLRMIAGFEHPSAGEVLIEGRRMGHTPPFRRNV
FT                   NTVFQNYALFPHMTVFDNVAFGLRMKRIPRDEIARRVREALHLVRLSGMEERYPRQLSG
FT                   GQQQRVALARALVNRPRVLLLDEPLGALDLKLRKEMQLELKHLQMTVGITFIYVTHDQE
FT                   EALTMSDRIAVMNAGRVLQVGTPMEIYERPASRFVADFIGESNFLRGTVQAASSAAATV
FT                   VIADRFPVEVPADRQLTVGQQVTVAVRPEKVRLVPIEAPGTNGLLHGRIEEVIYIGTDT
FT                   FYVVRVSDDTTIRVRSQNDRNRLDGGLLLPVGTPVSLTWATDAARILTE"
FT   gene            complement(521015..522469)
FT                   /locus_tag="trd_0524"
FT   CDS_pept        complement(521015..522469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0524"
FT                   /product="folylpolyglutamate synthase"
FT                   /EC_number="6.3.2.17"
FT                   /note="identified by match to protein family HMM PF02875;
FT                   match to protein family HMM PF08245; match to protein
FT                   family HMM TIGR01499"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06270"
FT                   /db_xref="GOA:B9KYH8"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH8"
FT                   /protein_id="ACM06270.1"
FT                   /translation="MSEASVPDARYRWATGYLRALIQAPPGPPPGTPPEIVRLRAQRRL
FT                   ERLRDFLAYLGNPHRVYPVIHITGTSGKGSTAAFIANILHVAGYRTGLHTSPYLQVETE
FT                   KLQIAGQLIAPERFAEEVAILDQAVRSWIARGGQPLTYGEFWTALVFQTLRSERVDVAV
FT                   IEVSVGGRFDLTNVVLPEVAVITTVGLDHVRTLGPTIRDIAWHKAGIIKPGRPAITGVT
FT                   DPELLAIIAAEADAVGASLTVVREGSDYWVTSTGLGTTLTDLRTGHTFPIGLLGSYQAR
FT                   NAALAIAAIRTFADRIGGRIDDETIARGLVTTRFPGRFEIIQETPLVILDGAHNPQKMA
FT                   ALLEALDALSVQGRRLALFGVLEGHDALTMATMLAKSVDMVVLTTPRAFLRTAADPVEL
FT                   AAACQAQGTHAVTVDDPAEALALVLEMAQPNDLIVVTGSLYLVGHVREHWYPSSLIVTQ
FT                   RTCWPIRRSIAIQGAESACRQQHGSV"
FT   gene            522541..523770
FT                   /locus_tag="trd_0525"
FT   CDS_pept        522541..523770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0525"
FT                   /product="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05158"
FT                   /db_xref="GOA:B9KYH9"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYH9"
FT                   /protein_id="ACM05158.1"
FT                   /translation="MTFREGRDFPAWRFFALGAIGSAVGFGFVAGTLVFAAPLFAISPS
FT                   RIAQLVSLHGHGQLYGFVLALTIGVACWFLPRLWGRPQRGVPWLVGMFLFSGLLLRVFG
FT                   SILDRPRLALVGGGLEFVAFVQAGWDLTRSVVQAPLAGKARDPALAVGVIVAVVALPMG
FT                   LAADLCAMVGICSSGRVVSVLVGFYGAAVPIALAMTGRLFPLYFWTRVPHRRYLAWALM
FT                   ITTGGLWWRVGAFVAEWSYGVRFGCALQGAGLVGAIVALRLLEPRQVRPAAKRSLWQDP
FT                   YAWLAALAYTALGADALLLLGATFRGVLSAPALEWHLVGVGYLMVLITAVGPLLLAVFA
FT                   GERTGATWPGWVILGSVLMTASLRIGAALAPGEAARWAGAAAGLIGATTVLLFAWHARI
FT                   LSLRRSRRAL"
FT   gene            523845..524936
FT                   /locus_tag="trd_0526"
FT   CDS_pept        523845..524936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0526"
FT                   /product="Mrp"
FT                   /note="identified by match to protein family HMM PF01883"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05294"
FT                   /db_xref="GOA:B9KYI0"
FT                   /db_xref="InterPro:IPR000808"
FT                   /db_xref="InterPro:IPR002744"
FT                   /db_xref="InterPro:IPR019591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI0"
FT                   /protein_id="ACM05294.1"
FT                   /translation="MSELTRERVLEALRPVQDPELHRSLVDLGMIKEVTIEGASVRVQV
FT                   ELTTPACPLRERIREDVERAVRALPGVQTVEVGFSSRVRAAGTGLPDRQPIPGVKNTIA
FT                   VASGKGGVGKSTVAVNLAVALAQEGATVGLLDADVYGPSIPLMLGAEEQPGLVDNKIIP
FT                   GRAYGIAVMSVGYILDPEKALIWRGPLVSQLIRQFLSDVQWGDLDYLVIDLPPGTGDVQ
FT                   LTLVQTIPLSGAIIVTTPQDVALADAIKGLQMFREVKTPVLGIVENMSYFVCPHCGHVA
FT                   EIFGSGGGERVANKYGVPLLGQIPIDPAVREGGDRGVPVVVGQPGSSTAQAFREAARQA
FT                   AARLSVEAVKKPRKPVMMLQPKR"
FT   gene            525008..526384
FT                   /locus_tag="trd_0527"
FT   CDS_pept        525008..526384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0527"
FT                   /product="3-oxoacyl-(acyl-carrier-protein) synthase II"
FT                   /note="identified by match to protein family HMM PF00109;
FT                   match to protein family HMM PF02801; match to protein
FT                   family HMM TIGR03150"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06355"
FT                   /db_xref="GOA:B9KYI1"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR017568"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI1"
FT                   /protein_id="ACM06355.1"
FT                   /translation="MRCRWCGGEVPKGARYCPWCGRARTAEASGGRRRVVITGLGAVTP
FT                   LGLSVEETWQRILRGESGIQRIERFDPSDLPVQIAGEVRGFVLGDWVDAKTARQMAMFS
FT                   QYALEAAGQAWRDAGLDSGAIDPARAAVVIGTGAGGMATILETHELAQRRGLLRISPHF
FT                   MTIFPHNMPAYHLAQAFRFLGPSLTVSTACATGAQAIGEAAEMIRNGAADIALAGGTEY
FT                   CVFPLFIASFAVQRAASTWNDRPEEASRPFDAERHGFVVGEGAGIVVLEALEHAQARGA
FT                   RIYAELLGYASSNDGYHPIAPDPEGSGAARAIRAALADACVGPEDVDYINAHAASTPLG
FT                   DRAETQAIKAVFGERAYRIPISSTKSMIGHLMGAAGAVESIVTILSIRDAIVHPTRNYR
FT                   YPDPECDLDYVPEGPRRHTIRVALKNSFGLGGQNCCLVFAAWDGARGPEQSEPSSLRLE
FT                   "
FT   gene            526394..527350
FT                   /locus_tag="trd_0528"
FT   CDS_pept        526394..527350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0528"
FT                   /product="putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05018"
FT                   /db_xref="GOA:B9KYI2"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI2"
FT                   /protein_id="ACM05018.1"
FT                   /translation="MPKGYAPVSGLESPRFAGIRTFARLPHVRELAGVDVAIVGAPFDT
FT                   GVTYRVGARFGPAAVREMSAMLRTYHPSLDVDVYEVLSVVDYGDLPVVPGYIEDSYQRI
FT                   EQGLLPLLEHDVVPLVIGGDHSITLAELRAVARRYGRVGFIQFDSHTDTWDEYWGKKYT
FT                   HGTPFRRAVEEGLIETTRAIQVGMRGSLYGPEDLDQSRELGFEVWTADDVRRTGLGAVI
FT                   EAIRRRVGQGPVFVSFDIDFLDPVYAPGTGTPEVGGFTTREAQELLRGLVGVDIVAADM
FT                   VEVLPAHDVSGVTALAAANLLFEILAVLAFNRRGMTR"
FT   gene            527406..528380
FT                   /locus_tag="trd_0529"
FT   CDS_pept        527406..528380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0529"
FT                   /product="putative agmatinase"
FT                   /EC_number="3.5.3.11"
FT                   /note="identified by match to protein family HMM PF00491;
FT                   match to protein family HMM TIGR01230"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06157"
FT                   /db_xref="GOA:B9KYI3"
FT                   /db_xref="InterPro:IPR005925"
FT                   /db_xref="InterPro:IPR006035"
FT                   /db_xref="InterPro:IPR020855"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI3"
FT                   /protein_id="ACM06157.1"
FT                   /translation="MDEREDQGRVRWRPRFSGLRTFARFPHRAELAGVDVAIVGIPFDT
FT                   GVTYRPGARFGPAAVREHSSRIEQYHPPLDVDVTEYLTVIDYGDTPVVPMETLESYQLI
FT                   EETIRTVVEGGVIPVGIGGDHSVTLPELRAVARRFGPLALVHFDAHVDTWDTIWGTRYN
FT                   HGTPFRRAVEEGVVDPVRSIQIGIRGSLGERGELEQSRELGFAVWTAWEVRRAGIERVL
FT                   EAVRQRVGQHPVFVSFDIDFLDPAFAPGTGTPEVGGFAMWEAQELVWGLVGLNIVAADV
FT                   VEVLPDRDPAGVTALNAANIVFDLLAVLAATRRERHGTAERAE"
FT   gene            528355..528993
FT                   /locus_tag="trd_0530"
FT   CDS_pept        528355..528993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0530"
FT                   /product="putative aminomethyltransferase protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05758"
FT                   /db_xref="GOA:B9KYI4"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI4"
FT                   /protein_id="ACM05758.1"
FT                   /translation="MVQPSAPSEHILFGRVPKRAAQVRPTVPIAFPLAEGQLLQITDVQ
FT                   GKQVADMVAFNLHDVREYLSTSHTRAINNSLVLTQGMTLYSNRRNPMLVLLEDTVGRHD
FT                   ILFPACDRRRYLDDYGIPDHPNCKDNFLAALREYGIEEDDIPDPVNWFMNVGIVAKGRF
FT                   EIREPLSERNDYVLLRALMDLVVAVSACPQDQNPCNAFNPTDILVRIYD"
FT   gene            complement(529000..530700)
FT                   /locus_tag="trd_0531"
FT   CDS_pept        complement(529000..530700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0531"
FT                   /product="urease alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="identified by match to protein family HMM PF00449;
FT                   match to protein family HMM PF01979; match to protein
FT                   family HMM PF07969"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04891"
FT                   /db_xref="GOA:B9KYI5"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI5"
FT                   /protein_id="ACM04891.1"
FT                   /translation="MPVRIDRQHYARWYGPTAGDRIRLADTNLYARIERDDTLPGFEPL
FT                   VGFGRPVRDGMLAGRDHGPSKLDLVITNVVVMDPVLGIFKSNIGIKDGRIVAIGRAGNP
FT                   DVMEDVEVLISNATGIIPAEGLIATPGGVDAHVHLSSTSVVPAALSAGITTLVAQGSGG
FT                   VWDLGVNPVNNLRHLLEAFETIPLNLAVLGRGSSDTAQLVEHLEAGCAGFKIHEDVGAF
FT                   PAVIDACLTIADQAGVQVALHTDGLNEAGSLRETIAAIAGRSIHAYHVEGSGGGHAPNI
FT                   LEIVSEPNVIGSSTSPTIPYSVNSTAELLDMIIAVHRLATDIPSDLAAARDRVRASTIA
FT                   AEDVLHDLGAIAIMSSDSQGMGRIGEVITRTWQLAHRMKEIRGGGYDPASGNGDDNPRI
FT                   LQYLAKYTINPAIAHGLDHEVGSLEPGKLADIVLWHPAFFGAKPAAVIKAGFVAWAPVG
FT                   DGMGSTRWSQPLIYRPMFGGLGRAPAALSVAFVAPVAATSSHLERSGLQRRLVAVRNVR
FT                   RVFKNAMRYNTASPRVEVDPRTYAVAINGQVVEIPPAERLPLTFLHFIA"
FT   gene            complement(530709..531098)
FT                   /gene="ureB"
FT                   /locus_tag="trd_0532"
FT   CDS_pept        complement(530709..531098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureB"
FT                   /locus_tag="trd_0532"
FT                   /product="urease, beta subunit"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00699; match to protein family HMM TIGR00192"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05631"
FT                   /db_xref="GOA:B9KYI6"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI6"
FT                   /protein_id="ACM05631.1"
FT                   /translation="MSEHPVPPGGIIPGPDPIEIDARLPVTRLRITNRGTVPIHLTAHF
FT                   HVFEANPALCFDRRKGFGMRPDLPVGWAVRIEPGQTVELPVVPIGGQRIVRGFHGLVDG
FT                   PLDAIDLEALIERMIARGFCHEPEE"
FT   gene            complement(531095..531391)
FT                   /gene="ureA"
FT                   /locus_tag="trd_0533"
FT   CDS_pept        complement(531095..531391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ureA"
FT                   /locus_tag="trd_0533"
FT                   /product="urease, gamma subunit"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by match to protein family HMM
FT                   PF00547; match to protein family HMM TIGR00193"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04609"
FT                   /db_xref="GOA:B9KYI7"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI7"
FT                   /protein_id="ACM04609.1"
FT                   /translation="MTPKELDRLTVFTLAELARRHRARGIKLNYTEAAALLCDEVYEEA
FT                   RAGRSYEEVVAHASSLLTRDDVLPGVPEMLTVLHIDALFPDGTRLVTLRNPIR"
FT   gene            complement(531388..531729)
FT                   /locus_tag="trd_0534"
FT   CDS_pept        complement(531388..531729)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0534"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06358"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI8"
FT                   /protein_id="ACM06358.1"
FT                   /translation="MAERRLYIWLERDPLAGPPDTAIEDVPGRADLDLLAEAIRQGKLG
FT                   RYLPTKLALSRHRVPLLPSGYRRVNVANLLRQYRIPYRTRLEVLTDASSLQDCSSRIAR
FT                   SSREHEPCT"
FT   gene            complement(531774..532022)
FT                   /locus_tag="trd_0535"
FT   CDS_pept        complement(531774..532022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0535"
FT                   /product="DNA binding domain, excisionase family protein"
FT                   /note="identified by match to protein family HMM PF00376;
FT                   match to protein family HMM TIGR01764"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04526"
FT                   /db_xref="GOA:B9KYI9"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYI9"
FT                   /protein_id="ACM04526.1"
FT                   /translation="MIEIDGVEYLTANEAAALLGVKRETLYAYASRGRLRSYRRGIRRE
FT                   RLYRRSDIEALLRLQPAAGQGDDLPLPKAESWIPFTS"
FT   gene            532392..532535
FT                   /locus_tag="trd_0536"
FT   CDS_pept        532392..532535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0536"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05743"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ0"
FT                   /protein_id="ACM05743.1"
FT                   /translation="MFSSVELARGSHHSIVEVDREYATPRELRHSAGIVRDRRGTTDRL
FT                   AP"
FT   gene            532651..532875
FT                   /gene="rpsU"
FT                   /locus_tag="trd_0537"
FT   CDS_pept        532651..532875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsU"
FT                   /locus_tag="trd_0537"
FT                   /product="ribosomal protein S21"
FT                   /note="identified by match to protein family HMM PF01165;
FT                   match to protein family HMM TIGR00030"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04511"
FT                   /db_xref="GOA:B9KYJ1"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ1"
FT                   /protein_id="ACM04511.1"
FT                   /translation="MAKSVHVELRENESFDALLKRFTKELQKAGVLRDYRAKRHYVSKS
FT                   EQRRAKIRKAEHRRRRKLAKLAKKGQLGL"
FT   gene            532938..533237
FT                   /locus_tag="trd_0538"
FT   CDS_pept        532938..533237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0538"
FT                   /product="hypothetical protein"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain a
FT                   frame shift; identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05332"
FT                   /db_xref="GOA:B9KYJ2"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ2"
FT                   /protein_id="ACM05332.1"
FT                   /translation="MRQTWLLPVATATFVLFVAGSIAAVTMWSVAPWIIPLLAVPSLIV
FT                   TWFALAVALADLMRRPAHRFPGGRWLWLLLIALLNVVAFLPYWLLVARRPNEED"
FT   gene            complement(533457..534122)
FT                   /locus_tag="trd_0539"
FT   CDS_pept        complement(533457..534122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0539"
FT                   /product="TENA/THI-4 family"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06178"
FT                   /db_xref="GOA:B9KYJ3"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR027574"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ3"
FT                   /protein_id="ACM06178.1"
FT                   /translation="MTSFTQELWRSIDPIYQAIVVHPFLVGLTDGTLPEEAFRFYVVQD
FT                   ALYLQDYARCLALAAAKAPRETWCELFADHAKVALVVERALHESFFAAWGLSPDKIAGT
