(data stored in ACNUC7421 zone)

EMBL: CP001281

ID   CP001281; SV 2; circular; genomic DNA; STD; PRO; 4496212 BP.
XX
AC   CP001281; ABKT01000000-ABKT01000094;
XX
PR   Project:PRJNA20091;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 10)
XX
DE   Thauera sp. MZ1T, complete genome.
XX
KW   .
XX
OS   Thauera sp. MZ1T
OC   Bacteria; Proteobacteria; Betaproteobacteria; Rhodocyclales; Zoogloeaceae;
OC   Thauera.
XX
RN   [1]
RP   1-4496212
RX   DOI; 10.4056/sigs.2696029.
RX   PUBMED; 23407619.
RA   Jiang K., Sanseverino J., Chauhan A., Lucas S., Copeland A., Lapidus A.,
RA   Del Rio T.G., Dalin E., Tice H., Bruce D., Goodwin L., Pitluck S., Sims D.,
RA   Brettin T., Detter J.C., Han C., Chang Y.J., Larimer F., Land M.,
RA   Hauser L., Kyrpides N.C., Mikhailova N., Moser S., Jegier P., Close D.,
RA   Debruyn J.M., Wang Y., Layton A.C., Allen M.S., Sayler G.S.;
RT   "Complete genome sequence of Thauera aminoaromatica strain MZ1T";
RL   Stand Genomic Sci 6(3):325-335(2012).
XX
RN   [2]
RP   1-4496212
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Sayler G.S.;
RT   ;
RL   Submitted (10-DEC-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-4496212
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Mikhailova N., Sayler G.S.;
RT   ;
RL   Submitted (14-MAY-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 45dd05537b2bd933d68477e4aaf6ad63.
DR   BioSample; SAMN00000048.
DR   EnsemblGenomes-Gn; EBG00001063141.
DR   EnsemblGenomes-Gn; EBG00001063144.
DR   EnsemblGenomes-Gn; EBG00001063147.
DR   EnsemblGenomes-Gn; EBG00001063149.
DR   EnsemblGenomes-Gn; EBG00001063150.
DR   EnsemblGenomes-Gn; EBG00001063152.
DR   EnsemblGenomes-Gn; EBG00001063154.
DR   EnsemblGenomes-Gn; EBG00001063156.
DR   EnsemblGenomes-Gn; EBG00001063158.
DR   EnsemblGenomes-Gn; EBG00001063159.
DR   EnsemblGenomes-Gn; EBG00001063160.
DR   EnsemblGenomes-Gn; EBG00001063161.
DR   EnsemblGenomes-Gn; EBG00001063165.
DR   EnsemblGenomes-Gn; EBG00001063166.
DR   EnsemblGenomes-Gn; EBG00001063167.
DR   EnsemblGenomes-Gn; EBG00001063168.
DR   EnsemblGenomes-Gn; EBG00001063169.
DR   EnsemblGenomes-Gn; EBG00001063170.
DR   EnsemblGenomes-Gn; EBG00001063171.
DR   EnsemblGenomes-Gn; EBG00001063172.
DR   EnsemblGenomes-Gn; EBG00001063173.
DR   EnsemblGenomes-Gn; EBG00001063175.
DR   EnsemblGenomes-Gn; EBG00001063176.
DR   EnsemblGenomes-Gn; EBG00001063177.
DR   EnsemblGenomes-Gn; EBG00001063178.
DR   EnsemblGenomes-Gn; EBG00001063179.
DR   EnsemblGenomes-Gn; EBG00001063180.
DR   EnsemblGenomes-Gn; EBG00001063181.
DR   EnsemblGenomes-Gn; EBG00001063182.
DR   EnsemblGenomes-Gn; EBG00001063183.
DR   EnsemblGenomes-Gn; EBG00001063184.
DR   EnsemblGenomes-Gn; EBG00001063185.
DR   EnsemblGenomes-Gn; EBG00001063186.
DR   EnsemblGenomes-Gn; EBG00001063187.
DR   EnsemblGenomes-Gn; EBG00001063188.
DR   EnsemblGenomes-Gn; EBG00001063189.
DR   EnsemblGenomes-Gn; EBG00001063190.
DR   EnsemblGenomes-Gn; EBG00001063191.
DR   EnsemblGenomes-Gn; EBG00001063192.
DR   EnsemblGenomes-Gn; EBG00001063193.
DR   EnsemblGenomes-Gn; EBG00001063195.
DR   EnsemblGenomes-Gn; EBG00001063197.
DR   EnsemblGenomes-Gn; EBG00001063198.
DR   EnsemblGenomes-Gn; EBG00001063199.
DR   EnsemblGenomes-Gn; EBG00001063200.
DR   EnsemblGenomes-Gn; EBG00001063201.
DR   EnsemblGenomes-Gn; EBG00001063202.
DR   EnsemblGenomes-Gn; EBG00001063203.
DR   EnsemblGenomes-Gn; EBG00001063204.
DR   EnsemblGenomes-Gn; EBG00001063205.
DR   EnsemblGenomes-Gn; EBG00001063206.
DR   EnsemblGenomes-Gn; EBG00001063207.
DR   EnsemblGenomes-Gn; EBG00001063208.
DR   EnsemblGenomes-Gn; EBG00001063210.
DR   EnsemblGenomes-Gn; EBG00001063212.
DR   EnsemblGenomes-Gn; EBG00001063214.
DR   EnsemblGenomes-Gn; EBG00001063215.
DR   EnsemblGenomes-Gn; EBG00001063216.
DR   EnsemblGenomes-Gn; EBG00001063217.
DR   EnsemblGenomes-Gn; EBG00001063218.
DR   EnsemblGenomes-Gn; EBG00001063219.
DR   EnsemblGenomes-Gn; EBG00001063220.
DR   EnsemblGenomes-Gn; EBG00001063222.
DR   EnsemblGenomes-Gn; EBG00001063223.
DR   EnsemblGenomes-Gn; EBG00001063224.
DR   EnsemblGenomes-Gn; EBG00001063225.
DR   EnsemblGenomes-Gn; EBG00001063226.
DR   EnsemblGenomes-Gn; EBG00001063227.
DR   EnsemblGenomes-Gn; EBG00001063228.
DR   EnsemblGenomes-Gn; EBG00001063229.
DR   EnsemblGenomes-Gn; EBG00001063230.
DR   EnsemblGenomes-Gn; EBG00001063231.
DR   EnsemblGenomes-Gn; EBG00001063232.
DR   EnsemblGenomes-Gn; EBG00001063233.
DR   EnsemblGenomes-Gn; EBG00001063234.
DR   EnsemblGenomes-Gn; EBG00001063235.
DR   EnsemblGenomes-Gn; EBG00001063236.
DR   EnsemblGenomes-Gn; EBG00001063238.
DR   EnsemblGenomes-Gn; EBG00001063239.
DR   EnsemblGenomes-Gn; EBG00001063241.
DR   EnsemblGenomes-Gn; EBG00001063243.
DR   EnsemblGenomes-Gn; EBG00001063245.
DR   EnsemblGenomes-Gn; EBG00001063247.
DR   EnsemblGenomes-Gn; Tmz1t_R0001.
DR   EnsemblGenomes-Gn; Tmz1t_R0002.
DR   EnsemblGenomes-Gn; Tmz1t_R0003.
DR   EnsemblGenomes-Gn; Tmz1t_R0004.
DR   EnsemblGenomes-Gn; Tmz1t_R0005.
DR   EnsemblGenomes-Gn; Tmz1t_R0006.
DR   EnsemblGenomes-Gn; Tmz1t_R0007.
DR   EnsemblGenomes-Gn; Tmz1t_R0008.
DR   EnsemblGenomes-Gn; Tmz1t_R0009.
DR   EnsemblGenomes-Gn; Tmz1t_R0010.
DR   EnsemblGenomes-Gn; Tmz1t_R0011.
DR   EnsemblGenomes-Gn; Tmz1t_R0013.
DR   EnsemblGenomes-Gn; Tmz1t_R0014.
DR   EnsemblGenomes-Gn; Tmz1t_R0015.
DR   EnsemblGenomes-Gn; Tmz1t_R0016.
DR   EnsemblGenomes-Gn; Tmz1t_R0017.
DR   EnsemblGenomes-Gn; Tmz1t_R0018.
DR   EnsemblGenomes-Gn; Tmz1t_R0019.
DR   EnsemblGenomes-Gn; Tmz1t_R0020.
DR   EnsemblGenomes-Gn; Tmz1t_R0021.
DR   EnsemblGenomes-Gn; Tmz1t_R0022.
DR   EnsemblGenomes-Gn; Tmz1t_R0023.
DR   EnsemblGenomes-Gn; Tmz1t_R0024.
DR   EnsemblGenomes-Gn; Tmz1t_R0025.
DR   EnsemblGenomes-Gn; Tmz1t_R0026.
DR   EnsemblGenomes-Gn; Tmz1t_R0027.
DR   EnsemblGenomes-Gn; Tmz1t_R0028.
DR   EnsemblGenomes-Gn; Tmz1t_R0029.
DR   EnsemblGenomes-Gn; Tmz1t_R0030.
DR   EnsemblGenomes-Gn; Tmz1t_R0031.
DR   EnsemblGenomes-Gn; Tmz1t_R0032.
DR   EnsemblGenomes-Gn; Tmz1t_R0033.
DR   EnsemblGenomes-Gn; Tmz1t_R0034.
DR   EnsemblGenomes-Gn; Tmz1t_R0035.
DR   EnsemblGenomes-Gn; Tmz1t_R0036.
DR   EnsemblGenomes-Gn; Tmz1t_R0037.
DR   EnsemblGenomes-Gn; Tmz1t_R0038.
DR   EnsemblGenomes-Gn; Tmz1t_R0039.
DR   EnsemblGenomes-Gn; Tmz1t_R0040.
DR   EnsemblGenomes-Gn; Tmz1t_R0041.
DR   EnsemblGenomes-Gn; Tmz1t_R0042.
DR   EnsemblGenomes-Gn; Tmz1t_R0043.
DR   EnsemblGenomes-Gn; Tmz1t_R0044.
DR   EnsemblGenomes-Gn; Tmz1t_R0045.
DR   EnsemblGenomes-Gn; Tmz1t_R0046.
DR   EnsemblGenomes-Gn; Tmz1t_R0047.
DR   EnsemblGenomes-Gn; Tmz1t_R0048.
DR   EnsemblGenomes-Gn; Tmz1t_R0049.
DR   EnsemblGenomes-Gn; Tmz1t_R0050.
DR   EnsemblGenomes-Gn; Tmz1t_R0051.
DR   EnsemblGenomes-Gn; Tmz1t_R0052.
DR   EnsemblGenomes-Gn; Tmz1t_R0053.
DR   EnsemblGenomes-Gn; Tmz1t_R0054.
DR   EnsemblGenomes-Gn; Tmz1t_R0055.
DR   EnsemblGenomes-Gn; Tmz1t_R0056.
DR   EnsemblGenomes-Gn; Tmz1t_R0057.
DR   EnsemblGenomes-Gn; Tmz1t_R0058.
DR   EnsemblGenomes-Gn; Tmz1t_R0059.
DR   EnsemblGenomes-Gn; Tmz1t_R0060.
DR   EnsemblGenomes-Gn; Tmz1t_R0061.
DR   EnsemblGenomes-Gn; Tmz1t_R0062.
DR   EnsemblGenomes-Gn; Tmz1t_R0063.
DR   EnsemblGenomes-Gn; Tmz1t_R0064.
DR   EnsemblGenomes-Gn; Tmz1t_R0065.
DR   EnsemblGenomes-Gn; Tmz1t_R0066.
DR   EnsemblGenomes-Gn; Tmz1t_R0067.
DR   EnsemblGenomes-Gn; Tmz1t_R0069.
DR   EnsemblGenomes-Gn; Tmz1t_R0070.
DR   EnsemblGenomes-Gn; Tmz1t_R0071.
DR   EnsemblGenomes-Gn; Tmz1t_R0072.
DR   EnsemblGenomes-Gn; Tmz1t_R0073.
DR   EnsemblGenomes-Gn; Tmz1t_R0074.
DR   EnsemblGenomes-Gn; Tmz1t_R0075.
DR   EnsemblGenomes-Tr; EBT00001665758.
DR   EnsemblGenomes-Tr; EBT00001665759.
DR   EnsemblGenomes-Tr; EBT00001665760.
DR   EnsemblGenomes-Tr; EBT00001665761.
DR   EnsemblGenomes-Tr; EBT00001665762.
DR   EnsemblGenomes-Tr; EBT00001665763.
DR   EnsemblGenomes-Tr; EBT00001665764.
DR   EnsemblGenomes-Tr; EBT00001665765.
DR   EnsemblGenomes-Tr; EBT00001665766.
DR   EnsemblGenomes-Tr; EBT00001665767.
DR   EnsemblGenomes-Tr; EBT00001665768.
DR   EnsemblGenomes-Tr; EBT00001665769.
DR   EnsemblGenomes-Tr; EBT00001665770.
DR   EnsemblGenomes-Tr; EBT00001665771.
DR   EnsemblGenomes-Tr; EBT00001665772.
DR   EnsemblGenomes-Tr; EBT00001665773.
DR   EnsemblGenomes-Tr; EBT00001665774.
DR   EnsemblGenomes-Tr; EBT00001665775.
DR   EnsemblGenomes-Tr; EBT00001665776.
DR   EnsemblGenomes-Tr; EBT00001665777.
DR   EnsemblGenomes-Tr; EBT00001665778.
DR   EnsemblGenomes-Tr; EBT00001665779.
DR   EnsemblGenomes-Tr; EBT00001665780.
DR   EnsemblGenomes-Tr; EBT00001665781.
DR   EnsemblGenomes-Tr; EBT00001665782.
DR   EnsemblGenomes-Tr; EBT00001665783.
DR   EnsemblGenomes-Tr; EBT00001665784.
DR   EnsemblGenomes-Tr; EBT00001665785.
DR   EnsemblGenomes-Tr; EBT00001665786.
DR   EnsemblGenomes-Tr; EBT00001665787.
DR   EnsemblGenomes-Tr; EBT00001665788.
DR   EnsemblGenomes-Tr; EBT00001665789.
DR   EnsemblGenomes-Tr; EBT00001665790.
DR   EnsemblGenomes-Tr; EBT00001665791.
DR   EnsemblGenomes-Tr; EBT00001665792.
DR   EnsemblGenomes-Tr; EBT00001665793.
DR   EnsemblGenomes-Tr; EBT00001665794.
DR   EnsemblGenomes-Tr; EBT00001665795.
DR   EnsemblGenomes-Tr; EBT00001665796.
DR   EnsemblGenomes-Tr; EBT00001665797.
DR   EnsemblGenomes-Tr; EBT00001665798.
DR   EnsemblGenomes-Tr; EBT00001665799.
DR   EnsemblGenomes-Tr; EBT00001665800.
DR   EnsemblGenomes-Tr; EBT00001665801.
DR   EnsemblGenomes-Tr; EBT00001665802.
DR   EnsemblGenomes-Tr; EBT00001665803.
DR   EnsemblGenomes-Tr; EBT00001665804.
DR   EnsemblGenomes-Tr; EBT00001665805.
DR   EnsemblGenomes-Tr; EBT00001665806.
DR   EnsemblGenomes-Tr; EBT00001665807.
DR   EnsemblGenomes-Tr; EBT00001665808.
DR   EnsemblGenomes-Tr; EBT00001665809.
DR   EnsemblGenomes-Tr; EBT00001665810.
DR   EnsemblGenomes-Tr; EBT00001665811.
DR   EnsemblGenomes-Tr; EBT00001665812.
DR   EnsemblGenomes-Tr; EBT00001665813.
DR   EnsemblGenomes-Tr; EBT00001665814.
DR   EnsemblGenomes-Tr; EBT00001665815.
DR   EnsemblGenomes-Tr; EBT00001665816.
DR   EnsemblGenomes-Tr; EBT00001665817.
DR   EnsemblGenomes-Tr; EBT00001665818.
DR   EnsemblGenomes-Tr; EBT00001665819.
DR   EnsemblGenomes-Tr; EBT00001665820.
DR   EnsemblGenomes-Tr; EBT00001665821.
DR   EnsemblGenomes-Tr; EBT00001665822.
DR   EnsemblGenomes-Tr; EBT00001665823.
DR   EnsemblGenomes-Tr; EBT00001665824.
DR   EnsemblGenomes-Tr; EBT00001665825.
DR   EnsemblGenomes-Tr; EBT00001665826.
DR   EnsemblGenomes-Tr; EBT00001665827.
DR   EnsemblGenomes-Tr; EBT00001665828.
DR   EnsemblGenomes-Tr; EBT00001665829.
DR   EnsemblGenomes-Tr; EBT00001665830.
DR   EnsemblGenomes-Tr; EBT00001665831.
DR   EnsemblGenomes-Tr; EBT00001665832.
DR   EnsemblGenomes-Tr; EBT00001665833.
DR   EnsemblGenomes-Tr; EBT00001665834.
DR   EnsemblGenomes-Tr; EBT00001665835.
DR   EnsemblGenomes-Tr; EBT00001665836.
DR   EnsemblGenomes-Tr; EBT00001665837.
DR   EnsemblGenomes-Tr; EBT00001665838.
DR   EnsemblGenomes-Tr; EBT00001665839.
DR   EnsemblGenomes-Tr; EBT00001665840.
DR   EnsemblGenomes-Tr; Tmz1t_R0001-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0002-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0003-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0004-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0005-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0006-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0007-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0008-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0009-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0010-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0011-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0013-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0014-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0015-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0016-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0017-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0018-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0019-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0020-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0021-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0022-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0023-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0024-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0025-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0026-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0027-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0028-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0029-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0030-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0031-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0032-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0033-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0034-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0035-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0036-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0037-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0038-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0039-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0040-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0041-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0042-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0043-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0044-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0045-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0046-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0047-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0048-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0049-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0050-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0051-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0052-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0053-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0054-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0055-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0056-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0057-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0058-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0059-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0060-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0061-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0062-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0063-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0064-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0065-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0066-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0067-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0069-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0070-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0071-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0072-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0073-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0074-1.
DR   EnsemblGenomes-Tr; Tmz1t_R0075-1.
DR   EuropePMC; PMC2881769; 20388716.
DR   EuropePMC; PMC3558969; 23407619.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00080; yybP-ykoY.
DR   RFAM; RF00140; Alpha_RBS.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF01057; SAH_riboswitch.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01754; radC.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01851; cyano_tmRNA.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02194; HPnc0260.
DR   RFAM; RF02278; Betaproteobacteria_toxic_sRNA.
DR   SILVA-LSU; CP001281.
DR   SILVA-SSU; CP001281.
XX
CC   On May 14, 2009 this sequence version replaced gi:217505792.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024116
CC   Source DNA and bacteria available from Gary S. Sayler
CC   (Sayler@utk.edu)
CC   Contacts: Gary S. Sayler (Sayler@utk.edu)
CC        David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   ##Metadata-START##
CC   Organism Display Name :: Thauera aromatica 3CB2
CC   GOLD Stamp ID         :: Gi03593
CC   Greengenes ID         :: 23705
CC   Isolation Site        :: Marine sediment, Arthur Kill, NJ
CC   Isolation Country     :: USA
CC   Latitude              :: 40.55515
CC   Longitude             :: -74.215865
CC   Temperature Range     :: Mesophile
CC   Biotic Relationship   :: Free living
CC   Diseases              :: None
CC   Habitat               :: Host, Marine
CC   ##Metadata-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4496212
FT                   /organism="Thauera sp. MZ1T"
FT                   /strain="MZ1T"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:85643"
FT   gene            250..1752
FT                   /locus_tag="Tmz1t_0001"
FT   CDS_pept        250..1752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: azo:azo0001 chromosomal replication initiator
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA;
FT                   Chromosomal replication initiator DnaA domain; SMART:
FT                   Chromosomal replication initiator DnaA domain; AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52804"
FT                   /db_xref="GOA:C4ZIB0"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB0"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACK52804.1"
FT                   /translation="MTQDFWTFCLSRLEQELPQQQFNTWIKTLRAEPGEGGWALIAPNR
FT                   FVLQWVRERYLRRVEELGEEFAGAPLAIELQLPPAGAARPARAAATADVAPARASAPRS
FT                   TIEATPAQAVETAETAPAVLDTVDAAEPAEPPVRPRRAAAPRSHSSEPSSGLDLAYEKT
FT                   RLNPDFTFDTLVTGRANDLARAAAMQVAQNPGTSYNPLFVYGGVGLGKTHLVHAIGNAV
FT                   FRHNPRAVIRYVHVEDYYADVVRAYQQKSFDAFKRYYRSLDMLIIDDIQFFNNKNRTQE
FT                   EFFHAFNALTEARKQIVITCDTYPKDIQGLEDRLISRFDWGLTVQIEPPELEMRVAILK
FT                   KKAEALRVLVDDDVAFLIAKNLRSNVRELEGALNKVVAYARFHGRQIGLEVAKEALKDL
FT                   LHAHNRQLSIEHIQKTVADYYKIKIADMHSKKRTRVIARPRQVAMWLAKELTPMSLPAI
FT                   GEAFGGRDHTTVLHACRTITELRLGDAQLNHDVHVLTQVLRG"
FT   gene            1813..2922
FT                   /locus_tag="Tmz1t_0002"
FT   CDS_pept        1813..2922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: azo:azo0002 DNA-directed DNA polymerase;
FT                   TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; SMART: DNA polymerase III beta
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52805"
FT                   /db_xref="GOA:C4ZIB1"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB1"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACK52805.1"
FT                   /translation="MLLLTTTRDALLAPLQSVAGIVEKRHTLPILSNVLIEKHADQLTM
FT                   LATDIEIQIRTTTGGHIGGEDASITVGARKLQDILRALPDSAEISLTLDDKRLTVKAGR
FT                   SRFQLQTLPAADYPRLNPPTDAAAHLSIGQRTFKRQLAQVAYAMAQQDIRYYLNGLLLI
FT                   ADGGELRMVATDGHRLAYAASDLEAPIATRTEAILPRKTVLELARQLADSDDPLEILLA
FT                   GNQAVFRFGPIELVTKLIDGKFPDYERVIPTAHPKLIHFARQPLLSALQRAAILTNEKF
FT                   RGVRMVLEDGVLRIASTNAEQEEAMDELEIDYQGDKLDIGFNVTYLLDVLNNLSSETVD
FT                   WRFNDGNSSALITLPGNDKFKYVVMPMRI"
FT   gene            2972..5473
FT                   /locus_tag="Tmz1t_0003"
FT   CDS_pept        2972..5473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0003"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: azo:azo0003 DNA gyrase subunit B; TIGRFAM: DNA
FT                   gyrase, B subunit; PFAM: DNA topoisomerase type IIA subunit
FT                   B region 2 domain protein; DNA gyrase subunit B domain
FT                   protein; TOPRIM domain protein; ATP-binding region ATPase
FT                   domain protein; SMART: DNA topoisomerase II; ATP-binding
FT                   region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52806"
FT                   /db_xref="GOA:C4ZIB2"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR041423"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB2"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACK52806.1"
FT                   /translation="MSEPQDQPTASAKAHEDYDETSIQQLEGLEAVRKRPGMYIGDTSD
FT                   GTGLHHMVFEVVDNSIDEALAGHCDDIVITIHADNSISVTDNGRGIPVGVKMDDKHEPK
FT                   RSAAEIVMCVLHAGGKFNQNSYKVSGGLHGVGVSCVNALSKWMNVTVARDGKRHLLEFE
FT                   RGKPQNRVIEVVDGVEVSPARVIGETTKRGTKVHYLADEEIFGTIEYHYDILAKRLREL
FT                   SFLNNGVKIRLIDQRTGKEEDFAFAGGVKGFVEYINRAKTVLHPNVFYATGTTRIPTGH
FT                   GHDAELAVEVAMQWNDSYQEQVLCYTNNIPQADGGTHLTGLRAAMTRVINKYIEENEIA
FT                   KKAKVDITGDDMREGLACVLSVKMPDPKFASQTKMKLVSSEARPAVEEVVASKLGDFLL
FT                   ENPIDAKTICNKIVEAARARDAARKAREMTRRKGVLDGVGLPGKLADCQEKDPALCELY
FT                   LVEGDSAGGSAKQGRDRKFQAILPLKGKILNVEKARFDKLLQSQEIATLITALGTSIGK
FT                   DDYKPEKLRYHRIILMTDADVDGAHIRTLLLTFFYRQMPELVERGHIYIAQPPLYKIKH
FT                   GKSEMYIKDDSELSNHLLRLALDGAVLVPREGADPISEEALGGLARTYLLAEAVTRRLA
FT                   SYIDPEVLQVMLAHDIEVSLDDEAAARASAERIQPHLPEGLQIYAEYHDEAEGWRLTIE
FT                   RLHHGNRKFGWVEHDFLVSGDYRAIRNAAEAISGLIGPGAEIRRGEKRQTVSRFADAIK
FT                   WMLADVERGITKQRYKGLGEMNPEQLWETTMDPAVRRLLRVQIDDAIAADEIFTTLMGD
FT                   NVEPRRAFIEGNALYAQNIDV"
FT   gene            5709..7262
FT                   /locus_tag="Tmz1t_0004"
FT   CDS_pept        5709..7262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0004"
FT                   /product="Site-specific DNA-methyltransferase
FT                   (adenine-specific)"
FT                   /EC_number="2.1.1.72"
FT                   /note="PFAM: N-6 DNA methylase; KEGG: dar:Daro_1303 N-6 DNA
FT                   methylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52807"
FT                   /db_xref="GOA:C4ZIB3"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR022749"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038333"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB3"
FT                   /inference="protein motif:PRIAM:2.1.1.72"
FT                   /protein_id="ACK52807.1"
FT                   /translation="MSLDLNQLETRLWAAADQLWANTGLKPSEFSNPVLGLIFLRYAEK
FT                   RFHEAEAKLIESGLGVSEIEKFDYQAEGALYLPDNAHFSYLLDLAEGQDLGKAVNEAMA
FT                   AVEAENEELKGVLPRSYGRLPNTVLVELLRVLNGLGEVEGDAFGKIYEYFLGKFALAEG
FT                   QKGGVFYTPTSIVKLIVEIIEPFHGKIFDPACGSGGMFVQSAQFVSRHQKRAAEELTVY
FT                   GTEKANDTVKLAKMNLAVHGLSGDIRESNTYYEDPHKAVVGNTGKFDFVMANPPFNVSG
FT                   VDKERVKDDPRFPFGIPTTDNANYLWIQHFYTALNERGRAGFVMANSAGDARGTELEIR
FT                   KKLIQTGGVDVIVSVGSNFFYTVTLPCTLWFFDRAKAKGERKDEVLFIDARGTYRQVSR
FT                   AIRDFLPEQIEFLANIVRLWRGEAVEIEAGSQEMLRQQFPEGGYRDIAGVCKVATLAEI
FT                   EAQGWSLNPGRYVGVADRGADDFDFAEKFEALAEELERLNGEADQLQEQISSQAVALLS
FT                   "
FT   gene            7271..8407
FT                   /locus_tag="Tmz1t_0005"
FT   CDS_pept        7271..8407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0005"
FT                   /product="restriction modification system DNA specificity
FT                   domain protein"
FT                   /note="PFAM: restriction modification system DNA
FT                   specificity domain; KEGG: tcx:Tcr_0333 restriction
FT                   modification system DNA specificity subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52808"
FT                   /db_xref="GOA:C4ZIB4"
FT                   /db_xref="InterPro:IPR000055"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB4"
FT                   /inference="protein motif:PFAM:PF01420"
FT                   /protein_id="ACK52808.1"
FT                   /translation="MNEFFDVTLGEVVDFFNGKAIKPGQDGEYPAYGSNGLIGGAPDWK
FT                   YENSIIIGRVGAYCGSVAYCKSRFWASDNTIVARPKSGDVGYFYYLLKALELNRYAGGA
FT                   AQPLVTQTVLKGVPARVPDIPTQRRIASILSAYDDLIENNTRRIAILEEMARRIYEEWF
FT                   VRFRFPGHEQVKMVESELGLIPEGWKATNIGEVAENHDRKRKPLSKMQREKFKGPYPYY
FT                   GAAKIFDYVEDYIFDGRFVLMAEDGSVITPDGFPVLQLANGRFWANNHTHILRGTPDAS
FT                   TEFIYLRLSSQKVSGYITGAAQPKITQANMNRIPVCLPPRDLMARFTELVGPKFDLIDC
FT                   LERKHTNLRATRDLLLPKLISGELDVSTLPEPEEAIAA"
FT   gene            8404..11610
FT                   /locus_tag="Tmz1t_0006"
FT   CDS_pept        8404..11610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0006"
FT                   /product="type I site-specific deoxyribonuclease, HsdR
FT                   family"
FT                   /note="KEGG: dar:Daro_1308 type I site-specific
FT                   deoxyribonuclease HsdR; TIGRFAM: type I site-specific
FT                   deoxyribonuclease, HsdR family; PFAM: protein of unknown
FT                   function DUF450; type III restriction protein res subunit;
FT                   SMART: DEAD-like helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52809"
FT                   /db_xref="GOA:C4ZIB5"
FT                   /db_xref="InterPro:IPR004473"
FT                   /db_xref="InterPro:IPR007409"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR021810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040980"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB5"
FT                   /inference="protein motif:TFAM:TIGR00348"
FT                   /protein_id="ACK52809.2"
FT                   /translation="MTTVLTAKEVTAGYGELVLVELPAMDCFASLGWEVANLYDETFGV
FT                   DGTEGRKSSAEVILVPRLRRALERINPGYPATAYEQAIEQLTEDRSKQIPVNANQAFYT
FT                   LLRDRVKVEITDDEGNPQTVELLVIDWNDPDNNDFFLAQQMWVSGEMYKRRCDLLGFVN
FT                   GIPLVFVELKGPHVPLKSAYDDNLKDYKGQSVPQLFHPNAFIILSNGSQTRVGTLTSPW
FT                   EHFFEWRRIDDETEAGSTSLETAIRGLCDKRRLLDLVENFTVFETARGGLIKKVAKNHQ
FT                   YLGVNKAIAQMVKLRESGDREAAKKLGVFWHTQGSGKSLSMVFFTQKVLRKLPGKWTFV
FT                   MVTDRAELDDQIYKTFTATGAITGAEVQASSAENLKQLLREDHRYVFSLIQKFRTEKGE
FT                   AYPRISERDDIIVITDEAHRSQYDVFALNMRNALPNAAFLGFTGTPLIAGEEERTREVF
FT                   GDYVSVYDFARSIEDGATVPLYYENRTPELQIINDNLNRDIERLLEEAELYEEQEKKLE
FT                   REFAREYHLITRDDRLETIAADLVKHFLGRGYRGKAMMVCIDKATAVRMYDKVQTHWKK
FT                   HLADLEAQLKTASGDAKETLADKIMVMRTTDMAVVVSQSQNEIEELKEKGLDIVPHRQR
FT                   MVGENLDEQFKDPDGQLRLVFVCAMWITGFDVPTCSTLYLDKPMRNHTLMQTIARANRV
FT                   APGKTAGLIVDYVGIFRNLQDALRIYAKPNQPGQLPIKDKAALVEQLEGLLRDAQSFCT
FT                   GLGIDLKGIVNTPPAQRLEALQKAMDVILEAGEDKTKAYLLLAGQVARTFKAILPDAEA
FT                   NAHAPTSVLVAYLGAMIKALRPPPDISGVMNDLDALLDDSIATEGYRIGARPEAEALID
FT                   LSQIDFAALQKKFEEGKKATETEKLKGQIEKKLDTMVRENKGRIDFLEKFQRLIESYNS
FT                   SSHNLEAFFKELMHFAQNLTQEEQRATRENLSEEELAIFDLLTQPEPELTEKEKNEVKK
FT                   VAKDMLAKLKAEKLVLDWKLKTQTKADVERTIRDFYIRLPGAYTPELKKDKRAKTYAHI
FT                   FENYFGAGQSVYQDIGVAAH"
FT   gene            11908..14043
FT                   /locus_tag="Tmz1t_0007"
FT   CDS_pept        11908..14043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0007"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: acb:A1S_0077 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52810"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB6"
FT                   /inference="similar to AA sequence:KEGG:A1S_0077"
FT                   /protein_id="ACK52810.1"
FT                   /translation="MITTPTQTLLQAYASLVLHDANEAATRLRVIDRVLREILGWLDED
FT                   ISPEEHVTEDGLTTYADYILRTANTAIVVEAKKAGAAFAAHAGNRRVKLSNAFLQSELG
FT                   TAIVQARDYARKLSIDFAVATNGSTWAIFPAQRHDQVKFHESTALVFWSLDDALNESYQ
FT                   EFFDLLSRDSVISGSLETNLLGRTENQVENRKLGSFFSTNARQTLSNPVFPLIENEVMT
FT                   SFSDSIVDLNDESFERCYVATPESIKFDHKIRMHVGRRQQLVSGTVLRPMKSSDAEQLF
FT                   AKIQQSSSASRKPLAILLLGTVGAGKTTFLHYMRKVRLKEVFTQDAARPYPHWLHLDFL
FT                   TNSPNITATDFIYSSLREYINQDPFLQDWDKCIKNAYADEIKALRSGPLAAMSGSQEKV
FT                   NERIADKIFSDYQSIRPYVDRILRYATKHSAFFLAIDNVDQIEDEDIQSKLFTEALAIS
FT                   RSLSLNLVLALRQGTFARHRNSPSIDAFDFEAVQIDPPRIASVLSKRFALVKHLAAGKR
FT                   GDFIAENGARVRVEDISQIVDLLQGSVLGTEIGTRIEVLATDDVRLALRMTREFLERGY
FT                   TNPGKAIEYHRRTGKYVLPRHEAFRAIILGTRTVYTEDFSPIGNPFDSRIGVNQAQMLR
FT                   LYVLSAIVAYASENGFRFIDVAGCLIPYKSGVVKRRCRAGDAGAVNGTRAARVGPRCLG
FT                   WGWSIRTTDRRTAVRPA"
FT   gene            complement(14003..14215)
FT                   /locus_tag="Tmz1t_0008"
FT   CDS_pept        complement(14003..14215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0008"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:p1D1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52811"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB7"
FT                   /inference="similar to AA sequence:KEGG:p1D1"
FT                   /protein_id="ACK52811.1"
FT                   /translation="MNTYHPPSGLLRGLDLLIDADWTPAQARAVIELLDDLRERIWAHY
FT                   ERVLFEHYRQDHLTQAELPFDDPSF"
FT   gene            complement(14212..14970)
FT                   /locus_tag="Tmz1t_0009"
FT   CDS_pept        complement(14212..14970)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0009"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:p1B4 IstB transposition helper
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52812"
FT                   /db_xref="GOA:C4ZIB8"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB8"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACK52812.1"
FT                   /translation="MTTPEPLLARARALQLHGVVSHWDACAQAPWIAPLIEWEETERSR
FT                   RSLERRLRCAHIGRFKPLADFDWRWPEQCDPAAVAELMTLAFLETATNAILVGPSGLGK
FT                   TTIAQNIAHQAVLRGQTVLFTTAGQLLGELAALDSDSALRRRLRHYASPTLLVIDEVGY
FT                   LSYSNRHADLLFELISRRHEKKSTLITTNKSFAEWSEVFPNAACVVALIDRLVHHAEII
FT                   ALKGQSWRHKEAQERAATNARKRKSARSPA"
FT   gene            complement(14957..16447)
FT                   /locus_tag="Tmz1t_0010"
FT   CDS_pept        complement(14957..16447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0010"
FT                   /product="transposase, IS21 family"
FT                   /note="KEGG: cti:pRALTA_0592 transposase, IS21 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52813"
FT                   /db_xref="GOA:C4ZIB9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIB9"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0592"
FT                   /protein_id="ACK52813.1"
FT                   /translation="MALSPEHEAQILRYHHAERWRIGTIAAQLGLHRDTVARVLTQAGL
FT                   PRHGAVQRASAIDPYLPFLHETLAQFPRLTAARLYDMVRARGYPGRPDHFRHLIARHRP
FT                   RPSAEAYLRLRTLPGEQAQVDWGHFGHLTIGRARRPLMAFVMVLSWSRQLYLHFFLDAR