FT                   PYAPTNLAYTSYLLRVAYERPFEEVIGALLPCYWIYWEVGKHLERSGSPNPLYQKWIDT
FT                   YASEEYAAVVQAVLDVADQVVTDLPESRRQPIRTHFVTTARYEWMFWDAAWRLERWPV"
FT   gene            complement(534138..534782)
FT                   /locus_tag="trd_0540"
FT   CDS_pept        complement(534138..534782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0540"
FT                   /product="TENA/THI-4 family"
FT                   /note="identified by match to protein family HMM PF03070"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05008"
FT                   /db_xref="GOA:B9KYJ4"
FT                   /db_xref="InterPro:IPR004305"
FT                   /db_xref="InterPro:IPR016084"
FT                   /db_xref="InterPro:IPR026285"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ4"
FT                   /protein_id="ACM05008.1"
FT                   /translation="MPSTLLDELLAEARPIWQAMIAHPFLHELATGTLSRERFHFWVQQ
FT                   DYRFVQDGIRFLGLLIARAPDEELRRGLLDAAVAFRNELTIFEEYARQHALSLAVEPTP
FT                   ICLGYTSFLLATAATGSLVEALTVLWCAEKAYYDAWSAVRAQLGLAPAYARWIENWTSP
FT                   QFASWVDWLGEQLAKRATTPDRPPIRAAFLATARYEYLFWDMVYTGSNWPI"
FT   gene            535094..535222
FT                   /locus_tag="trd_0541"
FT   CDS_pept        535094..535222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0541"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05828"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ5"
FT                   /protein_id="ACM05828.1"
FT                   /translation="MEEFASERDWKAFLVWDMVELGKESSPPALARGAGDEPVHTP"
FT   gene            535360..536136
FT                   /locus_tag="trd_0542"
FT   CDS_pept        535360..536136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0542"
FT                   /product="glucose-1-phosphate thymidylyltransferase"
FT                   /EC_number="2.7.7.24"
FT                   /note="identified by match to protein family HMM PF00483"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04784"
FT                   /db_xref="GOA:B9KYJ6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005907"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ6"
FT                   /protein_id="ACM04784.1"
FT                   /translation="MKGVVLAGGLGTRLYPLTFATNKHLLPVYDQPMIYYPIQTLVKAG
FT                   IDEIMVVTGGPHAGDFLRVLRNGRHLGVRHLEYAYQEEERGIADALSLCEEFADGEHIC
FT                   VILGDNTTDADIRPAVESFTGGALIFLARVPDPHRFGCPVFDPNDPTRILRIEEKPKEP
FT                   KSPYAVTGLYLYDNRVFEFIRELEPSPRGELEITDVNNRYLELGLLRWVELQGFWSDAG
FT                   TFESLHRANRYWAERRGYRDPDPILPSALPAGRSTH"
FT   gene            536149..538299
FT                   /gene="argS"
FT                   /locus_tag="trd_0543"
FT   CDS_pept        536149..538299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argS"
FT                   /locus_tag="trd_0543"
FT                   /product="arginyl-tRNA synthetase"
FT                   /EC_number="6.1.1.19"
FT                   /note="identified by match to protein family HMM PF00750;
FT                   match to protein family HMM PF05746; match to protein
FT                   family HMM TIGR00456"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05674"
FT                   /db_xref="GOA:B9KYJ7"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ7"
FT                   /protein_id="ACM05674.1"
FT                   /translation="MFKREATRAAELINAELEALGYGRRTLEMRPIPFPGVWGTSTTVC
FT                   YQIANEQLAEELERVAAGLSKKEAKRLVQERVRERAQAIAEELARRLSRHTGFARVEAI
FT                   NGYLNIVYDSNRFANDVLRTVLAEGSEFGRGEARGERVMVEYSQPNTHKAFHVGHLRNV
FT                   CLGNALSRVLRFAGFDVLEANYIGDIGLHVIKCLWCYLRFHQGEEPPRERRGRWLGEIY
FT                   AEADRRLSYRQDVIELLNELAREDQAFVQAIDRMLKELWQEHKVGEDIAYLLGQIAHGR
FT                   EIKPDAFYDDQTIVKFWPIVGRQLEQELVEARASDEGEKAAERIQRVEEWYDRWRRLAA
FT                   TLDWWPHVPEWEREVRETFQRWERKDPEFVRLWEETRAWSMEEFYRIYEELDVHFDVWF
FT                   FESEVEEEGRQIVRELLERGIAEISDGLPVVKIDEKLGLEKETYRTLPILRSDGTTLYS
FT                   TKDLALTKRKFEQYHVDRAIWVVDVRQTLYLQQIFKVMELWGFQQAAKCYHLAYETVML
FT                   PSGAMSSRLGNVVLYEDVARQVLERALEIIEEKNPTLPPEVKASVARQVGLGSLKYGML
FT                   SRDNNRVIVFDIEEALSFEGHAAPYIQYAHARACRILEKVDTLPEGPYALDALTREEID
FT                   LIEQIALFPDEVQRAADEYKPLVIANYVYELAKRFNEFYRVCPVLQAPEPQRSARLAIV
FT                   AAARQTLANGLQLLGIAAPEVM"
FT   gene            complement(538319..539773)
FT                   /locus_tag="trd_0544"
FT   CDS_pept        complement(538319..539773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0544"
FT                   /product="probable transcription regulator"
FT                   /note="identified by match to protein family HMM PF03816;
FT                   match to protein family HMM TIGR00350"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04500"
FT                   /db_xref="GOA:B9KYJ8"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ8"
FT                   /protein_id="ACM04500.1"
FT                   /translation="MTSDRPPDGSLPPTRFTARQLRAARQGSFESLDAPESVPPRPSRR
FT                   RVSLPALAATLLLVIVAGIAAYLAPLAWASWRAYQRVFTTPIPRANVTINAQGTPEVVL
FT                   VSPNDPAIQLPDWDKKDRINVLLLGVDRREAGDVPRADTIIVVTIDPLTKDVGMLSIPR
FT                   DLLVTIPGYGQEKINAAYPLGMSSPLTGPGLLRATIEYNFGIPIHYYAEVDFEGFVRIV
FT                   DTLGGVVVDVPAPIKDDEYPGEDYNYTRVYFAPGLQHMDGRTALRYVRTRHDDNDFSRG
FT                   YRQQQVLRALREQGLRLDLLRKAPQLVDALADTVRTDLSPQQVLALAKLGSEIPRERIR
FT                   SFTLLEATTSYWEPGQPFYLIPNWPAIQAILDEMFPPREGQPRPRVRSTTVAPPAQPLA
FT                   PDLVEPVQTPPPEVQAPVQPQPTETAPVETEPTPSTPTPGTQLTPTLPPATPTPHGMHT
FT                   PVPTVVPTAESTTPEATPTPEGTPTP"
FT   gene            complement(539789..539911)
FT                   /locus_tag="trd_0545"
FT   CDS_pept        complement(539789..539911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0545"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05024"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYJ9"
FT                   /protein_id="ACM05024.1"
FT                   /translation="MLGDRDGHCTDTSMGRNRCCVNRNPFPDGCYTAARRIGAR"
FT   gene            539928..540521
FT                   /gene="dcd"
FT                   /locus_tag="trd_0546"
FT   CDS_pept        539928..540521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dcd"
FT                   /locus_tag="trd_0546"
FT                   /product="deoxycytidine triphosphate deaminase"
FT                   /EC_number="3.5.4.13"
FT                   /note="identified by match to protein family HMM PF00692;
FT                   match to protein family HMM TIGR02274"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04845"
FT                   /db_xref="GOA:B9KYK0"
FT                   /db_xref="InterPro:IPR011962"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYK0"
FT                   /protein_id="ACM04845.1"
FT                   /translation="MILSDRDIIAALKSGRIKITPEPDLETQLGACSIDLHLGNTFMVF
FT                   EHSRFSYIDPRQPQSIGDAMRTIVVPDGEPFIMQAGDFALASTREYIELADDLVGRLEG
FT                   RSSIARLGITVHSTAALFEPGWAGTATMELSNLGRMAVALYPGMRICSFTFEQLSSPAM
FT                   VPYRMKRGNKYAGQKDPKPSRLAEELSLEQLRGR"
FT   gene            complement(540528..541067)
FT                   /locus_tag="trd_0547"
FT   CDS_pept        complement(540528..541067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0547"
FT                   /product="putative ATP:cob(I)alamin adenosyltransferase"
FT                   /note="identified by match to protein family HMM PF01923;
FT                   match to protein family HMM TIGR00636"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05479"
FT                   /db_xref="GOA:B9KYK1"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK1"
FT                   /protein_id="ACM05479.1"
FT                   /translation="MLYTGKGDQGYTDLLGGRVPKYAPRPETFGTLDEATCAIGLARAL
FT                   AQDQETKQTLIRVQRDLYVMMAELAFAPGIEQEKYRITAEHVQHLEVTIDAIGARVPIG
FT                   RHFVLPGDTVAGAALDFARTVVRRAERLVARLYHDGDIHNEHLLAYLNRLSSLLFVLAR
FT                   YEDHRAGVTPTPAKEP"
FT   gene            complement(541089..541949)
FT                   /locus_tag="trd_0548"
FT   CDS_pept        complement(541089..541949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0548"
FT                   /product="ABC-2 type transporter superfamily"
FT                   /note="identified by match to protein family HMM PF01061"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04624"
FT                   /db_xref="GOA:B9KYK2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK2"
FT                   /protein_id="ACM04624.1"
FT                   /translation="MASIELTEPVRPPSPLLRASIGVLTLWQRDLLRFWRDRTRIAGGL
FT                   AQPLLFLAIFGAGLSPWMGNLGGTMFGPDYLQFLYPGIIGMSVLFSSIFSAVSVVWDRE
FT                   FGFLKELLVAPIPRWSIVIGKALGGSSTAMFQGLLLLILAPVIGVRLSLSTILLLIPLL
FT                   FLLAFSLSSIGLVIAARMRSTEGFGLIMNFLVTPLLFLSGALYPLNNLPTWLLILTRLD
FT                   PVTYGIDAIRRVVLSSSGVPQPVIDQLGVTLFGHPLDPLTDAAVVLGLGLVLITVAARQ
FT                   FARPD"
FT   gene            complement(541971..542192)
FT                   /locus_tag="trd_0549"
FT   CDS_pept        complement(541971..542192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0549"
FT                   /product="multidrug ABC transporter, ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05682"
FT                   /db_xref="GOA:B9KYK3"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK3"
FT                   /protein_id="ACM05682.1"
FT                   /translation="MQECCAGVPQLRSRTPPYPTIPELVRQLSVPIRSVSLRRPSLDDV
FT                   FLALTGRQIRDEEPSSLDQLRERIRARR"
FT   gene            complement(542961..545306)
FT                   /locus_tag="trd_0550"
FT   CDS_pept        complement(542961..545306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0550"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04832"
FT                   /db_xref="InterPro:IPR014820"
FT                   /db_xref="InterPro:IPR015330"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK4"
FT                   /protein_id="ACM04832.1"
FT                   /translation="MTITTDILRQAAQKYQALGLPAIPAYRGRPLILWQVYQQRLPEPE
FT                   EVEGWPWSKADGVAVICGHQTTFGGFWWCLDVEHQHRVEAERWLDATHPGWRHGLVAES
FT                   QRNGLHVYCRSRQPVRTQRHEWGDIKGSGSLVYAPPSRRYKPDATQDYEWLSFDPTNAL
FT                   QLEPADLPWPTDNGHQQGPLGQPSLAETLKTTIPVGNRHNTMVRVAGWLRGVGHLEPDE
FT                   ILTVLQQMNRRCEVPLPDQELVEIARSSSKWSVNPTLVAGNGHQQSTDSGGHPVRKPVR
FT                   FTGRETPPLRPWLVADVIPEGLPALIYGNGGSAKSYLALLAGLAVAAGVPWLGKPTVQR
FT                   PTLFADFELDETEQHRRARRLAIGLGLADVPEVFEYVQLADLSPRDAEAVLVDWVAAHP
FT                   DGLVIVDSVGAAAITDLEKAQAVVQVFRNLRSLNPGGLLLVDHQAKLQPGQDYRDKTPF
FT                   GSVYKYNLSRVVWQSELVESQPGEAWVILRNTKNNLGPLQGEIGVKLSFGEGLVTVTPV
FT                   ALTTGPLVERASLESRIIAVLKEHGPSTAQEIADRLEANPKSVKAKLSRLKGLGRVVVT
FT                   GTVGREHLWSLPGTPGHSPDDQEQASLTLTDNTAVNVNAGPGKHHTPHREAKIDAQDPG
FT                   GEAGKHHTWLHEAQNDEHTPAGEAEKHHAWLPDAKNAVCEVCGQLFTWSGRGQPARYCS
FT                   RTCQMKAYRQRSTPVDAPGRGNPGSLATETETNGHPPDPSACLDCGKRIDAEGFQYICP
FT                   PCMKLRYDKLQRQYPEKLIRWLEQQHGR"
FT   gene            complement(545370..545741)
FT                   /locus_tag="trd_0551"
FT   CDS_pept        complement(545370..545741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0551"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05067"
FT                   /db_xref="GOA:B9KYK5"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK5"
FT                   /protein_id="ACM05067.1"
FT                   /translation="MMTVAVSPTLPYAIKYRKHGRIVCLGKICRNDDGELIFGVPYKGR
FT                   PFRTPSLPLPVYLHLLAAGVRWWIIRFDDQRKAYRIELARVDRVATIGTDGELTVPLRM
FT                   FEACPYPEWPYAVRSVLIR"
FT   gene            complement(545790..545972)
FT                   /locus_tag="trd_0552"
FT   CDS_pept        complement(545790..545972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0552"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06307"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK6"
FT                   /protein_id="ACM06307.1"
FT                   /translation="MMLVVKVSRFRPGQLEPEAVVATTDQAICQAVLRLIRERLAREEE
FT                   QDGLVSKPTVRRTDD"
FT   gene            complement(546244..547323)
FT                   /locus_tag="trd_0553"
FT   CDS_pept        complement(546244..547323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0553"
FT                   /product="putative integrase"
FT                   /note="identified by match to protein family HMM PF00589"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05245"
FT                   /db_xref="GOA:B9KYK7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK7"
FT                   /protein_id="ACM05245.1"
FT                   /translation="MATIRRRKSGLFEARLQRDGRRFSVYGRTETEVRQKLAELERKLA
FT                   IDQAPPVGRVTVRELCERWLATERKRWKPKTYYDYRWHLEHHVYPVLGRVQLSKLTPDR
FT                   LQRFFDSLSGRSANLTFRLLHRCFVVGIRWGFLGQNPCDRVVPPAYQAPPIELPDADAL
FT                   ARLFRYCLESDDPYAGLVGLSLLCGLRRGEITALRWSDIDLQTGQLSVVRSGQWIAGRW
FT                   VETEPKTRAGRRTIYVGEQGIRLLRRQKALVAQLKLQAGPAWQEHGLVFPGPNGQPLSP
FT                   SRVAAAVQRICKASGVPPLRHHSLRHASASLALLAGVPLPEVSRQLGHANVSITARVYS
FT                   HCISDGRRVTEAIERVLAG"
FT   gene            complement(547416..548336)
FT                   /locus_tag="trd_0554"
FT   CDS_pept        complement(547416..548336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0554"
FT                   /product="ABC-type multidrug transport system, ATPase
FT                   component"
FT                   /note="identified by match to protein family HMM PF00005;
FT                   match to protein family HMM TIGR01188"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05595"
FT                   /db_xref="GOA:B9KYK8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005894"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR025302"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK8"
FT                   /protein_id="ACM05595.1"
FT                   /translation="MTAAIEVHELVKQYGDVTAVAGINFTVARGEFFAFLGPNGAGKTT
FT                   TINILCTLARPTSGRARVASCDVVREPHRVRERIGIIFQDPSLDTQLTAWKNLALHARV
FT                   YGVPGTLWRQRAEQLLRLVELWDRRHQLVRTFSGGMKRRLELVRGLLHRPEILFLDEPT
FT                   LGLDPQTRRQIWSYLETLRRETGVTLFLTTHYLEEAEQCDRVAIIDHGRVIALDTPDRL
FT                   KARVGRDIIVLATADDARAASELRERFSLQPLVVDGTLRVEVERGDTFIPELVRQLSVP
FT                   IRSVSLRRPSLDDVFLALTGRQIRS"
FT   gene            549180..549476
FT                   /locus_tag="trd_0555"
FT   CDS_pept        549180..549476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0555"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04478"
FT                   /db_xref="GOA:B9KYK9"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYK9"
FT                   /protein_id="ACM04478.1"
FT                   /translation="MQWRILSAWFALLVVGGANAMLFWSSFNRVVGGFGTGRDWLGLVG
FT                   GLFGVLVSLVVARWYLQRTGALVGGMEKRAVGDTAGEGTGRRGQHVGQSRSER"
FT   gene            549448..549585
FT                   /locus_tag="trd_0556"
FT   CDS_pept        549448..549585
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0556"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04470"
FT                   /db_xref="GOA:B9KYL0"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL0"