FT                   MENFLRGHVGAFARWGAVPRIALYDNLKSAVLERCGNAIRFHPSLLALAGHYRFEPRPV
FT                   AVARGNEKGRVERAIRYVREAFFAGRPFVDLDDLNAQAQAWCEGAAGERRCPDDPSITV
FT                   TEAFGMERERLLALPEAPFPTDEVRAVSAGKTPYVRFDLNDYSIPHTHVRRTLTVCADP
FT                   LRVRILDGQDVIATHARSYDRRQQIECAAHLEALVAHKHAASAHRATDRLTAAVPACQA
FT                   LLAQAAERGEPLARTTRALTDLLDRYGASELAAAVDEALARGVPHPNAVRMALERRREA
FT                   PPPLGVPLPAHLKTRDVTVRAHSLAGYDRLLEDDHDDA"
FT   gene            complement(17927..19006)
FT                   /locus_tag="Tmz1t_0011"
FT   CDS_pept        complement(17927..19006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0011"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_1488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52814"
FT                   /db_xref="GOA:C4ZIC0"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52814.1"
FT                   /translation="MSDLSDTPQSEGACPLPKRVEFAQWLLRFVDPDRSSDYRDAFWDL
FT                   LRALLTQYQGDGKDGIEPSSLSTQDLWRWALDGRGKPFDDLTSEKARKRVNPHWSALEQ
FT                   SFAELQGRFTDAARKAGFTGLLWPTKDKSEGGRSSTYRLEWRPFGVSTALPTLPADYEK
FT                   QPFVLRYREDRSSLRFSLLGRLFLWPLLFRRHGDASMRIDGVRRYVPAVGLGLMILLAG
FT                   LPVVIVLLQLGKGVLEWGWIAVAAVFFWFPLRPLMRLYDRFIIMASPLFYPFSEKECQV
FT                   ELVRDPEAAVPPGRQRGYNLRLVRYVADCPLCGGNVSLRDGGLGQFNRLVGCCDEEPGE
FT                   HVFSFDRKLRAGHWLRSRW"
FT   gene            19138..19368
FT                   /locus_tag="Tmz1t_0012"
FT   CDS_pept        19138..19368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0012"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52815"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52815.1"
FT                   /translation="MLETLVLHIAGERVTLRWLPSGDLAVYHRPAEHVRALVEPICRNR
FT                   GHWNSEYNNWVVFRQFRAAVVSELEAEADHV"
FT   gene            19361..20134
FT                   /locus_tag="Tmz1t_0013"
FT   CDS_pept        19361..20134
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_5541 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52816"
FT                   /db_xref="InterPro:IPR010330"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC2"
FT                   /inference="similar to AA sequence:KEGG:M446_5541"
FT                   /protein_id="ACK52816.1"
FT                   /translation="MSEGMHHGLDFGLDHTGRMRGIDEVEQGLACNCECPECGSPLVAR
FT                   KGAVRMHHFAHQGESCTTGAETALHRMAKQIVADERRLVEPGRDKPTPFEHATLPDDIP
FT                   WPGLRPDVVLWSETATLHVEVTVTHRCEPKKLDEIIRVGIPTLELDLSLAYRLQRRGWT
FT                   IEQLTDRLVHDPGIRRWLHLPERAMERAQAADVPEPQTPTKTPAPIDRAPTSRIYAPFD
FT                   GTLLVFDSWYGLVPRDPVARAQLIAELQKPRSEEN"
FT   gene            complement(20155..20952)
FT                   /locus_tag="Tmz1t_0014"
FT   CDS_pept        complement(20155..20952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0014"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52817"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52817.1"
FT                   /translation="MARPIDRDPSDPSVPLWLSQGRRTAEIAEEGARAGLSSNAVAEQI
FT                   QVAVQLPAHRAREHERAFRFLMAHYPAYVAEKKVDANFVAVSQLHSLYRLDRAKAAELA
FT                   PGVLSGEIKAAALRGVIDSVLASQGTGDRTRVFESKRRVADFVSDATERLIANPALLGI
FT                   GPVDEVREFRVGPRFAPDLAMRQGQRWIAVEISTASASMPPHQVGRYLGRLAQLEQKYD
FT                   RAILVLPHDRGDIADMVRRFQDEWIGREAEVMLLERSAEQEEA"
FT   gene            21052..21828
FT                   /locus_tag="Tmz1t_0015"
FT   CDS_pept        21052..21828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0015"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bvi:Bcep1808_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52818"
FT                   /db_xref="InterPro:IPR014833"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52818.1"
FT                   /translation="MNTPKRPPTAPKHTVQGARVLGRISGRPAVFYHSRKAGGILALES
FT                   AGERIIAQLAELDPRVKSISPQPFALDVTTGKVFTTRRDLEDARKARVSVNALRRDYTP
FT                   DLLLVLHDGRRIIIEVKDPRHALHPDYRAKLNTAQRIFAMRGEHFLLIPLQYTESAPLV
FT                   HNTELLARALVHPLAPSVIHAVSEQINTLLGGNQMALRDLMPALGLTLREAPALITTGA
FT                   LETDLARVVVNGRTLVRAAHGSLRHLEILPIQEDRP"
FT   gene            21825..23813
FT                   /locus_tag="Tmz1t_0016"
FT   CDS_pept        21825..23813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0016"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0028 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52819"
FT                   /db_xref="GOA:C4ZIC5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52819.1"
FT                   /translation="MSRFMQREERIRTAEGEFIVRSIDPNDKLVELFDPSSGELKKMTI
FT                   PAMRRQISDGSMRRLTVKPMSGTVRDLAQSDSASRQLLFNRFRVQRLESCLHRGDSKAE
FT                   AIRKLIAEPLALDDGTPVPPISERQAYRLIDAASSSPLELMPAHAERGNRLPRHSKDVE
FT                   ELVRHLIEEEYAKVHSRITMRKLSELATTLAREKGLIATSRRISRAYVRDFFIKRYHGD
FT                   IDHKRIDPRIARSKKAVAKERIRVDAALQRVEQDTNSLPFIVMTSEGPLKNPYLTVSID
FT                   CGTGVPLGWHLSKTPVTEEETLDCLERSLYSKAERFSQLSIDCSIDPYGLFANLYLDNG
FT                   PENKGRRITRITEIGIFLTRVAANSGHQKPYIERFFGSLKPALEALPGCTRFDGKDGAR
FT                   TDEAMKDDLLTLDELERWIVRWMYEEWVHRPLERFITADYYDTDEAPGITPATRWAYYE
FT                   QNTSLPPPPDRERWIRMRYLTDERSLSAKTGLSIEGFRYRGEHLRQLIRQYGPDSQVTA
FT                   YYNPSDYRFAYVADRETGELLRLVNDEVNATTPAFSFTEAKLRRAHVRKTAAAVPACVA
FT                   NFQRELAAASLSGGRRKRGHMAEQREVRAAAKLSKAIQKSEANPVPAQPAGDAPTLWTD
FT                   GLLLTDDAIPNYDLETKPRQSNGGTES"
FT   gene            23810..24817
FT                   /locus_tag="Tmz1t_0017"
FT   CDS_pept        23810..24817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0017"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0029 transposition helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52820"
FT                   /db_xref="InterPro:IPR008868"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52820.1"
FT                   /translation="MSVQLELRRALDVTIVPHPAFVTQSERLTQLLQDHKNGLAPGVEV
FT                   IIGPSRIGKSEILQRLASQYPERRENGRLIKPVLFVSIPPGTAPKDLPISVIQALGVPV
FT                   PRERSRAAVLAEMMLQKLKLAQTMAILFDETSHLVEPGSKMQPTHASDWFKALFDKASV
FT                   SIVMAGVPRLTRLFDSNPQFRGRSRRPLELMPYRWDRADERKIFAGCAQAFLKVFVGHA
FT                   CPIQTSMNTDSLMRHLYAVSTGNIGLLSNYFKALAREVRAPGPLDLQALQRASEHVNLP
FT                   AHGLLPPFSRDHMPDELLMQLLMTELATYEIVLPIDSPQTALAAHRHQVSAVPV"
FT   gene            24814..26631
FT                   /locus_tag="Tmz1t_0018"
FT   CDS_pept        24814..26631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0018"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0030 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52821"
FT                   /db_xref="InterPro:IPR009492"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52821.2"
FT                   /translation="MTALIELFPPEPTEGPIEYLRRLSVRNGYSNWRSLVRATGVNPTL
FT                   NALWKNKPTLIDALGLDPAWLDGVMPPSAEGRGLHDPFFRRTATDPVCPQCLAEGDHLH
FT                   HAWSHSLVSACPDHGTALIDTCPSCDQPLSPDRFDLATCDCGYPLHEAISPSASPFERW
FT                   VSARLAGDLRPVDGLPEIGTPEDYSGLGKLLFSLAIRLDPSAKVKAGKTSRPHDLAQTR
FT                   ALIESICPLFEAWPQGFNTHVRDRLVAGNQAVFSPSGRLGAWYMNLHVACRKAKAFAPL
FT                   WTAFSDAMIDHFDGNLRGQQVLTPSPERERRFVPVAEAARLIGVSGPKLGAALKAGIVA
FT                   GHVSKQGTAYTLALMDREEVERIRTERARWITANDAAVAAGVPPSVIAHLAEAGLLKND
FT                   DEWSQDILKSGPIEKASVETLLEHLKSLVEPREVAETLRFGQLIGRRTTDSKGIRKLYQ
FT                   AIHSGEVRATGYTPGCGLDGLTFATEEIRRYLGSVGLTDGMTLTQLEKVTGWKYEALSH
FT                   WAERGLLKTIDVLLQGRSARLVTNAALADFRRVWIPVSDLAQAMGTKSSALTAKITQRG
FT                   IPIHGQLALPSGAKRGGLLQLADLGALIG"
FT   gene            27045..28148
FT                   /locus_tag="Tmz1t_0019"
FT   CDS_pept        27045..28148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0019"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: rpi:Rpic_2926 AAA ATPase central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52822"
FT                   /db_xref="GOA:C4ZIC8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC8"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACK52822.1"
FT                   /translation="MPRTVVDALEREREAQRERADTEQDDPPAPASAEAPPVVPSPTAD
FT                   ADLGHDWHLVFDPEAIRHVADETQHGDRERRPQFKRWVEKMARNGGKRLVQDLPEQLDE
FT                   LVEQFPNFRETVHVIEALAAVHRHLPTQRQSEALLLAGPPGVGKTYFIEAFAAMAHVDF
FT                   GPVSLGSAQGAFELTGTSQHWSNFAPGKVWQLLAEGDHANAVLLLDEIDKAGGDDRYRT
FT                   SSALLDLLESRTARRFVDQALDIEIDASMLWKIATANTIDAIAPPVLSRLHVIAIEPPS
FT                   DNQLRLIYLAQWRELVADLSRPPELSRSVVRQLIASREPPRVTQRLLRIGLGRALHDRR
FT                   RRVSDLPSNRQEPRSQPIGFVRPMSSP"
FT   gene            28291..28683
FT                   /locus_tag="Tmz1t_0020"
FT   CDS_pept        28291..28683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0020"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pna:Pnap_4833 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52823"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIC9"
FT                   /inference="similar to AA sequence:KEGG:Pnap_4833"
FT                   /protein_id="ACK52823.1"
FT                   /translation="MDEDNRNNFRLIVGGVWPIEAVEDLPEVWLADWRVYEIVQSTAEP
FT                   AMRHLVGWAMRAGQGQVSSAIRYIDPVTRRCVTRSGRTYHLHGKPGLSEDARYVWGVWK
FT                   RLNRVDDARDVTDELASLFEAASRQR"
FT   gene            28719..29444
FT                   /locus_tag="Tmz1t_0021"
FT   CDS_pept        28719..29444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0021"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_3053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52824"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52824.1"
FT                   /translation="MNRELDELLCQRYPRIFRDRHAPMTDTCMCWGFACGDGWYALIDT
FT                   LCAEIQRHVETTGIGEVVATQVKEKFGCLRFYVRSGDVHISAMTWFADYLSGFICEECG
FT                   APALRTGSSWIQTRCARHGGENFPLDAPTRAESDEELLCPEWLPANKHAAWARAAAFHL
FT                   PPVRTRGWRHIATALEHTIRNDLRHNELPAVVITNVTESDALRYRWAGGDTRGWLAAMV
FT                   RLAEAYSARSDRQTGAAAY"
FT   gene            29649..30227
FT                   /locus_tag="Tmz1t_0022"
FT   CDS_pept        29649..30227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0022"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bph:Bphy_6762 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52825"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52825.1"
FT                   /translation="MSDRSDNPDDWGNDAFFCGVCDRPFRKELYDVSREIERTIFHGPE
FT                   CMDEVEVADSDGIAAFCSERCREIGIGKVLTEHSIRATYPGIGPVETCSRCSGPVDMAT
FT                   FHLAFGKSILRFPDWDRLPAFVLEHVTLAVVCNRCAPPPVRLIEDQARLPHESARDPQA
FT                   CGHEGSPPPMQQPSHPSEEPLPCEPRPAT"
FT   gene            30340..30570
FT                   /locus_tag="Tmz1t_0023"
FT   CDS_pept        30340..30570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0023"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52826"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52826.1"
FT                   /translation="MSTKVSIQYAVDEASGTTAHLYDECLAPADSAVFLELTGISEVSV
FT                   DVTPNGTTVTIAIARELAAKLGLIPRIKQQE"
FT   gene            30886..31110
FT                   /locus_tag="Tmz1t_0024"
FT   CDS_pept        30886..31110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0024"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_1570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52827"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52827.1"
FT                   /translation="MSKTAPKPPMTQQQRDHRSDQFNPNYGTSGTNPANGKVNGNRGQQ
FT                   LNPNRPAILMFGDREWIDHRHRAQFTRLQ"
FT   gene            31370..32230
FT                   /locus_tag="Tmz1t_0025"
FT   CDS_pept        31370..32230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0025"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpt:Rpal_1135 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52828"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52828.1"
FT                   /translation="MPNFLPLKLPGRTSAYRLSNADLLDIVADATHGMSAKLDLFVGTG
FT                   LGIGSLDSPEYRARMVETAEASTIYSQLQQMRDYAYEGHFPDFLFNFGDTIHDVMAFAY
FT                   AQIRPFDYMNEFYGVPTGGDIERLKILLTKFYARWKLDVPAEIEASWDFVRDFAEQMGL
FT                   SSSRFALVEIALLANMTERSVRNSARSSEPPSRRLMVKRDGHYLYVEREEATRWLAGRR
FT                   GFIPSLLPEGFPDSVFRSAFEKLGIEMNALTAEGDKDDRLRSEDSARTKTPITQHPFDT
FT                   KGDPQ"
FT   gene            32227..32649
FT                   /locus_tag="Tmz1t_0026"
FT   CDS_pept        32227..32649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0026"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52829"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52829.1"
FT                   /translation="MIGRTVMTIDINREAQIIEMLRSIGCGLKPARTQSRSRVRALVVE
FT                   SATLSQPVVIHKDRLNAIRVAVAPAMYRTELEDEHHGVRAARNIRSSLNQFRHSAYCAF
FT                   ANADAMGEPVAKCYEIDWDNGGCLEKLRKLLVGLMH"
FT   gene            33106..34251
FT                   /locus_tag="Tmz1t_0027"
FT   CDS_pept        33106..34251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0027"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA5346 transposase (IS4), fragment"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52830"
FT                   /db_xref="GOA:C4KA79"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:C4KA79"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK52830.1"
FT                   /translation="MDIGKLADMVEVFEGLEDWRNAQQTRHRLSELLTVAVCAVLSGAD
FT                   DFEEISQWGRAKVPWLRGFLRLDYGVASPDTFERVFALLDPKQFEQAFRTWVGGIIPAV
FT                   GKDQVIAIDGKSSRRTTSKAAAAPLHLVSAFAANVGVVLGQTATAEKSNEITAIPELLK
FT                   VLDIEGCIVTIDAMGTQTKIARAIRERGAHYVLCVKDNHPKLLDSIMFADIDPRGPLTP
FT                   SSTHETTSTGHGRIEVRRCTAFDATDRLHKAEAWKDVASFAVVERVRTVGERTSTERVY
FT                   YISSLPADAERIAVAIRSHWEVENRLHWCLDVQFGDDYARGRIGHIAHNLALVRHMALN
FT                   LIRLDKSIKTSIKTKRLLAATSDEFRAALLGFEPPDEDDDD"
FT   gene            34785..36314
FT                   /locus_tag="Tmz1t_0028"
FT   CDS_pept        34785..36314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0028"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   azo:azo1861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52831"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID7"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACK52831.1"
FT                   /translation="MKSALFVDFDNVYSGLRKLDQAIADRFARQPLEWMHWIISKLELP
FT                   DHSPEGARRRVLVRRCYLNPQAYQRFRPSFNLAGFEIIDCPALTSEGKTSTDIHMVLDI
FT                   IDLLQHETHYDEFIVFSADADFTPVLRKLRRWDRRTTVLAIGFPSAAYRASADLLIDQD
FT                   EFVRKALGFKDEDELSTPEPVPPSNSAAPDAKALSAAARLLVEQAVEEASSAVPMAKLA
FT                   AQILDKIDGIDASTWAGYGSFRGLVESWSLGPLRSTTAAGGVIYDPRRHTLPTSTTSVT
FT                   PKVLDKDVGGVVELIRQEVTRSATPVPCSRLASLITSQFGAIAADWNGKGTFRKFIEAL
FT                   ELDPLQFDWSMAGGVVQDPTRTSSMPRNGSASSGWMEYEDILPVATQIHEVSGVPLLRP
FT                   QDYRALFSIIEQDVRSHPFELKETGKRVRDGLREGGFGGSRLDVNWILRGLLMRGHVFG
FT                   NGQDDAAALGMKTANNVRSLCLREQMILDKATETAIARWFGTGQVGAHLRQ"
FT   gene            36617..37216
FT                   /locus_tag="Tmz1t_0029"
FT   CDS_pept        36617..37216
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pzu:PHZ_c1523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52832"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52832.1"
FT                   /translation="MITKRTAIPGVTSASASLSATVNELVREGGGRRTIVVDSRTFILS
FT                   LTPAPPGQSAPSSDDTDRVAALEAELLSVGDQDQRSVLARPDMLDLEAASSLSGIPVRT
FT                   LTHMRRTNRILALARAGAKKGYRFPAFQFEPTVLAAMPSVLAAFGPARAWQAFDFLMHA
FT                   EPMLSGAVPIELLRSGQAADVERVVRAAATLNHGAY"
FT   gene            complement(37399..37731)
FT                   /locus_tag="Tmz1t_0030"
FT   CDS_pept        complement(37399..37731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0030"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mch:Mchl_1871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52833"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZID9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52833.1"
FT                   /translation="MRETVKLHAGSVDAMGKRFVDAWHRVERGEKVEEAHLTLPDLDAM
FT                   LSVLTPRRLDLLRHVHRQPAATVAALARAIKRDYKCVRDDVVALAQAGLIARDKNGLAR
FT                   LSTVCR"
FT   gene            complement(37900..39534)
FT                   /locus_tag="Tmz1t_0031"
FT   CDS_pept        complement(37900..39534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0031"
FT                   /product="TIR protein"
FT                   /note="SMART: TIR protein; KEGG: bra:BRADO2180 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52834"
FT                   /db_xref="GOA:C4ZIE0"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE0"
FT                   /inference="protein motif:SMART:SM00255"
FT                   /protein_id="ACK52834.1"
FT                   /translation="MDIAAKIAPKVFVSYARQDCSTLAEELVTALELLQFEGYLDRSDI
FT                   AAGEDWEHRLDALIRQADTVVFVLSPRSVQSERCAWEVQRALALSKRIIPVVGMAVDDA
FT                   SVPAPLQRLNYIHFTAGHSFARSLGQLADALRLDIGWIREHTRLGELALRWNERQQPDA
FT                   LLLRGDELSAGQAWMANWAPEFPPVTELQRSFIAASADAQTRRESLERQQNEAIAKANA
FT                   ERAEALTRREEALFSLKRRTLLGGVLAVALSLGLGGMAWWSLQLRRRAEEAERTAIDEL
FT                   VRREAMRTDISGQIVAYATSPGQWAMDSGVDGHSPYTGTLLRELQSPDISLWVALSRTT
FT                   TQVAKATNGSQRPFISSDMNGDVFLGHPSPTRRLRALVIGAGRFQMATDLSFEGAYKDA
FT                   DAWGAFLAGRGFSVQTLRDPTRASVLASIEALRVSALDEADASIRRVGIALQPDGTQAQ
FT                   PSLPVPRRTRPDAEPAHDALIVFFYAGYGFRAGAERFLAVSDTAFDTAKTGLVTEPGAT
FT                   AVSVDDLEKVLREAAAASVVILDTNFI"
FT   gene            complement(39923..40747)
FT                   /locus_tag="Tmz1t_0032"
FT   CDS_pept        complement(39923..40747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vha:VIBHAR_02004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52835"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE1"
FT                   /inference="similar to AA sequence:KEGG:VIBHAR_02004"
FT                   /protein_id="ACK52835.1"
FT                   /translation="MTIVSTDAGSQLLAKFLDGQIKRLVESVNAINGSHIPRVARLFSL
FT                   YSAVIEDAISIRILCENARINQAYIVSRALLERLTNFCFLQLCTAPEFSDYVDYSLNKA
FT                   GRSLDRSIEANGKVKARIALNGGDFELPPEISAAIAKFTSERGREKTRWTNVSLPDRAA
FT                   VIEAKLGNTGLFMSLLTIYADASEALHGTLYGAAFHLGAYQASPPHDQASLDQHRHQTL
FT                   SALYLMAGGGIDTLFSLLASLGDSDFKNVALASKNAFKEAAIATGLAASKDK"
FT   gene            complement(40887..42050)
FT                   /locus_tag="Tmz1t_0033"
FT   CDS_pept        complement(40887..42050)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0033"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_0081 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52836"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52836.1"
FT                   /translation="MNEIQKAILSECADRWFKNPAGITASDLGRKFGISNEEACKEVEL
FT                   LCEAGYGKMNRDADFTELSFDLENPQAGFTSNPLRTHVFFPSEQVLADAFYGSKLPRQN
FT                   LPEYVVRLHLGAHQYGLVFFDEEVLSRYFEHPEFYEIEDSLAGGSIATTSEAGEDRHLY
FT                   VRYGKCRLKTGRIAVSAVHKDLANMGASEQRYWHAHEISAPSIDTTDDNFQRFLGRTYE
FT                   GAWVEYPDPIRNLLTEVVGANSDLNPLSLFTRTENVHLRMPVEQTYKSYCDCASELYKV
FT                   VGPDALSQPALKALLQDRFGQTQADFIHPESKRPLSSLQLLGLLESNLGVPDAFNGPLK
FT                   KVAKLRIEADHKILEPQASNRSYSSDFANLCSELKNGIAKIRAALAR"
FT   gene            complement(42129..42494)
FT                   /locus_tag="Tmz1t_0034"
FT   CDS_pept        complement(42129..42494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0034"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bja:bsr2127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52837"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52837.1"
FT                   /translation="MAAEDKEELVQRVLSDHVENVFRQRPSLYMAYLAKLVSVKNDPSF
FT                   ADYFEVAATRDLVVHNNNVVNALYLEKSGTKARGAIGDKLSVDESYYYSALAKLKKVSG
FT                   AIKRDVEKKYGKSDEEV"
FT   gene            42998..43183
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0035"
FT   gene            43738..44010
FT                   /locus_tag="Tmz1t_0036"
FT   CDS_pept        43738..44010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0036"
FT                   /product="transcriptional regulator, CopG family"
FT                   /note="KEGG: rpi:Rpic_4338 transcriptional regulator, CopG
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52838"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE4"
FT                   /inference="similar to AA sequence:KEGG:Rpic_4338"
FT                   /protein_id="ACK52838.1"
FT                   /translation="MTKTSSKTPSAHVPLPLTDKVGQMSQRREHSPSSIMHPAASTRIA
FT                   QEARRDRLTQEALADVDAGLLVDHWAVQAWADNLGTEKAVPLPNG"
FT   gene            complement(44617..45192)
FT                   /locus_tag="Tmz1t_0037"
FT   CDS_pept        complement(44617..45192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0037"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52839"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52839.1"
FT                   /translation="MAKNYYGCIPIMAWLLCHYFYSRDHYVWVAERYYPYRLPNPRSSN
FT                   PHRIYEDLYEPWMDADNFDKYISQTRLSLRNGVESKEKAGAITSGDATRLKKICDKIEV
FT                   AFFCPIVLRLDIDQIDGARLETAGSGASVGSHEFLIRDLHENEFDILFLDVVQDPAVKQ
FT                   LVADEIAGTSRGTAPADAMDLLEQRLLP"
FT   gene            45394..46305
FT                   /locus_tag="Tmz1t_0038"
FT   CDS_pept        45394..46305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0038"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ret:RHE_CH01976 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52840"
FT                   /db_xref="InterPro:IPR019302"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52840.1"
FT                   /translation="MSVTRRIYVSLPADPWLPPNLNALKWGIVDEIAKLGFTPEIFTNP
FT                   RGQSGLASAKAWNPRDADEIARRCVGAAVLGMPRWRFRDGDGQDVLLPTEFNHYEGALT
FT                   RTLGLPTLVLVQRDVLRRVVFDGSFGGYVGQFPADAGVGWLHTDEFLVPFKYWTDQLRE
FT                   RRDIFLGYCSSSASTAAQIKRYLASQNASVLDWQSDFIPGRTIIDQIEEAASRSIAGIF
FT                   LFTKDDDLANPSEAHQSVPRDNVVFEAGYFSGLKGKRNVLIVREAGSKMPADLGGDIYA
FT                   ALMDRNDIAPIERTLAAFIGAI"
FT   gene            46522..46737
FT                   /locus_tag="Tmz1t_0039"
FT   CDS_pept        46522..46737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0039"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52841"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52841.1"
FT                   /translation="MLERTEEVALCTLGEPLGMTGTVLARCQGQAFIWQPQDYEGDLVT
FT                   QIARLTCAADLRGSALETIRRSYVRQ"
FT   gene            complement(47379..47666)
FT                   /locus_tag="Tmz1t_0040"
FT   CDS_pept        complement(47379..47666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0040"
FT                   /product="addiction module antidote protein"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   dvl:Dvul_1443 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52842"
FT                   /db_xref="GOA:C4ZIE8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE8"
FT                   /inference="protein motif:TFAM:TIGR02684"
FT                   /protein_id="ACK52842.1"
FT                   /translation="MVKTASFDAADYLNDEQTIAEYLTAALEDPNPDVFLAAVRDVARA
FT                   RGMAQLAKDAGLGRESLYKALTPGAKPRYDTVLKLLHALGVKITATPVHS"
FT   gene            complement(47670..47987)
FT                   /locus_tag="Tmz1t_0041"
FT   CDS_pept        complement(47670..47987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0041"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: dvl:Dvul_1444
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52843"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIE9"
FT                   /inference="protein motif:TFAM:TIGR02683"
FT                   /protein_id="ACK52843.1"
FT                   /translation="MDTHAGMNTFLRTDDFDAWLAGLKDNVARARIVHRIRSAEHGNLG
FT                   DCEPVGEGVSEMRIHVGPGYRAYYTRRGAVIYLLLPGGEKSSHKRDIKRAIEMARALDK
FT                   E"
FT   gene            48124..48735
FT                   /locus_tag="Tmz1t_0042"
FT   CDS_pept        48124..48735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0042"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52844"
FT                   /db_xref="GOA:C4ZIF0"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52844.1"
FT                   /translation="MKQFIRDNPTIAFGLGLPLLLVAVFLAISGIPVLLVAPAQYEVLY
FT                   ATHYNFHNNPHNAIRIAVVGDRVQVSYVGNTQPYQTPRLWRFNPKTGAVKEIALPLPPG
FT                   LAPNSGRPVEAEKTPSVTPIDVPDLAGLRVDSSSLAPDGYRFSSGADGYGGKVFDGLFL
FT                   GSSRYRVHAELVKDGRSIRLPETEGAYYGNAVRFVGWVLP"
FT   gene            48732..49922
FT                   /locus_tag="Tmz1t_0043"
FT   CDS_pept        48732..49922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0043"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ppu:PP_4936 O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52845"
FT                   /db_xref="GOA:C4ZIF1"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52845.1"
FT                   /translation="MTWLLLLIVLIVLAGGWWGWPLAAALFGSRAVHDKTSALGRIAEL
FT                   MRAHDISPAEVAAVYRDPTLLATTAPKRSSGEIARTLFIYLGAIFILAGIGTYIGMFWN
FT                   RMGSVMRIVVTLGVGYALLVVLVSALHERKFPRLVLPLTLATAFMLTNGWFVFIHELFP
FT                   RGNDWRLAALAVFGTMAIHQGLLFRQYASSVLAFTALCFVYGFLAVGLDLLDVPAGFSA
FT                   LVLGASLLLVASGLEGSPQRSLAEFAYLIALCWFNAGLFDRVAIAAAADWAALLTGASV
FT                   MSAAYGLHKDGRQLRLSGLGYLIGSALAYSGLFDLLRQTPVELLYFAVTAAMLYVCVLL
FT                   QSRALLLTTVLAMLGFISHFTARHFVDSLGWPISLVLMGVAFIGVGALAMRIKRQM"
FT   gene            50038..50280
FT                   /locus_tag="Tmz1t_0044"
FT   CDS_pept        50038..50280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0044"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; PFAM:
FT                   protein of unknown function DUF172; KEGG: lch:Lcho_2964
FT                   prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52846"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF2"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACK52846.1"
FT                   /translation="MTTLTASEARANLYRLIDQAAESHQPIHIAGKRTSAVLLSAEDWQ
FT                   AIQETLHLLSIPGMRESIKEGMAEPLDESARELDW"
FT   gene            50277..50540
FT                   /locus_tag="Tmz1t_0045"
FT   CDS_pept        50277..50540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0045"
FT                   /product="addiction module toxin, Txe/YoeB family"
FT                   /note="TIGRFAM: addiction module toxin, Txe/YoeB family;
FT                   PFAM: Addiction module toxin Txe/YoeB; KEGG: afr:AFE_0870
FT                   addiction module toxin, Txe/YoeB family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52847"
FT                   /db_xref="GOA:C4ZIF3"
FT                   /db_xref="InterPro:IPR009614"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF3"
FT                   /inference="protein motif:TFAM:TIGR02116"
FT                   /protein_id="ACK52847.1"
FT                   /translation="MSWQLVFSKYARKDAKKLAVAGLKSKAKDLLAILAKDPFQKPPPY
FT                   EKLVGDLAGAYSRRINIQHRLVYEVFAEERVVRVLRMWSHYE"
FT   gene            50666..50893
FT                   /locus_tag="Tmz1t_0046"
FT   CDS_pept        50666..50893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0046"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gur:Gura_3815 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52848"
FT                   /db_xref="InterPro:IPR018739"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF4"
FT                   /inference="similar to AA sequence:KEGG:Gura_3815"
FT                   /protein_id="ACK52848.1"
FT                   /translation="MNLAEAIYRHSQRLPDEAAREALDFIEFLEQRYGVKPAETTATPR
FT                   EFREPGSARGKLEIVADDDDHLVDFKDYMP"
FT   gene            50890..51276
FT                   /locus_tag="Tmz1t_0047"
FT   CDS_pept        50890..51276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0047"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   sus:Acid_2753 PilT domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52849"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041705"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF5"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACK52849.1"
FT                   /translation="MKALLDTHTLLWFLLDDPALSGTARELIRSPETEVFVSPASYWEI
FT                   AIKISIGKYRLPEPLAAFMDRELSRNRFDILPISVRHADRVARLPFHHRDPFDRLIVAQ
FT                   ALEDAMPLLSADQVMDRYGAQRVW"
FT   gene            51312..52766
FT                   /locus_tag="Tmz1t_0048"
FT   CDS_pept        51312..52766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_0017 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52850"
FT                   /db_xref="InterPro:IPR021804"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF6"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0017"
FT                   /protein_id="ACK52850.1"
FT                   /translation="MPLDFTTLDTLRSHHPAWRLLRSDHAALVASFLHRVFVAPNVRGM
FT                   AAADLAEALEDELYALRLLRGDDAFPKPALDYLNDWAAADKGWLRKYYRPGTDEAQFDL
FT                   TPATEKALAWLAQLSERQFVGTESRLLTLFALLKQMGEGSETDPARRIAELQRKRDEID
FT                   AEMARVLAGDIPLLDDTALKDRFQQFMQGARELLADFREVEHNFRQLDRRVRERIALWE
FT                   GSKGALLEQIMGERDAIADSDQGRSFRAFWDFLLSSRRQEELSDLLDQVLALPAVAELN
FT                   PDARTRRVHYDWLEAGEHTQRTVAQLSQQLRRFLDDQAWLENRRIMDLLHGIESKALAL
FT                   RAAPPPGPVMEIALPGAAIELALERPLHTPPTRPAIAALRVEAGDEDVDPHALFEQVTV
FT                   DKARLARHIRHALQDRAQVTLAALVAAQPLEQGLAELIAYLQLGSDAFTTTVDEATPEP
FT                   IEWQASAADGAMVTRKARLPRVIFMR"
FT   gene            52918..53601
FT                   /locus_tag="Tmz1t_0049"
FT   CDS_pept        52918..53601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0049"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lch:Lcho_0223 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52851"
FT                   /db_xref="InterPro:IPR025449"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF7"
FT                   /inference="similar to AA sequence:KEGG:Lcho_0223"
FT                   /protein_id="ACK52851.1"