FT                   /protein_id="ACM04470.1"
FT                   /translation="MSGRAGQKDERSEQHPVGTLFLTLLMLIVIVGIWLTVYFDMLGRG
FT                   "
FT   gene            549589..550056
FT                   /locus_tag="trd_0557"
FT   CDS_pept        549589..550056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0557"
FT                   /product="cytochrome c oxidase (bo3-type) subunit II"
FT                   /note="identified by match to protein family HMM PF00116;
FT                   match to protein family HMM PF00127"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05518"
FT                   /db_xref="GOA:B9KYL1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR034214"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL1"
FT                   /protein_id="ACM05518.1"
FT                   /translation="MRIEAYERIFMILAGLMLVLGIVGIGIGALVAGVHVPSPAGRIDP
FT                   RALSTTPPFDQPGLRDLGGGKYEAVVIARAWQFQPDEIQVPVGATVTFTLASPDVIHGF
FT                   VLTGTNANVMVIPGQISQVTARFDQPGEYLWVCHEYCGFGHHQMYGKVVVR"
FT   gene            550053..551741
FT                   /locus_tag="trd_0558"
FT   CDS_pept        550053..551741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0558"
FT                   /product="cytochrome c oxidase subunit 1"
FT                   /note="identified by match to protein family HMM PF00115"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04586"
FT                   /db_xref="GOA:B9KYL2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL2"
FT                   /protein_id="ACM04586.1"
FT                   /translation="MSATARARTVAGGGAVTHEGIFLAEQLWPIKGQLVLALIGLAIGG
FT                   LMGLMQALDRVGIVIYKAMLMQTYYQGLTIHGVLLAFLFTFAFSNAFVSLVAIRGFERP
FT                   LASTFLAQGAFWTMLVGTLLAAYAILTNQATVLFTFYAPMRASSLFFLGAALLVISTLL
FT                   TALNLVLTRRAWQREHPGERTPLLGFVGVVTYVMWALASLGVVVLVVFFLLPWSLGWLK
FT                   TTDPQFNRILFWYTGHAIVYFWLMPAYISWYLMVPRQVGGRVFSDSLVRLAFILLLVFS
FT                   VPTGLHHQYVDPGIPTVMKVVHLFTTFSVVFPSLVTAFTVMAALEDGGRARGGTGLLGW
FT                   IWKLPWGDPSVAAQLLAMLVFILGGATGIVNASYNLNNVVHNTSFVPGHFHMTVGTAVT
FT                   LSFIGISYWLIPFLTGRELMGRRLALAQAWLWFVGVLLFARGQIAAGLLGEPRRSSIGE
FT                   APYRDLISAGLDNWLTAIGGTLMVISGLLYFIVVLWTVFAGRRLTQPLEIPVAEMRFGA
FT                   RETSPRLDQLGFWFLIAVILVAIAYIPTILLYLPLQSVSPPIKVY"
FT   gene            complement(552014..553639)
FT                   /locus_tag="trd_0559"
FT   CDS_pept        complement(552014..553639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0559"
FT                   /product="probable acetolactate synthase large subunit"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05229"
FT                   /db_xref="GOA:B9KYL3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL3"
FT                   /protein_id="ACM05229.1"
FT                   /translation="MPVLTGGQALVAQLLEEGIEIVFGLPGVQLDWAFDALYEARDRIR
FT                   VIHTRHEQATSYMADGYARTTGKMGVCLVVPGPGVLNAMAGLATAYACNSRVFCITGQI
FT                   PSDQIEKGRGFLHEIPRQLEALRSVTKWAARAMHPSQIPALAHEAIVQLWSGRPRPVAL
FT                   EIPPDVLQATAEVETIAATRPLPPDGDPELIERAAQLLGTAQKPLIFAGGGILAAEAWE
FT                   ELRALAELLEAPVVLTMDGKGALDDRHDLAHNIIAARELVPESDVILIVGSRFLQPATS
FT                   DWGPRHQAVIQIDIDPDEIGRNYPPTIGIVADAKRALSALLERVPLYNQKRDSRRAELR
FT                   ALKERVFDLLWEVQPQASFAMALREALPEEAIVVSESTQVGYWTWNAFPVYRPRTFVTS
FT                   GYQGTLGFGFATALGAKAGNPDRPVLSLNGDGGFLYNLPELATMVQHRLDVITVVFNDN
FT                   AFGNVRRIQKERFGGHYIASELYNPDFVALAHSFGIEGVRVSTPEALRDIVADTVRNPR
FT                   PILIEVPVGEMPSIWGIVMAGRRS"
FT   gene            complement(553862..554698)
FT                   /locus_tag="trd_0560"
FT   CDS_pept        complement(553862..554698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0560"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /note="identified by match to protein family HMM PF00561"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06296"
FT                   /db_xref="GOA:B9KYL4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL4"
FT                   /protein_id="ACM06296.1"
FT                   /translation="MSVTELAWATTPNGTKIAYERRVGSAGPPILALHGVLVGTSNWVH
FT                   QVLRLPQFQWLLPHLRGHGNSPPPMPHQTIEEAALDVESVLLAERIDRAVVLGNSLGAT
FT                   IALALALMRPHRIHGLVLVEPSLPALAGEEERERLRHSAALVRELLAAGRIDEALAHFL
FT                   GPRLGPNWAEKAGQRRLEEWRRNIFSTPAWIDAVLAFDPGPVPLAAIDCPTLLVYGAET
FT                   QPGYRRTIFALADLLPHAQIAEVPRAGHGAPVDNPDAFNELLLGFLSAIEWLPSPG"
FT   gene            complement(554704..556023)
FT                   /gene="sucB"
FT                   /locus_tag="trd_0561"
FT   CDS_pept        complement(554704..556023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="trd_0561"
FT                   /product="2-oxoglutarate dehydrogenase, E2 component,
FT                   dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="identified by match to protein family HMM PF00198;
FT                   match to protein family HMM PF00364; match to protein
FT                   family HMM PF02817; match to protein family HMM TIGR01347"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06102"
FT                   /db_xref="GOA:B9KYL5"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL5"
FT                   /protein_id="ACM06102.1"
FT                   /translation="MAIEVRVPQMGESIVEAVIGAWRKREGDPVNPGDVLVELETEKVN
FT                   VEVTADRAGVLQHILKREGETVTVGEVIALIEETAQVTAPVQETPAEAGRAREPAPLPE
FT                   VTTAAASQPAQPAGGPAVRATPAVRRLAEEYGIDLAEVPASGEGGRVTREDVLRYVAQR
FT                   GAAARPADGAAPQPVAAAPPPAAPPAPGVTPPEAPVVLPFSAAGRREERIRMSQRRKTI
FT                   ARRLVEAQHTAAMLTTFNEIDMSAVVALRNRWRQQFRERYGVSLGFMSFFTKAVVGALK
FT                   AFPLLNAEIQGDEIVVKYYYDIGIAVATDEGLVVPVVRDADRKSFAEIEREIEELARKA
FT                   RERRLTLEELSGGTFTITNGGVFGSLLSTPILNPPQVGILGMHKIEERPVVVNGEIVIR
FT                   PMMYVALTYDHRIVDGREAVLFLVRVKELIEDPERLLLEG"
FT   gene            complement(556044..558941)
FT                   /gene="sucA"
FT                   /locus_tag="trd_0562"
FT   CDS_pept        complement(556044..558941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="trd_0562"
FT                   /product="2-oxoglutarate dehydrogenase, E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="identified by match to protein family HMM PF00676;
FT                   match to protein family HMM PF02779; match to protein
FT                   family HMM TIGR00239"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04944"
FT                   /db_xref="GOA:B9KYL6"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL6"
FT                   /protein_id="ACM04944.1"
FT                   /translation="MRHPQARWHAAENLAKCPESRCRSESDEVGAMVNQQEALERLTGL
FT                   NLGYILELYEVYRRDATAVTPEWRAFFEQWGPHLEQLAAPSPAAAIAGPAFDFTKVAAV
FT                   VQLAQRIRHRGHRAARLDPLGSPPPGDPALDPAYHGLTSQDLEHLPATLVGGPAAQGAR
FT                   NAAEAIERLREIYCGTIGYDYGHLQDRTEREWLEEAIESERYRVRLSPTEKRALLERLT
FT                   AVEVFERFLHRTFVGQKRFSIEGTDTLVPILDEILRQVAETGIPKVAMGMAHRGRLNVL
FT                   AHVLGKPYEQILAEFMGLDHREPVALTEGGTLGYTGDVKYHMGGIRAAGQLQVILAHNP
FT                   SHLEFVDPVVEGMARALQERRDRPGAPEQDVDACLPILIHGDAAFPGEGIVAETLNMSG
FT                   IPGYATGGTLHIIVNNQLGYTTEPQEGRSTFYASDPARGFEIPVIHVNADDPEACLTAA
FT                   RLAFAYRQRFHKDVLIDLIGYRRWGHNEGDEPTFTQPVMYRRIAEHPTVRELWAQRLVA
FT                   EGIVTRDEAAALEQELFGKLQHLRQEVLTRAQRADQVNGSIGSGAPKLPTIATAVPLET
FT                   LKELNRQAHTLPAGFNLNPKLRRQLQRRLEVVEREEVIDWAHAELLAFASLLAEGIPIR
FT                   LTGQDTIRGTFSQRHVAFYDFETGERVIPLQQMPAARASFAVYNSPLSEAGPLGFEYGY
FT                   SVQAPDALVLWEAQFGDFANVAQVIIDQFIVSGWAKWRQRSALVLLLPHGYEGQGPEHS
FT                   SARLERFLQLAAEDNVRIANCTTAAQYFHLLRRQAILRTVDPRPLIVMTPKSLLRHPRA
FT                   MSPMRELAEGRFQPVLDDPTARQRPDDVTRLILCSGKVYVDLVTSQFAATASHVAIVRV
FT                   EELYPFPGDELAAILRQYPNARDVVWLQEEPKNMGAWTYMQPRLQPLLNGRTLRYIGRP
FT                   ERASPAEGFAEMHEQEQARIIAEAFAGVPEPAVPA"
FT   gene            complement(559017..560273)
FT                   /locus_tag="trd_0563"
FT   CDS_pept        complement(559017..560273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0563"
FT                   /product="putative FAD binding domain"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01494"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06195"
FT                   /db_xref="GOA:B9KYL7"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL7"
FT                   /protein_id="ACM06195.1"
FT                   /translation="MAKQIGRFDAIVVGARIAGCVTAAALAQLGWSILLIERARFPRPT
FT                   LSTHLFFSDTLHAFQRAGLLEPVLRIGAPRLRWLRFPYVAAPFPESGEFDFALCIRRDV
FT                   LDTALFETVRSLSNVTALTSARVTAVRRVDDRRWDVVVETTSEEWLASAPLVIGADGKD
FT                   SIVARQVGAPVLQEIPPLFAWYYTYVDDLPWDSDLAALAYRGDYPEIGAEYAAAFLFPC
FT                   DAGLTLVGYGVEHRAFPAFRRDVTHHFFAGLRRIPEIWERFAAARQVAPIRGTGHLPNF
FT                   LRQASGTGWALVGDAGCHQDPHSVQGMGNAARSAWLLAEELARVQTEGIDLQQALARYA
FT                   SRRDDDLLPMFAFTTFELRRRLPDDIWERFEARTREDPHLASLRVAAMVHAIHPATVYT
FT                   PERVVSLANGEAVLPLHSA"
FT   gene            560974..562332
FT                   /gene="mgtE"
FT                   /locus_tag="trd_0564"
FT   CDS_pept        560974..562332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mgtE"
FT                   /locus_tag="trd_0564"
FT                   /product="magnesium transporter"
FT                   /note="identified by match to protein family HMM PF00571;
FT                   match to protein family HMM PF01769; match to protein
FT                   family HMM PF03448; match to protein family HMM TIGR00400"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05121"
FT                   /db_xref="GOA:B9KYL8"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL8"
FT                   /protein_id="ACM05121.1"
FT                   /translation="MATEMDIQMQLRSLLQRGERETVEDLLWELVEQRQLYAVLRELEP
FT                   FELARLAELLGDETFGEFLAELDPSDAADLLERLSSQEAADVLEAMAPDDAADVFARLD
FT                   PDEARQILVEMEPLEAQELQELLSYPPETAGGRMTPSYVALLPDVRVDQAIAALRKVAA
FT                   EVETIYYAYVVDEANHLLGVVSMRDLVLSPPYRTVGEIMTRDIVKVRATADQEEAARLL
FT                   VEEGLLAIPVVDDEDRLLGIITVDDVADILEREVTEDIERLGGSQPLEVPYTRATPFYL
FT                   WRRRIGWLLLLFVAEMYTGTVLRHFEQELEEAIALAFFVPLLIGTGGNAGSQVVTTLVR
FT                   AMAVEGIGIRDFFRIFPKEFIAGLLAGVVMGTAGFLRAEILGVDPAISLTVGVALFCIV
FT                   LWAVTVATLLPLLLRRLGIDPAVVSSPFIATLVDGTGLVIYFNVARIILHLHS"
FT   gene            562388..563326
FT                   /locus_tag="trd_0565"
FT   CDS_pept        562388..563326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0565"
FT                   /product="Zn-dependent hydrolase"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04659"
FT                   /db_xref="GOA:B9KYL9"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR037482"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYL9"
FT                   /protein_id="ACM04659.1"
FT                   /translation="MRELEPGWYLVDLRFQGVENVIASYLFVGRQGVAIVDTGPSTTIE
FT                   RLVAALQELDVPPEAVRHLVLTHIHLDHGGAAGHLLERFPNARVYVHPLGAPHLIDPTR
FT                   LWASAARIYGDRMELLWGSIRPCAAERVVVVEDGEAIDLGDGRRLRALATPGHASHHHA
FT                   WLDTATGSVFAGDIAGIRISALPFVFPPTPPPDIDLGQWRRSIERLRRLQPSRLYLGHF
FT                   GPVEDIDWHLDDLLARLFLWAGWIGALLEQGLDAETIAGRLQELTDGEFHRLLGERAPV
FT                   IAYQWASGSFRMTVDGYVRYFRTHRPWASGS"
FT   gene            563323..564564
FT                   /locus_tag="trd_0566"
FT   CDS_pept        563323..564564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0566"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF07690"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06018"
FT                   /db_xref="GOA:B9KYM0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM0"
FT                   /protein_id="ACM06018.1"
FT                   /translation="MRTQRAMSAPSLQRRAYRLIILLGLVSLFGDISYEGVRGVTGPYL
FT                   ALLGASAVAVGLVAGLGEFAGYALRTASGYLADRLRLHWLLTVVGYGLIATLPLLALVH
FT                   RWELAAALIVLERLGKALRTPSRDAILSHAASQVGRGKGFGIHEALDQLGALIGPVIFA
FT                   VALTFDGEAGYRLGFGLLTIPAILAIVILVLAWRQEPEPESLESVTPRVNRPTEASGSR
FT                   RLSGPFWRYTLFTALTTLGFVPFALLSYHVEQTGRFSPPLIPLLYAVAMGVDGGIALIA
FT                   GWGYDRFGLRTLAAVPICIALGTAAALQSTTGFIITGVVVWGIAMGLVETTMRAAVGEL
FT                   SAPSARGLAYGVFNTVFGTAWLAGGAVLGYLYEQLGSRGTIGATLVLEIAALLLFWGLG
FT                   VARAHASYRAQSVS"
FT   gene            564605..564730
FT                   /locus_tag="trd_0568"
FT   CDS_pept        564605..564730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0568"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04711"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM1"
FT                   /protein_id="ACM04711.1"
FT                   /translation="MPRHRPSSAEFGRAVGRSPEALGWQSACPLMSGARELLGGE"
FT   gene            complement(564693..566438)
FT                   /locus_tag="trd_0567"
FT   CDS_pept        complement(564693..566438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0567"
FT                   /product="PHP domain protein"
FT                   /note="identified by match to protein family HMM PF02811"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05554"
FT                   /db_xref="GOA:B9KYM2"
FT                   /db_xref="InterPro:IPR002008"
FT                   /db_xref="InterPro:IPR002054"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR010996"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR022311"
FT                   /db_xref="InterPro:IPR027421"
FT                   /db_xref="InterPro:IPR029398"
FT                   /db_xref="InterPro:IPR037160"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM2"
FT                   /protein_id="ACM05554.1"
FT                   /translation="MRRNEEVALLLDNIAELLMLKNENPYRIRAYTTAAQNIRALDEDI
FT                   EELARQGKLDEIPGVGKAIAAKIEEYLRTGRLEYYEQLKREVPLQAVDLLEVPGIGPAR
FT                   AHLLYEQLGITTIQDLLQAAQEHKLRKLPGFGEKLEERIAREAARLMQRSKRLLLGIAL
FT                   PVAEEVVAALRPHAAIRAIDPAGSLRRMKETIGDIDILVASDDPPAVVDAFVHLPFVKE
FT                   VLAVGPTRPSILTREDLQVDLRVVRPHEYGSALLYFTGSKEHNIALRSFVQERGWKLSE
FT                   YGLFDETGKLLASETEHEIYALLGMDWIPPELRENRGEIEAAREHRLPILVEQRDIRGD
FT                   LHVHTDWSDGHEPLERMCEAARARGYEYLVISDHSPSLTVARGLSIERLREQRERIREL
FT                   NERLAPFRILQGAEVNILSDGTLDYPDEILAELDLVIVSVHSAFDMPQERMTERVIRAL
FT                   ANPHVDILGHPTGRLLTSRLPYEIDLDAVLDAAAHYGVAIEVNGQPDRLDLPDIWVQRA
FT                   INRGILIACTSDAHSTRQLDNMRWSVATARRGWAEPRHVLNTRSLEELRTWLATHHRGA
FT                   PAHRT"
FT   gene            complement(566444..567214)
FT                   /locus_tag="trd_0569"
FT   CDS_pept        complement(566444..567214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0569"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05732"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM3"
FT                   /protein_id="ACM05732.1"
FT                   /translation="MVFQDPYFHALRRRLQAAPYDEARRRLTARLAETTPHPPRPPHLT
FT                   PDEIAQREQWLYREGLDLYLPILRTVLRAIAREVEAGLVEPTELDPEELTFATYQRARS
FT                   ELRELPQLPRDRFAWLRRLAHDTVHRAALARHAERHRGTASEPTEHPEAPPAELQGTAA
FT                   RLAAALADPDLPLPDDLLADPETRRLLDQLLDRLPEQWRETYLLSALDRWSDEQIAAVT
FT                   GLLPDEVRALVHATVRLLRAWLEESTVQPTRPKE"
FT   gene            complement(567553..569280)
FT                   /locus_tag="trd_0570"
FT   CDS_pept        complement(567553..569280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0570"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04875"
FT                   /db_xref="GOA:B9KYM4"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM4"
FT                   /protein_id="ACM04875.1"
FT                   /translation="MGQTPILRPLQPNGRVTTVPRTAASAIGKPRWCNRLVHLVLALLG
FT                   LSATLFTLLVTWNERSRAITAPLLLGRYAAAGALATDGRAIVLAIPETADSTLLLEVSG
FT                   NEHHATLTRSTGQISELALAQGTALWLERSCTDCSGRIRALRLETRETWTLAETGIRSG
FT                   PRANGRWAAWVARNGTDRLFVADLENTRHPPRILTVLPPEHAITDLQLRAGRVAWVEVT
FT                   RTEEWRIQLQPVASADAPVTVLQGEGTPPSILLSNDALITIDQTMRVISLDEPRLNVPI
FT                   WESVPKAVTADGRYVFWIDTALPETGRRAIMAYDTLSKSRFLAVPDATYVSQLAVGGDR
FT                   LVWFQEHGPDDVSLWAAPIADLLPTARRAKPESQNPGWRYFPETGHYLANGFRHFWEQF
FT                   GGASLFGFPLSEEFDEYDPDAGQFRTVQYFERARFVWIPDSPIALDSVVLDHIGVELVH
FT                   QLGLASARVFRSPAPASDGAGMTTCRTFPETGHELCGPLLDAWLHIGSSVTARMPPDQA
FT                   ALLITGLAISEPTVLPDGTIVQYFERARLEFRPQAEPERAVSLGRIGAEILAARDWLR"
FT   gene            complement(569414..570361)
FT                   /gene="arcC"
FT                   /locus_tag="trd_0571"
FT   CDS_pept        complement(569414..570361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arcC"
FT                   /locus_tag="trd_0571"
FT                   /product="carbamate kinase"
FT                   /EC_number="2.7.2.2"
FT                   /note="identified by match to protein family HMM PF00696;
FT                   match to protein family HMM TIGR00746"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04863"
FT                   /db_xref="GOA:B9KYM5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM5"
FT                   /protein_id="ACM04863.1"
FT                   /translation="MRRIVVALGGNAIIQAGQRGTAEEQQANVDLTCRQLAELVAAGYE
FT                   LIITHGNGPQVGNLLVKNELAREIVPPVPLHWCVAQTQATIGFMIQQSLGAELRQRGID
FT                   RVVATLVTRTEVSPDDPAWNDPTKPIGLYYPEERARAIMAETGQVWKPQGTRGWRRVVP
FT                   SPDPIAIVDRPAIELLLAAGALVVACGGGGIPVVRRPDGRYEGVEAVVDKDLAAALLAH
FT                   ELGADALLILTDVPNVMLHYGTPQARPLERVLASELRRYQVEGHFASGSMGPKVEAALR
FT                   FVSRGSTRRSIIAALDHARDALEGRAGTHVLPDP"
FT   gene            complement(570358..571818)
FT                   /locus_tag="trd_0572"
FT   CDS_pept        complement(570358..571818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0572"
FT                   /product="Protein of unknown function (DUF1116)
FT                   superfamily"
FT                   /note="identified by match to protein family HMM PF06545"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04999"
FT                   /db_xref="InterPro:IPR009499"
FT                   /db_xref="InterPro:IPR024033"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM6"
FT                   /protein_id="ACM04999.1"
FT                   /translation="MDGMHEKVQKLLETTPAVINVGLDLFARSVQDQGGAVYPVEWKPP
FT                   MVEPRRLALPLFNDPTIDAANREAVTRMMRAQPVVVGVARARDVIPGMTDRTFLHAGPP
FT                   IDWAHASGPLRGALIGAMLFEGFAATPEEAIRKLESGYVELSPNHEHSAVGPMAGVISP
FT                   SMPVYIAINAAGENRAYTNFNEGIGKVMRMGAYAPEVIDRLRWISTVLAPLVGQALARS
FT                   GGIDLRNIIAQALQMGDECHNRNKAATSLFYREIAPYLVECDAPLSDIAAVLRFINAND
FT                   HFFVNLAMVAAKVMADAAHGIPGSSLVTTLSRNGTEFGIRVSGLGDRWFTGPANVPRGL
FT                   YFPGFGPDDANPDIGDSAITETAGFGGFALAGAPAIVQFIGGTPADAVQATLEMYEITV
FT                   AEHEVFRIPALDFRGTPVGIDLRSVVRSGILPVIDTGIAHREPGIGQVGAGIVRPPARC
FT                   FTEAYRAFEDAYLAGHSRTTTLESRGMA"
FT   gene            complement(571841..573385)
FT                   /locus_tag="trd_0573"
FT   CDS_pept        complement(571841..573385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0573"
FT                   /product="protein fdrA"
FT                   /note="identified by match to protein family HMM PF06263"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06163"
FT                   /db_xref="GOA:B9KYM7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM7"
FT                   /protein_id="ACM06163.1"
FT                   /translation="MVVRIRIEPNSYFDSVALMAVASVVNRLPGVDLAALLMGTSANLE
FT                   LLRDSGLWDERLETVSPNDLVIAVRASDDAAAERAIDEAVHRLRSSARTSQVSEAKVTL
FT                   RTLRTALRQVSQASVVAISVPGPYAPIEAEEALRADRHVFLFSDNVPIEEEVRLKELAQ
FT                   ERGLLLMGPDCGTAFIAGLGLGFMNAVRRGPIGIVAAAGTGLQQLASLIDWFGSGISHG
FT                   IGTGGRDLDARVGGRTMLAGLEALAHDPATQVIVLVSKPPAPEVAEKVLAFAAACGKPV
FT                   VATFIGQTAPVTEGVHVAANLTEAARLAVHLATGQSLADLDLPRRQEALARVRAERSRL
FT                   APTQRYLRGLYSGGTLCDEAMVLLQPRIGPIRSNIPLQPELRLTDPHRSEEHTFVDLGS
FT                   DEFTVGRPHPMIDQTIRLERFRREAADPTVAGIVLDLVLGYGAASDPAAELAPAIREAR
FT                   VEAERTGRILPCIVALVGTQSDPQDYARQRRTLEDAGAIVVPSNALAAELAAELIA"
FT   gene            complement(573793..574644)
FT                   /locus_tag="trd_0575"
FT   CDS_pept        complement(573793..574644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0575"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05203"
FT                   /db_xref="InterPro:IPR021530"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM8"
FT                   /protein_id="ACM05203.1"
FT                   /translation="MTIAVQRLASPILPLLTSPSRTLTVVAAYPRAAYATDGTTWLSVV
FT                   TPGALLPPDALQLRTKSPLVALVPTGSQLIAGQGALLLPDGTPLTIDQQTRVWQPTLRT
FT                   RWTCQWKRARLQALLDELTDPPRGDRFLATTISRSKALLAELIGAIITADRAHIAQQVD
FT                   RLAGLGPGLTPLGDDLLVGCCLALTLLAARTGEERWSSLRQEIALQAASRTTPRSAAWL
FT                   QQAARGEYAREFLLVAQALCRGDHPCLPHLLARVTQVGATSGWAVTFGLIATLERSILP
FT                   PA"
FT   gene            574627..574749
FT                   /locus_tag="trd_0576"
FT   CDS_pept        574627..574749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0576"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05422"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYM9"
FT                   /protein_id="ACM05422.1"
FT                   /translation="MDGDRHGVSPSLMRASVRERHAEMRRHDSLARNGRSGRGE"
FT   gene            574761..575645
FT                   /locus_tag="trd_0577"
FT   CDS_pept        574761..575645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0577"
FT                   /product="carbon monoxide dehydrogenase medium chain"
FT                   /EC_number="1.2.99.2"
FT                   /note="identified by match to protein family HMM PF00941;
FT                   match to protein family HMM PF03450"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06069"
FT                   /db_xref="GOA:B9KYN0"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN0"
FT                   /protein_id="ACM06069.1"
FT                   /translation="MKPPRFRYHAPESLDEALAVLAETGDEAKPLAGGQSLIPMLNMRL
FT                   ARPSLLIDLNGLSELAGIELRDGVLVVRAMTRHRAVERSPLVAEHVPLLAEAIPWVGHL
FT                   PIRTRGTIGGSVAHADPAAEVPGVLVALDGAVRLASRRGERLVSADEFFLDLLTTAAEP
FT                   DELVTEVHFPLLGPHSGSAWLEIARRHGDYALVGAGAVLVLAEDGRTIQDARLSFIGVA
FT                   GRPVRARGAEAILRGQSIGEEAWKAAAAAVREELDPPSDLHASAQYRRSVAGVLAERAL
FT                   AIAAARAQGGVAA"
FT   gene            575642..576136
FT                   /locus_tag="trd_0578"
FT   CDS_pept        575642..576136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0578"
FT                   /product="aldehyde oxidase small subunit"
FT                   /note="identified by match to protein family HMM PF00111;
FT                   match to protein family HMM PF01799"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04714"
FT                   /db_xref="GOA:B9KYN1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN1"
FT                   /protein_id="ACM04714.1"
FT                   /translation="MTAVGSERRVIRVTVNGVPYEREVEARLLLSDFLRHELGLTGTHV
FT                   GCEHGVCGACTILLDGEPVRSCLLLAVQAHGHELETVEGLAPSERELHPLQQAFWEKHG
FT                   LQCGYCTPGMLMVLKAFLAENPDPSEEEIREAISGNLCRCTGYQNIVEAARYAAQLMRQ
FT                   S"
FT   gene            576156..578531
FT                   /locus_tag="trd_0579"
FT   CDS_pept        576156..578531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0579"
FT                   /product="oxidoreductase, large chain"
FT                   /note="identified by match to protein family HMM PF01315;
FT                   match to protein family HMM PF02738"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05074"
FT                   /db_xref="GOA:B9KYN2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN2"
FT                   /protein_id="ACM05074.1"
FT                   /translation="MPTRIFGEPVKRAEDPRLLTGHGRYVDDIDLPGQLHAAFLRSPLA
FT                   HARIRAIDVRAAQEMAGVVAVWTYQDIGPCQRRMPLLIPHPDLTHPATRYALAKDEVNH
FT                   VGEPVAMVIAESRYVAEDALEAIVVEWEELPPVVDIERAIEPGSPLVHEELGTNVAAHY
FT                   VGVVGDPEAAFARAAHVFRERLVIERSAGMPLETRAVLATWDPVHELLEVWDTTQAPIV
FT                   IRNALAALFGLAPTQVRVVAPDVGGGFGCKIMVYPEEVLVPYAAMVLGRPVKWTEDRLE
FT                   HFVGTNHERLQIHEAEIAVDAEGRIVAIRDRFLHDAGAYTPYGIIVPIITACQLPGPYK
FT                   VPNYHVEFRAVYSNTVPVSPYRGAGRPHAAFVMERLLDRVADELALDRAEVRRRNFIQP
FT                   HEFPYDVGLIFQDGAPTRYDSGNYPGMLELLLQQMDYERLVREELPRLRAEGRFVGVGI
FT                   ACYVEGTGIGPYEGATVRVEPTGQVYVATGMPQQGQAHKTVLAQIVAEELQIPLDAVQV
FT                   FEGDTAHFQFGSGTYASRSAVVCGSAVALAARKVREQGLALAAEELEVAVEDLVVEDGR
FT                   VFVRGAPERGFTWAQLAQLANPLRYAYAGDLVVRPRPWTGPTLPPGRQPALEATEYYSP
FT                   PHATWASGAVGALVEVDVATGMVTFRKLWVVHDCGKMINPLVVEGQVHGGIAQGIGGAL
FT                   YEKLHYDENGQLLNASFMDFLMPTAMEIPRMEVAHQETPSPLNPLGVKGVGEAGAIPLP
FT                   ALVAAAVEDALRPFGVRITRMPLDPDTIWRMTHPEETA"
FT   gene            578641..579435
FT                   /locus_tag="trd_0580"
FT   CDS_pept        578641..579435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0580"
FT                   /product="putative polyketide cyclase"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06141"
FT                   /db_xref="GOA:B9KYN3"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN3"
FT                   /protein_id="ACM06141.1"
FT                   /translation="MGSVKLYDLSQPLNQEVSFWPFYPPFEVKYIKRKAEHGVNAQYIM
FT                   TSNHMGTHLDAPRHFITNGKTIDQIPLEWLYGPGVIVDLSDVLDELDIFTPEMIEQRVE
FT                   VREGDILFIHTGWHRYAQFGETPDEEKYLLRHPGPHPSIVDWLIAKKIKIWGVDMVSTD
FT                   HPMNLPIGRFLGRGGLEQWKRVRAICERKFGEKLTELFPEEHYQLTHNALFPHDCIHVE
FT                   NLGGEIGRRELHNRRLTLGVFPWLFKGGEAAFCRVVAFVEEA"
FT   gene            579488..580309
FT                   /locus_tag="trd_0581"
FT   CDS_pept        579488..580309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0581"
FT                   /product="putative polyketide cyclase"
FT                   /note="identified by match to protein family HMM PF04199"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05305"
FT                   /db_xref="GOA:B9KYN4"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN4"
FT                   /protein_id="ACM05305.1"
FT                   /translation="MAIDLARCRVLDLSQDWDIHTPGFALYEGPTVKWIKRVAFERAGG
FT                   QWISSTLHVGTHLDAPLHFITGGQDIAAIPLNKLVGWACIVDLTRYGIGDYDIYGPEHF
FT                   EQWERDTGIRIQPGDILVIHTGYHHYYPSDWATDPALRQPDETRYFIKHPGPTRAFAEW
FT                   VLRRQISWLAVDCASADHPFNTVIRKIRADLVPEFEAKHGKSISELLPDSDYQVMHFAL
FT                   FPHGVIHIENAGGEIDKVLNRRIMVGCFPWRFKGGEAAFCRFVAFVPEDEL"
FT   gene            580312..581298
FT                   /locus_tag="trd_0582"
FT   CDS_pept        580312..581298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0582"
FT                   /product="NAD-dependent alcohol dehydrogenase"
FT                   /note="identified by match to protein family HMM PF08240;
FT                   match to protein family HMM TIGR02822"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05307"
FT                   /db_xref="GOA:B9KYN5"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014187"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN5"
FT                   /protein_id="ACM05307.1"
FT                   /translation="MRAMVLERPGQPLVLQELPVPEPGPGQVLLRIRACGVCRTDLHIV
FT                   AGELPGPKLPLVLGHQIVGEVVRAGPGANRLVPGQRVGVPWLGWTCGECRYCRSGRENL
FT                   CDRARFTGYTLDGGFAEYTVADERYCFPIPAGYPDEQAAPLLCAGLIGYRALRFAGEAQ
FT                   RLGFYGFGAAAHILTQVAVWQGRTVYAFTRPGDLESQVFARELGAVWAGGSDESPPEQL
FT                   EAALIFAPVGALVPQALRAVEKGGIVVCAGIHMSDIPSFPYAWLWEERVIRSVANLTRQ
FT                   DGEAFLSLAPRVPVRTEVQLYRLEEANRALDDLRHGRIRGAAVLVID"
FT   gene            complement(581300..583921)
FT                   /locus_tag="trd_0583"
FT   CDS_pept        complement(581300..583921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0583"
FT                   /product="cation-transport ATPase, E1-E2 family"
FT                   /note="identified by match to protein family HMM PF00122;
FT                   match to protein family HMM PF00689; match to protein
FT                   family HMM PF00690; match to protein family HMM PF00702;
FT                   match to protein family HMM TIGR01494"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06351"
FT                   /db_xref="GOA:B9KYN6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN6"
FT                   /protein_id="ACM06351.1"
FT                   /translation="MLAMGGELASSSTSIPTTDPNRGLTEAEVHARRARFGPNELPQPQ
FT                   SPALWRLALAQVTHLFALLLWIAAASASIAGMTELALAIVAVILLNGIFAFLQEYRAER
FT                   AAARLRSLLPLRVTVRRDGHEIVIDARELVPGDIVILKAGDRVPADVLLLEGIDVAVDV
FT                   STFTGESVPINPSPGDAIQAGTSLTRGRAIAVVTATGANTRLAQLARLTAAPRRQPTPL
FT                   TRELQRLVRIITVLAVSVGLLFFAVAVFLRLPVLDAFVFMLGVTVALVPEGLLPTLTLS
FT                   LAVAAQRMAERRALVRHLEAVETLGLTTVICTDKTGTLTLNELSVTSIWTPAGSARLFG
FT                   QGYEPDGESDIEPGAEASVRELARAAALAADGRAVWRDGRWLPLGDPLDTALWVMVHRI
FT                   GLDPDTIRAKAPVLRTYPFDPHRRRSSVLTESQLIVKGAPENVLPNCRNAEQARQVADR
FT                   MAAEGLRVIAIASRPVLPGSASDVLDPDTLERELILLGLIGFSDLPRSEAKEAVARCRK
FT                   AGIRVIMVTGDHPATALAVAREVGLVGDNPLVVTSAQLPPDDTALGALVDRDEVVIARV
FT                   APEDKLRIARALQARGHVVAMTGDGVNDAPALRQADVGVAMGRSGTDVAREAADLILLD
FT                   DNFATIVAAIEQGRTTFQNIRRFLTFHLTDNVAELAPFVIWALSGGRVPLALNVLQILL
FT                   LDLGTDALPALALGVEPPSPRVLDSPPPRFHLVDRSLLVRAFLVLGPTEALMEMIAFFA
FT                   VLSSASWQPGMTVPSETILLAASGTAFTAIVLGQGANAIANRSDDRPAWRVGLSGNRAL
FT                   VLALAASCVLLLATLSIPPLARIVGQAPPTALGWFLAALTVPAVMLIDALWKTIVRRQP
FT                   SG"
FT   gene            complement(584210..584455)
FT                   /locus_tag="trd_0584"
FT   CDS_pept        complement(584210..584455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0584"
FT                   /product="putative 4-hydroxybenzoyl-CoA thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04627"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN7"
FT                   /protein_id="ACM04627.1"
FT                   /translation="MQYHRPLLLHDTGTCTLAVQDVQRSSLPFAFTLQRHGDARPAVTG