FT                   /translation="MKHSMDDEDLAPSPAEPPGPAAAPDLSVLLIGLLKGVLYREADER
FT                   QWSGLLQLQARVREYVAVLALELVLDEAEGYAFLRGRPEPADDDPAPRLPRLVARRPLS
FT                   YPVSLLLALLRKKLAEFDAGGGDTRLVLGRDDIVELVRVFLPEGPNEARLIDQIETHIN
FT                   KVVELGFLARLKPASASATAPASFEVRRILKAFVDAQWLADFDARLAAYRAALADGKET
FT                   PSDEP"
FT   gene            53768..53860
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0050"
FT   gene            54144..57566
FT                   /locus_tag="Tmz1t_0051"
FT   CDS_pept        54144..57566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0051"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: bpy:Bphyt_0015 conserved hypothetical
FT                   cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52852"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF8"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0015"
FT                   /protein_id="ACK52852.1"
FT                   /translation="MNDPQSLGLDFVADDTLSGFRLQRLEVLNWGTFDRHVWTLQLDGR
FT                   NGLLTGDIGSGKSTLVDAITTLLVPAQRIAYNKAAGADTRERSLRSYVLGHYKSERNEV
FT                   TGAARPIGLREPGSYSVILGVFHNAGYDQTVSLAQVFWFKEAQGQPARFYLGAEHALSI
FT                   TDDFSGFGPDITQLRKRLRGAGAEVLDSFPPYAAWFRRRFGIDNEQALELFHQTVSMKS
FT                   VGNLTDFVRNHMLEPFEVGPRIQALIDHFDDLDRAHQAVLKAQRQVSLLGPLVDDCHRH
FT                   DALAADISALRRCREALQPHFAARKLALLDHRLELAAEEWARADAQVMRLDTLREEQAG
FT                   RIDALKQAINANGGDRLERLAAEIRKQEQVRDARLAKARRYGELAAVLGASAAADAEAF
FT                   ASQRLHFAASREEARNRDAELQNTLTEHAVTLRQGKLEYDALSAEIDSLKRRRSNIDDR
FT                   QIQIRAALCGALGIDVEDMPFAGELLQVREDERDWEGAAERLLRGFGLALLVPDAHYKA
FT                   VAEWVDGNHLRGRLVYFHVRPPRAGELPALHPDSLVRKLAIKPDSPHYDWLERELAHRF
FT                   DVACCATQEQFRRETRAITRAGQIKDPSGRHEKDDRHAIADRSRYVLGWSNTAKIEALE
FT                   AQRRQLEARLGEVGSQIGRIEAERRTLAGRLDALTRLEEFTAFDELDWHGVAGAIATLE
FT                   DERRALEAASDLLKTLNQQLADLQRIRVDTERELGAARERRAKVEQRQADAEALRTATL
FT                   ALVDAAPIDPELVPRLEALCAEVLGEHPLTVESCDNREQEVRTALQSRIDAEDLRLKRL
FT                   AEKIIKAMAAFKQQFPLETAEIDASLEAGFEYEKLLAQLDRDDLPRFLARFKELLNVNT
FT                   INEIANFNAQLARERETIKERIAHINKSLGEIDYNPGRYIVLESQASPDAEIRDFQQEL
FT                   RACTEGALTGAGEGDDEQYSEARFLRVKGIIDRFRGREGLSDQDRRWTAKVTDVRNWFL
FT                   FAASERWREDDSEHEHYSDSGGKSGGQKEKLAYTILAASLAYQFGLEWGAVRSRSFRFV
FT                   VIDEAFGRGSDESAQYGLRLFEQLNLQLLIVTPLQKIHIIEPFVASVGFVHNEGGSASK
FT                   LRNLSIEEYRAQKAEMRAAAQAAPRAGGGASAS"
FT   gene            57563..58888
FT                   /locus_tag="Tmz1t_0052"
FT   CDS_pept        57563..58888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0052"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: bpy:Bphyt_0014 conserved hypothetical
FT                   cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52853"
FT                   /db_xref="InterPro:IPR024534"
FT                   /db_xref="InterPro:IPR024537"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIF9"
FT                   /inference="similar to AA sequence:KEGG:Bphyt_0014"
FT                   /protein_id="ACK52853.1"
FT                   /translation="MSWSTAQDLRAQVMRLWERGELLREGLPQDSGAPPCACLPEEESE
FT                   GSGAQPCELPADAAAYTAVGPPAGHSRFPLRLTLKTPTSDDITRHFDAVRAWVAAISAT
FT                   PHVRLEWQETRHRVQGSQRLPASAWVDRLDDALAWIGKRAEDARFRALHAETAARQPLL
FT                   LPWLHKRPLRALELAAEWSRLLDVVAWLQAHPRPGMYLRQVDLPGIHTKFIESQRGVLA
FT                   ELLDLALPAAAIDPSRTGAQQFAARYGFLDKPVLLRLRILDPALGLLPGAPCPDLALDA
FT                   DSFARLRLDVARVFITENETNFLAFPRVDKAIVIFGAGYGWEALARAEWLQRCPIHYWG
FT                   DIDTNGFAILAQLRARFAHVESLLMDRATLLAHEALWGREDSPRPADVSRLSAEERGLY
FT                   EDLRNHHIRPSLRLEQEHIGFGWLEKALRIVHAVDDFQPSDG"
FT   gene            59258..60451
FT                   /locus_tag="Tmz1t_0053"
FT   CDS_pept        59258..60451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0053"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: xom:XOO_0502
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52854"
FT                   /db_xref="GOA:C4ZIG0"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG0"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ACK52854.1"
FT                   /translation="MKIESIRLKNFKAFRNVHLKDIPSFLVVVGANGSGKSTLFDVFGF
FT                   LHDCLKGNVRQALDKRGRFGEVLSRGCDPKKDTILIELQYRMEITDVERLVTYSLEIGE
FT                   RQGLPVVCKELLRYKRGRYGSPYHFLSFAEGEGYAITNEEDFNKTDEELDRETQRVAPD
FT                   TLAIKGLGQFERFKAANAFRSLIENWHVSDFHISAARGRKDASGEMEHLSETGENLPLV
FT                   ARYLHEQHAEIFSRILATMTKRVPGVTSVEPKLMDDGYLTLRFQDGSFKTPFLDRYVSD
FT                   GTIKMFAYLVLLHDPKPHPLLCVEEPENQLYPQLMPELAEEFRSYANRGGQVFVSTHSP
FT                   DFLNAIELDEVYWLVKQQGYSEIHRARDHAQIAAYVAEGDQLGYLWKQGFFDGVDPR"
FT   gene            60448..61029
FT                   /locus_tag="Tmz1t_0054"
FT   CDS_pept        60448..61029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0054"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xom:XOO_0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52855"
FT                   /db_xref="InterPro:IPR025455"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG1"
FT                   /inference="similar to AA sequence:KEGG:XOO_0501"
FT                   /protein_id="ACK52855.1"
FT                   /translation="MRELVFLLEEPSAKAMLESLLPRMLKEDTRFRCIPFEGKQDLEKQ
FT                   LTRRIRAYQNERARFIVLRDQDSHPDCTAVKQGLLDLCDKSGKFARCLVRIACRELEAF
FT                   YLADLQAVERALEIDGLTRHQNSRKFRSPDGLGSPSRELKTLTRNRYEKVAGSRAIGKH
FT                   LQLDNARSASFRNLIAAIRRCEDELLREAV"
FT   gene            61128..61211
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0055"
FT   gene            61359..62705
FT                   /locus_tag="Tmz1t_0056"
FT   CDS_pept        61359..62705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0056"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   azo:azo1861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52856"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG2"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACK52856.1"
FT                   /translation="MKSALFVDFDNVYSGLRKLDPAIADRFARQPLEWVNWVIGELELP
FT                   DHAPAGARRRLLVRRCYLNPQAYQRFRPSFNLAGFEIIDCPALTSEGKTSTDIHMVLDI
FT                   IDLLQHEARYDEFIVFSADADFTPVLRKLRRWDRRTTVLAIGFPSAAYRASADLLIDPD
FT                   EFVRNALGFKDEDDAPGAGAPPADVAPESLSLAASARFAQASPEAARSVPPASFSSGAD
FT                   ALDHDLAEIVETMRAEVARSAAPVPCSRLASLITTRHPALAADWNGKGSFRRFVDSLEL
FT                   APLRFDWSNSGGFVFDPARSGAGMQDGSVTPDWGEDQDILPLAMQIHEVSGVPLLGPAE
FT                   YRALFSIIADDVGRHPFDLKETGKRVRDRLREAGLGGSRLDVNWILRGLLMRGHAFGEG
FT                   QDRAATLATKTANNVRSLCLREQMILDRAAETAIARWFGTHPAPTRSGQ"
FT   gene            62797..63351
FT                   /locus_tag="Tmz1t_0057"
FT   CDS_pept        62797..63351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0057"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bte:BTH_II1321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52857"
FT                   /db_xref="InterPro:IPR021212"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG3"
FT                   /inference="similar to AA sequence:KEGG:BTH_II1321"
FT                   /protein_id="ACK52857.1"
FT                   /translation="MASRNPSFFRRIGLAFSVLFGAELAGRLVRLREEGADTEAAAGTE
FT                   DAAAAAQPAIVRETTPEAALQLLGLLQRDARFIDFVQENIAAYSDADIGAAARVVHEGC
FT                   RKVLDEHFAITPVRDEAEGSRLTLPEGFDAAAVRLTGKVVGKPPFTGTLGHRGWRVTDT
FT                   RLPALAEGHDASVIAQAEVEL"
FT   gene            63348..65195
FT                   /locus_tag="Tmz1t_0058"
FT   CDS_pept        63348..65195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0058"
FT                   /product="DnaK-related protein"
FT                   /note="KEGG: eba:ebA1980 DnaK-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52858"
FT                   /db_xref="GOA:C4ZIG4"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG4"
FT                   /inference="similar to AA sequence:KEGG:ebA1980"
FT                   /protein_id="ACK52858.1"
FT                   /translation="MSAPARYTLGIDLGTTHCALSYVDLEASDGDQAAQQVLEIPQLTG
FT                   PGSIEARPLLPSFLYLPHADELAPGDLSLPWGATQDHAVGEFARSRGAATPIRLVASAK
FT                   SWLCHPGVDRRADILPAEAPPEVARISPLTASVRYLSHLRAAWNAAHPEAPFDAQDVTV
FT                   TIPASFDPAARELTAEAAQAAGYPPITLLEEPQAALYSWIQRSAGQWRKEVKTGDLILV
FT                   VDVGGGTTDLSLIAVLEREGNLELHRVAVGEHILLGGDNMDLALAYTVTRKLAEQGTRL
FT                   DPWQTRALAHACRGAKEALLSDSDLDSVPVVVPSRGSKLIGGSIRTEVRREELVATLVE
FT                   GFFPRVAVTEMPITRARAALTQLGLPYAQDAAVTRHLAAFLTRQLGATADLEGFAAQPE
FT                   ESVFLHPTAVLFNGGVLKSGLIAGRVLDTLNDWLAADGAAPARLLGGADLDLAVARGAA
FT                   YYGYVRRGRGVRIRGGTARAYYVGIESSMPAIPGMEPPLEALCVAPFGMEEGSEAALPA
FT                   QEFGLVVGEPVRFRFFGSSVRRQDEVGTLLDFWQPDELQELEEIEATLPAEGRRPGEVV
FT                   RVKLHARVTETGTLELEALPVDGSARWKVQFDVRGTAEA"
FT   gene            65206..68034
FT                   /locus_tag="Tmz1t_0059"
FT   CDS_pept        65206..68034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0059"
FT                   /product="DnaK-related protein"
FT                   /note="KEGG: eba:ebA1979 DnaK-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52859"
FT                   /db_xref="GOA:C4ZIG5"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR021030"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG5"
FT                   /inference="similar to AA sequence:KEGG:ebA1979"
FT                   /protein_id="ACK52859.1"
FT                   /translation="MATRYTVGIDLGTSNTVVAFAAEGEDRIQVLEIEQLVGRGELAAR
FT                   TLLPSVRYHPAAGELDPATLRLVASAGEGQGAPPAVLGEAVVGQYARELGAQVPGRAVA
FT                   SAKSWLSHAGVDRNAAILPWGAAEDVPRVSPVVASASYLAHVRAAWNRQHPGAALENQD
FT                   IVLTVPASFDEGARALTLEAARLAGLPRLRLLEEPQAAFHDWLFRHREQLAAELAQSRL
FT                   LLVCDVGGGTTDLTLIQVEPAADGLSPPRLTRIGVGDHLMLGGDNMDLALAHLVEKRLL
FT                   AGGERLSAAQLAQLVQRCRAAKEQLLAADAPEELKVTLLGAGSRLIGAARSTALRRDEV
FT                   LRLVVDGFLPLVGADEAPARRRAAIVEFGLPYPADPAISRHLAAFLRRHGQVSRAALGM
FT                   PGPGAGRDADGDADEAAAPLAIPDTLLLNGGVFRADAISARLEGLLAHWRGAPPRVLHN
FT                   DAPDLAVARGAVAFALVRAARSGLGIGGGSARSYFLVLEAGGEAARAICVLPRGTESGT
FT                   EVALPERRFALRLGQPVRFHLVSSTGDRAWQAGELVELDADDFIHLPPLAARLPATAAG
FT                   RRENVAVRLVACLTEVGTLEMQCVAIDDDTQRWQLAFQVRAEADTPATEAAAGAHPRLA
FT                   QAIALIDEVFGGQARELDAKAVRQLRARLERVLGRRDDWDMALLRALFDALLERARRRR
FT                   RSAEHERVWLNLAGYCLRPGLGAALDDWRIDQLWALFGQGLQYVREGNNWSEWWTLWRR
FT                   CAGGLDEARQLQVLEVLAEHLEDTDAARRRGDPVQGSYDDMVRLAAALERVPAMHRIEV
FT                   GKWLLERLARPAEKAHTWWALGRVGARESLYGSAHTVVPPETAAEWLQAVLALDWKVVE
FT                   PAAFAAAQLARLTGDRARDLAPELRDEVARRLAALRAPQSWITMVREVVSLDDADRRRS
FT                   FGEALPPGLRLL"
FT   gene            complement(68098..68412)
FT                   /locus_tag="Tmz1t_0060"
FT   CDS_pept        complement(68098..68412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0060"
FT                   /product="Putative mono-oxygenase ydhR"
FT                   /note="PFAM: Putative mono-oxygenase ydhR; KEGG:
FT                   ypp:YPDSF_0414 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52860"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR014910"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG6"
FT                   /inference="protein motif:PFAM:PF08803"
FT                   /protein_id="ACK52860.1"
FT                   /translation="MPILLQVDFPYAGPWGEDMAQAMRGLAESIAQEPGLLWKIWTENR
FT                   DSGEAGGIYLFTDRADAERYLAMHRARLLGFGVPEVHAKLFEVNAPLSAIDRAPLAGLQ
FT                   "
FT   gene            68722..69600
FT                   /locus_tag="Tmz1t_0061"
FT   CDS_pept        68722..69600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0061"
FT                   /product="methylated-DNA/protein-cysteine
FT                   methyltransferase"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: lhk:LHK_00147
FT                   methylated-DNA--protein-cysteine methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52861"
FT                   /db_xref="GOA:C4ZIG7"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG7"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACK52861.1"
FT                   /translation="MSTDSAALHYDTIARAIAFVRARPRHTPPSGAVAEALGLDLGQWQ
FT                   QVLAEWAGITPERFLHCLGRAYARERLSPTPERLPERDAGDPAPSDLARAVPLTWEPMP
FT                   PASGRTVALGHGLAATPFGDALLAWTTRGVCHLAFRCRDEAALLVELRSLWSAAAPVRD
FT                   DAHAHRLAQRIFPSRAPSTPVAAATGASGPAEAANPAPGGVHLILRGTPFQVRVWSALM
FT                   RIPPGRLMSYRQLATLLGMPAAPRSVGSAIAANTLGYLVPCHRLIRADGDAGEFRWGRE
FT                   RKLAMLAWEAT"
FT   gene            69597..70118
FT                   /locus_tag="Tmz1t_0062"
FT   CDS_pept        69597..70118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0062"
FT                   /product="protein of unknown function DUF45"
FT                   /note="PFAM: protein of unknown function DUF45; KEGG:
FT                   azo:azo0661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52862"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG8"
FT                   /inference="protein motif:PFAM:PF01863"
FT                   /protein_id="ACK52862.1"
FT                   /translation="MNTRRSPDYLAGYPPALVHQVRTLIEQGGLADALRRRYPQGHAVR
FT                   SDSALHDYVQALKAAHLRSAPPLTKVRFDNTLHVIRNALGTHTAISRVQGSRLQAKREI
FT                   RIATLFRAAPEAFLRMIVVHELAHLRVREHDKAFYQLCLHMEPDYHQYEFDLRTYLSYR
FT                   DAGGEALWGA"
FT   gene            complement(70449..72623)
FT                   /locus_tag="Tmz1t_0063"
FT   CDS_pept        complement(70449..72623)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0063"
FT                   /product="catalase/peroxidase HPI"
FT                   /note="TIGRFAM: catalase/peroxidase HPI; PFAM: Haem
FT                   peroxidase; KEGG: vch:VC1560 catalase/peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52863"
FT                   /db_xref="GOA:C4ZIG9"
FT                   /db_xref="InterPro:IPR000763"
FT                   /db_xref="InterPro:IPR002016"
FT                   /db_xref="InterPro:IPR010255"
FT                   /db_xref="InterPro:IPR019794"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIG9"
FT                   /inference="protein motif:TFAM:TIGR00198"
FT                   /protein_id="ACK52863.1"
FT                   /translation="MSENSTNTAGKCPVMHGGNTAAKDAVMAWWPKALNLDILHQHDRK
FT                   TNPLGPGFDYREELKKLDVDALKNDLKALMTDSQEWWPADWGHYGGLMIRMAWHAAGTY
FT                   RIADGRGGGGTGNQRFAPLNSWPDNGNLDKARRLLWPIKKKYGNKISWADLIILAGNMA
FT                   YESMGFKTFGFAFGREDIWHPEKDIYWGSEKEWLAPSGSEGSRYSGQRDLENPLAAVMM
FT                   GLIYVNPEGVDGKPDPIKTAHDMRVTFARMAMNDEETVALTAGGHTVGKAHGNGSAAVL
FT                   GPAPEAADLEEQGFGWMNHTTRGIGRDTVTSGIEGAWTSHPTKWDNGYFDMLFKHDWWL
FT                   QKSPAGAWQWEPVNIAEEDMPVDVEDPSIRRKPMMTDADMALRFDPAYRKIAERFRNDQ
FT                   AYFEDVFARAWFKLTHRDMGPKARYLGPDVPAEDLIWQDPVPAGNKTYDVAAVKARIAA
FT                   AGLSVGDMVATAWDSARTFRGSDYRGGANGARIRLAPQKDWEGNEPARLARVLAAYEKI
FT                   AAETGASIADVIVLGGNVGLEQAIKAVGFNVEVPFAPGRGDASQAQTDVESFEVLEPVH
FT                   DGFRNWQKKDYVVQPEEMLLDRAQLLGLTAPEMTVLVGGLRVLGTNHGGSGHGVFTDRV
FT                   GALTNDFFVNLTDMSYSWKPTGRNSYDIVERKSGAKKWTATRVDLVFGSNSILRAYAEV
FT                   YAQDDNQEKFVRDFVAAWTKVMNADRFDLR"
FT   gene            73151..74407
FT                   /locus_tag="Tmz1t_0064"
FT   CDS_pept        73151..74407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0064"
FT                   /product="outer membrane porin"
FT                   /note="PFAM: outer membrane porin; KEGG: pae:PA2760 outer
FT                   membrane protein precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52864"
FT                   /db_xref="GOA:C4ZIH0"
FT                   /db_xref="InterPro:IPR005318"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH0"
FT                   /inference="protein motif:PFAM:PF03573"
FT                   /protein_id="ACK52864.1"
FT                   /translation="MSKKLAGLIVLGLASATPAFAAGQAEAKGLVEDSSLNVLLRNAFI
FT                   NRDYKGGRHDSGEWGQGAIANFESGFTQGTVGFGVDAFAAYAVRLDGSRDRAGNWGIDF
FT                   FKQDSTGMPEKDVAKGGASLKLRFSNTVLAYGDLRPNLPVLSHDNSRLLPESYTGTMLT
FT                   STEIEGLEFNAGTFHAQSRKSDEGRDSGGLKGIDVIGASYKFNDAFSGAFYVSDVEDVL
FT                   KRQYLNLNYVLPIASNSLTFDFNGYRTKQDADFQPGKSRIWSLASTYATGPHAFTLAYQ
FT                   RNNGDIDYNYGFYQSEGWIGDGGGSIWLANSYWSDFNAADEQSWQVAYSVDFAEYGIPG
FT                   LSYRIAYVRGHDIDVGTTTDGKEHELFNQLSYKVQSGAAKDLNVRLRASTLRVSESARA
FT                   YNSSGNEVRIFLDYPFSVF"
FT   gene            complement(74514..75311)
FT                   /locus_tag="Tmz1t_0065"
FT   CDS_pept        complement(74514..75311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0065"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="PFAM: protein of unknown function DUF1555; KEGG:
FT                   rfr:Rfer_0835 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52865"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH1"
FT                   /inference="protein motif:PFAM:PF07589"
FT                   /protein_id="ACK52865.1"
FT                   /translation="MKTRTRTSCKAGVLALALALSAGGASAAQIYWTDWTGSDLDPGVG
FT                   FKGVGTITTSNSTVSVTYTNPQGISFYETGGGTYYYSNGTDGPTGTSPFTSTAVDNRPA
FT                   TTDIVALNRAGLQTLSFSQAIANPVFAYVSLNGNGYGFDQDFDILSFGDSSDGNACGYW
FT                   GCGTSYKQMVTVNGKTEYQLLGTGEPHGTLQFKGTFDTVNWRSLSDENWNGFTVGVQGT
FT                   AVEFCDANPTAPGCTPNGVPEPASLALLGLGLAGLGVARRRRA"
FT   gene            75538..76191
FT                   /locus_tag="Tmz1t_0066"
FT   CDS_pept        75538..76191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0066"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; KEGG: azo:azo0013
FT                   pseudouridine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52866"
FT                   /db_xref="GOA:C4ZIH2"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH2"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACK52866.1"
FT                   /translation="MRPEIHPSIPALHVDECLLVVDKPAGLLSVPAGGEGRQDCLAARI
FT                   QARWADARIVHRLDAATSGLVLFARGAEMLRRMSLAFEQRIVGKQYVAVVHGHLAQDDG
FT                   EIDLPLAEDADNRPRQIVDALRGRRALTRYRVLDRQGAGADACSRLELKPVTGRAHQLR
FT                   VHLLCLGHPIFGDPLYAPPESAARFGRMHLHAARIAFMHPHTRVPMVFDSPAPF"
FT   gene            76254..77348
FT                   /locus_tag="Tmz1t_0067"
FT   CDS_pept        76254..77348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52867"
FT                   /db_xref="GOA:C4ZIH3"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH3"
FT                   /inference="similar to AA sequence:KEGG:Daro_1033"
FT                   /protein_id="ACK52867.1"
FT                   /translation="MTTRSPLQRVADLLRAEWHHLTAFTPSTRRWQLAFAAALASGLPL
FT                   MVGAWFGHLEYGLISSIGGLALLYLPNTPMSHRMVWLMACAFGMAASYALGLMTHFLPL
FT                   AKVGVLALIAMLVTMVCRFYRVGPPGSLFFVMAAAIGAYTPGTVEEIPLRVGLFTMGAL
FT                   LASLIAFVYSLQVLRLQPADAVPPLQPPTFDFVVFDSVVIGAFVGLALAIAQALQLDRP
FT                   YWVPVSCLAVIQGVSLRAVWNRQLQRVLGTAIGMLFAWWLLSLPLDAWRIALLVILLVF
FT                   VIESLVVRHYGLAVIFITPLTILLAEAATLGHAPLAELIASRFTDTLLGCVVGLVGGIC
FT                   LHSARFRTLFGNPMRRLIPRQPPS"
FT   gene            77383..78339
FT                   /locus_tag="Tmz1t_0068"
FT   CDS_pept        77383..78339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0068"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: dac:Daci_5134 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52868"
FT                   /db_xref="GOA:C4ZIH4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK52868.1"
FT                   /translation="MKINQLRYFLAVADKGSVRAAATALGVSAAAVSQALRELETAMGT
FT                   PLFTRESHGAVLSYAGRQFLIHARLILGQVSRAEAEIAQIRGATGGSLTIGVTPWVAQS
FT                   ILPHALARFHALRPDVHLDVTEAVGTVHPLLRDGTLDLVIAIPPPRQEASIFYTRELFR
FT                   CDLAVVGRLGHPFASATSLEELVDQDWVLTMLGAGQDEPLVNLLAPHGIAPPPHRVHYA
FT                   RSALVAISMLEVGNMLTICPWPLLETPLLRGRVQALPIRNPLPEMHTAIIVRRNDTLSA
FT                   AGQLFIDCFEDATRTCVATDDPALKRIMNSVERAPDA"
FT   gene            complement(78462..78731)
FT                   /locus_tag="Tmz1t_0069"
FT   CDS_pept        complement(78462..78731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0545 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52869"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH5"
FT                   /inference="similar to AA sequence:KEGG:Daro_0545"
FT                   /protein_id="ACK52869.1"
FT                   /translation="MQAPKILPWVARKAGISEGDALDAWRRALVDAAAYVGVRSGATFD
FT                   RVAVDRFVALAHARASVLSARAARPAPSVTRRWPPGAVAQRCAA"
FT   gene            78974..79990
FT                   /locus_tag="Tmz1t_0070"
FT   CDS_pept        78974..79990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cvi:CV_0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52870"
FT                   /db_xref="GOA:C4ZIH6"
FT                   /db_xref="InterPro:IPR019614"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH6"
FT                   /inference="similar to AA sequence:KEGG:CV_0361"
FT                   /protein_id="ACK52870.1"
FT                   /translation="MSSTLTDLLAAALAARAPLIAQLAAEDTDAWRLFHGTVEGAPGLT
FT                   VDRYGSVLLAQTFHRPLSAEQLAELEAFYAAALPGLALVWNDRSGKNSRVANPLPPEQQ
FT                   ALAEQPSEFSELGVRYRFQARHGGQDPWLFLDLRAARRRVMQEAAGKSLLNVFAYTCGV
FT                   GIAAAKAGARHVVNVDFAESALAVGKDNARLNELPIRVRFIKSDAFAALRQYAGIGQPK
FT                   MVRGKHLPPFPELAPHRFDLVFLDPPRYAKSPFGVVDLVHDYAALFKPALLATEEGGTL
FT                   ICCNNVARVDREDWLEQLERSARKAGRAVREAEWISPEADFPSRDDNPPLKVVLLRV"
FT   gene            80047..80391
FT                   /locus_tag="Tmz1t_0071"
FT   CDS_pept        80047..80391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0071"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_0587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52871"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH7"
FT                   /inference="similar to AA sequence:KEGG:Daro_0587"
FT                   /protein_id="ACK52871.1"
FT                   /translation="MAGFENYQEATRKIEDEIEHMGVALGIDWSDEAQVRALAREALDH
FT                   SQDRIREAAASPDDHELGAKVTLFGLASLMLRTMEESAGVGIESHGGPVWKAFGRALWL
FT                   EAEQRRQPEA"
FT   gene            80573..82225
FT                   /locus_tag="Tmz1t_0072"
FT   CDS_pept        80573..82225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0072"
FT                   /product="phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent"
FT                   /note="KEGG: dar:Daro_0233 phosphoglyceromutase; TIGRFAM:
FT                   phosphoglycerate mutase,
FT                   2,3-bisphosphoglycerate-independent; PFAM: BPG-independent
FT                   PGAM domain protein; metalloenzyme domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52872"
FT                   /db_xref="GOA:C4ZIH8"
FT                   /db_xref="InterPro:IPR005995"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR011258"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR036646"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH8"
FT                   /inference="protein motif:TFAM:TIGR01307"
FT                   /protein_id="ACK52872.1"
FT                   /translation="MLQKFPAFAGVQGPVVVIVMDGYGIPRHEVGSAIDAARKPTLDRL
FT                   FAQYPNIVLRAHGTAVGMPSDDDMGNSEVGHNAIGAGQVYAQGAALVANAIAEGAIWQG
FT                   EAWQQIVAGAKTGANGKAGVLHFIGLFSDGNVHSHIDHLKAMVLRAKEEGVPTVRIHAL
FT                   LDGRDVPETSALDYVVPFEAFLKDISTAGFDARIASGGGRQTITMDRYDANWPMVARGW
FT                   RTHVLGEGPQFASATDAVHGLREKHPGTIDQDLPEFIVAEDGRPIGTIEDGDAVVFYNF
FT                   RGDRAIEITRAFVEEHFTAFDRVRHPRTTYAGMLQYDGDLQLPKRFLVAPPAIKDTSSE
FT                   WFSKSGLAQFACSETQKFGHVTYFWNGNRSNKFDGETWQEVPSDVVPFEQRPWMKAAEI
FT                   TDAMIAALQSGRFKVLRCNYANGDMVGHTGNFRAATMAIEAVDLALARLLPAIDAAGGV
FT                   ALITADHGNADEMFELDKKTRQPAQNKDGSYKAKTAHTLNPVPLILYDNVSGGKLGLKP
FT                   LETAGLSNIAATVANLLGLHKHDKWDDSLLEVK"
FT   gene            82296..82700
FT                   /locus_tag="Tmz1t_0073"
FT   CDS_pept        82296..82700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0073"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo2840 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52873"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52873.1"
FT                   /translation="MRSMKKPVRAASGALLFVAALATGACGLLPQKTEVAPGVTQQTGQ
FT                   FEFALPSGEYRCERGERLQIRRELANAVNNRIQLGWNGSQYQLERDLSYSGLPRFEDGA
FT                   SGLVWIDLPWKGLLLDGRTHKPLANECRAA"
FT   gene            complement(83082..83858)
FT                   /locus_tag="Tmz1t_0074"
FT   CDS_pept        complement(83082..83858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0074"
FT                   /product="Polyprenyl synthetase"
FT                   /note="PFAM: Polyprenyl synthetase; KEGG: eba:ebA4512
FT                   polyprenyl synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52874"
FT                   /db_xref="GOA:C4ZII0"
FT                   /db_xref="InterPro:IPR000092"
FT                   /db_xref="InterPro:IPR008949"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII0"
FT                   /inference="protein motif:PFAM:PF00348"
FT                   /protein_id="ACK52874.1"
FT                   /translation="MFQHSAPSPAWLQHDMERVDAIIRAHMNNDVALIRQVVEFILHGA
FT                   ERRRPALVLASARALGHGGERPHALAAAVELIHISLALHDDVTEASGGAADGEREGALF
FT                   GNAGNILLGDLLYTSAFRMIVDLGDMEVMRVLSDATNVIAEGEVAYRELLAAPASRTPE
FT                   AWLDIARRRRAKLFEAGAECMAIVHGADPAARSALARFGLHVGSAHALRSEAEDAARFG
FT                   VADAQARAQAEIEAARAVADGLALANAAALGVVVEG"
FT   gene            84061..85401
FT                   /locus_tag="Tmz1t_0075"
FT   CDS_pept        84061..85401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0075"
FT                   /product="Ferric reductase domain protein protein
FT                   transmembrane component domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; Oxidoreductase FAD-binding domain
FT                   protein; oxidoreductase FAD/NAD(P)-binding domain protein;
FT                   FAD-binding 8 domain protein; KEGG: eba:ebA4977 putative
FT                   flavodoxin oxidoreductase precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52875"
FT                   /db_xref="GOA:C4ZII1"
FT                   /db_xref="InterPro:IPR000951"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII1"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACK52875.1"
FT                   /translation="MKNIKLALLLVLATLSLLWWWADPLLVQGDTYFALRTLAVNYTGV
FT                   LAMGAMSIAMILALRPAALEPLLGGMDKAYRLHKWLGIAGLSVGVVHWLWAKGTKWAVG
FT                   WGWLQKPARGPRPEQTVELFRFFQEQRGLAETIGEWAFYLFAVLAAIALIKRFPYRRFV
FT                   QTHRVMAAVYLALVVHGVVLLPFAYWTQPLGMVMGMLMAAGSWAALRSLAGRIGRGRRA
FT                   HGRIERVVRHPANQVLEVGLRLDTPWPGHQAGQFAFVTFDEREGPHPFTISSAWGGDGR
FT                   MDFMIKPLGDYTRSLPATLKLGDPVRVEGPYGRFDFGGAQARQIWVAGGIGITPFVARM
FT                   QARAQEDRPGGRAAAIDLFYSTSAPDEGFIARLRELAARARVQLHVLVSPRDGRLDADG
FT                   ICRSVPDWKQAGVWFCGPAGFGAMLRDTLAARGLPAERFHQELFEMR"
FT   gene            85609..86442
FT                   /locus_tag="Tmz1t_0076"
FT   CDS_pept        85609..86442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52876"
FT                   /db_xref="InterPro:IPR021390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII2"
FT                   /inference="similar to AA sequence:KEGG:azo0326"
FT                   /protein_id="ACK52876.1"
FT                   /translation="MNDALAIPAAFAERRLFEPIAPWLARFTTPGLPSRAALDALLAEA
FT                   APAARSGGGAPIRFAAPGDDEAGYEARIFATGEVPTREADWHDFFNALAWCAWPRTKAC
FT                   CNRLHLDELRARDAAGLAGRGPRRDALTQFDECGIVVVSADPQVPALLAAHAWEEVFWN
FT                   RREALQHSTRFLVFGHGSWDQLRAPFPGLCAKAIHRVVDPAWLALPAAAARAETDAWLA
FT                   ARLAATIGDFSPRSLGPLPLLGIPGVTPASESAGYYRDTRQFRPQRMPAGTAAGA"
FT   gene            86642..87538
FT                   /locus_tag="Tmz1t_0077"
FT   CDS_pept        86642..87538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0077"
FT                   /product="DNA ligase (ATP)"
FT                   /EC_number="6.5.1.1"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: azo:azo3130
FT                   DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52877"
FT                   /db_xref="GOA:C4ZII3"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029319"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII3"
FT                   /inference="protein motif:PRIAM:6.5.1.1"
FT                   /protein_id="ACK52877.1"
FT                   /translation="MRPPTRIPAPALRRPGRCIRSLILALALLPAGAVAQTAEPADAPA
FT                   AMLALRYDPAIDPAGWWVSEKLDGVRASWDGSVLRFRSGRALPAPAWFLAALPPVALDG
FT                   ELWLGRRRFDELSGLLRREDPADPLWREVRYMLFELPGAAGDFDTRLARLRSLAEAADA
FT                   PWVQAIPQQRVPDRAALQRLLGEVLASGGEGLMLHRADALWQPGRSEALRKLTPWLDAE
FT                   ARVVGYLPGKGRLQGRVGALQVERADGRRFRIGSGLSDALRANPPALGALVTYRYRELT
FT                   PAGLPRFPRYLRERTLP"
FT   gene            complement(87799..89730)
FT                   /locus_tag="Tmz1t_0078"
FT   CDS_pept        complement(87799..89730)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0078"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; ABC transporter
FT                   transmembrane region; SMART: AAA ATPase; KEGG: azo:azo3632
FT                   ABC transporter permease and ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52878"
FT                   /db_xref="GOA:C4ZII4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK52878.1"
FT                   /translation="MPSDTASPAPLSALRGLLPFLRPYRARVVLAFVFLCLGSAAILVV
FT                   PLAFRDLIDAGFGGVSGGGAATGGAADGGGLFGAQGLDGRFVALFGLAVFWAAAVAARY
FT                   YTVSWIGERVTADLRSAVYARVLRQSPQYFETLQTGEVLSRLTGDTTLVQTVVGSSISL
FT                   GLRSLFQFVGGMLMLAVTSVQLFGLIFGLMALLALPITLIGRRVRSLSREAQDRIADAS