FT                   SMLCVCVDGATRRPVPLPRTIREALADDAYMLAEAS"
FT   gene            complement(584572..584694)
FT                   /locus_tag="trd_0585"
FT   CDS_pept        complement(584572..584694)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0585"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05719"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN8"
FT                   /protein_id="ACM05719.1"
FT                   /translation="MARAPVISPSARLVEGGPLMRSITIPFEVLWTDVDPLGYV"
FT   gene            585226..585301
FT                   /locus_tag="trd_0586"
FT   tRNA            585226..585301
FT                   /locus_tag="trd_0586"
FT                   /product="tRNA-Thr"
FT   gene            585305..585379
FT                   /locus_tag="trd_0587"
FT   tRNA            585305..585379
FT                   /locus_tag="trd_0587"
FT                   /product="tRNA-Thr"
FT   gene            complement(585669..585812)
FT                   /locus_tag="trd_0588"
FT   CDS_pept        complement(585669..585812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0588"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05734"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYN9"
FT                   /protein_id="ACM05734.1"
FT                   /translation="MHAGVDLETVSAILWQSQLSVTGDYFAPMTAQVMQPALAQLSVLL
FT                   QD"
FT   gene            complement(585837..585992)
FT                   /locus_tag="trd_0589"
FT   CDS_pept        complement(585837..585992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0589"
FT                   /product="putative integrase"
FT                   /note="an automated process has identified a potential
FT                   problem with this gene model; the current end5 and/or the
FT                   end3 may need to extended or the current gene model may
FT                   need to be merged with a neighboring gene model; the
FT                   current gene model (or a revised gene model) may contain
FT                   one or more premature stops and/or frameshifts"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05002"
FT                   /db_xref="GOA:B9KYP0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP0"
FT                   /protein_id="ACM05002.1"
FT                   /translation="MAPAGPGRARGNPWSLVFTTHLGSPVSARNVTCIFHLLCQQAGVP
FT                   PIRFHD"
FT   gene            complement(586598..586717)
FT                   /locus_tag="trd_0590"
FT   CDS_pept        complement(586598..586717)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0590"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05476"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP1"
FT                   /protein_id="ACM05476.1"
FT                   /translation="MINLLASTALTRAQPMNARIVGLDLPRIPSRERGRKALA"
FT   gene            complement(587027..587173)
FT                   /locus_tag="trd_0591"
FT   CDS_pept        complement(587027..587173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0591"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04671"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP2"
FT                   /protein_id="ACM04671.1"
FT                   /translation="MSHDQHSWELGKQRQPGHDPKVRVRFQLGIRSRVNRARHSCLTMM
FT                   VMR"
FT   gene            587156..587275
FT                   /locus_tag="trd_0592"
FT   CDS_pept        587156..587275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0592"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06218"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP3"
FT                   /protein_id="ACM06218.1"
FT                   /translation="MLVVGHRSRVRPGETIDHPVGVQQDPESPPPRSSPEAAW"
FT   gene            587337..587756
FT                   /locus_tag="trd_0594"
FT   CDS_pept        587337..587756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0594"
FT                   /product="cytochrome oxidase subunit II"
FT                   /note="identified by match to protein family HMM PF00034"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05411"
FT                   /db_xref="GOA:B9KYP4"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP4"
FT                   /protein_id="ACM05411.1"
FT                   /translation="MRRLLLFGCLLSALLLVACGGGGGRSEEKVTPPPVNAELAAAGKE
FT                   YFNKYACSTCHSMAGQAGIGPALNGIYGKKVQLEDGSSVVVDDAYLRESILQPDAKTVK
FT                   GYPKGSMTNVIMPFMPELQKPEVLDALVEYIKSTT"
FT   gene            588180..589196
FT                   /gene="nadC"
FT                   /locus_tag="trd_0595"
FT   CDS_pept        588180..589196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadC"
FT                   /locus_tag="trd_0595"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="identified by match to protein family HMM PF01729;
FT                   match to protein family HMM PF02749; match to protein
FT                   family HMM TIGR00078"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05429"
FT                   /db_xref="GOA:B9KYP5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP5"
FT                   /protein_id="ACM05429.1"
FT                   /translation="MVLAPRKARLLRLVFGISRSELARARGARLSWEARKRGLRTVVTV
FT                   LRSGTLVAPDWDIPLLVLRESVCAWLREDLGYGDRTTLAVVSPGATGTAAIVMRQPGVL
FT                   CGMPVIEAVFAELDTRLRVTTMCREGELVPEGTVVGQVVGPLRGILAGERLALNLLQRL
FT                   SGIATLTRRFVDAVAGTGVMILDTRKTTPGLRLLEKYAVRVGGGRNHRFGLFDGVLIKD
FT                   NHVRVAGSVREAVQRVRNVIPHTMLVEVEVTTLEELDEALAAGADWILLDNMDVETMRE
FT                   AVRRVAGRAKLEASGGVTLERVRAIAETGVDAISVGALTHSASALDISLEVVAVDGR"
FT   gene            589216..590139
FT                   /gene="nadA"
FT                   /locus_tag="trd_0596"
FT   CDS_pept        589216..590139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nadA"
FT                   /locus_tag="trd_0596"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /note="identified by match to protein family HMM PF02445;
FT                   match to protein family HMM TIGR00550"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06001"
FT                   /db_xref="GOA:B9KYP6"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP6"
FT                   /protein_id="ACM06001.1"
FT                   /translation="MEQQELVREILRLKEERRAVILAHSYQRPEVQDIADFVGDSLGLS
FT                   REATRTDADVIVFCGVHFMAETAAILNPEKTVLLPDLEAGCSLAETINPEDVRAWREQH
FT                   PDGIVVAYVNTSAAVKAMADICCTSANAVEVVASLPEDRPIFFVPDMFLGAHVERVTGR
FT                   KLDIWLGECHVHAGIRSEDLAAQLAAHPDAEFLIHPECGCSSTCIFLRPDAKLLSTEGM
FT                   VRYAAQSAAREFVVATEVGILHRLHQKAPGKRFIPVREDAICHYMKRVTLEKVYESLRD
FT                   LKYVITVPEEIAVPARRALEAMLALG"
FT   gene            complement(590386..591450)
FT                   /locus_tag="trd_0597"
FT   CDS_pept        complement(590386..591450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0597"
FT                   /product="putative pyrimidine precursor biosynthesis
FT                   enzyme"
FT                   /note="identified by match to protein family HMM PF09084"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05726"
FT                   /db_xref="GOA:B9KYP7"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="InterPro:IPR027939"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP7"
FT                   /protein_id="ACM05726.1"
FT                   /translation="MFLADRFTRRRFFALGAIALATACRRGAGSPPTETAPTSTPPALG
FT                   PTPASGQLEAVSVALDWYPWSNHTGLLMAQERGFFRGQGLEVTLDVPANPEDVLKLVAT
FT                   GRNTFGISYQTDVLLARAEGIPIVSIAALVQHPLNSVMALERSGITRPRDLVGKQVGYP
FT                   GLPSDEALLATMLETDGAHLDDVKLVNVGYELVRALLSGQVDAVIGAYWVHESILIEQQ
FT                   GERPVILRVEQWGVPDFYELVMVTSEQQVREQPDRVQRFVGAMIQGYREAAADLDGAVQ
FT                   LLVRKYPETNQTLEERGIRLLAPLWTEGVPIFGWQEEKRWTDYAAWMRSRGLLHGDLDA
FT                   RLAFTNRFVEAARE"
FT   gene            complement(591464..592222)
FT                   /locus_tag="trd_0598"
FT   CDS_pept        complement(591464..592222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0598"
FT                   /product="ABC transporter, permease protein"
FT                   /note="identified by match to protein family HMM PF00528"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04865"
FT                   /db_xref="GOA:B9KYP8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP8"
FT                   /protein_id="ACM04865.1"
FT                   /translation="MMRDRVLPSLLLITALFAWELACRVFAVPDWVLPPPSAILAALLR
FT                   DYRLLLFHLSVTMQEIGLGLIVSIVLAIVLAIGIVASRLIERSVYPLVVASQAIPIVAL
FT                   APLLLIWFGYGLTPKVIVVVLICFFPIAVNMVDGLRGVDHELIDMVRSLGASKWQTLRF
FT                   VRLPAALPAFFSGLRVAAAVSVIGALIGEWIGASAGLGYLMIRAAAQFHTDRVFAAVLV
FT                   SALVSIALFASVTWLERQTLPWRTRPRTEP"
FT   gene            complement(592212..593018)
FT                   /locus_tag="trd_0599"
FT   CDS_pept        complement(592212..593018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0599"
FT                   /product="ABC transporter, ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00005"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06233"
FT                   /db_xref="GOA:B9KYP9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYP9"
FT                   /protein_id="ACM06233.1"
FT                   /translation="MVSRVDTDWRLELRGVTKVFQRDQLQVHALGPLDLRVADGEFVSI
FT                   IGPSGCGKSTLLDMIAGLEQPTSGEIWLDGAPAPYRLGKVAYMHQRDLLLPWRTVLENA
FT                   ILPLEVKRIPRRQAIERAMPWLRRFGLAEFASSYPAQLSGGMRQRAAFLRTLLTQCPLM
FT                   LLDEPFGALDALTRSSMQEWLLMLWEELDRTVILVTHDVEEAVLLSDRVVVLSQRPGTI
FT                   VADIPVDLPRTRTYAIVTDQAFVSLKARLLATLRRQPTLGVVTDDA"
FT   gene            593468..593680
FT                   /locus_tag="trd_0600"
FT   CDS_pept        593468..593680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0600"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04755"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ0"
FT                   /protein_id="ACM04755.1"
FT                   /translation="MIREGYFGHASAMLVPIYGLFRVHVHPRVSNDLLMCVGSSRRIQL
FT                   GLTVSWISDVSCNYQLFFKWFVPHQ"
FT   gene            594189..594566
FT                   /locus_tag="trd_0601"
FT   CDS_pept        594189..594566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0601"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05551"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ1"
FT                   /protein_id="ACM05551.1"
FT                   /translation="MGTVPTYRDVLMAVLSPGALVVLERLTPLICALYDLDLLLDYPVA
FT                   DQQQGSLRERLSERLERIVALLPSDVSPMANEVFTAVETLVTDVLGRELFLGEEIRRLE
FT                   LLDEAFRNDPLLFQLVRGRAN"
FT   gene            complement(594628..595017)
FT                   /locus_tag="trd_0602"
FT   CDS_pept        complement(594628..595017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0602"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04620"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ2"
FT                   /protein_id="ACM04620.1"
FT                   /translation="MMSLAACRRGGQAGVTTVTVELGEYYIKVDKAEVPAGKVRFVAKN
FT                   VGQMEHELIVLRTDLPADRLPYNEAEQKAEEEQAGEVLGEIEPEDLPPGKTAEMTLDLT
FT                   AGHYVLLCNIPTHYKQGMHLDLRAR"
FT   gene            complement(595403..596314)
FT                   /locus_tag="trd_0603"
FT   CDS_pept        complement(595403..596314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0603"
FT                   /product="ribonuclease Z"
FT                   /EC_number="3.1.26.11"
FT                   /note="identified by match to protein family HMM PF00753"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05790"
FT                   /db_xref="GOA:B9KYQ3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR013471"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYQ3"
FT                   /protein_id="ACM05790.1"
FT                   /translation="MVDVCLLGTGGMMPLPDRWLSALLVRCEGHVVLLDCGEGTQISWR
FT                   YTGWSFRDLDAIVFTHLHADHVAGLPGILYALAFADRQEPVRIIGPVGTAQVVAALRSI
FT                   VPTLPFPVETLELSGTSELELPGGLLLRALPVTHRIPCFAYTLHRPRGRRFDPQRAQAL
FT                   GIPMTLWHRLQRGETVEFAGQLLTPDLVLGPPRRGITVAFVTDTRPTPELPGFVAGADL
FT                   LVCEGMYGDTALLPRAIERGHMLMQEAAELARAASVERLWLTHFSPSLTDPEAWLPAIR
FT                   AIFPASEIGPVHQTVTLRYRDA"
FT   gene            596427..598025
FT                   /gene="ggt"
FT                   /locus_tag="trd_0604"
FT   CDS_pept        596427..598025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ggt"
FT                   /locus_tag="trd_0604"
FT                   /product="gamma-glutamyltransferase"
FT                   /EC_number="2.3.2.2"
FT                   /note="identified by match to protein family HMM PF01019;
FT                   match to protein family HMM TIGR00066"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04943"
FT                   /db_xref="GOA:B9KYQ4"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ4"
FT                   /protein_id="ACM04943.1"
FT                   /translation="MVRKVVTGRPTTRATEGMVATPHYLATLAGLRVLQDGGNAVDAAV
FT                   AANAVLTVVYPHMCSLGGDAFFLIWEPREQRLVGLNGSGRAPQGISLAALRDRGFREVP
FT                   AKGPWGVTVPGAVDAWATVLARYGTRDLAALLESALRYAEEGFPVSPLLARAIAAEEEI
FT                   FRRQEAATRQFLPGGRPPRSGQLLRQPDLAASLRLIAEHGPEAFYRGPIAEAIVAVLRS
FT                   AGGAMTLDDLAAHRSEWVEPLRSTYRGVEVIELPPNTQGVTALQLLNIVEGFPIGADEW
FT                   GSPRLLHLMLEAKKLAFADRDRYLGDPAFVDVPVARLLSKAYAAELRSRIDPDRASVPP
FT                   PPQWDSDTIYLCVVDRDGRAVSLIQSIYQSFGSGLVAAGIVLHNRGACFVLDEESPNAL
FT                   MPGKRPLHTLIPGMMVRDGRPWVVFGTMGGHSQPVIHLQLVNGLVDFGFEPQEAIEVAR
FT                   WVSRREPGEAGETIYLEPELAERAAGELARLGHRVEIVERWSSLMGHAHLIMIGDDGVL
FT                   SGASDPRAEGYALGW"
FT   gene            complement(598029..598514)
FT                   /locus_tag="trd_0605"
FT   CDS_pept        complement(598029..598514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0605"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05968"
FT                   /db_xref="InterPro:IPR021441"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ5"
FT                   /protein_id="ACM05968.1"
FT                   /translation="MLEAEAIGQPGQRRFRLIAGVGLDLVSLWMEKEQLQALGLAIEQL
FT                   FEQLRLAGLVRSRISEQPAARTAPLPPDLPEYVVGKMAIGYDEEHQRIAIFAHDIEQDE
FT                   DDDPVFAGRASLPAAKALARQIAQVIAAGRPRCPRCGAVIGPEGHVCPHDNGHLPLE"
FT   gene            598919..600121
FT                   /locus_tag="trd_0607"
FT   CDS_pept        598919..600121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0607"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06198"
FT                   /db_xref="GOA:B9KYQ6"
FT                   /db_xref="InterPro:IPR013529"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ6"
FT                   /protein_id="ACM06198.1"
FT                   /translation="MFVAIVTMLALVGCRGPAVYPTVTPTRSTLLGSVPTPSHESGAVG
FT                   TPVLEASQATPRGRAASGFAYGFNVAWRGDEDGAAFNQRTAEMVRQAGFQWVRFQVRWE
FT                   SLEPRPGEWDFRPIDRVLPVYEAAGLSVLASVVGAPEWARAANGGIVADPATFREAMRR
FT                   LASRYRGRIHAWEIWNEQNLAHELHGPVRVEPYCAVLRAGYEGVKAGDPEALVVFGGLT
FT                   PTGVNDPTIAVDDVAYLEAFYALDGGSCTRYFDVLGAHANATLNPPDTLWPERPGPGPG
FT                   WRDHPSFYFRRVEQLRAVMERHGDRRPVWITEFGWTTNNPAPGYEYGQYVSEEQQAEYL