FT                   ALAGEILAAMPTVQAFGQEDNEAARFAARAETSFAAAVRRTRVRAALTGLIIAAVMGTI
FT                   IFVLWIGARQVQAGALSVGDLGAFVIYAALVAGGAGTLAEVWGDVMRAAGASGRLLELL
FT                   QAEPVIRDAEAAEGVAEAAGGGGSRRAPRLHENPRSTRPAGAAPAANPAPDSPTKAPAT
FT                   HPAIELADVVFRYPARPAVAALDGIDLRIAAGEKVALVGPSGAGKTSLFQLLLRFYEAG
FT                   EGCIRIDGHDIRALPLRSLRARIAIVPQDPVIFSASALDNIRYGRPDAGDAEVIAAARA
FT                   AAADEFIARLPEGYATFLGERGTRLSGGQRQRIAIARAILKGAPILLLDEATSALDAEA
FT                   EVLVQQGLAAAMQGRTTLIIAHRLATVQKVDRIVVMDAGRIVETGTPADLRRQGGLYAR
FT                   LAALQLEG"
FT   gene            89938..90546
FT                   /locus_tag="Tmz1t_0079"
FT   CDS_pept        89938..90546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0079"
FT                   /product="protein of unknown function DUF924"
FT                   /note="PFAM: protein of unknown function DUF924; KEGG:
FT                   har:HEAR1730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52879"
FT                   /db_xref="InterPro:IPR010323"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII5"
FT                   /inference="protein motif:PFAM:PF06041"
FT                   /protein_id="ACK52879.1"
FT                   /translation="MDTPATIHAFWFGPAADADAEAAIIERQSALWWRKQPAVDAEIRA
FT                   RFAPLVGRAAGGELDTWLGGLRGRLALVLLTDQFPRNIWRGEAAAFAFDVLALRWAKEA
FT                   LARGLDAGLRPIERVFLYLPLEHSENLADQREAVRRFDTLAIAVEPALRTAFAGYLDYA
FT                   RRHLEIIERFGRFPHRNAALGRETSPEEAEFLRQPGSRF"
FT   gene            90585..91289
FT                   /locus_tag="Tmz1t_0080"
FT   CDS_pept        90585..91289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0080"
FT                   /product="glutamine amidotransferase class-I"
FT                   /note="PFAM: glutamine amidotransferase class-I; KEGG:
FT                   mms:mma_3646 GMP synthase (glutamine-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52880"
FT                   /db_xref="GOA:C4ZII6"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII6"
FT                   /inference="protein motif:PFAM:PF00117"
FT                   /protein_id="ACK52880.1"
FT                   /translation="MKAHILQHVPFEGPGHIGDWLAARGADIGSTRFWESPVLPDPAAI
FT                   DLLVVMGGPMSVNDEAELPWLVAEKRFIAEVVALGRPVLGICLGAQLIASAHGARVYRN
FT                   ADKEIGWFEVAASGAEPDAADTASRFPFPARTTVLHWHGETFDLPAGARLLASSPACRH
FT                   QAFQLGGRTIGLQFHLEMTASSLRAIVDNCRGELVPGRWIQDEATILGHADGHFAATHA
FT                   LMDGLLDWLVRA"
FT   gene            complement(91297..92259)
FT                   /locus_tag="Tmz1t_0081"
FT   CDS_pept        complement(91297..92259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52881"
FT                   /db_xref="InterPro:IPR025567"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52881.1"
FT                   /translation="MPIDPKDLRTAAGSLLDPRLVDTMNLKPVGTSSLVNLEGRLGVFT
FT                   PVAEDGSGADNTEAVIAALRKELVRLESENAALRRQLAEVEAARKRSPDDFASAVAHTL
FT                   DTLQHKLTQTTNPVSRFAVREVAIDAQVTVDVSPLGTLEYRFVRPEDDIDPSKLSRIRL
FT                   DLVPLPREDAGLSASPEFSPWAGVEDIVGVGETWRGALNRQQIFTIADLLVAGSRLKSS
FT                   AELAALVGVDRQRLAEWMGHAELLSVRTIEPRAADVLWTVGIRSLETLAGAAAVEVVEK
FT                   YNAEVARRAHKSLAPINAAQAASWIEAAKKYHGRPREGG"
FT   gene            complement(92298..92690)
FT                   /locus_tag="Tmz1t_0082"
FT   CDS_pept        complement(92298..92690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0082"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52882"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52882.1"
FT                   /translation="MDKANVSAGELAGQQAVELGELLARTVVSVAAAQEALDRHATDRL
FT                   DAIERGDEDAPRVPPLWYTFTEVTLEVALSASVERASGSVPPRLMSRPVDPRQVSLYGY
FT                   QAASSLMVRLRLAPRQGMPDVSPPPA"
FT   gene            complement(92743..93636)
FT                   /locus_tag="Tmz1t_0083"
FT   CDS_pept        complement(92743..93636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0083"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52883"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZII9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52883.1"
FT                   /translation="MPDLLPPLARALAEDANVSDELRGAGIAFGTLVERTGAAVAATQL
FT                   QLDTSSAATASALAATLVNVIAVREQVFRDDGTLDHVTNHVRPLPLISFIDPVFYQWTS
FT                   VRLQGEFYAREFAASSETTSAYSGSNFGLFGSGVSMFFGPGMVTSGSGSGSSTTTTDVS
FT                   TDVSLGRIRASALLEPRDDVGIPKPNQVIRGPRLALIQGEIADVMDGGDLVGRTMSVLL
FT                   QYSRRNGAPIAGKALSVESSGVPWRHLGSGVTDAAGQLQIELRRDFLDEDADTAPASFV
FT                   ITARIGLVSNSVTVTF"
FT   gene            complement(93664..94683)
FT                   /locus_tag="Tmz1t_0084"
FT   CDS_pept        complement(93664..94683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0084"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: reu:Reut_B5403 putative hemagglutinin-related
FT                   transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52884"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52884.1"
FT                   /translation="MADNTEKPGKGKPTRTQAGATSPATALPEGSILSAGALMPGAVGG
FT                   ALALGADVSGELAELAPSFGDILASIGRGVADSQTALDRGLVDTATTLSQSNITVVTDV
FT                   VQELNDDGLPVPSATQLVTQNVSLINFVRPTAHQWSHVALRMDMTVGAVDNERGISVNS
FT                   KTKSARATNVGLFFGFLGIGVSSFKEKSTFRSEESDFESNWAEGRVLMDALLQPRNVDG
FT                   FDPPAEVSIGPQIFMALGSVQETLNSGVVTARSTDIVITVRKANGAVNPTVTIDVDPGP
FT                   FDLSFATADGFTGNTTNAAGQCRITLSRNIPSPLFQRRVRGTVTATLGQIERSTTVSL"
FT   gene            complement(94705..97305)
FT                   /locus_tag="Tmz1t_0085"
FT   CDS_pept        complement(94705..97305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0085"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="PFAM: peptidase S8 and S53 subtilisin kexin
FT                   sedolisin; KEGG: bba:Bd2321 subtilisin-like serine
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52885"
FT                   /db_xref="GOA:C4ZIJ1"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR034058"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ1"
FT                   /inference="protein motif:PFAM:PF00082"
FT                   /protein_id="ACK52885.1"
FT                   /translation="MVPAPRAHPGVAPACFALVPAAATAGAVLARYGELALVEVERVPV
FT                   TAWASWTDLDPIRVHGVPRILPSGCFEPGAGPRCILRFAGPVLPAWRETLATLGWTPRF
FT                   DCPPSGLCADVGGDLVALRAALPALRAIAPYAAEDCARAGAGGVAALPDTVDAVAFSVE
FT                   DRVRLEGELTAAGLQVVASSPYKLRVSGDAGAVGRLRDAVGVKIADPGTLPRTASLSLR
FT                   LAIGATALPESAGGATGAQGGEGELIAFADTGLGTGATDAPHPDFAGRVQAIHSWPLAP
FT                   GWSAFVRAPGADDGGADRGSGHGTHVAGLAAGDGGLSAGRLVGVAPGARILMQAIEQYV
FT                   DPLPEWRSRLQPGFYLAGRPLDLRELLEQARAAGAAIHVDAWGVEAAGAYTDDSWECDH
FT                   FLHAHAEMLVIVAAGNAGRDRNRDGAVDAGTLYAPASAKSVLAVGATEGPDAGIGLRGG
FT                   WAALDPAGTRFPDPAQRGASVSGDAERLALLSSCGPTLDGRIKPDLCAPGTNLAAARST
FT                   ASSARGWGLANPLPWYQYLGGTSMSTGVVAGAAAVLRQRWRQVLGEAPGGAALKALLIH
FT                   GARAVHRRDGQGEEDRQRAGFGRLWLVGSLPGPDGPVLIEDRVGVVTGERRRIDCTGPG
FT                   RLRAVLCWYDAPGEALINDLDLVLRDAGGSVLAWGNHPAGAVGSPDRRNTVECIDVALG
FT                   EGEWMLEVRGVNVPLGPQPWALATSPGVVVRATPAAPGTPTVPADPLPAPRWRVDLPWT
FT                   AVRGVGARRAIELERTLPGGLAALCAGVPDEDALAFLPAALRAQIRSLAAFLGAPPPAA
FT                   ARLALAHPLHALLSGAPETVSTVAWQALAAALSPLLEALDRNVAREVRGERLFR"
FT   gene            97552..98052
FT                   /locus_tag="Tmz1t_0086"
FT   CDS_pept        97552..98052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0086"
FT                   /product="Water Stress and Hypersensitive response domain
FT                   protein"
FT                   /note="SMART: Water Stress and Hypersensitive response
FT                   domain protein; KEGG: bte:BTH_I2944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52886"
FT                   /db_xref="GOA:C4ZIJ2"
FT                   /db_xref="InterPro:IPR004864"
FT                   /db_xref="InterPro:IPR013990"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ2"
FT                   /inference="protein motif:SMART:SM00769"
FT                   /protein_id="ACK52886.1"
FT                   /translation="MSLAVRPSASSFTRSLLAVLASVLLAGCASLIQREPVRINVVGLE
FT                   PLPGAGMEMRFAVKLRVQNPNEAAIDFDGLALELDLDGKPFATGVSDRKGSVPRFGEAL
FT                   VEIPVSVSAIAVVRQALGVIEGEPKTEVPYTLRGRLAGGLLGGTRFSDAGMLKLPEPLR
FT                   NPR"
FT   gene            98139..98930
FT                   /locus_tag="Tmz1t_0087"
FT   CDS_pept        98139..98930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0087"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   maq:Maqu_3843 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52887"
FT                   /db_xref="GOA:C4ZIJ3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ3"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACK52887.1"
FT                   /translation="MTLPTVHDARLQLDKRVATLTLARDDVRNALTGTALIDDIVGVAE
FT                   WVNRCEEVSVLVITGEGAAFSAGGNVKDMAARGGDFAGDVAEVATRYRQGIQRIPLALQ
FT                   AVEVPVIAAVNGPAIGAGFDLANMADIRIASTKAKFGETFLNLGIIPGDGGAWFMQRLI
FT                   GYQQAFELTLSGRIVGAAEAKTLGIVLEVVEPEQLLPRAHELAARFAAQPPKALRLTKR
FT                   LMKMAQRMELKDFLDLSAAFQGMCHNEPEHLEAVQRLLART"
FT   gene            98951..100450
FT                   /locus_tag="Tmz1t_0088"
FT   CDS_pept        98951..100450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0088"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="KEGG: azo:azo0116 AMP nucleosidase; TIGRFAM: AMP
FT                   nucleosidase; PFAM: purine or other phosphorylase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52888"
FT                   /db_xref="GOA:C4ZIJ4"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ4"
FT                   /inference="protein motif:TFAM:TIGR01717"
FT                   /protein_id="ACK52888.1"
FT                   /translation="MNGHAPHFDVEDFADPAAALARVHEIYDLAVDHLRRGLQHYVDGA
FT                   DIGRHVRACYPLLRVRTDTVARADSRLSYGFVAGPGVFETTLTRPDLFADYYLEQFRLL
FT                   VQNHGVALQVGSSTQPIPVHFALPEHDYLEGHLGPERRRLLRDHFDLPDLGAMDDGIAN
FT                   GTFEPGPGEPHPLALFTAPRVDYSLHRLRHYTGTRPAFFQNFVLFTNYQFYIDEFIRLG
FT                   HELMADTASGHGYEAFVEPGNVLTRRADLPPQAEDADGTPPPRLPQMPAYHLVRGDHAG
FT                   ITMVNIGVGPANAKTITDHIAVLRPHAWIMLGHCAGLRNSQHLGDYVLAHGYVREDHVL
FT                   DEELPPWVPIPPLAEVQVALEAAVAEVTQLSGYELKRLMRTGTVASTDNRNWELLPSHG
FT                   MSSSPERRFSQSRAVALDMESATIAANGFRFRVPYGTLLCVSDKPLHGEIKLPGMADKF
FT                   YRERVDQHLRIGIRALEQLREQGVDRLHSRKLRSFAEVAFQ"
FT   gene            100492..102423
FT                   /locus_tag="Tmz1t_0089"
FT   CDS_pept        100492..102423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0089"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: azo:azo2509 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52889"
FT                   /db_xref="GOA:C4ZIJ5"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ5"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACK52889.1"
FT                   /translation="MSAAPPSAHPIRVLSVIPPMTQLNTPYPSTAYLTGFLRSRGVDAV
FT                   QEDLALKLVLRLLSPAGLDDIRARAEALPKKRRTPLVQGFLDHFARYRYTVDPTIAFLQ
FT                   GRDPTIAHRIASRTFLPEGPRFDAVDAYVDPDDPEGGDPLAWAFGALGLADRARHLATL
FT                   YLNELADILRDAVDARFEFVRYAETLAMSQPTFEPLAAALAAAPTLVDAYLKDLTLEAL
FT                   SRHSPQVVLVSTPFPGSVYGAFRIAQAIKAAHPEIVTVLGGGFVNTELRELAEPRVFDH
FT                   FDYVTLDDGERPLLALLEHLQGRRGRSRLVRTFVRDADTGQVRYINLAEPDVPFAEVGT
FT                   PTWDGLPLDGYLSVLDMLNPMHRLWSDGRWNKLTVAHGCYWKKCSFCDVSLDYIGRYDG
FT                   AAAGLLVDRIEAIIAETGQTGFHFVDEAAPPKALRALAEELLRRGLAISWWGNIRFEKS
FT                   FSPELCQLLADSGCIAVSGGLEVASDRLLQLMKKGVSVEQVARVTHAFTAAGVLVHAYL
FT                   MYGFPTQTVHDTVDALEYVRQLFEAGCIQSGFFHRFACTVHSPVGRNPEEFGVTLVALP
FT                   EITFAKNDVGFIDPTGVDHDRLGKALNKALYNYMHGIGLDTDVRAWFEDKVPRPRVARH
FT                   FIARALGA"
FT   gene            102550..104247
FT                   /locus_tag="Tmz1t_0090"
FT   CDS_pept        102550..104247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0090"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   azo:azo1270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52890"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ6"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ACK52890.1"
FT                   /translation="MDKQPTEGPELEVSFDELTRVLSVSIAHDPHFPRIDALWLRRRLE
FT                   AAGYADLQIRPDPIRRLIAQYNAGEAVAPVEIAQCVDASMQIGVSLDGLVARLSIVPAK
FT                   GGKPASKTELLALIESRGIVEGLLLEEMNRAIADGQADDLAIARGREPEPGKDGWLEYL
FT                   LPETRERVPSVRPCGRTDYRDLGEILVVHAGDALMRRHPPQPGVDGVNVYGRPIVARRG
FT                   REQRFAPGLRGTAISPEDPELLVAACDGQPVRVRNGAMVEPIFTVDAVNLATGNIDFDG
FT                   SVRIRNDVQAGMTVRASGDIEVGGVVEPATLEAGGSIVVKGGVLGGLGGKTAGKDYSAH
FT                   AIRCEGSFCATYAQQARISAGDSIFIDDVAMQCQLEARNHIRVGKRLRGQIVGGHCRAS
FT                   LSIHARTIGANSRIRTELEIGMDNGLEHAIQEKAEARDALENRLLEIGKMLTFADRHPD
FT                   RVTPEMLGRAEQTASALSGEIESLRSEEEDLQHRLALTREARVNAEREMFEGCIVRMGE
FT                   QLFKLSQDRGPTTVRLATQGLGVFPLEDDSRFDEPQRPAAASQGSSRR"
FT   gene            complement(104291..104791)
FT                   /locus_tag="Tmz1t_0091"
FT   CDS_pept        complement(104291..104791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0091"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen; KEGG:
FT                   azo:azo0105 thiol peroxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52891"
FT                   /db_xref="GOA:C4ZIJ7"
FT                   /db_xref="InterPro:IPR002065"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR018219"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ7"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACK52891.1"
FT                   /translation="MSKVTLGGNPIDVAGRFPQAGEAAPVFRLTGADLADVGLEAFAGK
FT                   RKVLNIVPSLDTPVCATSTRKFNAEAAGLADTVVLVVSADLPFAAKRFCETEGLKNVHT
FT                   LSTFRNPKFAQDYGVAITSGPLAGVTARAVVVVDGNDKVVYSQLVPEIKEEPDYAAALA
FT                   ALK"
FT   gene            105034..106185
FT                   /locus_tag="Tmz1t_0092"
FT   CDS_pept        105034..106185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0092"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: TIR
FT                   protein; KEGG: scl:sce3630 WD repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52892"
FT                   /db_xref="GOA:C4ZIJ8"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ8"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK52892.1"
FT                   /translation="MEPVDLFYSYAHEDEKLRDELDGHLALLRRKGVIRPWHDRGIVPG
FT                   QEWDKAIDEQLAMADLILLLVSMDFLNSDYIWGKELATAIERARRGDASVIPVLLRAVD
FT                   LEDAPFAHLQGLPTDLRPVTSWPNRDEAWTDVAKGIRRAVEAIRQRWASAPPPAAPPAA
FT                   PPEAPSVPRASGFGTAVASVPLPEEPVRTLEMARPAPRMAATRDARTDALLERTIAAFA
FT                   NELALAARIKGVQGIGSGEAEGLAEALIDMPAQKRVLWVDDRPENNRHELAALAKLQVE
FT                   VVNVRSTGEAIACLDADEEGFDLILSDWDRAEPAATASSAGLELLRMLAARPRRPPVIF
FT                   YHAEFDPSRRAARRECLLRAGAFGEAVRPGELLALIRSAFASD"
FT   gene            complement(106200..107039)
FT                   /locus_tag="Tmz1t_0093"
FT   CDS_pept        complement(106200..107039)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0093"
FT                   /product="peptidase M48 Ste24p"
FT                   /note="PFAM: peptidase M48 Ste24p; KEGG: azo:azo0101 heat
FT                   shock protein HtpX"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52893"
FT                   /db_xref="GOA:C4ZIJ9"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIJ9"
FT                   /inference="protein motif:PFAM:PF01435"
FT                   /protein_id="ACK52893.1"
FT                   /translation="MFGNWIKTSILMAGIVALFGAMGAAIGGQQGMLIALVMGGAMNVW
FT                   AYWFSDKMVLKMYKAREVDAASSPYLYNMVAELARRAELPMPKVYIIDEAQPNAFATGR
FT                   NPDNAAVAATTGIIRMLSERELRGVMAHELAHVKNRDILISTISATIAGAISMLANFGM
FT                   FFGGREGEERPNPIVSIAMMILAPLAGMLIQMAISRTREFGADRGGAEISGDPAALAAA
FT                   LAKIDAYARGIPMHTAERHPETAQMMIMNPLSGGGLRGLFSTHPSTQERIARLQTMR"
FT   gene            complement(107130..108092)
FT                   /locus_tag="Tmz1t_0094"
FT   CDS_pept        complement(107130..108092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0094"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /note="TIGRFAM: methionyl-tRNA formyltransferase; PFAM:
FT                   formyl transferase domain protein; KEGG: azo:azo0100
FT                   methionyl-tRNA formyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52894"
FT                   /db_xref="GOA:C4ZIK0"
FT                   /db_xref="InterPro:IPR001555"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR037022"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK0"
FT                   /inference="protein motif:TFAM:TIGR00460"
FT                   /protein_id="ACK52894.1"
FT                   /translation="MAATASGAGGLRVAFAGTPEFAAQALDAILKAAYAVPLVLTQPDR
FT                   PAGRGMKLSPSAVKQLALAHGIEVDQPEKLRTEEQRARLVACAPDVLVVAAYGLILPPA
FT                   VLALPRLGCINIHASLLPRWRGAAPIHRAIEAGDAETGITIMQMDEGLDTGPMLLRRAL
FT                   PIAADDTTASLHDRLAALGGACIVEALAALAAGALVATPQPAEGVTYAAKIGRAEADID
FT                   WSRPAAEIERAMRAFDPFPGAVSSLRDTAVKCWKARVVAGEGEPGRVLAVDADGIVVAC
FT                   GRDALRCTVLQRPGSKRLPAGEFLRGFPVSVGERFASAT"
FT   gene            complement(108092..108595)
FT                   /locus_tag="Tmz1t_0095"
FT   CDS_pept        complement(108092..108595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0095"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="KEGG: azo:azo0099 peptide deformylase; TIGRFAM:
FT                   peptide deformylase; PFAM: formylmethionine deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52895"
FT                   /db_xref="GOA:C4ZKT7"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKT7"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACK52895.1"
FT                   /translation="MALLPILRYPDPRLHTVAAPVGRVDDEIRRLIADMAETMYEAPGI
FT                   GLAATQVDVHKRIVVIDVSEDKSGLMALINPEILERSGEQVCEEGCLSVPGIYEKVSRA
FT                   ERVKVRALNEKGESFEFEADGLLAVCVQHEIDHLDGKVFVEYLSQLKLGRIKSKLAKKA
FT                   RITA"
FT   gene            108779..109828
FT                   /locus_tag="Tmz1t_0096"
FT   CDS_pept        108779..109828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0096"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; SMART:
FT                   Peptidoglycan-binding LysM; KEGG: azo:azo0098 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52896"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKT8"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACK52896.1"
FT                   /translation="MRPMMRIIFPLLVAFASLLGPAAHAQSNVRLAPDAPDSYTVVRGD
FT                   TLWGISGRFLQEPWRWPEVWRLNRDEIRNPHLIYPGQVVLLDRSGPWLSVGRRVGDGGT
FT                   RDGRLQPKVHSEPIAEALPSIPLQIIEPFLNRPLVVDQPRLDGSATIVATETSRVLTGT
FT                   GDTVFAKNIGDDADIWHIYRPARALEDPQTREAIAWEAAYLGTARVTERGEPTTLEIVS
FT                   AVEEIGTGDLMMPSEPPSVFSYAPHAPDFEVEGRILSIYRGVSETGRLNVVALNVGEQD
FT                   GLERGHVLALHRNRGVAEYRGEDGKESFRLPEKRYGVAFVFRVFERVSYALVMESDGPV
FT                   TIGDTLRKP"
FT   gene            109860..111023
FT                   /locus_tag="Tmz1t_0097"
FT   CDS_pept        109860..111023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0097"
FT                   /product="DNA protecting protein DprA"
FT                   /note="TIGRFAM: DNA protecting protein DprA; PFAM: SMF
FT                   family protein; KEGG: azo:azo0097 putative DNA processing
FT                   protein DrpA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52897"
FT                   /db_xref="GOA:C4ZKT9"
FT                   /db_xref="InterPro:IPR003488"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR041614"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKT9"
FT                   /inference="protein motif:TFAM:TIGR00732"
FT                   /protein_id="ACK52897.1"
FT                   /translation="MTAPADDLADWLRLACIPGVGTQGQRALLAAFGLPGHIFAAGRGA
FT                   LAAVVGGQAADAVLAVPAHEDIERTLAWASEAGNRVLTLADADYPRQLFDIADPPVLLY
FT                   VKGEPALLSRPGIALVGARSATAAGEANAEAFARTLAQQGLVVVSGLALGIDAAAHRGA
FT                   LAAGSTGAGTVAVIGTGIDRIYPARNAALAREIAAAGAVVSEFPLGTPPLQHNFPRRNR
FT                   LIAGLAEGVLVVEAALGSGSLITARLATETGREVFAIPGSIHSPLSRGCHRLIRDGAKL
FT                   VETAEDVVEELRGRLGWPAPVAASVKDRRSRGAVPAVPAAPPRQAALALDGERTRVLEA
FT                   IGHDPVDLDTIAARCGLTVDALYAILLPLELEGRLAKLPGGRFQRIT"
FT   gene            111107..111577
FT                   /locus_tag="Tmz1t_0098"
FT   CDS_pept        111107..111577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0098"
FT                   /product="protein of unknown function DUF494"
FT                   /note="PFAM: protein of unknown function DUF494; KEGG:
FT                   azo:azo0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52898"
FT                   /db_xref="InterPro:IPR007456"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU0"
FT                   /inference="protein motif:PFAM:PF04361"
FT                   /protein_id="ACK52898.1"
FT                   /translation="MFDILVYLFESYIHADACPEGELLNRKLSAAGFEQDDISEALEWL
FT                   AGLRRVARDIHPGTAPQAGSVRIYTEEEQALLDGRCRGFLSLLESAGVLGTAHRELIIE
FT                   RAMALADFNITLNRLKVIVLMVLWQQEEPIDTLMVDELLTEEDDWAYEPTVH"
FT   gene            111681..114245
FT                   /locus_tag="Tmz1t_0099"
FT   CDS_pept        111681..114245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0099"
FT                   /product="DNA topoisomerase III"
FT                   /note="KEGG: azo:azo0095 DNA topoisomerase III; TIGRFAM:
FT                   DNA topoisomerase III; PFAM: DNA topoisomerase type IA
FT                   central domain protein; TOPRIM domain protein; SMART: DNA
FT                   topoisomerase I DNA-binding; DNA topoisomerase I
FT                   ATP-binding; Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52899"
FT                   /db_xref="GOA:C4ZKU1"
FT                   /db_xref="InterPro:IPR000380"
FT                   /db_xref="InterPro:IPR003601"
FT                   /db_xref="InterPro:IPR003602"
FT                   /db_xref="InterPro:IPR005738"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013497"
FT                   /db_xref="InterPro:IPR013824"
FT                   /db_xref="InterPro:IPR013825"
FT                   /db_xref="InterPro:IPR013826"
FT                   /db_xref="InterPro:IPR023405"
FT                   /db_xref="InterPro:IPR023406"
FT                   /db_xref="InterPro:IPR025589"
FT                   /db_xref="InterPro:IPR034144"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU1"
FT                   /inference="protein motif:TFAM:TIGR01056"
FT                   /protein_id="ACK52899.1"
FT                   /translation="MSKQLIIAEKPSVAQDIARALGGFTKEKDYFESDEYVLSSAVGHL
FT                   LELTLPEEFEVKRGKWTFAHLPVIPPHFAVKPIEKTEDRLKLLTRLIKRKDVTGLINAC
FT                   DAGREGELIFNFIAQHAGTKKPMQRLWLQSMTAQAIRDGFAHLRAAQDVEGLRNAAICR
FT                   AESDWLIGINGTRAMTAFNSKTGGFHLTTVGRVQTPTLAMVVEREDRIRKFKSRDYWEL
FT                   EARFGCAAGEYPGRWFDEKFKRPEGDEHATAFRLWDKAQAEAIRAKCAGKPGVVSEEAK
FT                   PSTQLSPLLFDLTSLQREANGRFGFSARVTLQLAQALYEKHKVLTYPRTDARALPEDYL
FT                   ATVGEVMRTLPDQYAPFANEITRQGWVRPNKRIFNNAKISDHFAIIPTGALPKSLSDAE
FT                   HKIYDLVTKRFLAVFYPAAEYQITTRITRVEGEAFKTEGKVLVNPGWLTVYGKEAANDE
FT                   KDAKDGGAPQLVAVKQGETVSTEDIVVKSLQTKPPARFNEATLLSAMEGAGKMVDDEEL
FT                   RAAMAERGLGTPATRAQIIEGLISEQYIHRDGRELIPSAKAFSLITLLKGLGVTALTSP
FT                   ELTGGWEYKLAQMEHGKLSREAFMNEIAEMTREVVERAKRYESDTVPGEFVTLQTPCPK
FT                   CGGVVKENYKKFACQACDWSTWKIVAGRQFEYDEIETLLRAGKVGPLLGFRNKMGRLFN
FT                   ADIVLNEDKQPTFDFGQPKEGEEAEEVDFSDQQPVGACPKCASRVFEHGMAYVCEKSVG
FT                   PGKSCDFRSGKVILQQPIEREQMARLLTEGKTELLKGFVSARTRRKFSAFLVRGKDGKV
FT                   GFEFEAKAPKAGAKPAAGKGDEAAGEDAEPAAPRKRAARKAS"
FT   gene            complement(114523..115044)
FT                   /locus_tag="Tmz1t_0100"
FT   CDS_pept        complement(114523..115044)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0100"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: azo:azo2407 Bkd
FT                   operon transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52900"
FT                   /db_xref="GOA:C4ZKU2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU2"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACK52900.1"
FT                   /translation="MSTLSIDRHDLALLDALQRSGDATNATLGEAVHLSASQVSRRLQR
FT                   LQEAGLITGYAALLDPAALGLDVMAFAHVVLERHGGVRTEAFEDGVAALPEVLECFSVS
FT                   GNADYVLRIVAPDLAAFSELMMKRVLRLPGIANIKTDIVLGKVKQTHVLPLEHIARPGR
FT                   PRRGVRFTVS"
FT   gene            115164..116792
FT                   /locus_tag="Tmz1t_0101"
FT   CDS_pept        115164..116792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0101"
FT                   /product="indolepyruvate/phenylpyruvate decarboxylase"
FT                   /note="TIGRFAM: indolepyruvate/phenylpyruvate
FT                   decarboxylase; PFAM: thiamine pyrophosphate protein TPP
FT                   binding domain protein; thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; KEGG: rfr:Rfer_0518 thiamine pyrophosphate
FT                   enzyme-like TPP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52901"
FT                   /db_xref="GOA:C4ZKU3"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012110"
FT                   /db_xref="InterPro:IPR017765"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU3"
FT                   /inference="protein motif:TFAM:TIGR03394"
FT                   /protein_id="ACK52901.1"
FT                   /translation="MNLTESLLHALVDHGARQIFGIPGDFALPYFRIIEQTGILPLHTL
FT                   SHEPGVGFAADAAARVQGGIGVAAVTYGAGALNMVNAVAAAYAEKSPLVVISGGPGLGE
FT                   SQSGLLLHHQAKTLDSQLRIFQEITCDQVRLDDAARAPADIARVLGNCVRNSLPVYIEI
FT                   PRDMVARPCAPVVREAPRAVDADALAACVDEILARLRAARAPVLMAGVEVRRFGLEDKV
FT                   AELSRRLGIPVVTSFMGRGLLADQDAPLMGTYMGLAGLPEVSALVEDSDGLFLVGVIIS
FT                   DTNFAVSGKHIDLRHTIQALEARVTMGYHTYADIPLDALIDGLLARVPHADAHFTVDRP
FT                   AFPHGLQADEATIAPADIACAVNDLMAAHGKLPIASDMGDCLFTAMDIEHTALVAPGYY
FT                   ATMGFGVPAGLGVQAATGQRPLILVGDGAFQMTGWELGNCRRYGWDPIVLLFNNASWEM
FT                   LRTFQPESGFNDLDDWGFAQMAAGLGGDGVRVHTRAQLKAALDKAIATRGRFQLIEVMI
FT                   PRGVLSESLSRFVNAVKRLNAAKAA"
FT   gene            complement(117393..117863)
FT                   /locus_tag="Tmz1t_0102"
FT   CDS_pept        complement(117393..117863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0102"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   cti:RALTA_A2583 putative DNA-binding protein, dps family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52902"
FT                   /db_xref="GOA:C4ZKU4"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU4"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACK52902.1"
FT                   /translation="MEIDIGIKEKDRAKIAEGLSRLLADSYTLYLTTHNFHWNVTGPMF
FT                   NTLHLMFETQYNELALAVDEIAERIRALGFPAPGTYKEFQKLTSMAEPEGVPNAQEMIR
FT                   LLVQGQEAVVKTARSIAPIADKASDEPTLDLLTQRMQVHEKTAWMLRSLLEG"
FT   gene            complement(117980..118936)
FT                   /locus_tag="Tmz1t_0103"
FT   CDS_pept        complement(117980..118936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0103"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: azo:azo0094 putative OxyR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52903"
FT                   /db_xref="GOA:C4ZKU5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK52903.1"
FT                   /translation="MTLTDLRYLVALAHERHFGRAAEKCHVSQPTLSVAVKKVEEELGI
FT                   QLFERSASEVKITETGRRIVAQAERVLMEASQIQEIAAAGKDPLAGPLRVGVIYTIGPY
FT                   LLPRLIPRVHQLAPRMPLIIQENFTARLAEALKRGELDVIIISLPFDEAGVVAQPVYDE
FT                   PFRVLIPADHPWNAESEIDPQHLADDQLLLLGAGNCFRDQVLEVCPSCRNIGGLQRTLE
FT                   GSSLETIRHMVATGLGVTVLPSSAADEMATQNPLVAVRPFTMPEPSRRVALAWRVTYPR
FT                   NGAIDVLRAAILDSALPGVRPVGRAVPPGQVPWVDSR"
FT   gene            119066..121102
FT                   /locus_tag="Tmz1t_0104"
FT   CDS_pept        119066..121102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0104"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: azo:azo0093 putative TonB-dependent
FT                   receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52904"
FT                   /db_xref="GOA:C4ZKU6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU6"
FT                   /inference="protein motif:PFAM:PF00593"
FT                   /protein_id="ACK52904.1"
FT                   /translation="MHLHRPPTALALLSLLAAGTVEASSADAFFEPLPVVLSASRLAQP
FT                   LQDSPGAVTVIDADLIAATGYRELARVLRLVPGFQVGQERGNLQWVTYHGLGMDSPMQI
FT                   QLLVDGRASLTPSFTASAERALPGDIERIEVVRGSNSAAYGSNAFLGIVNIITDDASRH
FT                   PGTRLKLATGAPGIRDASLRHAVQSGPLSVRIGAHHEEDEGFADLYDGRRTDVLNLRAD
FT                   LQVGEHDAVALNAGVAESTHELGYAGSIFDIAAQREGRDTNRSLHLRWRHGPEDDAIRV
FT                   SAYWSRQSRDDLWRYDSAANSRTLANAFPERLRGTVGNSATFVQHNLEIERRERVDEAT
FT                   RLMWGAEWKRIEHDSPFWYHERRNHARDEHRLFANLELRTGTAFLWNAGGMLEQLQGDE
FT                   ARLAPRVFLNWQAAPRITWRIGHSRAWRQPDLFERNVDIRITDDKGELVQRRQYPNPDL
FT                   RPQRIDASEIGFLGVFGDSRSTLDVRLFRERIEDLIVRNAVPSDWPIEGKLPEAISRGL
FT                   GSTRWENHSGRVQLNGIETQLHLKPWRGTEFLLAHSLIDRDVDDPRIRRNVAPYTASLS
FT                   WLQRAGAWRSLLSVLRMGPIDAGFSYVPGFDYTVPSYTTVDWSVSRNLRLFDMAVELRL
FT                   TGINLLGRHQELANRPLQAQPEFAGRPANEVSRQAWLALETTF"
FT   gene            121251..122720
FT                   /locus_tag="Tmz1t_0105"
FT   CDS_pept        121251..122720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0105"
FT                   /product="protease Do"
FT                   /EC_number="3.4.21.108"
FT                   /note="KEGG: azo:azo0092 serine protease MucD; TIGRFAM:
FT                   protease Do; PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; SMART: PDZ/DHR/GLGF domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52905"
FT                   /db_xref="GOA:C4ZKU7"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU7"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ACK52905.1"
FT                   /translation="MRKLLTVTAVALALGTLFPQASALSAAHAQAAAPSMVSPNRFGLP
FT                   DFGDLVEQVGPAVVNIRVVQRAAQGTAGENPLANDPFYDFLRRFGVPMPGFPGQPGMGP
FT                   RARQGIGSGFIVSKDGYVLTNAHVVAGEDGDAALSEVTVTLIDKREFKAKVVGIDRRTD
FT                   VALLKLDASGLPAVKIGNPDQARVGEWVVAMGSPFGFDNTVTAGIISAKARRLPDETYV
FT                   PFIQTDVAINPGNSGGPLFNLAGEVIGINSQIYSRSGGFMGISFAIPIDVAMNIKDQLV
FT                   SHGRVQRGRLGIAIQNVDKDLAQSFGLTDPRGALVASVEPGSAADKAGLQAGDVVLAVD
FT                   GRRIDDSAELPRVIGEKRPGTRVKLELWRDGRSREVAATLDELKAETVAGSAPAPSQVE
FT                   RIGEQFGLSARALTAEETARLQLRGGVVVEGADGAAARAGLQRGDVILAINNQPVASVA
FT                   DLRAQLERAGKRFALLIQRGEARIFVPVRLE"
FT   gene            complement(122802..124424)
FT                   /locus_tag="Tmz1t_0106"
FT   CDS_pept        complement(122802..124424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0106"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; histidine
FT                   kinase HAMP region domain protein; SMART: chemotaxis
FT                   sensory transducer; histidine kinase HAMP region domain
FT                   protein; KEGG: azo:azo0091 methyl-accepting chemotaxis
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52906"
FT                   /db_xref="GOA:C4ZKU8"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACK52906.1"
FT                   /translation="MIRFSDTPIWLRLTGAIWLMMVAAFGSMIVWETRVNRDMAIEQAK
FT                   DFAGTVNEMTMAGLTGMMITGTVAQRDVFLDQIKELSVVQDLEVIRGEAVSRVFGAGGA
FT                   RDAARDADERLALVEGRATMRVDHDAEHGEHLRVVIPSLASPAWLGKDCIACHQVPQGT
FT                   PLGAVSMRISLDKANAAVNAFRNQSAMFAALVSIPLILFIYLFITRFVTRPLDGLNRGL
FT                   GRIAEGGGDLRLQLPVRGRDEIGRSARTFNDMMGTLGGLVRQVGDSASAVTEAASRLAA
FT                   DAEAVAASSQRQNESSVGAADAVDEMVGSISAIAEHAEAVRERSHDSLERSREGQRSLE
FT                   RLVGEVGEVEAAVRQMADAVVAFVDSTQAISRMTSEVREIAEQTNLLALNAAIEAARAG
FT                   EQGRGFAVVADEVRKLAEKSARSAGEIDQITREVARRSSSVRGALDDGLGHLASSRQMA
FT                   DAVMQVLTAANSLVVEVGEGLDRIAGATGAQRSASESVTARIGEIAGMARSNNDALAHT
FT                   VRSARELGELALRLQESVSRFRF"
FT   gene            124696..125148
FT                   /locus_tag="Tmz1t_0107"
FT   CDS_pept        124696..125148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0107"
FT                   /product="cytochrome c prime"
FT                   /note="PFAM: cytochrome c prime; KEGG: azo:azo0090
FT                   cytochrome c'"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52907"
FT                   /db_xref="GOA:C4ZKU9"
FT                   /db_xref="InterPro:IPR002321"
FT                   /db_xref="InterPro:IPR010980"
FT                   /db_xref="InterPro:IPR012127"
FT                   /db_xref="InterPro:IPR015984"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKU9"
FT                   /inference="protein motif:PFAM:PF01322"
FT                   /protein_id="ACK52907.1"
FT                   /translation="MKKAIALGILSLTLATAASAQVKPEDQIKFRQAGYSFMSWNMGKI
FT                   KANLEGEYNPQQVQAAATAIAGIAGSGMGALYGPGTEKDIGNLKTRVKPEFFQEMPNVG
FT                   KLATDFNNAAANLAKVAATGDKAAVQKAFADTGSTCKACHDKYRME"
FT   gene            125517..131153
FT                   /locus_tag="Tmz1t_0108"
FT   CDS_pept        125517..131153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0108"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_1200 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52908"
FT                   /db_xref="InterPro:IPR024983"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV0"
FT                   /inference="similar to AA sequence:KEGG:Gmet_1200"
FT                   /protein_id="ACK52908.1"
FT                   /translation="MSNQPKVTIVRIPGRVRPDEPLRLASWIGGDSPLFAGVAPARSFR
FT                   LGATGSRGTAEDTVAEAIPEDALVEIEFEGGACFWTVGADLRKRLQEAGGASARGGSGA
FT                   DDGAWDLPSSIAAPVTGTRGLAGKLTIRALRWMGFDPVKAGLDKIVDLAETRSVPREGV
FT                   FLVGDDGIRGEPLKTPIPDGERTLILLHGTASNTRGSFSKLWLRQPKQWARLRACYGER
FT                   IFALEHCTLTRSPIENALKLARLLPRSGSLRLLSHSRGGLVGELLALDPARVDRAGITA
FT                   VLAAAQRENPPAAEALMQQEAQLFALLRELEARPALQIERFVRVACPVIGTSLAGEKLD
FT                   QWFSLLVLAAIADEMRRSNSRGMITSGLASLASHGLDMLAETAAAIIGSRKRADQLPGL
FT                   EAQMPGSALVRILNGNPGRGELFVVAGDAAPREQDWLAELRFCLIDRYFEQDHDLVVDT
FT                   RAMLDGPDRPVRKVFFRAGPTVNHFSYFGNEDSAAAVAAALTDAVDTATLFHDYAGEWP
FT                   LPAETARGLFAPRALADPPLQGARGIVVLVPGLCGSELQVAGREVWASVPALACGGFRK
FT                   TLRIDNPAVEPGDPLAGSYLALANALRSSGYVVRMHGYDWRKSVVDSIKGLGDTLSTAL
FT                   GDATAGKLPVHAIVHSMGGVLIRAAFAQDRGLWKRWKEQPRPEARVIMLGTPNQGSHAV
FT                   TLLLTKRDEFFAKLAMLDLHNSERELLEIAQHFPGVLELLPNAADENGEEIRLPATWQR
FT                   YCTADGQRWPVPPEAALTQSGELWRTLLAGDPLIDDERLIYVAGTAKETPRLAEIAEDG
FT                   RFRLLKTADGDGRVTWASGIPAKCREGGRLYYMNAVHGDMPAHTPAFPALQELLEKGET
FT                   GRSALTRKPVPIQARGAVEAPGEYAPVSPAMLSHYPTRSDLLAAATGATLRAPRTEREE
FT                   EMRTRVRVIHGDLIFVDAPVLVGHIQGTNNLEQAEYILDRALNGRMQNRLDAGIYAGPL
FT                   GSYALFPPQPEERFAAGAIVIGIGRVGELSPGSLCDGVARALVAYAITRHEERKRTHDR
FT                   QAATAGKPLQLPVCALLIGAAIGELSLRDSVTAILRGHRKARERLADAKLDDRIELTQL
FT                   DFVELLEDRAIQALNAARDAVTLDGELRRHFCIEDTLAKNEGGRQRAYAELGEDAWTRI
FT                   AISAVRIADGSGTQLLFNVHGDLARTEQLYNGIALGSIERFTRQLIDTESDNEEVGRTL
FT                   FELLLPNWLKDQAPDRRRAQLIIDSAVAGIPWELLRDRMEDDRSDRGGAPLSVRSGLVR
FT                   QLSTGRFRQRIQRADGFHALVVGDPDLGRLGDYFPQLAGAREEAAEVAQLLKDGGFDTP
FT                   PALLGGSAEQIQIALYQRDWRILHLSGHGIYRETLPTIDADHSAKPADEAVTATGMLIG
FT                   ENSVLTTAHIEQMRVVPDFVFINCCSLGRIEAERAMLGENRPGNPMLAANLATQLIEMG
FT                   VRGVIAAGWRVLDDAAKLFASTFYEAFLAGETFGEAVLAARRATFDRFPTTNTWGAYQC
FT                   YGDPSLLLRRPPSSHERRRHAARYDFVAPREVIAELERLTQQSRYQAMESADDRKRREE
FT                   RIDALARLCERRGWSGHGDIQEAFGQLWAEFGDHDRAIACYRAAQGAGDGSASMKATEQ
FT                   LINMLARRGSGLLAAGGPEAMAKGKALLGEAEQLITGVLAVAPNAERHCLLGSIWKRKL
FT                   KLTADNQLDAALKSMAQAYRNAENCALEAGGRLYYPALSVLHADLLRQLLGTLTPDEGK
FT                   AARQRIAAVRKEIEDPAFQARDFWDRVAPLDLALSEALFDTACEENADRQANDASFSKA
FT                   QEEYQALLAYSSRRERESVVGTLDALKTFLERLPAQRKGAHFARARELVGRLNTLADAL
FT                   RKLL"
FT   gene            complement(131205..131885)
FT                   /locus_tag="Tmz1t_0109"
FT   CDS_pept        complement(131205..131885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0109"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: azo:azo0089 hydrogenase
FT                   cytochrome b-type subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52909"
FT                   /db_xref="GOA:C4ZKV1"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV1"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACK52909.1"
FT                   /translation="MRKVRVWDLPTRLFHWLLAILVVAAYVTAQIGGSLIEWHGRVGIA
FT                   ITGLLAFRLVWGVIGSTYARFADFVPGPAHLWAHLRGHWSGLGHNPLGALSVLALLGVM
FT                   LYQAVTGLFSNDEIAFSGPLRALVSSETSDWLSGLHRQNYWAIIVLVGLHVSAVLFYAL
FT                   FKKDNLLRPMVTGMKEVDEADAQPAQGGGALAFAIALAITAAVLYFATGSFIEPPPPPP
FT                   PAAW"
FT   gene            complement(131954..138007)
FT                   /locus_tag="Tmz1t_0110"
FT   CDS_pept        complement(131954..138007)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0110"
FT                   /product="excinuclease ABC, A subunit"
FT                   /note="TIGRFAM: excinuclease ABC, A subunit; PFAM: ABC
FT                   transporter related; KEGG: azo:azo0088 putative
FT                   excinuclease ABC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52910"
FT                   /db_xref="GOA:C4ZKV2"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV2"
FT                   /inference="protein motif:TFAM:TIGR00630"
FT                   /protein_id="ACK52910.1"
FT                   /translation="MSVSATRYTPIDAPASISDAIRIRGARQNNLRNLSLDLPLNRLTV
FT                   VTGVSGSGKSSLVFDTLYAEGQRRYVETFSPYARQFLDRMDKPQVDRIEGVPPAIAIDQ
FT                   TNPVRTSRSTVGTMTELADHFKLLYARAAHLHCRCCGKPVRRDSAVSIAADLRARAAAA
FT                   GDPRLVVCFPVTVPSSFSEEEVTGLLAAQGYTRIQERLAGVGAEGQDVLQVVQDRFRAS
FT                   NAEDSRLAEALEAALQRGHGRLAVYASGEGVRAEKSAGTPGEAVWRYSSGLHCADCDIH
FT                   YSEATPGLFSFNSPIGACETCRGFGRVIGVDFGLVVPDESKTLAEGAIKPWQTESYREC
FT                   QQDLEKMAKKYGVAMDIPVRDLPPEHRQWLFEGDPKWKNWDSSWPRYWYGVRHFFDWLE
FT                   TKAYKMHIRVLLSRYRSYTECPACHGARLKPDALLWRLPTRAQASCRSGASRDHHVSSS
FT                   VGAAEPPIAACAAPTGSAPTAGESPTAGGVVTVGGANAAAGVSTVGTAPAVGEAAAAAG
FT                   IALAGVQGLAIHELMALPVDRIRDAIAALALPGVADEATELVLGEIRSRLTYLADVGLG
FT                   YLTLDRQSRTLSGGEVQRINLTTALGTSLVNTLFVLDEPSIGLHPRDIGRILGVMTRLR
FT                   DAGNTLVVVEHDPQVMVAADELLEIGPGPGERGGDIVARGTPAEIAANPDSVTGPWLAG
FT                   TKRIDVDRPPRPVDAATPRLKLVGARQHNLRDLTVGFPLRRLTCLTGVSGSGKSTLIQD
FT                   VLFPALAKHFGEAAESPGVFDRLENVDNLRGVVMVDQSPIGKSSRSNPVSYVGAWDPIR
FT                   ALFAALPEAKQRGYTPGTFSFNAGHGRCPTCTGSGFEHVEMQFLSDVWLRCPDCDGKRY
FT                   RPEVLELQWNGLSVADVLELTVHEALDVFREHPKVLAALAPLADVGLDYLRLGQPVPTL
FT                   SGGEAQRLKLAGHLAEAAQKKPVRKASVVDKFGDKAGDKTEPGLLFLFDEPTTGLHFED
FT                   VAKLLGAFDKLLQAGHSLIVIEHNLDVIAASDWIIDLGPEGGEDGGAIVVEGPPEAVRA
FT                   HASSHTGAALRDYAEALARTRAGNRGLSPVSADAEAPGSRRSGASRDHGGSGRAVATES
FT                   AIAACAAPTGDRSLVAAEPRVEYRPVAAPAIEIRHAREHNLKNVSLQIPRDQFTVITGL
FT                   SGSGKSTLAFDIVFGEGQRRYLESLNAYARQFVQPASRPDVDGLFGIPPTVAIEQRTSR
FT                   GGRKSTVATLTEIHPFLRLMYVKLGTQFCPDCNVPVTPQSFEAIVAQLQRELRGASVEV
FT                   LAPLVVNRKGLYTDLAKWARGKGHAQLRVDGEYLPTAKWPRLDRYKEHNIELPTGMVVV
FT                   QPESEATLREFVRQALEIGKGVIKVLEIGKLGAVPITFSTLRACPSCGTGFPEPDPRLF
FT                   SYNAKHGWCPKCYGTGLKTAARIEDPDALDLGDAEEVIVSDEPCPACDGARLNPVARAV
FT                   RFRDLGLHQLAAQPVDRAAGFFADLALNERETDIARDLVSEIRGRLAFLQHVGLGYLAL
FT                   DRAAPTLSGGEAQRIRLAAQLGSNLRGVCYILDEPTIGLHPRDNRLLLDTLEALRDRGN
FT                   TLLVVEHDEDTIRRADHVIDLGPGAGVRGGRVVAEGTIADLLAAPESATGECFRHPLQH
FT                   PLRPRRAVALENPAIRIEGANLHNLRDIDVRIPLARLTVVTGVSGSGKSSLARDVIHAN
FT                   LRARLGDPEATRARRRGQAQPEAVDQPLVGCAAMPGWHQVGRVLEVDQTPIGKTPRSCP
FT                   ATYVGFWDAIRKLFADTFDARTRGWNASRFSFNTGAGRCPVCDGAGQTTVEMSFLPDVK
FT                   TPCEACGGARFNPETLSVRWKDRTVAEVLAMPVDEAVDFFSAHPAIAHPLQLLQDVGLG
FT                   YLTLGQPSPTLSGGEAQRIKLVTELAKVRRRPGDAEDTGGVPLPADKHSLYVLDEPTVG
FT                   LHMADVDKLIRVLHRLTDAGHTVLVIEHDLDVMAEADWLIDLGPEGGEGGGRVVAEGPP
FT                   EVAMATPESHTGRHLREFLAQRKTE"
FT   gene            138384..139571
FT                   /locus_tag="Tmz1t_0111"
FT   CDS_pept        138384..139571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aca:ACP_1781 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52911"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV3"
FT                   /inference="similar to AA sequence:KEGG:ACP_1781"
FT                   /protein_id="ACK52911.1"
FT                   /translation="MDPIRNPFSPGAGTPPPELAGRDDLRESLRIALERARIGRPAKSA
FT                   MLVGLRGVGKTVLLDRIRMDAEAAGIHTVRIEAPEGRSLPALLAPQLRQALLRLSQIAA
FT                   AKDYAVRGLRALAGFVGKLKVTFGDIEVGIDYEPEPGLADNGDLEHDLQALFEQVGLAA
FT                   KSASTALAIFVDELQYVEEAQLAALITAMHRTEQRQLPVVLVGAGLPQLRGQMGNAKSY
FT                   AERLFDFPMIGPLPPAAARLAIEKPIENEGVAITERAVSQILQVTQGYAYFLQQWGSHT
FT                   WQAAHASPIDIDAVNAASVTAVAALDESFFRVRFDRLTPKEKRYLRAMAELGEGPHRSG
FT                   DIANCFSAPVSSLAPTRSSLITKGMIWSPNHGDTAFTVPMFNEFMKRIMPGDDWR"
FT   gene            complement(139992..140528)
FT                   /locus_tag="Tmz1t_0112"
FT   CDS_pept        complement(139992..140528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0112"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52912"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52912.1"
FT                   /translation="MNEQVKELTPQTLMSSSNRLIEIHITQARLRALRLVAFTGAVFPG
FT                   EWSVQWNEAIVPDLLEFGFHARKVNEFCGLMDEEFGPIDVRIVKISEGDPGIWETNYRN
FT                   ALNALMHMQTFSIGHVHADHRRIFLAAESNLIATYIKVSTDRFPEVTISLFGLVDCFLN
FT                   RVLQKVREKHPQLRF"
FT   gene            complement(140674..141450)
FT                   /locus_tag="Tmz1t_0113"
FT   CDS_pept        complement(140674..141450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0113"
FT                   /product="ATP-binding region ATPase domain protein"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   SMART: ATP-binding region ATPase domain protein; KEGG:
FT                   pen:PSEEN1772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52913"
FT                   /db_xref="GOA:C4ZKV5"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV5"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK52913.1"
FT                   /translation="MRYDKQNKRIENLSQQVTDLIRQNAALKKEVDSTREILNNTLHEI
FT                   RRFSAQLSKFCERISRDTQSDPGLNQAALSAFYTAGMISSRLAYTDIELNPKAIESQTP
FT                   LRSGIFKKFDKTKRILAEEAKNRNVTISLFGESRTEIDALPVFELLPFVILENAVKYSP
FT                   QNQTIEIIFESFSGRQQVTVKSYGPDVEDDELPRLFEKGFRGALTKTMPGEGLGLFLAK
FT                   RVCDFHGISIFAEVRNRKKFIFNGIEYSEFLIQVRF"
FT   gene            complement(141451..142125)
FT                   /locus_tag="Tmz1t_0114"
FT   CDS_pept        complement(141451..142125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0114"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52914"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52914.1"
FT                   /translation="MFIQLGTPERLNSIGQETIDLKEAKSRIEIAVLDDKPFAPKDSLV
FT                   SHGFRIRELGPDIRSIDMISAYPIVICDVRGVGKAFGSSLEGAHLVSEIRKDYPDKYIV
FT                   SYTGETYSLPLTNALAAADKRLAKDDSIDVWIKTLESGLNEVSNPRNRWIRLRTALLSR
FT                   GVELHHVFNLEQALIKAVHARKPEILNNKATSAEISAEAKDLVIKFSATALATLISSAL
FT                   GI"
FT   gene            complement(142196..143083)
FT                   /locus_tag="Tmz1t_0115"
FT   CDS_pept        complement(142196..143083)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mno:Mnod_3577 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52915"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52915.1"
FT                   /translation="MATLEIRHEVDRFVLYFDTPRREISAYALATALVGLADAVREANA
FT                   IVNPGYVVEVVVEALSDGSFKATVRTIFTKAKNLFSHQAVQAVIWGIVATHIYEKAIKT
FT                   EVPPNITVTDTLVTIEIGNEKIIVPKDVYEAKKQVERSERFNNALGKVFDAAASDPNVE
FT                   GIAIVDGTGPQRPPLIVPREKFALFQTEQPVDESTREIVEITHVEISRAILERGKRRWE
FT                   FFWRGVRIAAPVLDQKFFDRFFAHEIMIAPGDSLEVALRIVQEKKPDSGIYVNVRYEIV
FT                   EVFQHLPRLTQHAL"
FT   gene            complement(143447..144070)
FT                   /locus_tag="Tmz1t_0116"
FT   CDS_pept        complement(143447..144070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0116"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   rfr:Rfer_3267 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52916"
FT                   /db_xref="GOA:C4ZKV8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKV8"
FT                   /inference="protein motif:PFAM:PF00043"
FT                   /protein_id="ACK52916.1"
FT                   /translation="MDKLKLTYFDVSGGRAEPARLALHIGGIPFEDKRFAFGDFAEVRK
FT                   TTPLDQVPTLHVNDVQVTQSDAITRYAGKLAGLYPEDDLQALFCDEVMGALEDINTKIV
FT                   ATFGMTGDALKHARDALAAEVLPRYLRWLQNQLEAHGGEFLADHRLTIADLKTFVILRW
FT                   LGSGKLDHIPADLVETVAPKLAAFVDRIAGIPAIAEYYKLRGGS"
FT   gene            complement(144153..144673)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0117"
FT   gene            complement(145036..145812)
FT                   /locus_tag="Tmz1t_0118"
FT   CDS_pept        complement(145036..145812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0118"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: mms:mma_2801 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52917"
FT                   /db_xref="GOA:C4ZJB0"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZJB0"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACK52917.1"
FT                   /translation="MNPAQLERLADHLTKLRLFKSRERLEALLQQAAAEDMAYADFLEQ
FT                   VLAEEVAAKTSKNVTMRTAMARFPFVKPLETFDFAYQPSIDKKQVHTLAMCHFIEHGDN
FT                   VLVLGPPGVGKTHLAVALGLKAIEAGYRVLFTTAASLIAALTKAHAEGRLDEKLKIYTT
FT                   PRLLIIDEIGYLPIERQGANLFFQLISRRYERGPMILTSNQSFGAWGEVFGDRVIATAI
FT                   LDRLLHHAVTLNIRGNSYRLKEKLKAGLVRPEEAEA"
FT   gene            complement(145809..147158)
FT                   /locus_tag="Tmz1t_0119"
FT   CDS_pept        complement(145809..147158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0119"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: bpt:Bpet1147
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52918"
FT                   /db_xref="GOA:C4ZJA9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZJA9"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACK52918.1"
FT                   /translation="MEGKEVFDDVAPRGDIVGGASATVPVSGQSEEARMLTRERWEEVH
FT                   RLRAGGLSVSAIARGLDLDRKTVRRCLRQPAWSPYRREASAVCLLDAHRPWLLERAPQV
FT                   GYSARILYQELRARHGYRGGYDTVKNAVRPLRKEATLAALTQRRFETGPGEQAQVDWGQ
FT                   VKVRLGDETRTVHVFVMTLGYSRRCWVEGFENERLTSLLAAHEHAFAHFGGRTAQLLYD
FT                   RMRTVVLGSEAGRIRWNPTFEAFARHWGFEPRLCKPYRAQTKGKVESGVKYVKRNFVPG
FT                   RSFHDLDDFNAQLLQWVQEVADVRVHGTTHQRPIERFAEEAAALVPTASQASFLQAMVR
FT                   DRVVADDWLVSIDANRYSVPCRLIGKTVQVVRAGGLWQIRYRGELVAEHAVLAGRHQLS
FT                   IEPEHGPGAAARNARQRYGTAPAPAQSSVQHDDWVEVRDLSIYEQMLEAA"
FT   gene            complement(147423..148073)
FT                   /locus_tag="Tmz1t_0120"
FT   CDS_pept        complement(147423..148073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0120"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ade:Adeh_1402 hemerythrin HHE cation binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52919"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW1"
FT                   /inference="protein motif:COG:COG3945"
FT                   /protein_id="ACK52919.1"
FT                   /translation="MKLIETLQDEHVLIDQVLGSFRAFVDGFIDGTADPDDGGRFAAFF
FT                   TEFAGHFHHDREERVFLNALVTDAELPGDRGPVYAVLHEHAEMAAWLCEMLPILEQRPP
FT                   SEDDRVRLRALATRYSHALWRHIDAENSVLYPEGVKRLRRSGVAELPDRPMSEAEAAAR
FT                   EGAAALLVRYPPVEDFALTRGDGCFMCRAHGETCDGLEAEWWTEIEWEEFYLG"
FT   gene            complement(148441..149355)
FT                   /locus_tag="Tmz1t_0121"
FT   CDS_pept        complement(148441..149355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0121"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: mex:Mext_0486 LysR substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52920"
FT                   /db_xref="GOA:C4ZKW2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK52920.1"
FT                   /translation="MRRISLEDLHIFRCVAVEGGVLRAAARLNRVPSNVTTRIKQFESR
FT                   LGTQLFRRQGRNVVLTDAGHRLLGHAERLLRLADEAEEDLCSGVVAGSLRLGSLESAAS
FT                   VRLPPILSRYHAAHPRTHVELQTGTTAALLRRLDNHQIDAAFVSEPFDKGSLSAVAVFA
FT                   EELVLITARGGPRIGGAQDLADQTVVAFPHGCSYRRLLVDWFAAAGVTPRRFLDLGSYH
FT                   AIVACVAAGTGVAIMPASVLDNAVMGDSIQRHELPEAMRTNRTNLVWAGEPGGPLSALL
FT                   ELLRVGAQAGACGRHGRTSKSMP"
FT   gene            149420..150628
FT                   /locus_tag="Tmz1t_0122"
FT   CDS_pept        149420..150628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0122"
FT                   /product="protein of unknown function DUF1228"
FT                   /note="PFAM: protein of unknown function DUF1228; major
FT                   facilitator superfamily MFS_1; KEGG: mex:Mext_0485
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52921"
FT                   /db_xref="GOA:C4ZKW3"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW3"
FT                   /inference="protein motif:PFAM:PF06779"
FT                   /protein_id="ACK52921.1"
FT                   /translation="MEKNPPSSLSPGTTVFIGLLALAIAMGIGRFAFTPLMPLMVRDGS
FT                   LNTVTGTEWATANYVGYLLGAISASWFARSPRLGLQVGLLGVAATTLAMAWGNAALPWL
FT                   GLALRASAGVFSAWVLVCASSWCLPELARRSSTSLGGWIYTGVGVGIAATGVLTWLGGA
FT                   QAAAVLWVELGLLAVVGAVHVMWRLRGQSAAASPAGTPDAPKPPPPAVASGNLGIVLCY
FT                   SAFGFGYIIPATFLPTMARQLVSDPLVFGLTWPIFGGAAALSVAFAAHRLHGWPRRKVW
FT                   AIAQGVMAAGTLLPLLQPALWVLAASAVLVGGTFMVTTMAGLQLARERAPANPTALLAR
FT                   MTTGFAAGQIAGPLLVRLVGDTRIAGLDALGLASATAGLLLAMTAIWLWRDDIAAATKP
FT                   RSA"
FT   gene            150793..151179
FT                   /locus_tag="Tmz1t_0123"
FT   CDS_pept        150793..151179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0123"
FT                   /product="succinate dehydrogenase, cytochrome b556 subunit"
FT                   /note="TIGRFAM: succinate dehydrogenase, cytochrome b556
FT                   subunit; PFAM: succinate dehydrogenase cytochrome b
FT                   subunit; KEGG: eba:ebB154 putative succinate dehydrogenase
FT                   cytochrome b subunit (succinate dehydrogenase, cytochrome
FT                   b556 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52922"
FT                   /db_xref="GOA:C4ZKW4"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW4"
FT                   /inference="protein motif:TFAM:TIGR02970"
FT                   /protein_id="ACK52922.1"
FT                   /translation="MDKPPHRLPVFLNLAQIRFPIGAIASIAHRVSGVLLFIALPVLAA
FT                   LLHASLRSEADFASVRGLLSSPLSLVVAGVLAWALAHHVLAGIRHLLMDVGIGSELERA
FT                   RASARLILVAAPALALLLLVWGLS"
FT   gene            151176..151517
FT                   /locus_tag="Tmz1t_0124"
FT   CDS_pept        151176..151517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0124"
FT                   /product="succinate dehydrogenase, hydrophobic membrane
FT                   anchor protein"
FT                   /note="TIGRFAM: succinate dehydrogenase, hydrophobic
FT                   membrane anchor protein; KEGG: eba:ebA4576 succinate
FT                   dehydrogenase,hydrophobic membrane anchor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52923"
FT                   /db_xref="GOA:C4ZKW5"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW5"
FT                   /inference="protein motif:TFAM:TIGR02968"
FT                   /protein_id="ACK52923.1"
FT                   /translation="MRLFTGQRAWVVQRLSALLLLVLILLAMLALPFASPLDFSAWRAL
FT                   AGGALGGPLIALLFGALCAHAWVGMRDIVLDYLQPRGLRLAVLGLITVVLLGVLARVLL
FT                   SLAMVALAA"
FT   gene            151535..152230
FT                   /locus_tag="Tmz1t_0125"
FT   CDS_pept        151535..152230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0125"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.5.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: eba:ebA4578 succinate
FT                   dehydrogenase iron-sulfur subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52924"
FT                   /db_xref="GOA:C4ZKW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW6"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ACK52924.1"
FT                   /translation="MRLNIYRYDPERGDPPRMQAYDVQPEAGDKKLLDLLMRLRVQDDS
FT                   LSFRRSCREGVCGSDAMNINGRNGLACLTALDGLKEPIVLRPLPGFPVIRDLVVDMTQF
FT                   FAHYHSIRPWLINDEPLPERERLQTPPERERLDGLYECILCACCSAFCPSYWWNPDKFI
FT                   GPSGLLQAYRFIADSRDTASAERLDFLDDVYRLYRCRTIMNCTEVCPKGLSPSHAIERI
FT                   RLALLQRSS"
FT   gene            complement(152288..152863)
FT                   /locus_tag="Tmz1t_0126"
FT   CDS_pept        complement(152288..152863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0126"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52925"
FT                   /db_xref="GOA:C4ZKW7"
FT                   /db_xref="InterPro:IPR009698"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW7"
FT                   /inference="similar to AA sequence:KEGG:ebA6570"
FT                   /protein_id="ACK52925.1"
FT                   /translation="MSSLHLPPMLWSSDAAWTELSRRPPSLATLVFGVALPAAMLPPAM
FT                   LSHATDVGSAHYLPALSASAWQFVEFALFAAQLVGFLMIRWLIGAVAATHGVRASARDA
FT                   CLLATVSLLPLWLSSFALLQDGTLAVLVLPVLAIGASVALLKRGVRCMLGVREEIVALE
FT                   IGIVAIHCGVLAWAATMAVFLVPGLPAL"
FT   gene            complement(153046..153540)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0127"
FT   gene            153626..153697
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0128"
FT   gene            153808..155484
FT                   /locus_tag="Tmz1t_0129"
FT   CDS_pept        153808..155484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0129"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pol:Bpro_2832 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52926"
FT                   /db_xref="GOA:C4ZKW8"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW8"
FT                   /inference="similar to AA sequence:KEGG:Bpro_2832"
FT                   /protein_id="ACK52926.1"
FT                   /translation="MAEHAAEPTVKHFRLALLWPLRLLTATGALGPQQRPWQVLRDLGE
FT                   ASPWREVEHDLEVEGSVFQERHYNEFVTFLPYVQQFLYGEGRAQRGDSADAGPAMRVFR
FT                   RRDIAKLRVAARDGDAPVTLDVVHVHLYFFFDVDVVILNVEVAGGDLPLSAVQELMYRI
FT                   GRAYPSGWDEHGRALHSLAVAELIGRDGSVLARTDAHEREAFLTHVSRHRAPRIAAHWA
FT                   WLMQPLASAYSAQPGTLRYRQIEYHRMPLTAYLALDDPQALTRRDFVRLGLVTGAGPHT
FT                   AQAEREGGGNALPYAEPHLDDFERRHCYDRFWSASGAAPWTRYLCSGHALVVVGDAKSA
FT                   YFTDRERGVLAQFRHQHFLLFLIAHFQKSALLMFSERLVEALKRLHVTDPESVRRFKRA
FT                   IRASFEGFLRFTHRYWFHDIAEQAQTRALFRMTSAHLGTDALYAEIKERTADMNGYLEA
FT                   DSLRRQANTVVRLTVVTIFGLIGTITTGFLGMNLLAEAESPLAERLAYFALVFGVSTAL
FT                   TLYTMVKSKRLSDFLDAVSDERLSTWNKLRALAAVWRRGAD"
FT   gene            complement(155494..156642)
FT                   /locus_tag="Tmz1t_0130"
FT   CDS_pept        complement(155494..156642)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0130"
FT                   /product="glutaredoxin"
FT                   /note="PFAM: glutaredoxin; KEGG: psa:PST_1911 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52927"
FT                   /db_xref="GOA:C4ZKW9"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR011767"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKW9"
FT                   /inference="protein motif:PFAM:PF00462"
FT                   /protein_id="ACK52927.1"
FT                   /translation="MAIAAVLRTLLLLACLLFAHASPGADAGTAAPALDLPAPGQLHVY
FT                   VREGCPHCAEAKRFLAGLADARPGLQVVLREVDRDPVARDALVAISEAVGAWPPGVPTF
FT                   VYGGRVLVGFDDAEHVGAELLRLLDEAPPPPRDRVESGLFGTLSASELGLPLFTLALGL
FT                   LDGFNPCAMWVLLFLLSLLVRLQDRRRMAMVAGTFVLASGAVYYAFMAAWLNVFLLVGM
FT                   TAALRVGLAVLAMLIGLINVKDFFAFRRGVSLSIPESAKPGIYARARAILKAESLPASL
FT                   AAVAVLAVVVNFVELLCTAGLPAIYTAVLTGQDLSPLAHYGYLGLYILAYIADDALMVG
FT                   TAVLALGSGKLGERGGRMLKLLAGVVMLALGAVMLLRPEWLM"
FT   gene            complement(156672..157244)
FT                   /locus_tag="Tmz1t_0131"
FT   CDS_pept        complement(156672..157244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0131"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azo:azo0087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52928"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52928.1"
FT                   /translation="MNASRLLLALAASVLVVACAPEPAPAPKVEQAAPAPEAPRGEAAE
FT                   ARREAAEAAREAMQKAGEAARKIGEAGSAAVEAAVRTAAEKAASEFAKDASRASSDAGA
FT                   LNQAPDEDRGGDGRSPETARDAKEAAEQAAHRIAEATRDVAERLREVGKGALESMRART
FT                   EPTTQEAAPVEERAAVPPGGGKEPAGR"
FT   gene            complement(157388..157945)
FT                   /locus_tag="Tmz1t_0132"
FT   CDS_pept        complement(157388..157945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0132"
FT                   /product="translation elongation factor P"
FT                   /note="TIGRFAM: translation elongation factor P; PFAM:
FT                   Elongation factor P ; Elongation factor P/YeiP protein;
FT                   Elongation factor KOW domain protein; KEGG: azo:azo0086
FT                   elongation factor P"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52929"
FT                   /db_xref="GOA:C4ZKX1"
FT                   /db_xref="InterPro:IPR001059"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR011768"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013185"
FT                   /db_xref="InterPro:IPR013852"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015365"
FT                   /db_xref="InterPro:IPR020599"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX1"
FT                   /inference="protein motif:TFAM:TIGR00038"
FT                   /protein_id="ACK52929.1"
FT                   /translation="MKTAQELRSGNVIMVGSDPLVVQKAEYNKSGRNSAVVKMKFKNLL
FT                   TGAPSESVYKADDKFEVVVLDHKEVTYSYFADPMYVFMDADYEQYEVEADNMTDALKYL
FT                   EDGLQCEVVFYNGKAISVELPNSVVREVVYTEPAVKGDTSGKVMKPAKISTGFELPVPA
FT                   FVEIGDKIEIDTRTDEYKNRVK"
FT   gene            complement(158011..159198)
FT                   /locus_tag="Tmz1t_0133"
FT   CDS_pept        complement(158011..159198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52930"
FT                   /db_xref="InterPro:IPR016633"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX2"
FT                   /inference="similar to AA sequence:KEGG:azo0085"
FT                   /protein_id="ACK52930.1"
FT                   /translation="MHRFRSPARPRWEIFCQVVDNFGDIGVCWRLATDLARRGGGAVRL
FT                   WVDEWEALRRICPAAAAVDERAGGSVQGVELRRWTSAFVPLVPGEIVVEAFACELPAAQ
FT                   LEAMAALRQAPLWINLEYLSAEAWVAGCHGMASPHPRLPLVKHFFFPGFDAGTGGLLRE
FT                   ADLLARRDAWRARPEGRAAWLAARGIASGPDALRVSLFAYEQPELPALFDAWAGSGREM
FT                   LVLVPESRVLGDVQRALGRERLQAGDRVVRGALTACVLPFTDQAGYDELLWACELNFVR
FT                   GEDSFVRAQWAARPFVWQIYPQADAAHHDKLEAFLARYLQGLPAAEADALARFWRAWNG
FT                   CAPDRATPAEAWPALAAALPGLDVHARRWCDVQAELPDLATALDTFCSHIAHAAR"
FT   gene            159566..160528
FT                   /locus_tag="Tmz1t_0134"
FT   CDS_pept        159566..160528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6186 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52931"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX3"
FT                   /inference="similar to AA sequence:KEGG:ebA6186"
FT                   /protein_id="ACK52931.1"
FT                   /translation="MHGRKLLPLALILAFPALAIAQSAQQQGLPSPEAAQEQALLEQSR
FT                   TQVRGFSVWLGETVNDWFGDRPFEEGGKVTNGRLGLRNLWRQDEGWNTNVRFRARFDLP
FT                   NLRDKAYVFIGRQNERELVTDQSEAFTREQLLLEERRKEDQTGFAGVGVALRKNLDFRV
FT                   GVRGGMKFYTQARYRKQWALTELDRIEFRETVFWNNKDKFGSTTALDYEHAFTPSLSLN
FT                   WQNATTISEKTDDFAWGSSLGLFKRFGDDRILSGEMLVTGETGAEENVDEYGVRMKWTQ
FT                   PVYRDWLIGEFIVGHYWPQREDRERERAWGVGVNLEMRF"
FT   gene            complement(160792..161529)
FT                   /locus_tag="Tmz1t_0135"
FT   CDS_pept        complement(160792..161529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0135"
FT                   /product="pseudouridine synthase"
FT                   /note="PFAM: pseudouridine synthase; RNA-binding S4 domain
FT                   protein; KEGG: azo:azo0084 pseudouridylate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52932"
FT                   /db_xref="GOA:C4ZKX4"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX4"
FT                   /inference="protein motif:PFAM:PF00849"
FT                   /protein_id="ACK52932.1"
FT                   /translation="MQLERLLHAQGFGSRKDCRALIRAGYVSVAGEVCDDPTEEFDPGS
FT                   RDGSPGLEFTVDDQPWRFRAQAYVVLHKPAGYECSQKPTFHPSVFTLLPPQLLARGVQC
FT                   VGRLDQDTTGLLLLSDDGQFIHQWSSGKKRTPKVYEVTLKHAVEQDFADRLVAGVELND
FT                   EPVPIAAAACELLSPTTLRLTICEGKYHQVKRMVGAAGNRVEVLHRSRVGGLDLPAGLA
FT                   PGQWRWLEAEDLARLADYADATS"
FT   gene            161665..162132
FT                   /locus_tag="Tmz1t_0136"
FT   CDS_pept        161665..162132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0136"
FT                   /product="Domain of unknown function DUF1857"
FT                   /note="PFAM: Domain of unknown function DUF1857; KEGG:
FT                   azo:azo0083 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52933"
FT                   /db_xref="InterPro:IPR015075"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX5"
FT                   /inference="protein motif:PFAM:PF08982"
FT                   /protein_id="ACK52933.1"
FT                   /translation="MKFEHLIEVNDLADPLLTPLTREELWFGLLCRAEDARAFLPGLEA
FT                   CRIVERGAGSLVRDLHFGHAVIRDRVNFDTLRWIRFETEANAQHAGGSLTITIEEPEPG
FT                   ALFLRFAYHTSLPDQGEDARYAEFVRSAYHQSDLDTVRIIRMIAASGGLEQ"
FT   gene            162325..163320
FT                   /locus_tag="Tmz1t_0137"
FT   CDS_pept        162325..163320
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0137"
FT                   /product="putative exonuclease RdgC"
FT                   /note="PFAM: putative exonuclease RdgC; KEGG: azo:azo0082
FT                   recombination associated protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52934"
FT                   /db_xref="GOA:C4ZKX6"
FT                   /db_xref="InterPro:IPR007476"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX6"
FT                   /inference="protein motif:PFAM:PF04381"
FT                   /protein_id="ACK52934.1"
FT                   /translation="MWFKNLQVYRLPANWDMSAERLEEQLAKKPFHPCGSQDMESRGWL
FT                   SPLGNEVLVHAVGGQWLVCLGFEHRLLPSAVVKQEADERAEELAEQQGYKLGRKQLKEL
FT                   REQVTQELMPRAFTRRRRMFAWIDPINGWLVVDAASQSKAEDMLEQLRHTLDSFPLTLL
FT                   RTERSPMSAMADWLAGGEAPDGFTIDQDCELRSVAEDKAAVRYARHPLEGDDVKGHLEA
FT                   GKLPTRLALTFDDRISFVLTEKLEIKRLDFLDIVRDQVGEADKDDAEALFNAEFALMTG
FT                   ELAHLLPAVVAALGGELAGAAVETGVSAELPRVQKEMAAAQTVAADDPPF"
FT   gene            163813..164268
FT                   /locus_tag="Tmz1t_0138"
FT   CDS_pept        163813..164268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0138"
FT                   /product="protein of unknown function DUF107"
FT                   /note="PFAM: protein of unknown function DUF107; KEGG:
FT                   dar:Daro_0261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52935"
FT                   /db_xref="GOA:C4ZKX7"
FT                   /db_xref="InterPro:IPR002810"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX7"
FT                   /inference="protein motif:PFAM:PF01957"
FT                   /protein_id="ACK52935.1"
FT                   /translation="MNDTMFLEWWHWEIAGIALVLLELALPSFFIIWFGLGAMLTGFVL
FT                   LAMPDLALSQQIAVWIIASMAMTVLWFSFAKRARVRTLIGTAAGEVIGEVGLLVSAVAP
FT                   FERGKVRFQRPVLGADEWACVAESAIAAGERVKVVSVEGSYVKVTKA"
FT   gene            164289..165158
FT                   /locus_tag="Tmz1t_0139"
FT   CDS_pept        164289..165158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0139"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; SMART: band 7 protein; KEGG:
FT                   azo:azo2269 band 7 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52936"
FT                   /db_xref="GOA:C4ZKX8"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR001972"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX8"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACK52936.1"
FT                   /translation="MIMSEGLAIAIAVLVFVVITIAKGVRLVAQGEEWVVERLGKYHAT
FT                   LRPGLNILIPYLDRVAYKLVTKDIILDVQEQEVITRDNAVILTNAIAFVKVTDPVKAVY
FT                   GVTDFSEAIRNLIMTTLRSIVGEMELDEALSSRDKIKARLRESIADEAVDWGLTVKSVE
FT                   IQDIKPSESMQRAMELQAAAERERKAAVTKAEGAKQAAILEAEARLESAKRDANAQVML
FT                   AEASAESIRRVTAGIGDQAGPMMYLLGEKYIAALEKLGDSGSAKIVVMPADLQETLRGL
FT                   VGRLGARG"
FT   gene            165226..165606
FT                   /locus_tag="Tmz1t_0140"
FT   CDS_pept        165226..165606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0140"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52937"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKX9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52937.1"
FT                   /translation="MRKSSKPVRSLIAAVALVTVSTGALAQNFMKDKAEVEKLLTGATF
FT                   IGVYLRTESAYTLQFGTDGTLTDTTGAKARWWVDEQARYCREWLDGKLKGNTGCMNLEL
FT                   EEGQVALYSEGKKVVEGIVTRK"
FT   gene            165627..166148
FT                   /locus_tag="Tmz1t_0141"
FT   CDS_pept        165627..166148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0141"
FT                   /product="Protoporphyrinogen oxidase"
FT                   /EC_number="1.3.3.4"
FT                   /note="KEGG: rfr:Rfer_4072 protoporphyrinogen oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52938"
FT                   /db_xref="GOA:C4ZKY0"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR026816"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY0"
FT                   /inference="protein motif:PRIAM:1.3.3.4"
FT                   /protein_id="ACK52938.1"
FT                   /translation="MRLLIVYSTIDGHTLEICERIAAIARATGHEVELAEVESASAEQL
FT                   EACDRVVIGASIRYGHHRPAVKAFIDRHQAALEARPNAFFSVNAVGRKPHKRQADTNPY
FT                   VRKFLGQLRWKPQQVEAFGGKIEYPRYGFFDRNMIRLIMWVTGGPTDPRSVTDFTDWTQ
FT                   VEAFAHQLLA"
FT   gene            166152..166352
FT                   /locus_tag="Tmz1t_0142"
FT   CDS_pept        166152..166352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0142"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52939"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52939.1"
FT                   /translation="MTENARAVEPIAGWALWRLDDNGNRFVVAVFAHREEAEAAVRAFE
FT                   AHGHKQTYWVEAAGDRGCPPV"
FT   gene            complement(166628..167785)
FT                   /locus_tag="Tmz1t_0143"
FT   CDS_pept        complement(166628..167785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0143"
FT                   /product="amidohydrolase"
FT                   /EC_number="3.5.1.32"
FT                   /note="KEGG: pol:Bpro_4523 peptidase M20D, amidohydrolase;
FT                   TIGRFAM: amidohydrolase; PFAM: peptidase M20; peptidase
FT                   dimerisation domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52940"
FT                   /db_xref="GOA:C4ZKY2"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY2"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACK52940.1"
FT                   /translation="MSTLLQELSTNQEAMKTWRHHMHRHPEVAFDEHKTASYIARLLRE
FT                   WGYEVTEGVGKTGVVARMRCGDSKKSIGLRADTDALAVQEANDSDHKSTIEGKSHTCGH
FT                   DGHSAMLLGAAQHLARTRAFNGTVNLIFQPAEEIMGGAVAMIQDGLFERFPMDAVFGMH
FT                   NMPALEQGKMYFTSGPLFAAVDNWEIVLTGVGSHGSMPEKSIDPVVAGASLVMALQTIV
FT                   SRNVAAKDSAVVSVGAFLAGDAGNVIPQTATLRLSTRTSKPETRQLVLAKIKSITAAQA
FT                   EAFGVRYEIREGSPGAVLVNDPALTEECADIARKLLGEDQVVMPGPTYMGSEDFAFFAQ
FT                   LKPSTYCIIGNGDTAMVHHPKYDFDDDNLPVGAAYWVALTQHHLK"
FT   gene            complement(167930..169398)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0144"
FT   gene            169595..170485
FT                   /locus_tag="Tmz1t_0146"
FT   CDS_pept        169595..170485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0146"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: rme:Rmet_3555 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52941"
FT                   /db_xref="GOA:C4ZKY3"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY3"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK52941.1"
FT                   /translation="MKEHQLRALVQVAECSSIRAAARSMHLSQSALTKSLRELEEDVGE
FT                   ELMTRSYKGIEFTPAGSMLLSHARLALSILDKAAREIRLLRGGAGARVVLAVTPMAGAV
FT                   ALPRVLREYEKLCPDAEVHLTEGLLSQVLPDLIEGRLDFAIAVADPAELPYEVIFEPLG
FT                   PANAVLEGREGHPLAAATTWAELRDAKFVMNLSPGSLGRALMSWMEQQGLPTPRHVIHC
FT                   SSTLLMLELMQRTDCIGIGPGRLFDDKFVGYGLQRIDVTPMPPPMCFGLLRLRALPLST
FT                   AAKPMATLFSRYLST"
FT   gene            complement(170546..172153)
FT                   /locus_tag="Tmz1t_0147"
FT   CDS_pept        complement(170546..172153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0147"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   azo:azo0080 peptide chain release factor"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52942"
FT                   /db_xref="GOA:C4ZKY4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="InterPro:IPR041732"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY4"
FT                   /inference="protein motif:TFAM:TIGR00503"
FT                   /protein_id="ACK52942.1"
FT                   /translation="MTTTPFPPELLRDVEKRRTFAIISHPDAGKTTLTEKLLLFGGAIQ
FT                   LAGTVKARKSARHATSDWMEVEKQRGISVTSSVMQFEYQGHTINLLDTPGHEDFSEDTY
FT                   RVLTAVDAAVMVIDAAKGVEAQTIKLLEVCRLRNTPIITFVNKLDREVREPFELLAEIE
FT                   DVLKITCAPVTWPLGMGKAFRGVYHLLQHQVLTFTPGEERRSDGEIIKGLDNPELDKRF
FT                   PMEVGQLREDVELIDGASPPFDLDDFLAGKQSPVFFGSGINNFGVQEILQSLIDWAPPP
FT                   QARDGGSRMVQPAEPAFTGFVFKIQANMDPKHRDRIAFFRICSGRYSAGMKVRHVRAGR
FT                   EMKLANVLTFMANERVIMEDGVAGDIVGIHNHGQLQIGDTLTEGENLGFKGIPYFSPEM
FT                   FRAARLRDPLKSKQLQKGLQELGEEGAIQVFELEGGQMLLGAVGVLQFEIVAQRLKDEY
FT                   KVDAIFEPADIHTARWLTFPDDVTRRNFEREQALRLGKDIDGNPVYLATSRYNLAVTAE
FT                   KWPKVTFHATREHGEVLG"
FT   gene            complement(172290..172508)
FT                   /locus_tag="Tmz1t_0148"
FT   CDS_pept        complement(172290..172508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0148"
FT                   /product="17 kDa surface antigen"
FT                   /note="PFAM: 17 kDa surface antigen; KEGG: bbr:BB4017
FT                   osmotically inducible lipoprotein B precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52943"
FT                   /db_xref="GOA:C4ZKY5"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY5"
FT                   /inference="protein motif:PFAM:PF05433"
FT                   /protein_id="ACK52943.1"
FT                   /translation="MKIRTLVPALLLAAATTGCATWDNMSSREKSAATGAAVGGVAGAV
FT                   ITDGGILGTVGGAAIGGVIGDQVGKKK"
FT   gene            complement(172745..174127)
FT                   /locus_tag="Tmz1t_0149"
FT   CDS_pept        complement(172745..174127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0149"
FT                   /product="fumarate hydratase, class II"
FT                   /note="TIGRFAM: fumarate hydratase, class II; PFAM:
FT                   fumarate lyase; KEGG: pmy:Pmen_1689 fumarate hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52944"
FT                   /db_xref="GOA:C4ZKY6"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR005677"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR018951"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY6"
FT                   /inference="protein motif:TFAM:TIGR00979"
FT                   /protein_id="ACK52944.1"
FT                   /translation="MTRSETDSLGPIDVPAEAYWGAQTQRSLHHFAIGEERMPIAIVHA
FT                   LALIKKAAARVHARSGELPAEIARLIEQAADEILAGRHDAQFPLVVWQTGSGTQTNMNV
FT                   NEVVAGRANELAGQGRGGKAPVHPNDHVNRAQSSNDCFPTAMHIAAARAVHDELLPAIT
FT                   ELSNGLAIQAERHAGVLKTGRTHLMDATPITFGQELSAFVAQLNTAAHAIRAALPAVCE
FT                   LAQGGTAVGTGLNAPPGFGVEITAELAALTGLPLVSAPDKFAALAGHEPLVALSGALKT
FT                   LAVALMKLANDLRLLGSGPRAGLAELKLPANEPGSSIMPGKVNPTQCEALSMIACQVLG
FT                   NDATIAFAASQGHLQLNVFKPVIAYNLLQSIRLLADGCRNFQRHCVAGLEADRARMSEH
FT                   LERSLMLVTALNPHIGYDKAAQIAKKAWAEGTTLRTAALALGFTSAEEFDAWVRPQDML
FT                   GR"
FT   gene            174265..175419
FT                   /locus_tag="Tmz1t_0150"
FT   CDS_pept        174265..175419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0150"
FT                   /product="transcriptional regulator, CdaR"
FT                   /note="PFAM: sugar diacid recognition domain protein; KEGG:
FT                   ent:Ent638_0702 carbohydrate diacid transcriptional
FT                   activator CdaR"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52945"
FT                   /db_xref="InterPro:IPR008599"
FT                   /db_xref="InterPro:IPR025736"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="InterPro:IPR042070"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY7"
FT                   /inference="protein motif:PFAM:PF05651"
FT                   /protein_id="ACK52945.1"
FT                   /translation="MFLLDASLAQSIVDRAMQILRTNVNVMDERGLIIASGDRARIGSR
FT                   HEGALLVLAQGRAVEVDAAVAQRLHDTRPGINLPLRAEGRVVGVVGLSGEPDAVRQQAE
FT                   LVRLAAETMLEQAQWMQMLARDQRLREELVLQLIGVSPPGAGLDDWASRLGVDLARPCV
FT                   ALLIEIADASLAADAVLAAQQRLRRLLAEQEPGLACAPVTLRELAVLMPLPAAESDLRS
FT                   RLQALHGRLGGEGSGQPCLALGGRFGGDDGLARSWQSARATLQAGRRHRPQAAIHCYDE
FT                   LTLPVLLAGLGEGWRADELRRPLRRLAQQDRDGQLRCTLAAWFAHDMKAAPSAGALHVH
FT                   RNTLEYRLRRIGEITGLDLARLNDCLLLFIGLELDVAENREIPQ"
FT   gene            175532..176677
FT                   /locus_tag="Tmz1t_0151"
FT   CDS_pept        175532..176677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0151"
FT                   /product="glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="KEGG: kpe:KPK_0993 putative glycerate kinase;
FT                   TIGRFAM: glycerate kinase; PFAM: glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52946"
FT                   /db_xref="GOA:C4ZKY8"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY8"
FT                   /inference="protein motif:TFAM:TIGR00045"
FT                   /protein_id="ACK52946.1"
FT                   /translation="MKKIVIAPDSYKESLSALEVAQAIAAGFRQVFPVAEYVLVPVADG
FT                   GEGTVDAMVAATGGRKEIVTVSGPLGEPVEAFYGLTGDGATAVIEMAAASGLALVPPDR
FT                   RNPLVTSSRGTGELIRAALDAGARRFILGIGGSATNDGGAGMVQALGARLLDAQGGELG
FT                   PGGGALAALERIDVSALDPRLAQCRIEVACDVDNPLTGPRGASAVFGPQKGASVEMVQA
FT                   LDANLARFARIVERDLGVAVEAVAGAGAAGGMGAAMLAFFGAALKPGIEIVTAAVGLDA
FT                   HVRDADLVITGEGRIDFQTVHGKTPIGVARVAKRHGIPVIGIAGSLGADVGVVHAHGID
FT                   AVFSVLGKPCTLDEALHDAAANVELTARNVAAVLRIGLARR"
FT   gene            176862..177797
FT                   /locus_tag="Tmz1t_0152"
FT   CDS_pept        176862..177797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0152"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: xau:Xaut_3839
FT                   auxin efflux carrier"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52947"
FT                   /db_xref="GOA:C4ZKY9"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKY9"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACK52947.1"
FT                   /translation="MDIIFGIILPVFGTLGLGYVAARSGVFDEAANRGLSVFVFNFALP
FT                   LMLFRAIAQAELPDAMPWGYLLSYYIGAFGVYALAMLGGRVLFGRRLGEQAVLGLGAGF
FT                   SNTGMLGIPLVMTAYGPPAALPLFVMIACHSLLMLPPTTALIEAAQGAREGLGPMLLKL
FT                   TKSVLGTPIIWGLSCGLAFALLGIDIPGPLDAVAKGLGSAATPCALFALGASLTRYSLG
FT                   GNLREPALLVALKAVVHPAIVWLLATQVFAVPPLWVATGVLLAALPAGITPYLFAQRYG
FT                   ACQSTVASAVFLSTLVSVGTLSVLLFVLRP"
FT   gene            177797..178747
FT                   /locus_tag="Tmz1t_0153"
FT   CDS_pept        177797..178747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0153"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: azo:azo2550
FT                   putative malonate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52948"
FT                   /db_xref="GOA:C4ZKZ0"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ0"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACK52948.1"
FT                   /translation="MSVFLELLDFSLGVTGPIFTLLGLGVLLRRVGLITEGFIAAGSRL
FT                   VFVVGLPTMLFVNIARTRLEDSASAGMLVYGLAATVAIWLLMEWVASFVVQPERDRGVV
FT                   VQGAFRSNFGVVGLAYCGNAYGEAGLAMASLYVGVLTILVNILGVITLSRSRHSSQGPG
FT                   KVLRGIATNPLILGILLALPVSAFALPLPAVAMKSAAYIADMTLPLALLCTGATLDFRS
FT                   LRSEAGNTALATFGKLVAMPLVFTLGAWAAGFRAMELGVLMLMASSPSAAASYSMVRAM
FT                   GGNATLAANIIALTTLGSLFTTSVGVSLLRGVGLM"
FT   gene            178886..179866
FT                   /locus_tag="Tmz1t_0154"
FT   CDS_pept        178886..179866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   esa:ESA_00957 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52949"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ1"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACK52949.1"
FT                   /translation="MLLKKTLFAAATAVLATLAAGVVHAAPEKPECIAPAKPGGGFDLT
FT                   CKLVQSALQNGYLEAPMRVTYMPGGIGAVAYNTVIANRPAEAGTVVAFSGGSFLNLAIG
FT                   KFGKYTEDDVKWVAAVGADYGAIIVRADSPFQSLKDLIEATRANPGKVVYGAGGSVGSQ
FT                   DWMKSALVAREAGVDPKSMRYVAFEGGGEAMTALMGGHVQVYSGDASEVAAHLKGGRVR
FT                   VLAVLAPERLPGELAAIPTAIEQGYKVDWTIARGYYVGPKVADADYAWWVATFDKMLAS
FT                   PEFDKLRAERGLFPFARTGAAATEYVKQEVQRFRKLAVELGLTAQ"
FT   gene            179944..180387
FT                   /locus_tag="Tmz1t_0155"
FT   CDS_pept        179944..180387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0155"
FT                   /product="TctB protein"
FT                   /note="KEGG: plu:plu3182 TctB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52950"
FT                   /db_xref="GOA:C4ZKZ2"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ2"
FT                   /inference="similar to AA sequence:KEGG:plu3182"
FT                   /protein_id="ACK52950.1"
FT                   /translation="MSERIFGGVLLLVSLAGIWIGWDLQAPMSYEPVGPRAFPLLVLFL
FT                   LGLCAIALMLEKTSETVWAPPPVLKRIGLLFLIVLAYALLFDKLGFTIATALMTVPVAR
FT                   FFGGSWKQGVVGGIGLGVGMFFFFDRLLDVALPTGLWLNGILG"
FT   gene            180391..181893
FT                   /locus_tag="Tmz1t_0156"
FT   CDS_pept        180391..181893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0156"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: pmy:Pmen_1455 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52951"
FT                   /db_xref="GOA:C4ZKZ3"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ3"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ACK52951.1"
FT                   /translation="METLSLLMDGFAVAGTPENLMIALIGCFIGTVVGLLPGLGPINGV
FT                   AILLPIAFAMKLPPESALILLCAVYAGCEYGGRISAILINVPGDAGAVMTTLDGYPMAK
FT                   KGLAGPALSMSALASFTGALLATIGIVAFAPLLAEWAIAFGPAEYFALMVLALSCLGGL
FT                   VGDSLPKAMTACLIGLLLSTVGIDANSGVYRYTFDMLHLQDGIPFIVIVIGLFAVSELM
FT                   LMLQNEHTASEPITITGRILFNMKELMLAKWTMLRSAFSGFFIGVLPGAGATIASAMCY
FT                   AMERRMAGKDHQFGNGDIRGVAAPEAANNASANGSLVPMLTLGVPGSGTTAVMIGALTL
FT                   YNITPGPTLFQDQPVIVWGLIASLFIANVMLLVLNIPLIRVFVKFLSIPNWLLVPGVAA
FT                   ISLVGVYAVHGTTFDLILGTLIGGVGYLLRVMNFPIAPFILGFVLGDMMEQNLRRALSI
FT                   SDGDVGVLFASPISIGLWVAAAAMLLGPRLMRMMEQRKAVTA"
FT   gene            complement(182032..182448)
FT                   /locus_tag="Tmz1t_0157"
FT   CDS_pept        complement(182032..182448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0157"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   mno:Mnod_6721 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52952"
FT                   /db_xref="GOA:C4ZKZ4"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ4"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACK52952.1"
FT                   /translation="MNPHETPSQPRGEPAIRTIAMPADANPAGDIFGGWLMAQMDLAAG
FT                   NVAARRARSRCATVSVDRITFLRPVYIGDEVSLYADIVRVGRSSMTIQVEAWRRSRDGE
FT                   EQVKVTDASFVFVALDQGGRPRVIDPVSGPQAEH"
FT   gene            complement(182649..183692)
FT                   /locus_tag="Tmz1t_0158"
FT   CDS_pept        complement(182649..183692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0158"
FT                   /product="porin Gram-negative type"
FT                   /note="PFAM: porin Gram-negative type; KEGG: rfr:Rfer_0528
FT                   porin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52953"
FT                   /db_xref="GOA:C4ZKZ5"
FT                   /db_xref="InterPro:IPR001702"
FT                   /db_xref="InterPro:IPR002299"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="InterPro:IPR033900"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ5"
FT                   /inference="protein motif:PFAM:PF00267"
FT                   /protein_id="ACK52953.1"
FT                   /translation="MQRLSAPALVAAALALPSLALAQSNVTLYGLIDLNLGYEKSGSQR
FT                   YEGIGHGELNGSRLGFRGTEDLGNGNKALFVLESGFDPSTGVAEQGGRLFGRQSFVGLE
FT                   NGLGRVTLGRQYSPAFDALDPFDATGNADRSAGLLIRKAGAVKPAYETRFDNMIKVRSA
FT                   KLAGFELEGGYWFGKESGTDSTARQEGDGHGIAMLYANGALAGSLVTQTVQRDASGGKV
FT                   RTDGFALSYDFGIVKPYFAWSQDKERGSVGNGKARSWDLSAEIRLDPANTVAISYADRD
FT                   ESDGAASEDASGWSAYYLHALSKRTTLYAGYSQLDNEVGANYAIGNLTPAAGDKHQVMM
FT                   AGMRHRF"
FT   gene            complement(183815..185305)
FT                   /locus_tag="Tmz1t_0159"
FT   CDS_pept        complement(183815..185305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0159"
FT                   /product="histidine kinase"
FT                   /note="PFAM: Two-component sensor kinase domain protein;
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; SMART: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: bxe:Bxe_B1046
FT                   periplasmic sensor signal transduction histidine kinase,
FT                   TctE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52954"
FT                   /db_xref="GOA:C4ZKZ6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ6"
FT                   /inference="protein motif:PFAM:PF08521"
FT                   /protein_id="ACK52954.1"
FT                   /translation="MDGTSGSRPANPGTDDREHGAAARAVAAPGHGGSLRQRVLVWLLP
FT                   PLAVLLLINAFFTHRSALDAVNQAYDRTLTASVRAIGERTHSLGGQIQVDIPYAAFEGF
FT                   EADAAERIFHAVFDPAGGLVTGYADLRPPELPADDGGVRIFDLPYAGETVRLAAMRKRL
FT                   YDPALRGGDAVLIVFAETTGARRALARDLFVASLQRQSLLVAVGAILVLAALGTAFRPL
FT                   LRVRDHMRARDEEDLTPVRMERVPSEIAPLIDAINHHMERLSAMLAARRRFLADAAHQI
FT                   RTPLAVLTTQAEYGLRQTDPEEMLATFASLLRSTRAARRLANQMLTLSRAEAVNGLIGE
FT                   RAALDLAGLVKEVAMELAPLALKRDIDLAYEGIGHALTMQGNAPMLREMVSNLIDNAIR
FT                   YSPPGSAVTVAVAAFGEDAVVSVCDQGPGIPTAERERVFQRFYRILGQGDSEGSGLGLA
FT                   IVREIALAHGGRVTLRDGAGGRGLCVEVELPLGSTPSA"
FT   gene            complement(185307..185996)
FT                   /locus_tag="Tmz1t_0160"
FT   CDS_pept        complement(185307..185996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0160"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: reh:H16_A2379 response regulator,
FT                   OmpR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52955"
FT                   /db_xref="GOA:C4ZKZ7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK52955.1"
FT                   /translation="MRLLLVEDHAELAEWVARSLRHAGFVLDVLNRGDHADQSLRTERY
FT                   DLVILDLSLPGLDGLEVLRRLRNRESGPDKPAPTPVLVLTARGSTEERVHGLNLGADDY
FT                   LPKPFELAELEARIKALLRRAGNQVPLVRLGRLEFDTTTRMAAVDGQALALTPRELAVL
FT                   EALLARVGRPVAREALFEKVFEFDADARVEAIEIYVSRLRKKLEGAGVAINTLRGLGYL
FT                   LAEKPAA"
FT   gene            186140..187246
FT                   /locus_tag="Tmz1t_0161"
FT   CDS_pept        186140..187246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0161"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bma:BMAA1128 ABC transporter, periplasmic
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52956"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ8"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACK52956.1"
FT                   /translation="MRIRGGRAALKTVLAVVAAVAIAPARAEPIADRFDQARLEGVVVV
FT                   YAATDLAVVKPVIDDFEALHPGVRVQYHDMHSAELHARVVDEARRGLAGADVVWSSAMD
FT                   LQVKLVNDGHAQPHRSAETAALPRWAVWKDEAFGTTYEPAVIVYNKHLLGTTEVPDSHA
FT                   ELIRLLDRDPAPLRGRIATYDPERSGLGLLLHTQDAQANPIVFWQLARGMGRQGLEQHA
FT                   ASSEMLDRVAAGKLVLAYNVLGSYAHRRARSDPALGVALPRDYTLVLSRVAFIVRGARH
FT                   PAAARLWLDHLLSTRGQALLAANLGLLPVRTDAGTAGADSAAALLHHNLQHAFRPIRIG
FT                   SGLLAYQDQAKKQAFLRQWDAATRPASE"
FT   gene            187372..188430
FT                   /locus_tag="Tmz1t_0162"
FT   CDS_pept        187372..188430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0162"
FT                   /product="membrane protein AbrB duplication"
FT                   /note="TIGRFAM: membrane protein AbrB duplication; PFAM:
FT                   putative ammonia monooxygenase; KEGG: reh:H16_A3721
FT                   putative ammonia monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52957"
FT                   /db_xref="GOA:C4ZKZ9"
FT                   /db_xref="InterPro:IPR007820"
FT                   /db_xref="InterPro:IPR017516"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZKZ9"
FT                   /inference="protein motif:TFAM:TIGR03082"
FT                   /protein_id="ACK52957.1"
FT                   /translation="MSALSTLRLAAWRQILPTLALATLAGWLAERLHLPLPWMIGPLFA
FT                   VAGARMADRDLRPLPGGRQTGQWAIGAALGLYFSPEVVAQLSLHAPLVIAAALGSLVLG
FT                   MAYAFILLRLGGVDAPTAFFAALPGGASEMANLADRHGGAVDRIAAAHAIRVMMVVSVL
FT                   PFALTFAGVQGSDVYVPLARDVDAQHFPLLVGASLLGVGAFKLLRIANAWVLGPLLGVA
FT                   LATLAGVPLSALPPWVVNGGQLLIGCALGCRFSRAFFRAAPRFMSVAALTGAMSIVLAF
FT                   ALATLLGLVAEVPLSTLALATAPGGVSEMCITAKVLQLGVPLVTVCHVLRVVVLTVGAQ
FT                   WSFGIFRRLVAV"
FT   gene            complement(188470..189546)
FT                   /locus_tag="Tmz1t_0163"
FT   CDS_pept        complement(188470..189546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0163"
FT                   /product="NADH:flavin oxidoreductase/NADH oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase; KEGG:
FT                   mgm:Mmc1_0774 NADH:flavin oxidoreductase/NADH oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52958"
FT                   /db_xref="GOA:C4ZL00"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL00"
FT                   /inference="protein motif:PFAM:PF00724"
FT                   /protein_id="ACK52958.1"
FT                   /translation="MTDLFTPLQAGDLALPNRVLMAPLTRCRAEDGHVPGALMATHYAQ
FT                   RASAGLLIAEATMAMEGNSAFWHEPGIHSEAQVAGWKKVTDAVHAAGGRIVLQIWHGGR
FT                   ACHPLLNDGRQPVAPSALAITGDEVHTPQGKQPYVVPRELRDDELPDIVAGFARAAENA
FT                   RAAGFDGVEVHGANGYLLDEFLRDGSNQRGGPYGGPRENRARLLFEVLDAVCKVWGGGR
FT                   VGVRLSPLNSYNDMIDSDPIGLASWLAGCLNDWRLAYLHLMRGDFFGQQHGDVVTPVRA
FT                   AYRGVLIGNMGYSADEANAAIAAGKLDAVAFGTAFLANPDLPERIRRKAALNAPDPATF
FT                   YTPGPKGYTDYPTLADGA"
FT   gene            complement(189543..190886)
FT                   /locus_tag="Tmz1t_0164"
FT   CDS_pept        complement(189543..190886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo2590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52959"
FT                   /db_xref="InterPro:IPR007345"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL01"
FT                   /inference="similar to AA sequence:KEGG:azo2590"
FT                   /protein_id="ACK52959.1"
FT                   /translation="MNGPGARTATSLRPLSPAQAAAGATPRVGQPSPLILFGAFDRHNL
FT                   GDLLLGRIAAELAARLLPGRELRFAGLAVRDLRADGGARVEALAELAAEWKPPRRDTPP
FT                   PGLLQVGGEILDCSAWEAAVMLLDNAGAARAIALYDHDPAARAAWARHALGVPRGLPYL
FT                   AAHAALPPGTRSVHTGIGGVGFAALPAALRAEALAELRAAAGVQVRDRCTRDALAAAGL
FT                   DAALVPDPAVLVERLLGAEVAHHAATGEVAALRARFARGYVAVQLAAEFGDDATLATLA
FT                   GELAAIQRERDLGIVLFCAGRAPWHDDPDVLQRLRRRLPDPEAAVIAASPHVMDLCALI
FT                   ANAALCCASSLHARIVADAFARPAIGLLPGGAPQAAKLRAWLDTWHPPRRHHLAASGNL
FT                   RALARSVLDEAPAERKAQAVRLADLAETAARAAFARLFDPIDPEDKTP"
FT   gene            complement(190900..191700)
FT                   /locus_tag="Tmz1t_0165"