FT                   VRAFEIARTRWPWVTGMFVWNLNFSTIVGPEDEKGPWSVLNPDWSPRPAYRALSAMPKQ
FT                   P"
FT   gene            complement(600118..601149)
FT                   /locus_tag="trd_0606"
FT   CDS_pept        complement(600118..601149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0606"
FT                   /product="hydrogenase expression/formation"
FT                   /note="identified by match to protein family HMM PF00586;
FT                   match to protein family HMM PF02769"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05789"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ7"
FT                   /protein_id="ACM05789.1"
FT                   /translation="MSDRPLPTGKLPPQLLAEFLGNLSPDPSVLLGPGIGHDAAVIQID
FT                   TIRLVFKSDPITFATEAIGWYALNVNANDVACLGARPRWFLATVLLPEGTTAHDAQVIL
FT                   DDLARAAERLGVSVVGGHTEITVGLDRPIVAGTMIGELTTEYVLSPARVRPGDALLLVR
FT                   GIAIEGTALLARECRQTLERMLDQDLLARCRRFLYEPGISIVPAATLLLERLGEDLRYL
FT                   HDPTEGGLATGLHEVAVACGTGLVVSEEAILVYPETRAVCTALGLDPLGLIASGALLAV
FT                   VTPESVEHALDTLAQHDIPATQLGWLDPDPGRRVLIGSTGERPLPVFQVDEVARLFASG
FT                   GCV"
FT   gene            complement(601154..602281)
FT                   /locus_tag="trd_0608"
FT   CDS_pept        complement(601154..602281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0608"
FT                   /product="6-phosphofructokinase 1"
FT                   /EC_number="2.7.1.11"
FT                   /note="identified by match to protein family HMM PF00365"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05352"
FT                   /db_xref="GOA:B9KYQ8"
FT                   /db_xref="InterPro:IPR000023"
FT                   /db_xref="InterPro:IPR012003"
FT                   /db_xref="InterPro:IPR012829"
FT                   /db_xref="InterPro:IPR015912"
FT                   /db_xref="InterPro:IPR022953"
FT                   /db_xref="InterPro:IPR035966"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ8"
FT                   /protein_id="ACM05352.1"
FT                   /translation="MAERSLRRIGVLTGGGDAPGLNAALRAVVKTAILRYGWTVIGFED
FT                   GYEGAILGRARQLGLDDVRGLLVRGGTILGASNRANPFFFAHPEQGDTEPRDHSRTLLA
FT                   TLERIGIDALIVIGGEGSLSIAHRLNEMGLRVIGIPKTIDNDVRGTLQTIGFDTAVTTA
FT                   TEAIDRLHTTAESHHRVMLVELMGRDAGWIALSAGVAGGADVILIPEIPFVLDRVVEVI
FT                   RGRRQRRRSFTIVAVAEGARPLDGEAVFERTGPLPYQRKYGGISLVLQKQLSRILPTEV
FT                   RAVVLGHLQRGGTPTPTDRALATALGSAAVDALADDDDGVMVAIRAHPAGQATWGIVRV
FT                   PLAEVARGPRLVPLDHPLVRAARGIGISFAQQDEE"
FT   gene            602437..603891
FT                   /gene="proS"
FT                   /locus_tag="trd_0609"
FT   CDS_pept        602437..603891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proS"
FT                   /locus_tag="trd_0609"
FT                   /product="prolyl-tRNA synthetase"
FT                   /EC_number="6.1.1.15"
FT                   /note="identified by match to protein family HMM PF00587;
FT                   match to protein family HMM PF03129; match to protein
FT                   family HMM PF09180; match to protein family HMM TIGR00408"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05220"
FT                   /db_xref="GOA:B9KYQ9"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYQ9"
FT                   /protein_id="ACM05220.1"
FT                   /translation="MTTDRKYVEELIEQEDDFDRWYVEVIQKAELADESPVRGTRVIRP
FT                   YGFALWENMQAELDRRIKATGVQNAYFPLFIPKSFLEREAEHIKGFAPEVAWVTRGGDK
FT                   ELEEWLAVRPTSESIICPMFARWVQSYRDLPILINQWCSVVRWEERPRAFLRTLEFLWQ
FT                   EGHTVHATLEEAEERARLMLEVYRDFVESELAIPVIPGQKTESEKFAGALRTYTIEAMM
FT                   GGKHWALQSATSHNLGDHFGKVFDITFLDREGKRRYVFNTSWGLSHRTIGAMVMVHGDD
FT                   RGLKLPPRVAPIQVVIVPIWRKDEERRQVEETVDRVRAMLRRAVRVHADLRDDKTPGWK
FT                   FNDWDLKGVPIRLEIGPRDVASDQVTLVRRDVLGQRQAVPIANLVGAVQSELESIQVSL
FT                   FRAARAMLERYTEDVRDYEVLKERVATNAGFNRAFWCGDPACEARVKAETKATVRCIPF
FT                   EQPAELEPCLVCGAPGKYQVIWARAY"
FT   gene            complement(603959..604048)
FT                   /locus_tag="trd_0610"
FT   tRNA            complement(603959..604048)
FT                   /locus_tag="trd_0610"
FT                   /product="tRNA-Ser"
FT   gene            complement(604291..604381)
FT                   /locus_tag="trd_0611"
FT   tRNA            complement(604291..604381)
FT                   /locus_tag="trd_0611"
FT                   /product="tRNA-Ser"
FT   gene            complement(604419..604494)
FT                   /locus_tag="trd_0612"
FT   tRNA            complement(604419..604494)
FT                   /locus_tag="trd_0612"
FT                   /product="tRNA-Arg"
FT   gene            complement(604730..605437)
FT                   /gene="rpe"
FT                   /locus_tag="trd_0613"
FT   CDS_pept        complement(604730..605437)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpe"
FT                   /locus_tag="trd_0613"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="identified by match to protein family HMM PF00834;
FT                   match to protein family HMM TIGR01163"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04510"
FT                   /db_xref="GOA:B9KYR0"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR0"
FT                   /protein_id="ACM04510.1"
FT                   /translation="MTTTFGYRLPMLSPSILNADFGHLAAVVRELDEAGADAIHLDIMD
FT                   GRFVPNISFGLPIVRAVRDATTLPLDVHLMIVEPERYLEAFAQAGASALTVHVETCPHL
FT                   HRTIQAIHELGLLAGVALNPATPLAAIEEILPFVDLVLIMTVDPGFGGQGLIPAVLGKL
FT                   RRLRQMVDERGFRCLLSVDGGVKLSNLESVISAGADIVVTGSVLFTAEERPGEILRRLR
FT                   ERATQAYRTRSLR"
FT   gene            605537..606571
FT                   /locus_tag="trd_0614"
FT   CDS_pept        605537..606571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0614"
FT                   /product="putative molybdopterin biosynthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06245"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR1"
FT                   /protein_id="ACM06245.1"
FT                   /translation="MRRTWYLAGREPLPTGAVLRRDLILHSDGRRQFRRGTPLEELLSQ
FT                   ASVPEGLRIPIAVPDAGEIEQHEASLRIARAVAGIGTRFDAPHQGQVTIRAGQFGLVRV
FT                   DEQGLQRLVRTGAALVATVLDGRVAEEGEVIAIAKAPSLFVRVDRLERALAVLAGRSVV
FT                   HVAPFRRRRVALLAGARVRPAALEVAGRALGQKLARFGARLEEIERLDADDTSVIAQRI
FT                   AHWVAGGIELVLTAGSIMLDPDDPFLRAVRRLRAERTVHGAPVDPGTMFWVAYRDTVPI
FT                   FGLASCEMYGRTSVFDLIVPFALADERIDRPLMARLAHGGLLVDTQVARVPPRWRQELE
FT                   TESE"
FT   gene            606609..607355
FT                   /locus_tag="trd_0615"
FT   CDS_pept        606609..607355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0615"
FT                   /product="FHA domain protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06019"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR2"
FT                   /protein_id="ACM06019.1"
FT                   /translation="MLSKLQQFEDFVERLMEGTVGRIFRTTIQPAEIARWLERAMESQR
FT                   LESPEGPIVPNDYLVRLHPEDFVQFADFADSLSLQLEEWLLDIADEREYGFVDQVRVRI
FT                   LGDPSVPRRQVQVEAKIATLPADEFAARQLWQRTEVYRVLQDTGNVPRAFLRVVEGPLA
FT                   GQTFLIRKRVTTVGRAPENDIQLEVLDVSRRHARIEFDAGMFQIIDLGSTNGTLLNGVP
FT                   VDRSFLRHGDRLTLGTVVLEFSLPGA"
FT   gene            607365..607817
FT                   /locus_tag="trd_0616"
FT   CDS_pept        607365..607817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0616"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="identified by match to protein family HMM PF00498"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05863"
FT                   /db_xref="GOA:B9KYR3"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR3"
FT                   /protein_id="ACM05863.1"
FT                   /translation="MELVTQLPFEWFVLLLRLVFAFLLYFFIFLLARIMLRELAAAAVT
FT                   SSEEGGPPGHLIVQSPGSTGLRPGTRLPLEPVTVIGRHPSCTVRLDDAFISTEHAQLTW
FT                   EQGRWWITDLKSTNGTRVNGKPVTAPTGLRYGDVIELGDVRLVLAP"
FT   gene            608032..609783
FT                   /locus_tag="trd_0617"
FT   CDS_pept        608032..609783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0617"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05144"
FT                   /db_xref="GOA:B9KYR4"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR4"
FT                   /protein_id="ACM05144.1"
FT                   /translation="MKVARFIVLALLVFGVLANVVPVKHVQAAAPTVPEDLEMPRYFPE
FT                   TGFWVQGPFRRFWETQGALFVFGYPITGVFQQDGYWRQYFERAVFEYHPEKAGTVDEVQ
FT                   LVRVGAWRVSGREKEEPFRPVAWFPDTTDRRYFPETKHSLAYGFKNYWDRYGGWRVFGL
FT                   PLSEEFTEQNPPPPAGDGRSYTVQYFERARFEYHPENRGTPYEVLLGLLGWEYLQARGA
FT                   PAEARAKQDATLPPYDPIRKRQYGPHVGYGFNVAWRGDNDGDGFNQRTMELVKGAGFSW
FT                   IRVQAIWRDIEPRPGRYDTHALDRIIDAASRNGVKVVVSVVKAPAWADPNGGIPADPAP
FT                   FGKLMEFLAKRYAGKVHAWEIWNEQNLALETGGHVDVGRYVRLLKEGYQGVKRSDSKAI
FT                   VLFGGLTPTGVMDPSIAIDDVEYLRQAYAYNNGEIKRYFDHIATHPGGTLNPPDALWPE
FT                   RPGPGPGWIDHPSFYFRRAEQIRQVMVENGDGAKQVWLTEFGWSTANQAPGYEYGRYVS
FT                   EQQQAQYLVRAFQIARSQWPWAGVLLVWNLNFSTITQPSDEKYPWSVVYADWNPRPAYR
FT                   ALQEMPK"
FT   gene            609780..610661
FT                   /locus_tag="trd_0619"
FT   CDS_pept        609780..610661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0619"
FT                   /product="probable dolichol-phosphate
FT                   mannosyltransferase-putative membrane bound sugar
FT                   transferase involved in LPS biosynthesis"
FT                   /note="identified by match to protein family HMM PF00535"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05587"
FT                   /db_xref="GOA:B9KYR5"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR5"
FT                   /protein_id="ACM05587.1"
FT                   /translation="MNRLPSETRATMLPISGTLSLVLPAYNEAANLEAVVRRALEVLPA
FT                   LVEDFEVVIVDDGSRDGTSQIADRLAASDPRVRVVHHETNRGYGAALRSGFAAARGDLI
FT                   MFMDADQQFDPADFAHLAPFVPYADIVAGYRVKRRDPWIRLVYAAIFNAAMRLLFGITV
FT                   RDIDCAFKVLRGDLVRALHLTMNGALVNTELLVKAQRAGATIVEVGVRHYPRLSGEPSG
FT                   GSVRVIRRAVCEVAQLWWQLLWYQPPRGVGRGRPQPRSSQLVRAGVMVGLGATALYWLW
FT                   RRFAGGRPTQER"
FT   gene            complement(610649..610957)
FT                   /locus_tag="trd_0618"
FT   CDS_pept        complement(610649..610957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0618"
FT                   /product="DUF167"
FT                   /note="identified by match to protein family HMM PF02594"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06264"
FT                   /db_xref="InterPro:IPR003746"
FT                   /db_xref="InterPro:IPR036591"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR6"
FT                   /protein_id="ACM06264.1"
FT                   /translation="MTFAPIDRAGPAVEFWVQVQPRAPRAEVAGSRRDALLVRVTAPPR
FT                   DGEANEAVLRLLAETLHLPRGSIRIIAGTAQRRKRIRIDGLTSKELLERLAPILHRS"
FT   gene            complement(610954..611793)
FT                   /locus_tag="trd_0620"
FT   CDS_pept        complement(610954..611793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0620"
FT                   /product="conserved hypothetical protein TIGR00268"
FT                   /note="identified by match to protein family HMM PF01171;
FT                   match to protein family HMM PF06508; match to protein
FT                   family HMM TIGR00268"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0620"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04679"
FT                   /db_xref="GOA:B9KYR7"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR005232"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR7"
FT                   /protein_id="ACM04679.1"
FT                   /translation="MLEELHDKYERLLERLRRLGSVVVAFSAGVDSTFLLYAAREALGD
FT                   RVIAATGLSETYPEEEIEEARQLARELGVHHMLIRTEELTDPRYASNSHQRCFFCKQEL
FT                   YSKLRALADAAGFAAVIDGTNADDLADYRPGLRAARQLGVYHPLAEVGLTKREIRELSR
FT                   HFGLRTWDKPAYACLSSRFPYGTPITVEKLRQVAAAERALRELGFRAFRVRHHDQIARL
FT                   ELQPEDFPRALELRDEIVTRLRAAGYEFITLDLEGYRSGSFNRTLPDALKVGSTGHS"
FT   gene            611886..612878
FT                   /locus_tag="trd_0622"
FT   CDS_pept        611886..612878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0622"
FT                   /product="putative membrane protein"
FT                   /note="identified by match to protein family HMM PF03706;
FT                   match to protein family HMM TIGR00374"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0622"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06219"
FT                   /db_xref="GOA:B9KYR8"
FT                   /db_xref="InterPro:IPR022791"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYR8"
FT                   /protein_id="ACM06219.1"
FT                   /translation="MLGGRSVWRRVLTGLAFGIAVLAGVLVVADVRAVLPILARFPWPL
FT                   VPLVLTLTTGNYLLRFLKWELFLRWVGVRHLPRTTSLSIFLAGFAMSITPGKVGEWIKA
FT                   LLVAKLARVPMAPIVPVVAIERLTDGIAMLVLGLASAVLGTGWGWQPLVLLGVLVLVGL
FT                   WLVQQERVVIPLLRLAERVPFARKRTDAIMTVYEAARELLAWRRLLLVSGMSIVSWSLE
FT                   CAALFFILVGFGLSPDGQLAAVATFALSAASIAGALSLLPGGLGAAEASIAGLLIVLRP
FT                   GIGAAVAAAATVAIRLGTLWFGVLVGVIALIWLERTALAAPERRSLVAE"
FT   gene            complement(612948..615320)
FT                   /locus_tag="trd_0623"
FT   CDS_pept        complement(612948..615320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0623"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="identified by match to protein family HMM PF00013;
FT                   match to protein family HMM PF00575; match to protein
FT                   family HMM PF01138; match to protein family HMM PF03725;
FT                   match to protein family HMM PF03726; match to protein
FT                   family HMM PF07650"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0623"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05386"
FT                   /db_xref="GOA:B9KYR9"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYR9"
FT                   /protein_id="ACM05386.1"
FT                   /translation="MPPIIHERSIEIAGRLLTIETGRVAEQADGAVLVRYGETVVLTTV
FT                   VGAKQPVEGIDFFPLTVEYEEKMYAAGKIPGGFFRREGKPSEAAILAARLTDRPIRPLF
FT                   PKGYRNEVQVISTVLSADQENEPDVLSIIGASAALTLSDIPWYGPVGAVRIGELDGELV
FT                   INPTSHQLLESRMDIVVAGTADAILMVEGQANEISEDRFIEAVVRAHQEIKRIVAVQLE
FT                   LQAVAGKPKREFVPPQENVELKQQIADYLGDRLREAVFNPDKTLRVQATAALREEVIAH
FT                   FVPNEPLAIGTPQSGLPTAKEVGDLFDSLVKELVRRTILEQGERPDGRKPDEIREIWIQ
FT                   VGLLPRPHGSALFTRGQTQVLTVCTLGTKEEEQFLDSLGIEETKRYMHHYNFPPFSTGE
FT                   IRRLRGPSRRDIGHGALAERALLAVLPSEDEFPYTMRLVSEVLSSNGSTSMASVCGSSL
FT                   ALMDAGVPIRKPVAGVAMGLVTDQTTGRYTILTDIQGIEDALGDMDFKVAGTRDGITAI
FT                   QMDIKVMGITPEIMRDALEQARRGRLFILDKMSEVIDAPRPEMSPYAPRILRIKIKPEQ
FT                   IGEVIGPGGRVIRAIQEQTGTKISIEEDGTVFISAANEDAARRAVREIERLTRVPEVGE
FT                   IFYGRVVTIIPSGAFVEILPGKDGFLHISEIAPERVRSVEDVLKVGQEINVMVIGVRPD