FT   CDS_pept        complement(190900..191700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   azo:azo1315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52960"
FT                   /db_xref="GOA:C4ZL02"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL02"
FT                   /inference="protein motif:PFAM:PF03649"
FT                   /protein_id="ACK52960.1"
FT                   /translation="MVMELSVLDLALAALLILALAGLSLRLGLGIEQRLVVAAARTTIQ
FT                   LLLIGLVLKLLFDNAHFLWVAAMAAVMITAAGREVMARQKRRFVGWWGFGLGTLSMFVS
FT                   SFTVSVLALLVVIGNTPWYAPQYAIPLLGMVLGNTMNGIALGLDRLTQEASARRMVLET
FT                   RLALGQNWNETIADTRREAIRVGMIPIINAMAAAGIVSLPGMMTGQILAGTAPVEAVKY
FT                   QILVMFLIAGGTGFGTVVAVSLGARRLFDERQRLRLDRLRTGAD"
FT   gene            complement(191694..192371)
FT                   /locus_tag="Tmz1t_0166"
FT   CDS_pept        complement(191694..192371)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0166"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azo:azo1316 putative ATP binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52961"
FT                   /db_xref="GOA:C4ZL03"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL03"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK52961.1"
FT                   /translation="MPALALHQLRTRHIGPVDLDVAAGECVCIRGASGSGKSLLLRAIA
FT                   DLDPHAGEALLDGRACSSMPGPAWRRRVALVMAEGQWWADTVGEHFPAGCTPTWLDRVG
FT                   LPAGALDWQVARCSTGERQRLALLRTLMQGPAVLLLDEPTGNLDEDSTARVEAVLDDYR
FT                   REHAAALLWVSHDPRQAARVARRRFLLEDGKLVEEEEGGKAAADKGKAAGADRPPDTEG
FT                   AAW"
FT   gene            192565..192951
FT                   /locus_tag="Tmz1t_0167"
FT   CDS_pept        192565..192951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52962"
FT                   /db_xref="GOA:C4ZL04"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL04"
FT                   /inference="similar to AA sequence:KEGG:azo0016"
FT                   /protein_id="ACK52962.1"
FT                   /translation="MYRDPRFSGIFQTLGGPAAKPPTLLQKVVGAVVMAGVFMLALTFS
FT                   VAFFAVLLTAGVAIWGWVWWKTRALRKAMRAQMDAQAAAGGARAGGYGPAAGNRGLIIE
FT                   GEVIREVEIEEDPRRDGPGGRTPS"
FT   gene            complement(192990..196322)
FT                   /locus_tag="Tmz1t_0168"
FT   CDS_pept        complement(192990..196322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0168"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   pmy:Pmen_0559 potassium efflux protein KefA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52963"
FT                   /db_xref="GOA:C4ZL05"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="InterPro:IPR024393"
FT                   /db_xref="InterPro:IPR025692"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL05"
FT                   /inference="protein motif:PFAM:PF00924"
FT                   /protein_id="ACK52963.1"
FT                   /translation="MRPLIRVFLLLLFTLLAPWAAAEAPPRPQPDELRARAQALADRKL
FT                   PEAEQRAAQQALEQAQASLASADDHRRRLDSLKQTLADAPAQIAEARRQLAALPAAAPV
FT                   AAPAADTPLARLEERLAEQEAALADWRRRLDEADSLLVAARTGPERAQTEISTGQVRMA
FT                   AIEAMLASGREAGRDSRALSPERRDALAAEWHALDAQLALRRQELAGNSGLIDLGLARQ
FT                   ELARLQLARLEEAARALQDAISRQRASQAEQTVQALADVSADASHDDLLAREAAINQQL
FT                   SEYLLGATEKLDALTRRNQAVSQQLDMLNRSTTLIDEQIGVLQGSVLLSRILLEQRRAL
FT                   PAPTTDAGLADQIADIRLYQFEINKQREQLSIPAAHAERLLADAGEADPAVREPLLALL
FT                   ATRSELLERLNRELNAVLAQSITLQLAERQLLVSADRLRATLDKQMFWIPSNRPLDLAW
FT                   LQAVPAALAKQFAAIPWGSAVGELWAGLQARPFLFLPVLLLSVGLFARRRWLRAQLDSL
FT                   HADIGYVRRDSQLHTPRAILLNMLLTLPVSLLLALGGIALQMDARGQNAALGAALMDMA
FT                   QAWLVFRTAHRLLTPGGVAERHFQWPVERVRALHRNLNKLGLVVVAVVAVVAIAERQPE
FT                   SLGIDVLGILILLVGYATMAWLLVRGLLHTRLEDRPSPLRVFVGLALGLMPLALIGALV
FT                   MGYYYTALKLTGRLVDTLYVLILWRLAEGLLVRALGVAAHRIDHQRAVARREAAEREGR
FT                   AGADSEPAAVAEAPMLDIARINQQSLRLLHLALLSGLAVALYWVWADLLTVVSYLDNIT
FT                   LYEYASGSGETAGVVPISLADLLGALAIAAIAFMLATNLPGLLEVLVLSRLQLAQGSAY
FT                   AITTLLSYVIVGVGIASTLGTLGVSWDKLQWLVAALSVGLGFGLQEIFANFVSGLIILF
FT                   ERPLRIGDVVTIGNVSGTVSRIQIRATTITDFDRKEMIVPNKAFITGQLTNWSLTDTVT
FT                   RVTIKLGVAYGADLETTRRLLLAIAAENARVLKDPEPLVFFLNFGPSTLDHELRVHVRE
FT                   LGDRNAAIDEINREIDRRFREAGIEIAFNQMDVHIRSIADGREALLQQTAVTPPAGSPG
FT                   QQG"
FT   gene            196539..197732
FT                   /locus_tag="Tmz1t_0169"
FT   CDS_pept        196539..197732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0169"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; protein
FT                   of unknown function DUF1228; KEGG: eba:ebA1383 putative MFS
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52964"
FT                   /db_xref="GOA:C4ZL06"
FT                   /db_xref="InterPro:IPR010645"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL06"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACK52964.1"
FT                   /translation="MDYQIQRLKVLGAGIFSLMLALGVARFAYTPLLPLMQAQAGLGLA
FT                   EGGWLAAINYTGYLSGALLAASISDLVLKDRLYRIGMVVAVLTTLMMGLTTDFTVWAVS
FT                   RYLAGLSSAAAMLLGTGLILNWLIRHNHRHELGIHFAGIGLGIAGCSVAVALMSLWLDW
FT                   RAQWFVFTAIACVLLVPALRWLPAPDTSGLTRSGAPMHDDPPSPLFLRIFMASYFCAGV
FT                   GFVVSATFIVAIVNRLPGLEGQGSWSFLAIGLAAMPACIVWDFIARRTGALNALILAAV
FT                   LQIVGILLPVVVGGSLGAIAGALLFGGTFVGMVSLVLTMAGRYYPTRPAKMMGKMTISY
FT                   GVAQILGPAVTGWLGETFGSYAGGLWFAAAMMGVGTVLLVLLKIVDRRDAQAAAGVA"
FT   gene            complement(197708..198559)
FT                   /locus_tag="Tmz1t_0170"
FT   CDS_pept        complement(197708..198559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0170"
FT                   /product="NAD(+) diphosphatase"
FT                   /EC_number="3.6.1.22"
FT                   /note="PFAM: NUDIX hydrolase; Zinc ribbon NADH
FT                   pyrophosphatase; NADH pyrophosphatase-like; KEGG:
FT                   psa:PST_2247 NADH pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52965"
FT                   /db_xref="GOA:C4ZL07"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL07"
FT                   /inference="protein motif:PRIAM:3.6.1.22"
FT                   /protein_id="ACK52965.1"
FT                   /translation="MSLPSSLPPSGDPRPARTLVFRDHQLLVDLAATPTAGPDSWRAGL
FT                   VALRTLDFPVTTGEAWTVVEVERTIEAPDGHAFQHLKSLLDTLDGETLALAARALELLE
FT                   FDRAHRFCGACGAPTTLRTDPPARRCSAPDCGREHFPRVSPVVIVAVERGAEILLGRSP
FT                   HFPPGLYSTLAGFVDAGESAEQAVHREIFEETGLRIRAPRYFSSQAWPFPHALMLGYQA
FT                   EYAGGDIVCAPGEIEDARFFHVDALPPLFPIRYAMANQLLRDFCLRHGRPWPPAQATPA
FT                   AA"
FT   gene            198861..201101
FT                   /locus_tag="Tmz1t_0171"
FT   CDS_pept        198861..201101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0171"
FT                   /product="isocitrate dehydrogenase, NADP-dependent"
FT                   /EC_number="1.1.1.42"
FT                   /note="KEGG: dar:Daro_3120 isocitrate dehydrogenase
FT                   NADP-dependent, monomeric type; TIGRFAM: isocitrate
FT                   dehydrogenase, NADP-dependent; PFAM: Isocitrate
FT                   dehydrogenase NADP-dependent monomeric type"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52966"
FT                   /db_xref="GOA:C4ZL08"
FT                   /db_xref="InterPro:IPR004436"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL08"
FT                   /inference="protein motif:TFAM:TIGR00178"
FT                   /protein_id="ACK52966.1"
FT                   /translation="MSAGKSKIIYTLTDEAPLLATCAFLPIIRTFTGPAGVEVEKADIS
FT                   VSARVLAEFPEYLSEDQRVPDTLAELGRLTLEPDTNIIKLPNISASVAQLKACVKELQE
FT                   KGYKIPDYPEDPKTDEEKALRVRFGKCLGSAVNPVLREGNSDRRAPAAVKNYAKKHPHS
FT                   MGEWKQWSQTHVSHMHHGDFYHGEKSMTLDRARDVKMELITKSGKTIVLKPKVSLLEGE
FT                   IIDSMFMSKKALCEFYEKELEDCREAGILFSLHVKATMMKVSHPIVFGHCVKIYYKDAF
FT                   EKHGKLFEELGINVNNGMVDLYEKIKTLPESKRDEIIRDLHACQEHRPALAMVDSAKGI
FT                   TNFHSPNDIIVDASMPAMIRQGGKMWGADGKQYDSKCVMPESTFARIYQEMINFCKWHG
FT                   NFDPRTMGTVPNVGLMAQKAEEYGSHDKTFEIAEDGVANITDLATGEVLLSQNVEAGDI
FT                   WRMCQVKDAPIRDWVKLAVTRARNSGMPAIFWLDPYRPHENELIKKVKTYLKDHDTSGL
FT                   DIQIMSQVRAMRVTLERVARGLDTISVTGNILRDYLTDLFPIMELGTSAKMLSIVPLMN
FT                   GGGMYETGAGGSAPKHVQQLVQENHLRWDSLGEFLALAVSLEDLGIKTGNARAKLLAKT
FT                   LDEATGRLLDENKSPSPKTGQLDNRGSQYYLARFWAERLAGQAEDAELAGKFAPLAKAL
FT                   AENEQKIVAELAEVQGKAVDIGGYYKADAEKCKAVMRPSATLNAILKGARAA"
FT   gene            201270..202406
FT                   /locus_tag="Tmz1t_0172"
FT   CDS_pept        201270..202406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0172"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52967"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52967.1"
FT                   /translation="MADFRKLRVMISSRCASTVRRGDSRVSMTVVRTRLKRELEAESLC
FT                   GERLFEVWISDNAPDQSQGDLETAWEKSLEEVRKADIVLVLYTGEAGWAPARGLGVCHA
FT                   EFQQAWNDGPARLKVVRIGDVGTAPKDAAELKRDQAFQAYFDDLNPTSPAASDVDAIVA
FT                   RSREALREAVAGLVKLGGREARKGRFAYGAPLDWSRLDFGHRKKAMEDALGGGLAEFGA
FT                   VESSGGWLWPLGETSLLTICHGLPGGFGVAAAREMVGQPFLHDHLFLARALGEREAPAG
FT                   PLHLVACLKGITESQAMRQLGFPDATIVAAPFGVYVSDPVQKIQMIFLANCRDLTTTRN
FT                   ALCRLAEWLNATGEAANLARRALGRRRVVQAILDVQGD"
FT   gene            202433..202999
FT                   /locus_tag="Tmz1t_0173"
FT   CDS_pept        202433..202999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0173"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52968"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52968.1"
FT                   /translation="MSSALAGLYERSGRSPPAALADWEARVDGWCDAYLRVFPDAELSE
FT                   INLDLAVFQFDHVSERVTLAYALSVEPLMRRDSGRMRGFPDVNASVRRVLGDRAFVADK
FT                   GHFLGHASGGILDINLFPQRRELNRGWSEEGKRFRSMERYVAEHPGTFFYHRPSYRDQT
FT                   WIPATLEYGVLVDGERWWVDRFRNV"
FT   gene            complement(203028..205391)
FT                   /locus_tag="Tmz1t_0174"
FT   CDS_pept        complement(203028..205391)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0174"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: scl:sce4551 protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52969"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL11"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52969.1"
FT                   /translation="MNPGAPAPADDAFDAVFAIRLPPRPYPGLRPFEQHEWPIFFGRER
FT                   MTDEIVDRLLGHRLLVVHGDSGCGKSSLVRAGVLPRLEQESARGGVRWRTCTTLPRAAP
FT                   LWNLARALAALDTPGGDGHGLELRTIAFRRALNFGREAPAALAELLGCGPRSQVCILID
FT                   QFEELFEHARRHGAEEATLLAACLVGLLDAPPAGLYAVLTMRSEFLGACSRYEGFAEAV
FT                   NRTQYLLPRMEHDDLMRAIREPAVLYDGEVTRELAERLIVDGGGGQDQLPLIQHGLMLL
FT                   HDERARAAGLALAGPTPGAPAWRLGVEHYHAEHGLAGLLSAHADAVQARAEQQCLGGEA
FT                   TRVVEDLFRALTDINAEGQAIRRPCPLARLVAVTGAEESVLRCVVDTFRADGVSFLEPY
FT                   GHEALPADELIDISHEALIRCWRRIAEPREGWLAREFRNGLVWRALLVQADSFERDPGN
FT                   VLGATTTDERERWLRRRNAAWAERYGGGWERVQRLIAASVEARALRAAEREVAEKQRQE
FT                   ARRLRRRSRALAVGLSVLAFTSALGGLAWQQSRIAEAARRFAEGERELALTARDEVVRQ
FT                   LEALVEAREAEAAARAAAEAVAQEARQSATALASVVDELERATTAANAPASGDGQAVQR
FT                   SLTEAKSELRAQVSNLSNLSAQQAAPPVSAAPAPASGGVAPRLWIYIAEEGQRPTAEAL
FT                   EARLRSVRIGDAALELPGIVLVKAAPARSMLRCFRTEECRQDGEALARALAALLQSPTP
FT                   SLEDFSALYGSSGSVRARHYELWFAPGAIVLSAR"
FT   gene            complement(205388..206488)
FT                   /locus_tag="Tmz1t_0175"
FT   CDS_pept        complement(205388..206488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0175"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: disease resistance protein (TIR-NBS-LRR
FT                   class), putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52970"
FT                   /db_xref="GOA:C4ZL12"
FT                   /db_xref="InterPro:IPR000157"
FT                   /db_xref="InterPro:IPR015032"
FT                   /db_xref="InterPro:IPR035897"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL12"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52970.1"
FT                   /translation="MSYVGEPFRHDLFVSYSHGDDGSGGACLAPWSAAFAHELERELRA
FT                   DRRFRTSLSVFRDQDHRPAQSLDPMAPLTAQLQEQIAGAALLVVLMSPDYLASKWCADE
FT                   RDWWLQRQAALGLPHEERIAVVRIWPTDTPWPAALCDARGEPLVGFAFYPADGVPPRPL
FT                   GWTDLPGAFGSEFRKALLDMVGRLYPKLEAMRARTEELRRQREEAERLVRDGGQLLYLH
FT                   GRSDHAAAWEEAALKLVDKGFAVVPGEPDRVDSDPLRLQAVRERRVETLSGCDALLLLG
FT                   TEDGRALDADLVVVGKHDRQSARARSHRLLPCGLLDTAGATIATNVRRATARIVQADWI
FT                   DGTDAGWPVAVRDWLGGKGLQAGGAP"
FT   gene            complement(206627..207754)
FT                   /locus_tag="Tmz1t_0176"
FT   CDS_pept        complement(206627..207754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0176"
FT                   /product="poly (3-hydroxybutyrate) depolymerase"
FT                   /note="KEGG: azo:azo0050 poly (3-hydroxybutyrate)
FT                   depolymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52971"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL13"
FT                   /inference="similar to AA sequence:KEGG:azo0050"
FT                   /protein_id="ACK52971.1"
FT                   /translation="MSKRLHSLSSLLRAAVSLAAAALAAIALAAPPGALPALNIAIEDT
FT                   SVSGISSGGFMSVQMQVAHSGIVRGAGVVAGGPYYCAQDSVLKATTECSCTGAPTLSCK
FT                   VGEASTAVPELVAATRAFRAEGRIDDPAQIARQRVVTVVGGKDALVPAAITRQLHGYYD
FT                   AFGLPAAALKPVTLDAAGHTMPTTAYGGACGTTDEPYIGSCGFEAAHAILDWIYGPDVA
FT                   PPRTTPTPAGRFVEFDQRAYIPATGFFSHLWGTGLDKTGWVYIPPACAAGERCRLHVVF
FT                   HGCKQGQSFLPLRRPPDGGLYNGTTFVRNTGYDRWADTNRLVVLFPQAVSIPWKNPNGC
FT                   WDWWGYTDAHYATRDGIQIRSVRAMIERLASGRHD"
FT   gene            207964..208881
FT                   /locus_tag="Tmz1t_0177"
FT   CDS_pept        207964..208881
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0177"
FT                   /product="1,4-dihydroxy-2-naphthoate octaprenyltransferase"
FT                   /note="TIGRFAM: 1,4-dihydroxy-2-naphthoate
FT                   octaprenyltransferase; PFAM: UbiA prenyltransferase; KEGG:
FT                   dar:Daro_3664 1,4-dihydroxy-2-naphtoate prenyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52972"
FT                   /db_xref="GOA:C4ZL14"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR004657"
FT                   /db_xref="InterPro:IPR026046"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL14"
FT                   /inference="protein motif:TFAM:TIGR00751"
FT                   /protein_id="ACK52972.1"
FT                   /translation="MTPPHPAPSRPGTLAVWWAAIRPRTLGMALAPVMLGTALAVADGA
FT                   ELAWAVLFATVSCALLIQIGTNLYNDAIDFERGTDRPERLGPLRVTLAGWASAAEVKRG
FT                   ALLCLLLALLLGAWLCVVGGALILAIGLASLIAGWAYSGGPRPISHSPLGEFFVLLFFG
FT                   VFAVLGSHWLQSRALGHLDLLAGLAVGAPAAAVLLVNNYRDLAGDLRAGRRTLAALLGA
FT                   EGARRAFALLVLLPIPTLILIAASGAPGAILGLVGAPALAPLVWRFGRAEGGPALNALL
FT                   VDTARAGTRTGLLAAAGIVFVSSL"
FT   gene            208891..209838
FT                   /locus_tag="Tmz1t_0178"
FT   CDS_pept        208891..209838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0178"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG: mag:amb3073
FT                   Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52973"
FT                   /db_xref="GOA:C4ZL15"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL15"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ACK52973.1"
FT                   /translation="MSIDVLLPAALAFIMFSVGLALQGADFHRVFARPRALLIGLLGQL
FT                   VLVPLAALAVVLAFDLPVLLGMGLMVLAACPGGASSGFLTHLARANAALSLSLTVISSL
FT                   AALLTFPLLVKAVLAAFGEGVFGADGSVLAALPVGRLIGSVLVVTTVPIVAGMLLRRRA
FT                   PALTARAEPLVARVATLFFAAIVVATFVSHRHTILANLLSVGPATLVLNFVVMGLGYGL
FT                   VMLAGAERRDAVAVAMECGLQNAGLAIFVAIVLLRQPELAVGAVVYALTMNFGALGLVF
FT                   VARRREGALAHDAKRVLRLPPGPPTGSRATPPRR"
FT   gene            209988..211244
FT                   /locus_tag="Tmz1t_0179"
FT   CDS_pept        209988..211244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0179"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: azo:azo0568 putative sensory box histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase dimerisation and phosphoacceptor region;
FT                   SMART: ATP-binding region ATPase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52974"
FT                   /db_xref="GOA:C4ZL16"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL16"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACK52974.1"
FT                   /translation="MSDLPRKPTGVLAATLLILFGLALFVALAWSSHASLRELEAVTDA
FT                   RSRSRNGLLLAAEALRRTLDDLPQARLETLWTLVEHRVALAERNIADRRAYAEENSPWK
FT                   QRLDEGRDTMDRIRARFAGIEAMLRAEIEARDRSLSALRAHALLLNVLLPAIGGALILA
FT                   AWGLLQRERRRRVDAEAALLAANARLEDTVAQRTVELQRALGEIEAFAHGLDRSIEDER
FT                   RRLAREVHDQLGQLLTALKMMVHRALQGAPGREQDWPQIEAVLGEGIATVRRISAALRP
FT                   PLLDDLGLEAALGLAGRQFAERTGLACEVALVDAGQLSADQANQLYRIAQEALTNVARH
FT                   AQARRVRVEGVAVDGEYRLAVEDDGVGMAPQARSSLGLLSMRERAALAGGELHVGSGAG
FT                   GGVRIEARVPLIATGGEGG"
FT   gene            211241..211882
FT                   /locus_tag="Tmz1t_0180"
FT   CDS_pept        211241..211882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0180"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: tbd:Tbd_1588 two component
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52975"
FT                   /db_xref="GOA:C4ZL17"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL17"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK52975.1"
FT                   /translation="MKLLIVDDHPVMRFGVRQLVTQRWPDAVIGEASCLAQALEQVRAA
FT                   EWELAVLDLSMPDTSGLEGLVRLHRAAPLTRLLVLSMHDEAAYAARALQLGAAGYLTKE
FT                   HATTELVAAIERVRSGQRYISSDLAARLADLLSGEAPARAPHETLSAQEYRVLLLIAAG
FT                   HGASEIAEIMHLSVKTVGTYRSRIIDKTGLANTAEMARYCSEHGLVDRGG"
FT   gene            212315..214528
FT                   /locus_tag="Tmz1t_0181"
FT   CDS_pept        212315..214528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0181"
FT                   /product="response regulator receiver modulated diguanylate
FT                   cyclase/phosphodiesterase"
FT                   /note="KEGG: glo:Glov_3327 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PFAM: EAL domain protein; GGDEF domain
FT                   containing protein; response regulator receiver; GAF domain
FT                   protein; SMART: EAL domain protein; GGDEF domain containing
FT                   protein; response regulator receiver; GAF domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52976"
FT                   /db_xref="GOA:C4ZL18"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL18"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK52976.1"
FT                   /translation="MRIVIVEDSPLLRDNLIRLFADHPELSVLGSAAGEDAAVALIAAQ
FT                   RPDTVLLDLSLSQGSGLGVLRRLRATPGLAPRVLVLSSRPADPWEALCLDAGADAFLDK
FT                   AGDPSVLLAQLASWMPPLPLDELRRRRRLQQLQVLDTRAEPALDAIARLAARIAEAPVG
FT                   VISLVDTHRQWFKARVGVEVQTTSRSVSFCAHALLGDGLFEVEDATLDPRFADNPLVRG
FT                   DPGIRFYAGMPLVMPGGEVVGTLCVIDSRPRRLGATAREALAVLARSVTDELELRQRVG
FT                   ELEEEVARRHEAEARIMQLATRDALTGLPNRAALMDRLHQGVRAAQRSGNLLAVLFLDL
FT                   DRFKWINDTLGHDLGDALLQEMALRLSRAVRECDTVARLGGDEFAIVLGDLWQVADAEA
FT                   VAAKIVDVITRPLEVRGHALRVGGSVGVAVYPFQAHDEESLLRHADLAMYHAKESGGNR
FT                   HQLFSEQMNARAVERMTVESELRAAIAAGQLELHYQPQLCLEDGRLAGMEALVRWRHPR
FT                   LGLLAPGRFVPLAEDCGLIWELGLAVLELALAQLAAWDRAGLEVPRIAVNVSPAQLRPE
FT                   LVERIVEILDRHGVAARRLEIELTESALTADGPAANGLLQALRRMGASIAIDDFGVGYS
FT                   SLTLLRRLPISALKIDRSFVAELATNRQDAAIVEAILRMAHSVGLRTVAEGVEHAEQQA
FT                   ALGELGCQEVQGYLCARPLEAKAASAWLAGQHAGGLVPSAAAA"
FT   gene            complement(214571..215110)
FT                   /locus_tag="Tmz1t_0182"
FT   CDS_pept        complement(214571..215110)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0182"
FT                   /product="adenylate cyclase"
FT                   /note="PFAM: adenylate cyclase; KEGG: abo:ABO_0867
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52977"
FT                   /db_xref="InterPro:IPR012042"
FT                   /db_xref="InterPro:IPR023577"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL19"
FT                   /inference="protein motif:PFAM:PF01928"
FT                   /protein_id="ACK52977.1"
FT                   /translation="MAQEIERRFLVRDVRILDGRRGEPIIQGYLAKEVGSMSTRVRIRG
FT                   ERAFLTLKSPKQGFSRDEFEYPIPVDDAHQMIVRHCAGRVVRKTRYLVDHAHHVFEVDV
FT                   FQGHHAGLVVAEVELPHEETPLCLPHWIGDEITHDSQYGNFTLAEQAALLHGTPHRTHA
FT                   APTPVVVAPRSLPAAH"
FT   gene            215350..216015
FT                   /locus_tag="Tmz1t_0183"
FT   CDS_pept        215350..216015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0183"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   azo:azo0343 ParA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52978"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL20"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACK52978.1"
FT                   /translation="MSAPTLIALISQKGGSGKTTVAMQLAAGLALEGYRVALADLDPQE
FT                   SASRWAESAPADAPFPARVVRLSGSADEMGKTLRPVANKVDVVVMDCPPSIEHAHTMSA
FT                   LALCDIALVPVVPGPTDLWATRGIERLILERKRSRPGLRGALLPNRVTRTALSADVLEV
FT                   LRDFTLPVLDAALSQRSAYALGAVRGTSVFGLGRSAAPAQEEVARLVAAVVKLIEERG"
FT   gene            216012..216509
FT                   /locus_tag="Tmz1t_0184"
FT   CDS_pept        216012..216509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0184"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52979"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL21"
FT                   /inference="similar to AA sequence:KEGG:azo0344"
FT                   /protein_id="ACK52979.1"
FT                   /translation="MSATSSGLKSKLRETLKQEDAALAERSRAVAKPAAAQPRVGKPDA
FT                   AEPAATATPTTAAQALQPTVGGSAAAEKRATATLLELAAPAAAGRRDKGEKVERDSFSM
FT                   PAREHKRIKALREALGEHGVLVSKSALLRAGLALLAERDTGEIARLVAALPKVAKGKRK
FT                   RR"
FT   gene            complement(216668..218185)
FT                   /locus_tag="Tmz1t_0185"
FT   CDS_pept        complement(216668..218185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sus:Acid_1790 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52980"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL22"
FT                   /inference="similar to AA sequence:KEGG:Acid_1790"
FT                   /protein_id="ACK52980.1"
FT                   /translation="MDPDLGTELFESLGLDALLPESLSAWRPLLLEGMAFFLDRLPEAR
FT                   LGAIVAEQLALAASVSAARATALLARCPTLHKLGQVVARQPGLDAELRRHLQALESLPA
FT                   STDDGALHARIRAELGAGHGLHLADRALAEGSVAVVLPFSWRQDGRSHEGVFKALKPGI
FT                   GERLAEELAILPALGDFLERRGAEFGLPAIDYRSHLAAASRLLVQEIRLDREQANLRAA
FT                   AALFAADADVFVPALLPWCTPALTAMERIDGPKLADAALSAHESRRLGRALVGGLLARP
FT                   FWSCGEDAPFHGDLHGGNLLLAPDGRVAVLDWSLTARLSKAEREALVEVALAALALDAS
FT                   RIMAGLAGLGLRDTRAAPIGATVEHALDTLVRSGRPLGFDWLVGLLDALALQGAGGFGE
FT                   QLAVFRKSWLSLAGVLGDLGAGHDTDLPLLGLGLQRFAAEWPARLLAEPDSRAFSTHVS
FT                   TADLLRAAADTWPAGLRYWLRLLGFAGAENRDARRADGKPTRLPQGL"
FT   gene            complement(218215..218646)
FT                   /locus_tag="Tmz1t_0186"
FT   CDS_pept        complement(218215..218646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0186"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lch:Lcho_3617 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52981"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL23"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52981.1"
FT                   /translation="MSTHTRSALRASLKQEDVALDERLPEIAGTRPPTRPETEAPPLPA
FT                   EPAKAKPEKRKRESFALVASDLRRLDALRSTMKAAGRPARKSELVRAGLAALAALDHAE
FT                   TIALLDALPPLKRTAAKDDEKARAGKKKSSQRKAAARKR"
FT   gene            complement(218731..218940)
FT                   /locus_tag="Tmz1t_0187"
FT   CDS_pept        complement(218731..218940)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0187"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL24"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52982.1"
FT                   /translation="MQTHAHLTAPGTPTGDRLGLHAGLESLGAQLTARWQSRTRKHVAD
FT                   LLDDADALADWHRNLERLRRGEHG"
FT   gene            complement(219018..220871)
FT                   /locus_tag="Tmz1t_0188"
FT   CDS_pept        complement(219018..220871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0188"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /note="PFAM: Poly-beta-hydroxybutyrate polymerase domain
FT                   protein; alpha/beta hydrolase fold; KEGG: azo:azo1350
FT                   poly-beta-hydroxybutyrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52983"
FT                   /db_xref="GOA:C4ZL25"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL25"
FT                   /inference="protein motif:PFAM:PF07167"
FT                   /protein_id="ACK52983.1"
FT                   /translation="MPASRRGGKRPATAPSAKQQPDRGAHPAPPDSNGHNGRMVSNGRN
FT                   GLPDGRAVYRHIAAIGEGLTARADPFGIAAPILHAQMAWLMHPQELGERLAGLGTDLWQ
FT                   LQWHTWRRALGLPSADPVKPHADDPRFADPVWTDSATWDLVKEWYLAFTHHVQDMLYET
FT                   PGLSGKERRRAAFWWRKWLNAVAPTNYLWSNPIALRRFIDTRGHSLWQGWQNMLADLQA
FT                   GNVRMTDPDGFHVGDNLGTTPGAVIFRNRLLEVIHYAPTQPQVHAEPVVIVTPWINKFY
FT                   ILDLNPRKSMVRYLLDQGLDVYITSWKNPDASMREVRFDDYLVEGISAIVRVARECSGA
FT                   ERVHAVGYCIGGTALATWMAWAARHYGEDAVPVRDWTLFTTLVDFHKPGDIEVFIDEES
FT                   VAHLSEQMKEKGYLDGKDMAASFRLLRSNSLIWHYVVHGWLYGESPAPFDVLYWNMDTT
FT                   RMPAAMHAWYLRELYLNNRLVQPDALVVAGEPIDLRRIRQPLYAVAAEDDHIAPWAQTF
FT                   HTMHHVAADKRFVLSSSGHILGIVNPPVTPPRRHYRVATAHRADRAPLWRERAALREGS
FT                   WWEDWMAWLKPRAGELVAARPAADERHPALGDAPGTYVLEA"
FT   gene            221087..223015
FT                   /locus_tag="Tmz1t_0189"
FT   CDS_pept        221087..223015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0189"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2643 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52984"
FT                   /db_xref="InterPro:IPR018445"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL26"
FT                   /inference="similar to AA sequence:KEGG:Bxe_B2643"
FT                   /protein_id="ACK52984.1"
FT                   /translation="MEKIEAVASLGQAELLRPARVRAALAANDRLKLYLSVLQAAHDCA
FT                   QRGDARALDLAREFAVAGVDAPWLAQLPATAYREGKELHVAGLDRLAGLLAEDLCTMAR
FT                   PLEGDADFAARCAHWCAWLEALAPDTLSSAQLHALTSGKRGKDDSLHLLVMDLHKALNR
FT                   LASELSSETIDGAHVWQVDATDRSRIAAFMRGLNATRALKLDHPGLDTAATRDGARLLL
FT                   QNDIGTNDAHVLVIQVEGLRVVLTYSDLHRRRFAFFQSLLCEVGANWSEPQARTSAGLN
FT                   FGATYYVGTATFDCADEEALCGVLEGIGTRIVFLIDWNRARKRLEQFVGKTDAVAILAE
FT                   AARRRVGHMAWLAAGGEQLVFGAMQALGPEYFRIGDRLDGVLGTEKARAFVLESMALAS
FT                   AAMQQRQPLALVADDTRLLLARYLHRHDEFDLLAEHAAYCHALAEGLRDGLAHGHERDR
FT                   KAAREFSERAKDWERRADQLVMDARARAEARPRWEAFAELVETADDVADALEEAAFLLS
FT                   LIAADHHQGWRGEVHQTMQLLADAVLGAAQDHVRALEIARGFGEDSSAEDHEAFVAALW
FT                   RVLNAERQCDVLLRDVRRALAEHVSDAATLNLSTDFAQALESATDWLLATGYGLRRLVF
FT                   SRAGVGR"
FT   gene            223042..224697
FT                   /locus_tag="Tmz1t_0190"
FT   CDS_pept        223042..224697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0190"
FT                   /product="Pyruvate, phosphate dikinase"
FT                   /EC_number="2.7.9.1"
FT                   /note="PFAM: pyruvate phosphate dikinase
FT                   PEP/pyruvate-binding; PEP-utilising protein mobile region;
FT                   KEGG: bxe:Bxe_B2644 pyruvate phosphate dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52985"
FT                   /db_xref="GOA:C4ZL27"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR010121"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL27"
FT                   /inference="protein motif:PRIAM:2.7.9.1"
FT                   /protein_id="ACK52985.1"
FT                   /translation="MMAHPDAASAAAPADARRVVRLIHADAPLPADCSAEALGSKAWNL
FT                   ARMAALGLPVPPAFVIGTGWCAEPGALAEAAWRPALAELERLSGLRLGDTRHPLLLSVR
FT                   SGAPVSMPGMMETLLDIGLTETTLSGLLRVSGHPRLTWDAYRRLIAGYGEVVAGIDAQH
FT                   FDADLEAVRGECGECGQGDERVLDFAALRELAARHLDTYRREAGEAFPQDAHEQLRQAI
FT                   AAVFASWHADKARAYRAMHGLADDMGTAVTVQRMVFGNAGGLSGAGVGFTRDPSSGEPR
FT                   PWVDFLFNAQGEDVVSGRRSAHGHDELAAVAPAVWQAVLDVTARLERAFGDMQDFEFTV
FT                   QQGVLHLLQTRAGKRTPQAAARIALDLLDEGVIDAETARVRTAALDVRALAEHRIVRAD
FT                   GAALVPLGRAASAASGVACGEIVFDEARARARHAAGAKLILVRQDAETRDLAALELAEG
FT                   LLTCRGARTAHAAVVARQLGKVCLVGCEALRLDEAGRTLELGGHILREGELLTLDGNEG
FT                   AIHAGAAAVVEVVPQALLARLDALHGREVAALQS"
FT   gene            224724..224972
FT                   /locus_tag="Tmz1t_0191"
FT   CDS_pept        224724..224972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0191"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52986"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL28"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK52986.1"
FT                   /translation="MSFRSSYGHKCAIELYRDATERQAKLAGVTIPTFMCRRCGKRQSV
FT                   SGRRQVVRGSSRYGYHCASCSTARPAGAGCESRPSQV"
FT   gene            complement(224995..226707)
FT                   /locus_tag="Tmz1t_0192"
FT   CDS_pept        complement(224995..226707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0192"
FT                   /product="2-isopropylmalate synthase"
FT                   /note="TIGRFAM: 2-isopropylmalate synthase; PFAM: pyruvate