FT                   GKINLSRKALLEKEAAERAATAQAPADGRSHQPRAPQRPSGTAQPERRPGPPTPRRPEQ
FT                   RGPSRPPRPQAQRSTPPPGQYRIGDRLKELLGEDEPN"
FT   gene            complement(615512..615781)
FT                   /gene="rpsO"
FT                   /locus_tag="trd_0624"
FT   CDS_pept        complement(615512..615781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsO"
FT                   /locus_tag="trd_0624"
FT                   /product="ribosomal protein S15"
FT                   /note="identified by match to protein family HMM PF00312;
FT                   match to protein family HMM TIGR00952"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0624"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05728"
FT                   /db_xref="GOA:B9KYS0"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYS0"
FT                   /protein_id="ACM05728.1"
FT                   /translation="MALYKAQKAAIIEQFRQHENDTGSTEVQVALLTERINILTEHLRE
FT                   HKHDYHSRRGLMKLVGQRRRLLRYLKRTDAQRYQALIQRLGLRG"
FT   gene            complement(615925..616932)
FT                   /gene="ilvC"
FT                   /locus_tag="trd_0625"
FT   CDS_pept        complement(615925..616932)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvC"
FT                   /locus_tag="trd_0625"
FT                   /product="ketol-acid reductoisomerase"
FT                   /EC_number="1.1.1.86"
FT                   /note="identified by match to protein family HMM PF01450;
FT                   match to protein family HMM PF07991; match to protein
FT                   family HMM TIGR00465"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0625"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04629"
FT                   /db_xref="GOA:B9KYS1"
FT                   /db_xref="InterPro:IPR000506"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013023"
FT                   /db_xref="InterPro:IPR013116"
FT                   /db_xref="InterPro:IPR014359"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYS1"
FT                   /protein_id="ACM04629.1"
FT                   /translation="MATIYYDSDADLAYLAGKTVAVLGYGSQGHAHAQNLRDSGVQVVV
FT                   GLHEGSRSRERAKSDGFEVLTPREAAARGDIISMLMPDHVQKGVYEESVAPELRPGKLL
FT                   MFAHGFNIHYGRIVPPPDVDVAMVAPKSPGHILRDLYVQGIGVPALVAVHQDASGQAKQ
FT                   IALAYAKGLGCTKAGVIETTFKEETETDLFGEQAVLCGGVSHLIQAGFETLVEAGYQPE
FT                   VAYFEVLNELKLIVDLIYEGGLKFMRYSVSDTAEYGDYVSGPKVIDDHVRETMHKLLQD
FT                   IQTGRFAQQWIAENEAGRPNFYRMRQEHLQHPIEEVGDRLRAMMPWLKRREIPS"
FT   gene            complement(616978..617505)
FT                   /gene="ilvN"
FT                   /locus_tag="trd_0626"
FT   CDS_pept        complement(616978..617505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvN"
FT                   /locus_tag="trd_0626"
FT                   /product="acetolactate synthase, small subunit"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF01842;
FT                   match to protein family HMM TIGR00119"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0626"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05466"
FT                   /db_xref="GOA:B9KYS2"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004789"
FT                   /db_xref="InterPro:IPR019455"
FT                   /db_xref="InterPro:IPR027271"
FT                   /db_xref="InterPro:IPR039557"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS2"
FT                   /protein_id="ACM05466.1"
FT                   /translation="MVSVRSHTLVVLVEDKPGVMNRIVSLFRQRGFNIDSIAVGHSETP
FT                   GLSRITLVAQGDDRKIEQLVKQLYKILEVIKITDVTDENLIQRELALIKVTATDRNRSD
FT                   IMRLVTDVYQARIVDATPDSLIVEVTGPPDKIDSLITMVRSYGIKEIARSGVIAMARGA
FT                   RVVATTPQPVVA"
FT   gene            complement(617499..619271)
FT                   /gene="ilvB"
FT                   /locus_tag="trd_0627"
FT   CDS_pept        complement(617499..619271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvB"
FT                   /locus_tag="trd_0627"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /EC_number="2.2.1.6"
FT                   /note="identified by match to protein family HMM PF00205;
FT                   match to protein family HMM PF02775; match to protein
FT                   family HMM PF02776; match to protein family HMM TIGR00118"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0627"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04585"
FT                   /db_xref="GOA:B9KYS3"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS3"
FT                   /protein_id="ACM04585.1"
FT                   /translation="MYRRLSRREGELMAIETKERRTVEEEPQREPQLGAHLVMQALVRE
FT                   GVEVIFGYPGGAILPVYDALPSYPIHHVLVRHEQSAAFAADGYARATGKVGVCMATSGP
FT                   GATNLVTGIANAMMDSIPIVAITGQVPQSVIGMDAFQETDITGITLPITKYNMVIRSVE
FT                   EIGPAIQKAFYLARSGRPGPVLIDIPKDVQLAKGYLAPRQELHLPGYRPTIVPHRRQIR
FT                   RAAELIRQAERPLILAGHGIIISGATEELVRFAERTQIPVGLTLLGISGFPASHPLCLG
FT                   MVGMHGLAHANRAIHEADLIIGIGMRFDDRVTGRPSEFAPHAKIIHIDIDPAEIGKVLK
FT                   TEVPVVGDAREALRLLLEELEPLEHDDWLSAIRSWYRPIRTEPSGPDGALQPQYVIARL
FT                   HALTEGKAIVTTDVGQHQMWTAQLYRCDIPKQWISSGGLGAMGFGVPSAMGAAIGRPDA
FT                   EVWAVVGDGGVQMTLNEFATLVDEQLNVKVAIINNGYLGMVRQWQQLFHNRNYSETPIS
FT                   SPDYVLLGQAYRMAARRVTRPAEVDDAITWARSFRGPALIEFVVNQEENVFPMIPSGGS
FT                   FRDMIDDYRIEGEW"
FT   gene            619401..619514
FT                   /locus_tag="trd_0628"
FT   CDS_pept        619401..619514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0628"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0628"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05701"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS4"
FT                   /protein_id="ACM05701.1"
FT                   /translation="MLSERRTMRGSQQDTPSWPRVISFIRLRSGASTCWPS"
FT   gene            complement(619803..620384)
FT                   /locus_tag="trd_0629"
FT   CDS_pept        complement(619803..620384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0629"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0629"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04923"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS5"
FT                   /protein_id="ACM04923.1"
FT                   /translation="MNDPDRSTLPNEQQIASRLAGAREQLAILTEALRTRRPVLAEAAA
FT                   CAVIDQALKTVTAALHGFNLLLPQPLPAERVSWRNLRARFVAVQVESAVLDLIEEQLRP
FT                   RSGWLWWLDRKEHASTFAPLLRFDSEAGSVAIWRDPLDPTAGVESGAPEDYLATVLQRI
FT                   EELTREIGRLARKDAEAYRQAARRQPGRML"
FT   gene            620629..620760
FT                   /locus_tag="trd_0630"
FT   CDS_pept        620629..620760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0630"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0630"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05137"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS6"
FT                   /protein_id="ACM05137.1"
FT                   /translation="MTASKKPCREAEPGSDRSVIIVAGIARWSRAPSALWKNEQETS"
FT   gene            620862..621566
FT                   /locus_tag="trd_0632"
FT   CDS_pept        620862..621566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0632"
FT                   /product="KDP operon transcriptional regulatory protein
FT                   kdpE"
FT                   /note="identified by match to protein family HMM PF00072;
FT                   match to protein family HMM PF00486"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0632"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05508"
FT                   /db_xref="GOA:B9KYS7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS7"
FT                   /protein_id="ACM05508.1"
FT                   /translation="MRRRLVLLVDGDPVIQRLLRATLTTRGYSLVVAATAEAALGALDR
FT                   HEPDLVLLDIVLPDRCGFELLQDIRLRSAVPVIIVSARAAPDDRIRGFELGADDFVAKP
FT                   FYLDELVARIEAVLRRTSPTVDRSPLLQYDRVTIDLANRRVFVDGQEVRLSRTEWSLLE
FT                   QLARQPGRVVRHSELLSHVWGPEFIRETYYLRTWVSRLRAKLRDDEEPHRIIQTRPGLG
FT                   YRLADPAVPVTA"
FT   gene            complement(621556..621678)
FT                   /locus_tag="trd_0631"
FT   CDS_pept        complement(621556..621678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0631"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0631"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06209"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS8"
FT                   /protein_id="ACM06209.1"
FT                   /translation="MALDARVVPAAAYREGGQRETQSSDRAETLFPLQCAVVTP"
FT   gene            complement(622342..622602)
FT                   /locus_tag="trd_0633"
FT   CDS_pept        complement(622342..622602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0633"
FT                   /product="hypothetical protein"
FT                   /note="identified by glimmer; putative"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0633"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04709"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYS9"
FT                   /protein_id="ACM04709.1"
FT                   /translation="MRPQPASEQWQCELIGELILRYYFLQPAPTQWVAVGLLGTETGTI
FT                   FRVGCGSEPETALVDLRERLLVALSELTERSVPSRLVNCAA"
FT   gene            622794..623711
FT                   /locus_tag="trd_0634"
FT   CDS_pept        622794..623711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0634"
FT                   /product="serinethreonine phosphatase"
FT                   /note="similar to chain a, crystal structure of the
FT                   mycobacterium tuberculosis serinethreonine phosphatase
FT                   pstpppp at 1.95 a; identified by match to protein family
FT                   HMM PF00481"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0634"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06287"
FT                   /db_xref="GOA:B9KYT0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT0"
FT                   /protein_id="ACM06287.1"
FT                   /translation="MRSIVSTRTRIRETTLLVGAATDPGPVREQNEDAVLITDPASPEA
FT                   QECGVLLAVADGMGGYRGGEVAAQLAVETLRSQFYAAPVQPTEIAKRLEQAFRAANERI
FT                   YREWEPQGETHLMGTTLVAAVIRGDSLTVANVGDSRAYLVRARRATQITRDHSLVAEQV
FT                   EAGLLTPDEARGSSYRNVITRALGYRPRVDIDIFEVRLMSDDRIVLTTDGVHDVVKDDE
FT                   IASVVLAESPERAARTLVEKALASGTQDNATAVVAWLKPADLPVEPSPAAEESSSRWMI
FT                   VLLIIGLLVFIALIGVILVLGPGG"
FT   gene            623708..624580
FT                   /locus_tag="trd_0635"
FT   CDS_pept        623708..624580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0635"
FT                   /product="Amidohydrolase family"
FT                   /note="identified by match to protein family HMM PF04909"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0635"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05217"
FT                   /db_xref="GOA:B9KYT1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT1"
FT                   /protein_id="ACM05217.1"
FT                   /translation="MIPVVDAHVHIFPPDIVRSRAAYCERDRWFGLLYGNPRARLVTAE
FT                   ELANSMEEAGINISIAAGFPWADSGLCAYHNDYLAEASRASGGRIAWLATVVPHHRSAP
FT                   AEAVRSFAAGACGIGELNADAQGFDWSEPDQLTEMVEVCRAAGRPIMAHVSEPLGHDYP
FT                   GKGTAWPQRFVRFLERFPEIVVVAAHWGGGLPFYELMPEVAAVTRNLVYDSAASTYLYR
FT                   FSVFRVVVDLVGVERVLFASDFPVLKQGRFLERVRRESGLTEQELVLVLSENARRVYRL
FT                   TLPSERDAR"
FT   gene            624577..625152
FT                   /gene="ruvA"
FT                   /locus_tag="trd_0636"
FT   CDS_pept        624577..625152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ruvA"
FT                   /locus_tag="trd_0636"
FT                   /product="Holliday junction DNA helicase RuvA"
FT                   /note="identified by match to protein family HMM PF01330;
FT                   match to protein family HMM PF07499; match to protein
FT                   family HMM TIGR00084"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0636"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05448"
FT                   /db_xref="GOA:B9KYT2"
FT                   /db_xref="InterPro:IPR000085"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR011114"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013849"
FT                   /db_xref="InterPro:IPR036267"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYT2"
FT                   /protein_id="ACM05448.1"
FT                   /translation="MIRGVRGTLVAKRSGEVLVDVQGVTFRVQTSATTLQELGEPGDLV
FT                   SLVTHLIVREDELALYGFATEAELELFLSLLAVSGVGPRGALNLLSLAAPDRLTEWIRG
FT                   ERIEELARAPGIGKKTASRIVLELRGRLPALTEVQAGEPIDQELVAALQALGYTAQEAR
FT                   QAATHPEVRRAPSLEERIVAALRQLAPP"
FT   gene            complement(625154..626500)
FT                   /gene="hisD"
FT                   /locus_tag="trd_0637"
FT   CDS_pept        complement(625154..626500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisD"
FT                   /locus_tag="trd_0637"
FT                   /product="histidinol dehydrogenase"
FT                   /EC_number="1.1.1.23"
FT                   /note="identified by match to protein family HMM PF00815;
FT                   match to protein family HMM TIGR00069"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0637"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06072"
FT                   /db_xref="GOA:B9KYT3"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT3"
FT                   /protein_id="ACM06072.1"
FT                   /translation="MTRTIRVIESIAEAERFLSRSRQMPTHLPAAVQERIRAVFGGDLT
FT                   PLQVVERIIDDVRSQGDDAVRRYTLAFDGAHLDTFLATPEEFLRARRAITPELEAALRF
FT                   ARDRIVAFHRRAIPRSWIEFDETGAFGQLVRPVDRVGIYVPGGRAPLPSSLLMTAIPAQ
FT                   LAGVRDIVVCTPPGRDGTISPAVLAAAELLGIERVFKIGGAQAIAALAYGTQTVPAVDI
FT                   VAGPGNLFVVLAKRLVYGDVGIDQLPGPTETLLIADEQADPVLCAADLLAQAEHDPLAC
FT                   AILITPARTLAHKVAQELERQLQQLDRSEIARAALEANGAIIIVPDLERAFDLANLFAP
FT                   EHLCLLVRDPWRYLDRVRHAGGVFLGETSPEVIGDYTAGPSHVMPTGRTARFASPVTVQ
FT                   TFLKVTSLVAVAPKALEQLGSPALQLAMSEGLTAHAAAIEHRLERTRPD"
FT   gene            complement(626497..627516)
FT                   /gene="hisG"
FT                   /locus_tag="trd_0638"
FT   CDS_pept        complement(626497..627516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hisG"
FT                   /locus_tag="trd_0638"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /EC_number="2.4.2.17"
FT                   /note="identified by match to protein family HMM PF01634;
FT                   match to protein family HMM TIGR00070; match to protein
FT                   family HMM TIGR03455"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0638"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05005"
FT                   /db_xref="GOA:B9KYT4"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR013115"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR020621"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT4"
FT                   /protein_id="ACM05005.1"
FT                   /translation="MAEPLRIAIASKGEYEQATLRFLESAGLSVWRPNPRQYVGRLAGF
FT                   EDVEILFQRTADIVQQVASGGADFGITGYDLVAELAGDDPDVLVVFDDLGFRRCQLVLA
FT                   VPESWLDVTTLADLADLAVEWKRRGRTMRIATKFPNLTREFLLRNGVNYFTLVEGHGAL
FT                   EIAPALGYADLIADLTETGVTLRENRLRVLEGGVILRAQACLIASRRALRAAPQKLQQA
FT                   RSIIELIEARLRSRRYRLITANIRGSSEDEVVRHVTAHAATTGERGPTVARVYPKLGED
FT                   GPGWYEVTIIVPQHLLLEAVDHLRLAGSSGITVTSPEYVFDSRSHAFARLCQALEEKA"
FT   gene            complement(627521..628963)
FT                   /locus_tag="trd_0639"
FT   CDS_pept        complement(627521..628963)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0639"
FT                   /product="histidyl-tRNA synthetase"
FT                   /EC_number="6.1.1.21"
FT                   /note="identified by match to protein family HMM PF00587"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0639"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05809"
FT                   /db_xref="GOA:B9KYT5"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT5"
FT                   /protein_id="ACM05809.1"
FT                   /translation="MTIYQLTEPPQPLERLRGMQDTPPALHRRRQAVLHRIARVLERHG
FT                   YEFIETPILESTELFLRKSGPERIAQLYAFSFRNRDIALRPEHTASILRYYVESRQNDP
FT                   LPLRFAYAGPVFRYERPQAGRTRQFTEIGGELLGAPGPSGDAEVIHLAAEILEAVGIMP
FT                   RIVIGHVGIVLDYLAHLPLRQRARDWLLWSMERLRKGQTIDIESELPAFVDSTDIVQIT
FT                   QEVRTKLALTTEDLERLILALLREVGVPMTGASRQPEEIVRGVLAKLQRSADPDALRQA
FT                   LAFARELASLSGPPDDVLSALRRIVERYGLSPAPLQQIDEVLDQLAAYGLETDRIVLAP
FT                   GMARGLHYYTGILFEMYSQTDEGLQLCGGGRYDDLAQLLGARQPLPACGFAGGLERIAD
FT                   ASALQPKTEPRLLVTAADRSAITAATRFAEQLRASGAIVELDVRQRSLSSNRRYARRRG
FT                   VTEILIVDATGSVRRIDLSTEE"
FT   gene            complement(628960..631413)
FT                   /gene="pheT"
FT                   /locus_tag="trd_0640"
FT   CDS_pept        complement(628960..631413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheT"
FT                   /locus_tag="trd_0640"
FT                   /product="phenylalanyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01588;
FT                   match to protein family HMM PF03147; match to protein
FT                   family HMM PF03483; match to protein family HMM PF03484;
FT                   match to protein family HMM TIGR00472"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0640"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05510"
FT                   /db_xref="GOA:B9KYT6"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004532"
FT                   /db_xref="InterPro:IPR005121"
FT                   /db_xref="InterPro:IPR005146"
FT                   /db_xref="InterPro:IPR005147"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR020825"
FT                   /db_xref="InterPro:IPR033714"
FT                   /db_xref="InterPro:IPR036690"
FT                   /db_xref="InterPro:IPR041616"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT6"
FT                   /protein_id="ACM05510.1"
FT                   /translation="MKVPMRWLQELVATDRSAEEIAERLTLAGLEVESIERIGAHWDKI
FT                   YVGVVEKIEPHPNADRLVLATVDAGAHRLTVVTGAPNIAVGQKVALALAGATLYDGHSA
FT                   EPRLITLKPATIRGVRSEGMVCSEKELGLSEEHEGILVLDPDAPVGIPLRDYLGDEILE
FT                   LSITPNRVDAYSIVGIAREVAALTNSPLRLPELAPIQVSVDPTLATVEASDLCHRFVGI
FT                   ALEGIRVAPSPWWLRRRLQLVGLRPINNVVDVTNYVMIEWGQPQHAFDRSRLRGGRLIV
FT                   RRARPGEEIETLDHVRRPLNPDMLVIADAERPVGIAGVMGGLESEISDETTDVLLETAN
FT                   FDMLSIRRTARTLRLRTEASARFERGLDPNLCWPAAQRAVQLLSVLVPTCRVVAMVDHY
FT                   PVPRRPWQIRFPRSEIPRLLGVDYPDERVISVFESLGLSVERGWDNGRSVWLVTVPTYR
FT                   SDITIPADLVEEAARVIGYDTIPERLPVGQTVPVEIDPELRLVRQIQNGLVAAGLHEVI
FT                   TYPMVDDQALMALTPSGDRLPERIGFFIRPTQEFVRARNPIRPEWSIMRPSMLPTLLRN
FT                   AAEQLKFNEAVAIFETGKVYLPRQRDELPDERRVVGCLLAGLATPRDLYQDERPVDYFD
FT                   LKGILETILPRIGVADVAFCALTHPTLQPGRSAEIRARGRPIGVLGEVLVTVTERFGIP
FT                   PQTRVVVAEIDIPAILEIGLAPISVRPVSRYQPVDQDFAIVVDESVPAADVAAAIRAAA
FT                   GPLATEIRLFDVYRGPAIPPGKKSLAFRVIFSAPDRPLSEEELQRLRERIEQQVRRRVK
FT                   GEFRR"
FT   gene            complement(631446..632525)
FT                   /gene="pheS"
FT                   /locus_tag="trd_0641"
FT   CDS_pept        complement(631446..632525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pheS"
FT                   /locus_tag="trd_0641"
FT                   /product="phenylalanyl-tRNA synthetase, alpha subunit"
FT                   /EC_number="6.1.1.20"
FT                   /note="identified by match to protein family HMM PF01409;
FT                   match to protein family HMM PF02912; match to protein
FT                   family HMM TIGR00468"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0641"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04686"
FT                   /db_xref="GOA:B9KYT7"
FT                   /db_xref="InterPro:IPR002319"
FT                   /db_xref="InterPro:IPR004188"
FT                   /db_xref="InterPro:IPR004529"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR022911"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT7"
FT                   /protein_id="ACM04686.1"
FT                   /translation="MSATTPEQEVSVNTDRIEELRQRAKRELLAITTQAALAEWYARYL
FT                   GRRGELTQLLRALGTLPPEQRPIIGRLANELRDELQAAYEEREREVREIELAARIAAEA
FT                   IDVTLPGRRPRIGTLHPVTQMIREVTDIFAHLGFQVVEGPEVEYGSYAFDALNIPPEHP
FT                   ARDVWDTIFIESDQKEIVLRPHTSPMQIRVMERRKPPVRVVVPGRCYRYEAVDATHEWH
FT                   FHQIEGLAVDEQITMADLKGTLAEFARQLFGKERRVRFRCDFFPFVEPGVDFAIDCMFC
FT                   RGEGCRVCGQSGWIEILGAGMVHPQVLRNVGYDPDRYTGWAFGMGVERLVMLRYGVPDI
FT                   RYFYQGDLRFLAQFDRIPV"
FT   gene            632661..633962
FT                   /gene="eno"
FT                   /locus_tag="trd_0642"
FT   CDS_pept        632661..633962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eno"
FT                   /locus_tag="trd_0642"
FT                   /product="phosphopyruvate hydratase"
FT                   /EC_number="4.2.1.11"
FT                   /note="identified by match to protein family HMM PF00113;
FT                   match to protein family HMM PF03952; match to protein
FT                   family HMM TIGR01060"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0642"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05225"
FT                   /db_xref="GOA:B9KYT8"
FT                   /db_xref="InterPro:IPR000941"
FT                   /db_xref="InterPro:IPR020809"
FT                   /db_xref="InterPro:IPR020810"
FT                   /db_xref="InterPro:IPR020811"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYT8"
FT                   /protein_id="ACM05225.1"
FT                   /translation="MSQTTIAAVRAREILDSRGNPTVEVDVQLSCGTVGRAAVPSGAST
FT                   GRHEALELRDGEPRYAGKGVRRAVEHVNGPIASAICGMDALDQRAIDRVLIELDGTPNK
FT                   SRLGANALLGVSLAVARAAAAAVQLPLYRYLGGPNAHLLPTPMLNILNGGKHAAGSGVD
FT                   MQEFMVVPVGAPSFAEAIRWASEIYQALRSVLAERGAATTIGDEGGYAPRLPGNQDAIE
FT                   VILLAIDRAGYRIGEQVVLALDPAMTELYRDGIYHLPGEGRTLSPDELIDFWAEWIERY
FT                   PIVSIEDGLAEDDWDHWQRLTARLGQRVQLVGDDLFVTNPQRIRQGILFGVANAVLVKP
FT                   NQIGTLTETLEAIHLAQTHGYATVISHRSGETADAFIADLAVAVNAGLIKTGAPARIDR
FT                   VEKYNQLLRIEEELGPAGIYAGWRGFPAGLRRFG"
FT   gene            complement(634138..635712)
FT                   /gene="gpmI"
FT                   /locus_tag="trd_0643"
FT   CDS_pept        complement(634138..635712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpmI"
FT                   /locus_tag="trd_0643"
FT                   /product="2,3-bisphosphoglycerate-independent
FT                   phosphoglycerate mutase"
FT                   /EC_number="5.4.2.-"
FT                   /note="identified by match to protein family HMM PF01676;
FT                   match to protein family HMM PF06415; match to protein
FT                   family HMM TIGR01307"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0643"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06389"
FT                   /db_xref="GOA:B9KYT9"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/Swiss-Prot:B9KYT9"
FT                   /protein_id="ACM06389.1"
FT                   /translation="MDRPPMVCLVVLDGWAIGPDYPGNAIRAAHTPVMDRLQATYPMTT
FT                   LRCWGRDVGLPDDQMGNSEVGHLNLGAGRIVYQLITRIDLAIEDGSFFQNEAFQRALDR
FT                   ARQPGRTLHLMGLIGDGGVHSHQRHLLALLELAARAGISRVAVHAFTDGRDTAPTSGIE
FT                   HLRELLAALDRLRTGFVATVSGRYYAMDRDKRWERTKLAYDAIVCGLGQTARSPLEAIE
FT                   RSYAQGITDEFIVPTVIVDAEGKPLATINDGDAVIFFNFRADRARQLTQALTDAGGFTA
FT                   FPRCRWPRDLLMVTMAEYEPHFPVLVAFAPDIVRVPLARVLSDVGLRQFHTAETEKYAH
FT                   VTYFFNGGREEPFPGEDRLLVPSPKVPTYDLKPEMSAPEVTDAAVQAIVSQRYAFVLVN
FT                   YANPDMVGHTGVFAAAVAAVECVDRCLGRIEQAVRSVNGYLVVTADHGNADEMLVPGTN
FT                   EVWTAHTKNPVPFILVAPNHSPFRSVALRTGGRLADVAPTILEIMGLPQPEEMTGRSLI
FT                   VAPSVGR"
FT   gene            635860..637530
FT                   /gene="ilvD"
FT                   /locus_tag="trd_0644"
FT   CDS_pept        635860..637530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ilvD"
FT                   /locus_tag="trd_0644"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="identified by match to protein family HMM PF00920;
FT                   match to protein family HMM TIGR00110"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0644"
FT                   /db_xref="EnsemblGenomes-Tr:ACM06196"
FT                   /db_xref="GOA:B9KYU0"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU0"
FT                   /protein_id="ACM06196.1"
FT                   /translation="MRSERITHGIDRAPARAMLRAVGFRDEDFDKPIVAIANTWTDAMP
FT                   CNYHLRELAQHLREGIREAGGVPVEFNTIAVNDAISMGTEAMKASLISREVIADSIELM
FT                   AYGYQFDALVAIVSCDKTIPGGAMGVIRAGVPAMVLYGGSIAPGHWRDRELTIVEVFEA
FT                   VGAYAAGKITLEELQEIERRAIPGPGACGGQYTANTMAMALEVMGLSPMGYNAIPAIAP
FT                   EKASATREAGRRFMEVVRANRTPRDFLTKTSLRNAIAAVAATGGSTNAVLHLLAIAHEL
FT                   GIPLSIDEFDEISQRTPIIADLKPWGKYVAWSLYKAGGTKLVVKRLLEAGLVDGDARLV
FT                   TGETLAEAVADAQEAPGQPVVYHPSAPLKPHGGLVILRGSLAPEGAVLKVAGTEQMYFR
FT                   GTARVFDAEEQAMQAVLNQQIKPGDVVVIRYEGPKGGPGMREMLGITAAIVGEGLGPHV
FT                   ALVTDGRFSGGTKGLMIGHVAPEAPVGGPIAFVQDGDTIVIDVEKRRIDLEVSETELAE
FT                   RRSRWSPPAPRFTNGVFARYAALVSSASQGAVLRTPAWQ"
FT   gene            complement(637583..638692)
FT                   /gene="purK"
FT                   /locus_tag="trd_0645"
FT   CDS_pept        complement(637583..638692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purK"
FT                   /locus_tag="trd_0645"
FT                   /product="phosphoribosylaminoimidazole carboxylase, ATPase
FT                   subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF01071;
FT                   match to protein family HMM PF02222; match to protein
FT                   family HMM TIGR01161"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0645"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05120"
FT                   /db_xref="GOA:B9KYU1"
FT                   /db_xref="InterPro:IPR003135"
FT                   /db_xref="InterPro:IPR005875"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR040686"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU1"
FT                   /protein_id="ACM05120.1"
FT                   /translation="MRIGILGGGQLGRMLALAGYPLGLHFRGLDPAPEAPLGHVAELLV
FT                   ASYDDRLALEQFATGLDYVTYEFENVPGTTAEFLATRLPVLPPPVALFRAQDRLEEKQL
FT                   FESCGIPVPRYAPISSPEDFGPAIETVPFPAVLKTRRFGYDGHGQKRVRQPAELPRAWE
FT                   ELGRVSCLLEEFVPFDYEVSLLGARSRTGEIAFYPLVENRHTEGILALSRAPAPRANRT
FT                   LQEQAERSVAALLEELSYVGILAVEFFVVGETLLANEMAPRVHNSGHWTIEGAETSQFE
FT                   QHLRAILGWPLGSTAMRGYAAMINLLGSLPPIESLLAIPNVHVHLYGKTPRPRRKLGHV
FT                   TIRAESPEERDELVRLVLSIVEFPQPVTI"
FT   gene            complement(638704..639219)
FT                   /gene="purE"
FT                   /locus_tag="trd_0646"
FT   CDS_pept        complement(638704..639219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purE"
FT                   /locus_tag="trd_0646"
FT                   /product="phosphoribosylaminoimidazole carboxylase,
FT                   catalytic subunit"
FT                   /EC_number="4.1.1.21"
FT                   /note="identified by match to protein family HMM PF00731;
FT                   match to protein family HMM TIGR01162"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0646"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05547"
FT                   /db_xref="GOA:B9KYU2"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR024694"
FT                   /db_xref="InterPro:IPR033747"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU2"
FT                   /protein_id="ACM05547.1"
FT                   /translation="MQVTNASSRPLVGIIMGSRSDWETMSHAASTLDHLNIPYEVRVVS
FT                   AHRTPDLMFEYAATAEARGIEVIIAGAGGAAHLPGMTAAKTVVPVLGVPVQTHTLHGLD
FT                   SLLSIVQMPAGVPVGTLAIGRAGAVNAALLAAAILGTKYPEIRERLRRFRDEQTRAVLE
FT                   NPDPRQAP"
FT   gene            complement(639235..640725)
FT                   /locus_tag="trd_0647"
FT   CDS_pept        complement(639235..640725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0647"
FT                   /product="isocitrate dehydrogenase (NADP)"
FT                   /EC_number="1.1.1.42"
FT                   /note="identified by match to protein family HMM PF00180"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0647"
FT                   /db_xref="EnsemblGenomes-Tr:ACM04935"
FT                   /db_xref="GOA:B9KYU3"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="InterPro:IPR040978"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU3"
FT                   /protein_id="ACM04935.1"
FT                   /translation="MEQSGGSGATMKYVVTPNGKKLVTLIPGDGIGPEIVESACRLIEA
FT                   VGAPIEWEVRRAGASVFREGIASGVPDDTIESIKRTRVVLKGPLETPVGYGEKSANVTL
FT                   RKLFEAFANVRPVRELPSVPTPYRGRNIDLVVVRENIEDLYAAIEYRETPGVTIAHKLI
FT                   SYKGSEKIIRFAFELARAEGRKKVTCATKSNILKLTEGWFQHIFEEIASEYPDIEANHL
FT                   IIDNCAHQLVKAPEQFEVIVTTNLNGDIISDLASGLVGGLGFAASGNYGHEVAIFEPVH
FT                   GTAPKYAGKNVINPTAMILTAVMMLRYIDEFETAETIEQALIVTLEEGKALTRDVVGDE
FT                   RAVSTTAFTDAIIANLGRRSATWKTRPYQPIRIPAQRPELDPVRPSRRRVVGVDLIVEG
FT                   TEPPQILGPNLERLIDDLPLRLHLISSRGLQVYPDVGTTIDYVDHWRCRFLSHDGEVST
FT                   ATVTALLERLSARYRWSRVQLLHEFDGEPGFTRAQGED"
FT   gene            complement(640831..642195)
FT                   /locus_tag="trd_0648"
FT   CDS_pept        complement(640831..642195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="trd_0648"
FT                   /product="amine oxidase, flavin-containing protein"
FT                   /note="identified by match to protein family HMM PF01266;
FT                   match to protein family HMM PF01593"
FT                   /db_xref="EnsemblGenomes-Gn:trd_0648"
FT                   /db_xref="EnsemblGenomes-Tr:ACM05837"
FT                   /db_xref="GOA:B9KYU4"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B9KYU4"
FT                   /protein_id="ACM05837.1"
FT                   /translat