FT                   carboxyltransferase; LeuA allosteric (dimerisation) domain;
FT                   KEGG: dar:Daro_0511 2-isopropylmalate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52987"
FT                   /db_xref="GOA:C4ZL29"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR005668"
FT                   /db_xref="InterPro:IPR013709"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR036230"
FT                   /db_xref="InterPro:IPR039371"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL29"
FT                   /inference="protein motif:TFAM:TIGR00970"
FT                   /protein_id="ACK52987.1"
FT                   /translation="MMLQNPAAKYRPFAPIALADRQWPNTLIERAPIWMSTDLRDGNQA
FT                   LFEPMNVERKMRMFRTVCEIGFKEIEVGFPSASQTDFDFVRALIEGGHIPADVTIQVLT
FT                   QAREDLIRRTMESVRGAPRAIIHVYNATSPTFRELVFGMEKPQVLALAVSAVRLIKQIG
FT                   AEMEKECGTEIRLEYSPETFSATELDFAREVCDAVTAEWGATPENKVILNLPATVEVAT
FT                   PNVYADQVEWMHRNLARRDSVVLSLHPHNDRGSGVAAAELGLMAGADRVEGCLFGNGER
FT                   TGNVDIVTLALNMYTQGVSPGLDFSDINAVARTVEYCNQLPIHPRHPYVGDLVFTAFSG
FT                   SHQDAIKKGFAAQKAGQPWNVPYLPIDPADVGRSYDSVIRVNSQSGKGGIAYLLETEYG
FT                   IVMPRRLQVEFSREVQQVTDASGGEMSAAAIWDLFRSTYLDNVEPVRYVEHHLFEHGAA
FT                   QGIRLVVEFGGTRHLLVGEGNGPIDAAIHALRGAGIDVQVRSFEERSVAPSENGGNAQA
FT                   CAFLELTEAGGQGGDRYGVGIDANIVTASIRAILSGVNRLQPDCARAPAARAA"
FT   gene            226863..227348
FT                   /locus_tag="Tmz1t_0193"
FT   CDS_pept        226863..227348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0193"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: dar:Daro_0512
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52988"
FT                   /db_xref="GOA:C4ZL30"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL30"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACK52988.1"
FT                   /translation="MERPIVQLDRYDRQILELLQQDGRISNQELADRIALSPSACLRRL
FT                   RALEESGLIRGYRALLDARKLGLSLMALIHISMDRHTPERFSHFEAEVEKIPQVLECLL
FT                   ITGQDADYQLKVVVTDMDGYQALLLERITRIPGVTGVHSSFVLRRVIDKTALPLPGA"
FT   gene            227503..228702
FT                   /locus_tag="Tmz1t_0194"
FT   CDS_pept        227503..228702
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0194"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; globin; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: bpt:Bpet2616 nitric oxide dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52989"
FT                   /db_xref="GOA:C4ZL31"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR023950"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL31"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACK52989.1"
FT                   /translation="MDARVRELVKATIPVLKEHGVALTTYFYQRMFRHNPELKNIFNQS
FT                   HNETGKQPVALAMAVLAYAENIDDPSVLAPVITLIANKHASVGIRAEHYPIVGKHLLAS
FT                   IREVLGDAASDELIAAWGVAYGALADVFIDAESKLYNQACNADGGWSGWRSFRIIDKVR
FT                   ESEEITSLHLVPCDGGPLPAYRAGQYTTARVFVPELGVMQLRQYTLSIAPGAMHFRISV
FT                   KREPAGATTPAGRVSNRLHDFYKVGDMLELAPPFGEFFLDETHDGPVVLISGGVGITPM
FT                   ISMLDRLVAAAPSRPVQFVHACRNAAVFAFGAHLAKVAERNPQVRLHLFHDEGAVSAPV
FT                   QAGRVDLRALAGEVLAEGADYYLCGPVGFLEAQIATLHELGVESARIHAEVFDTGGIAT
FT                   "
FT   gene            complement(228901..229737)
FT                   /locus_tag="Tmz1t_0195"
FT   CDS_pept        complement(228901..229737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0195"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: ajs:Ajs_3127 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52990"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL32"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACK52990.1"
FT                   /translation="MTRNTRIARIRRSLAGIATVTIGLFAAQAIAQQPASIVVASTTST
FT                   EQSGLFGHILPQFKQATGIDVKVVALGTGQALDVGRRGDADVVFVHDADAERKFVDEGH
FT                   GIEHRKVMYNDFVLIGPKDDPAAAKGKDITGALQKLAAANGNFVSRGDKSGTHAAELRY
FT                   WKAAGVDNKGSGYKECGCGMGPALNMAASSGAYVLADRGTWLSFKNRADLAVLVEGDTR
FT                   LFNQYGVMVVNPERHPHVKQAEARKFVEWVVSPAGQEAIAAYKIEGEQLFFPNAGQ"
FT   gene            229931..230890
FT                   /locus_tag="Tmz1t_0196"
FT   CDS_pept        229931..230890
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0196"
FT                   /product="transcriptional regulator, PaaX family"
FT                   /note="TIGRFAM: phenylacetic acid degradation operon
FT                   negative regulatory protein PaaX; PFAM: PaaX domain protein
FT                   domain; PaaX domain protein; KEGG: eba:ebA5390 PadR
FT                   protein, putative regulator of anaerobic phenylacetate
FT                   metabolism"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52991"
FT                   /db_xref="GOA:C4ZL33"
FT                   /db_xref="InterPro:IPR011965"
FT                   /db_xref="InterPro:IPR012906"
FT                   /db_xref="InterPro:IPR013225"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL33"
FT                   /inference="protein motif:TFAM:TIGR02277"
FT                   /protein_id="ACK52991.1"
FT                   /translation="MKSRVIERWVEAHLAGRRISANSLIISVYGDLIAVHGGVVWLADL
FT                   IRLMAPFGLNERVVRTSVYRLVQDDWLESGQVGRRSYYRLAASGMRRFAPAWRRIFEPE
FT                   GEGWSGTWQVVMLPSALEARVADNLRRELSWAGYGALNAGVLLRPTDDASTLRNILDGC
FT                   GLRDRVVPLTARGLDGVTGAATDELVRECWDLQAIAATYDGFIEHFRPLLRAFGAGEAE
FT                   PEQAFLVQTLLMHEFRRVLLHDPQLPVQVMPNRWRGDAARELCARLYRLSWRAACRHLQ
FT                   ASCATPEGPLPPPSAQFFRRFGGLELPPAATDEVAAEG"
FT   gene            complement(230925..231830)
FT                   /locus_tag="Tmz1t_0197"
FT   CDS_pept        complement(230925..231830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0197"
FT                   /product="phenylacetyl-CoA:acceptor oxidoreductase"
FT                   /note="KEGG: eba:ebA5396 phenylacetyl-CoA:acceptor
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52992"
FT                   /db_xref="GOA:C4ZL34"
FT                   /db_xref="InterPro:IPR007059"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL34"
FT                   /inference="similar to AA sequence:KEGG:ebA5396"
FT                   /protein_id="ACK52992.1"
FT                   /translation="MKPNRSPLPGQPAPRLQQHWDWRAAGNFICGGSGGGLVLFAGLAG
FT                   LAGVEVRPQLAAGLLLVALGLLCVWFEIGRPWRALNVFRHIRSSWMTREASVALALFGA
FT                   GVLALYTAHPAAQALAGLCGLAFVYAQARILAADKGIPAWRHARCAPLVLGTGLAEGAG
FT                   LIATTLAGGLQIAAAMALVLALCARLLLWRRYLDGLRADRAPAPSVQAFEAIAARMVRV
FT                   GHLLPAGLALLAAAGILAGVPGAGSALAAAGLLAAGAGWWFKYTLIRRAAFTQGIALKH
FT                   HPVRGGKPAGLASAPRLGNA"
FT   gene            complement(231830..232477)
FT                   /locus_tag="Tmz1t_0198"
FT   CDS_pept        complement(231830..232477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0198"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: eba:ebA5395 phenylacetyl-CoA:acceptor
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52993"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL35"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK52993.1"
FT                   /translation="MTRYVMSIDLRRCVGCQTCTAACKNANATPPGVQWRRVLDLETGE
FT                   FPDVRRSFLPTACMHCAEPPCAAVCPTEATQKRRDGLVTIDYDVCIGCANCVMACPYEA
FT                   RSIVHEARFAYGEQPIASEAIRFDPSRISVATKCSFCKERIDAAAASGRIPGRDPEVTP
FT                   ACVNSCISGAMVFGDIDDPDSAVSRLLAKTQHFHMHEELGTGPSVYYIWDHA"
FT   gene            complement(232474..235227)
FT                   /locus_tag="Tmz1t_0199"
FT   CDS_pept        complement(232474..235227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0199"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: eba:ebA5393
FT                   phenylacetyl-CoA:acceptor oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52994"
FT                   /db_xref="GOA:C4ZL36"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR041932"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL36"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACK52994.1"
FT                   /translation="MTAATARNERKIPSYCYNCVAGPDFMTVKVIDGVATEIEPNFAAA
FT                   EVHPARGRVCVKAHGLVQKTYNPHRILQPMKRTNPKKGRNEDPGFVPISWDEALDTIAA
FT                   RLAGVREKGLVDDSGLPRVAASFGHGGTPAMYMGTLPAFLAAWGPIDFSFGSGQGVKCV
FT                   HSEHLYGEFWHRAFTVAADTPNCRYVISIGSNVDASGGPCAVTRHADARVRGYKRVQVE
FT                   PHLSITGACASEWVPIRPKTDPAFMFALIHVLVCEHGLGQLDLPFLRDRTSSPYLVGPD
FT                   GLYLRAPDSAKPLVWDPAAGRAVPFDTPGVEPALEGRFRVAAAVTVDADDARHALVDVE
FT                   GTPAHTMLVEHMRKYTPEWAEGICDVPATTIRRIAGEYLENAQVGATIEVDGATLPLRP
FT                   VAVTLGKSVNNGWGAFECCWARTVLATLVGALEVPGGTLGTTVRLNRPHDDRHLSVAAG
FT                   EDGFMAQKFNPTDKEHWVARPTGRNAHRTLVPIVGNSAWSQALGPTQLAWMFQREVPRD
FT                   FNMPKPTLPDIWFIYRSNPAISFWDTPSLVETIATFPFTVSFAYTVDETNFFADLLLPE
FT                   ATDLESLQMIKVGGTKFVEQFWTARGVVLRQPAVEPQGEARDFTWISTELARRTGLLEP
FT                   YNKAINRGAGGVSPLAGEGYDFSLDPTRTHDVDTIWDAICRAASTDLSQGQETHDLAWF
FT                   KEHGFYTVPMPQRSWYLTPTLAEKGLRYELPYQERLLRIGRELGNRLHEHDMHWWDTQL
FT                   SEYTALPEWHDVPGRWEQALVDSGAKPEDYPLWLLATKSMQYHTGGNVSIALMREVAQN
FT                   VRGHAGVIMNANTARRLGIADGDRVEIRSHIGATYGKAVLAHGIRPDTLVIPGQFDHWA
FT                   TPVAKDFGMPSLNTVAPMSLELTDATGSGADIVRVAIRRLEGSTVQ"
FT   gene            complement(235242..236060)
FT                   /locus_tag="Tmz1t_0200"
FT   CDS_pept        complement(235242..236060)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0200"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: eba:ebA5392 phenylacetyl-CoA:acceptor oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52995"
FT                   /db_xref="GOA:C4ZL37"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL37"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACK52995.1"
FT                   /translation="MLDHPSPASGAHRSYGVERRGTDSAILGEDAVAEEAPVALVYNGF
FT                   SHAVMLATPQDLEDFALGFTLSEGIAASARELHDIDVVEHALGCEVRMALASERFAAMR
FT                   ERRRALAGRTGCGLCGIESLAQLQRPLPPARLADTAIQPGALERAQAELAALQPLFQLT
FT                   GAVHAAAWCRRDGSVALVREDVGRHNALDKLIGAIATRGCGFDDGFVLMTSRASYEIVQ
FT                   KAATVGIAAIAALSAPTGMAVRLAEAAGVTLVGFARGHRHSVYTHPQRMH"
FT   gene            complement(236309..236917)
FT                   /locus_tag="Tmz1t_0201"
FT   CDS_pept        complement(236309..236917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0201"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1894 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52996"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL38"
FT                   /inference="similar to AA sequence:KEGG:Daro_1894"
FT                   /protein_id="ACK52996.1"
FT                   /translation="MPARTRGLIVGILLAAGAGSRFGGGKLVARLADGRGVAATTCARL
FT                   LPAVDLVVAVVPAQPGTLEDELRAAGAEVVRCGAEHPGMGVSIACGVAATADAAGWLVA
FT                   LGDMPLVPTAQHRLVADALRAGAAIAAPVCRGRRGHPVGFAARFGDELRALAGDEGARA
FT                   LLARHRGALVELAVDNDASWLDIDTPSDLAAVNHRLGSH"
FT   gene            complement(236893..237894)
FT                   /locus_tag="Tmz1t_0202"
FT   CDS_pept        complement(236893..237894)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0202"
FT                   /product="protein of unknown function DUF182"
FT                   /note="PFAM: protein of unknown function DUF182; KEGG:
FT                   eba:ebA3601 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52997"
FT                   /db_xref="InterPro:IPR003777"
FT                   /db_xref="InterPro:IPR027051"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL39"
FT                   /inference="protein motif:PFAM:PF02625"
FT                   /protein_id="ACK52997.1"
FT                   /translation="MDSVNLETLRQAVAWQAAGLPVTLATVVRTWGSSPRPEGALLAIC
FT                   GDGRLAGSVSGGCIEDDLSDRLRTQWLERPELVTYGITADQTRRFQLPCGGSLSLVLEP
FT                   LHAGSRLAETLARIERGELLARRLSLATGAVELLDSVPDTAVVFDGSRLTAAFGPRWRM
FT                   LIVGAGQLSAYLAQFALALDYRVTLSEPREEYRASWTLPGVEITTEMPDDAVAAMRPDR
FT                   RSVILAAAHDPKLDDLALIDALHSDAFYIGAVGSRATSAARRERLRLFDLGDAQIARLH
FT                   APAGLPLGSRTPPEIALAIVADLTARRNGTSLTAAVARPATESAACPLARAA"
FT   gene            238135..239259
FT                   /locus_tag="Tmz1t_0203"
FT   CDS_pept        238135..239259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0203"
FT                   /product="transcriptional regulator of molybdate
FT                   metabolism, LysR family"
FT                   /note="PFAM: regulatory protein LysR; KEGG: ajs:Ajs_3130
FT                   molybdate metabolism transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52998"
FT                   /db_xref="GOA:C4ZL40"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL40"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACK52998.1"
FT                   /translation="MRRIRLNYVLGADTGSAPLHNPLLDLLQAVREQGSISAAARVLDL
FT                   SYRHVWGELKRWELELGQPLILWEKGQAARLSEFGAKLLLAERQVQARLLPQIEALRAD
FT                   LERAFAIAFDDSVHVLSFHASHDEALAALGEEARTRGLHLDIRFTGSVDAIRALNEGRC
FT                   TMAGFHVRLPAVPGSRGSSSHSQRTYKPLLRPGLHKLIGFARRSQGLIVARGNPRGLHG
FT                   LADLARPGVRFVNRARGTGTRVIFDELLGELGLAPAAIEGYANDEPSHAAVAQAVASGQ
FT                   ADAGFGIEASARGRGLDFVPLVEEAYFLACLKSTLEHDATRALLALLRTAAWQQRLADL
FT                   PGYAPMQSGEVLSMSRVLPWWRFGGRGNAREGKQ"
FT   gene            239373..241331
FT                   /locus_tag="Tmz1t_0204"
FT   CDS_pept        239373..241331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0204"
FT                   /product="glucose inhibited division protein A"
FT                   /note="TIGRFAM: glucose inhibited division protein A; PFAM:
FT                   glucose-inhibited division protein A; KEGG: azo:azo0141
FT                   tRNA uridine 5-carboxymethylaminomethyl modification enzyme
FT                   GidA"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACK52999"
FT                   /db_xref="GOA:C4ZL41"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL41"
FT                   /inference="protein motif:TFAM:TIGR00136"
FT                   /protein_id="ACK52999.1"
FT                   /translation="MLYPTRFDVIVVGGGHAGTEAALAAARMGAATLLLTHNIETLGAM
FT                   SCNPSIGGIGKGHLVKEVDALGGAMAAATDEGGIQFRILNASKGPAVRATRAQADRVLY
FT                   KAAIRRRLENQPNLWLFQQAVDDLTVVGDRVTGVVTQIGLCFEAPTVVLTAGTFLNGLV
FT                   HVGMQNYSAGRAGDPPAISLGARLKELALPQGRLKTGTPPRLDARTIDFSVMTVQPGDD
FT                   PVPVFSFLGHASQHPRQLPCWMTQTNERTHDVIRANLDRSPMYSGVIEGVGPRYCPSIE
FT                   DKIHRFADKDSHNIFLEPEGLETHEIYPNGISTSLPFDVQLQIVRSIRGLENAHILRPG
FT                   YAIEYDYFDPRNLKSSLETKSIGGLFFAGQINGTTGYEEAAAQGLLAGANAALQVQGRE
FT                   PWCPRRDEAYLGVLVDDLITRGVSEPYRMFTSRAEYRLSLREDNADLRLTGKGRELGLV
FT                   DDVRWAAFCAKREAIERGTAQLKAAWARPEAIPAEDQQRVLGKALEREQRYFELLRRPE
FT                   TSYASLMSLPGAPDERETDAQVIEQIEIAAKYQGYIDRQQDEVTKQMQAEATRLPVGLD
FT                   YAQVRGLSKEVQQKLNQHKPETIGQAGRIQGVTPAAISLLLVWLKRRDLAARAGAVAPE
FT                   LAAPADAGDDVARRPAA"
FT   gene            241342..242064
FT                   /locus_tag="Tmz1t_0205"
FT   CDS_pept        241342..242064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0205"
FT                   /product="methyltransferase GidB"
FT                   /note="TIGRFAM: methyltransferase GidB; PFAM: glucose
FT                   inhibited division protein; KEGG: azo:azo0142
FT                   glucose-inhibited division protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53000"
FT                   /db_xref="GOA:C4ZL42"
FT                   /db_xref="InterPro:IPR003682"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL42"
FT                   /inference="protein motif:TFAM:TIGR00138"
FT                   /protein_id="ACK53000.1"
FT                   /translation="MAAGRQAHSFHGEELASRRERIAVSGRLQPYAARLADGIAALGLA
FT                   LPQETIDRLLAFGELLLKWNKVYNLTAIRSPQELITHHLLDSLAVLPQLEAVNRLADIG
FT                   SGGGLPGVVLAIVRPGLVVSSIETVGKKASFQQQAKIELGLDNFSVLNQRVEQVRPQSL
FT                   PGGAPEGAISRAFSSLADFVALSGHLVAEGGALYAMKGVNPVDEIAALPAGWAVAETHA
FT                   LTVPGLGAERHLLVIRRA"
FT   gene            242172..242942
FT                   /locus_tag="Tmz1t_0206"
FT   CDS_pept        242172..242942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0206"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   azo:azo0143 ParA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53001"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL43"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACK53001.1"
FT                   /translation="MAKIFCVANQKGGVGKTTTCVNLAAALHQAGQRVLLIDLDPQGNA
FT                   TMGSGVDKRDLKSSVYHLLVGMVDLAGVRVASPTGGYDVLPANRDLAGAEVELVNLDQR
FT                   EKRLRNALAAFVDDYDFVLIDCPPSLSMLTLNGLCCATGVIIPMQCEYYALEGLSDLVN
FT                   TIKKVHANLNRDLKIIGLLRVMFDPRVTLQQQVSNQLEGHFGDKVFRAIVPRNVRLAEA
FT                   PSHGMPGVVFDKSAKGAQAYMAFAHEMIERAKIF"
FT   gene            242957..243808
FT                   /locus_tag="Tmz1t_0207"
FT   CDS_pept        242957..243808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0207"
FT                   /product="parB-like partition protein"
FT                   /note="KEGG: azo:azo0146 chromosome partitioning protein
FT                   ParB; TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; SMART: ParB domain protein
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53002"
FT                   /db_xref="GOA:C4ZL44"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL44"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACK53002.1"
FT                   /translation="MNKPRLKGLGRGLDALLAANQEEEAEKGELQSLPTIALQPGKYQP
FT                   RTRMDPGSLEELAASIKAQGVMQPIMVRPVGEDAYEIIAGERRWRASQIAGLAEVPCLV
FT                   REIPDEAALAMSLIENIQREDLNPLEEAGGIQRLIDEFDMTHQQAADAVGRSRPAASNL
FT                   LRLLNLAKPVQELLMAGDLDMGHARALLPLDAASQIQLGNQVAARQLSVRDTERLVQQI
FT                   LNPRQKKPVPPPDRDLLRLEEEIADAIGATVKIKANKNGAGELTIRFGSLDQLDGVLGR
FT                   LR"
FT   gene            244090..244431
FT                   /locus_tag="Tmz1t_0208"
FT   CDS_pept        244090..244431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0208"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0152 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53003"
FT                   /db_xref="GOA:C4ZL45"
FT                   /db_xref="InterPro:IPR005598"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL45"
FT                   /inference="similar to AA sequence:KEGG:azo0152"
FT                   /protein_id="ACK53003.1"
FT                   /translation="MLKAVILQVIATLVAAALSGALFGVSGAVSAAGAGLACVLPSGLF
FT                   ALRLAAITRRSGTASVTAFVAGEFLKIASIVGLLVLVWAVYPDLHWGGMLVGLILALKA
FT                   NLFAFLVKT"
FT   gene            244434..245285
FT                   /locus_tag="Tmz1t_0209"
FT   CDS_pept        244434..245285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0209"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   azo:azo0153 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53004"
FT                   /db_xref="GOA:C4ZL46"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL46"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACK53004.1"
FT                   /translation="MATEGHAPTASEYVIHHLTHLNNTGHAQENIIDWSVINLDSMFYS
FT                   IVIGALTVFLLWLAARKATSGVPGRFQGIVEILVDMVADQAKGIVHSAESRRFVAPLAL
FT                   TVFVWIFLMNAMDLLPVDLLPRIWEGMYAAGGGDPAHAYMRVVATADLSATLGMSTGVL
FT                   LLCLYYNIKIKGVGGWVHELFTAPFGSHPLLYPINFAMQIIEFVAKTVSHGMRLFGNMY
FT                   AGELIFILIALLGSTATVFGFLGHVIAGSIWAIFHILIITLQAFIFMMLTLVYVGQAHE
FT                   SH"
FT   gene            245352..245597
FT                   /locus_tag="Tmz1t_0210"
FT   CDS_pept        245352..245597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0210"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   azo:azo0154 F0F1 ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53005"
FT                   /db_xref="GOA:C4ZL47"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL47"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACK53005.1"
FT                   /translation="MENVLGFVALAAGLIIGLGAIGACIGIGIMGSKYLEASARQPELM
FT                   NALQTKMFLLAGLIDAAFLIGVGIAMMFAFANPFQL"
FT   gene            245645..246118
FT                   /locus_tag="Tmz1t_0211"
FT   CDS_pept        245645..246118
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0211"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   azo:azo0155 F0F1 ATP synthase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53006"
FT                   /db_xref="GOA:C4ZL48"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL48"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACK53006.1"
FT                   /translation="MNLNATLIAQLVVFFILAWFTMKFVWPPIVKALDERANKIADGLA
FT                   AADKAKADLALAEKKVVEELRKARESAGDVRTSAEKQASQLIDEARAEASRIIAAAREA
FT                   AEHEAGAATQRAKEALRDQVAHLAVAGAEKILRREIDAKVHAKLLANLKQELQ"
FT   gene            246122..246655
FT                   /locus_tag="Tmz1t_0212"
FT   CDS_pept        246122..246655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0212"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: azo:azo0156 putative ATP synthase delta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53007"
FT                   /db_xref="GOA:C4ZL49"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL49"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACK53007.1"
FT                   /translation="MAENVTIARPYADAAFELARGAGALGPWSEALDRLALVAADSGMK
FT                   ACFNDPKLSAEQLCQLVLGVSGDLTAEQQNFVRVLVESERLQVLPEIRDLFVALKNEHE
FT                   GVREAQIASAFPLDDAALAALKADLEARFKAAVNVSVSIDPELIGGVRIAVGDEVIDAS
FT                   VRGKLANMAAALKN"
FT   gene            246664..248208
FT                   /locus_tag="Tmz1t_0213"
FT   CDS_pept        246664..248208
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0213"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: azo:azo0157 F0F1 ATP synthase subunit alpha;
FT                   TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53008"
FT                   /db_xref="GOA:C4ZL50"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL50"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACK53008.1"
FT                   /translation="MSMQLNPSEISDLIKSRIQNLQLAATSRNEGTVVSVTDGITRVHG
FT                   LTDVMQGEMLEFPGNTFGMALNLERDSVGAVVLGEYEHITEGDTVKATGRILEVPVGPE
FT                   LIGRVVNALGQPIDGKGPINAKLTDKIEKVAPGVIARQSVSQPVQTGLKSVDSMVPIGR
FT                   GQRELIIGDRQTGKTAVAVDAIINQKGQDMYCVYVAIGQKASTVANVVRKLEENGAMEY
FT                   TIVVAATASESAAMQYLAAYAGCTMGEYFRDRGMDALIVYDDLTKQAWAYRQVSLLLRR
FT                   PPGREAYPGDVFYLHSRLLERAARVNADYVEKFTNGEVKGKTGSLTALPVIETQAGDVS
FT                   AFVPTNVISITDGQIFLETDLFNAGIRPAINAGISVSRVGGAAQTKVVKKLSGGIRTDL
FT                   AQYRELAAFAQFASDLDDATRKQLERGRRVTELMKQAQYSPMSIADMAIVLYAVNNGYF
FT                   DDVDVGRVLAFESAMIQFVKTKQAALVSSILSKKELDAEGEKSLAAAIAEFKKSWA"
FT   gene            248230..249099
FT                   /locus_tag="Tmz1t_0214"
FT   CDS_pept        248230..249099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0214"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit; KEGG:
FT                   azo:azo0158 F0F1 ATP synthase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53009"
FT                   /db_xref="GOA:C4ZL51"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL51"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACK53009.1"
FT                   /translation="MASGKEIRTKIKSVQNTRKITKAMEMVAASKMRKAQDRMRSARPF
FT                   AEKIRRLAANLSQANVTDYKHPFLVRKDQVKRVGLILVTTDKGLCGGLNTNVQRIALNA
FT                   MKDWESSGVTEIRACAIGNKGLGFMQRMGVKVVSNVTQLGDTPHLEKLIGPVKVMLDAF
FT                   QNDELDAVYVAYTRFINTMKQEPVLEQLLPLTGEQLGTPESSWDYLYEPDPQVVIDELL
FT                   VRYVEALVYQAVAENMASEQSARMVAMKAASDNAKNVIGELQLVYNKTRQAAITKELSE
FT                   IVGGAAAV"
FT   gene            249126..250526
FT                   /locus_tag="Tmz1t_0215"
FT   CDS_pept        249126..250526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0215"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /EC_number="3.6.3.14"
FT                   /note="KEGG: azo:azo0159 F0F1 ATP synthase subunit beta;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53010"
FT                   /db_xref="GOA:C4ZL52"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL52"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ACK53010.1"
FT                   /translation="MSQGTIVQCIGAVVDIQFPRDSMPKVYDALKLEDVADSFAEANLT
FT                   FEVQQQLGDGVVRTIAMGSSDGLRRGMKVANTGTQISVPVGMGTLGRIMDVLGRPIDDA
FT                   GPIETDELRAIHQKAPKFDELSPSVELLETGIKVIDLICPFAKGGKVGLFGGAGVGKTV
FT                   NMMELINNIAKQHSGLSVFAGVGERTREGNDFYHEMKDSNVLDKVAMVFGQMNEPPGNR
FT                   LRVALTGLTMAERFRDEGRDILFFVDNIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEM
FT                   GRLQERITSTKVGSITSIQAVYVPADDLTDPSPATTFLHLDSTVVLSRDIAALGIYPAV
FT                   DPLDSTSRQLDPLVVGEEHYNVARQVQMTLQKYKELRDIIAILGMDELSPEDKLSVARA
FT                   RKIQRFLSQPFHVAEVFTGSPGKYVSLKDTIKGFKMIVSGELDSLPEQAFYMVGNIDEA
FT                   IEKAKKLQ"
FT   gene            250581..251006
FT                   /locus_tag="Tmz1t_0216"
FT   CDS_pept        250581..251006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0216"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: azo:azo0160 F0F1 ATP synthase subunit epsilon"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53011"
FT                   /db_xref="GOA:C4ZL53"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL53"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACK53011.1"
FT                   /translation="MAMTVHVDIVSAEEQIFSGLAEFVALPGEAGELGILPGHMPLMTR
FT                   IKPGAVRVRAQNATEEELIFVAGGLLEVQPGLVTVLADTAIRGKDLDEAKALEAKRKAE
FT                   ETMANQTARLDYAKAQAELMEAVAQLAAIQRLRKRGH"
FT   gene            complement(251139..251720)
FT                   /locus_tag="Tmz1t_0217"
FT   CDS_pept        complement(251139..251720)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0161 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53012"
FT                   /db_xref="GOA:C4ZL54"
FT                   /db_xref="InterPro:IPR003033"
FT                   /db_xref="InterPro:IPR038989"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL54"
FT                   /inference="similar to AA sequence:KEGG:azo0161"
FT                   /protein_id="ACK53012.1"
FT                   /translation="MISSLFLSATNHLLSQAGWARQRLQPHAGRTARLVLSPVAEIDFS
FT                   VTNEGQLAEWSGEEAPEVSLRLAVADLPRLLVDGLETAMRHVRIEGNAELAEALGFVFR
FT                   HLRWDAEEDLARLFGDIAAHRLVEGGRKVVDEGRRSLERASGNVAEYLTEESTLLVPRK
FT                   ALPAFAEEVVALRDAVARLDKRVARLEKRR"
FT   gene            complement(251890..252774)
FT                   /locus_tag="Tmz1t_0218"
FT   CDS_pept        complement(251890..252774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0218"
FT                   /product="import inner membrane translocase subunit Tim44"
FT                   /note="PFAM: import inner membrane translocase subunit
FT                   Tim44; KEGG: eba:ebA3013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53013"
FT                   /db_xref="GOA:C4ZL55"
FT                   /db_xref="InterPro:IPR007379"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL55"
FT                   /inference="protein motif:PFAM:PF04280"
FT                   /protein_id="ACK53013.1"
FT                   /translation="MKQFFLTLIVAVMSFGFVATEAEAKRLGGGSSFGMQRQATPPAQR
FT                   QPSATQQQAPAAGAATAAAQPKRSWMGPIAGLAAGLGLAALFSALGLGEGFANFVMILL
FT                   LAAAAFFVFRLIFRRGANAAAQQPARDLQYAGAPAGAAQQARPQQFEAGRPLAGGSVSA
FT                   QSGLDKALASGFDAEGFARQAKLNFIRLQAANDAGNLDDLREFTTPEVFAELCMQVNER
FT                   KGAGQRTDVVELNAQVIDVAEENDRYVVSVRFSGLLREQAEAAPEAFDEIWHLSKPLAG
FT                   SGGWLIAGIQQSQ"
FT   gene            complement(252793..253530)
FT                   /locus_tag="Tmz1t_0219"
FT   CDS_pept        complement(252793..253530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0219"
FT                   /product="ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /note="TIGRFAM: ubiquinone/menaquinone biosynthesis
FT                   methyltransferase; PFAM: UbiE/COQ5 methyltransferase;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   azo:azo0162 ubiquinone/menaquinone biosynthesis
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53014"
FT                   /db_xref="GOA:C4ZL56"
FT                   /db_xref="InterPro:IPR004033"
FT                   /db_xref="InterPro:IPR023576"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL56"
FT                   /inference="protein motif:TFAM:TIGR01934"
FT                   /protein_id="ACK53014.1"
FT                   /translation="MSDKTTHFGFQTVAEEQKEKKVAEVFSSVAQKYDVMNDLMSFGLH
FT                   RLWKHFTIQVSDVREGDRVLDVAGGTADLSLAFAKKVGRSGQVWLTDINHAMLARGRDR
FT                   MIDHGFAMPAAQCNGEKLPFPDDWFDCVTVAFGLRNMTHKDVALAEMRRVLRPGGRLLV
FT                   LEFSRVWKPLSPLYDLYSFKLLPWMGQKVANDADSYRYLAESIRMHPGQEELKAMMEQA
FT                   GLSRVNYFNLSAGVVALHRGYKI"
FT   gene            complement(253538..253960)
FT                   /locus_tag="Tmz1t_0220"
FT   CDS_pept        complement(253538..253960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0220"
FT                   /product="protein of unknown function DUF971"
FT                   /note="PFAM: protein of unknown function DUF971; KEGG:
FT                   azo:azo0163 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53015"
FT                   /db_xref="InterPro:IPR010376"
FT                   /db_xref="InterPro:IPR038492"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL57"
FT                   /inference="protein motif:PFAM:PF06155"
FT                   /protein_id="ACK53015.1"
FT                   /translation="MAGLDENTPTPTDIIVHRDRKTLEVAFDDGSRFELPFEFLRVYSP
FT                   SAEVRGHGPGQETLQQGKRDVDIVDLAPVGNYAIKPTFSDGHDSGLYSWDYLFAIGRNQ
FT                   EELWNNYLEALERAGGTRDPSKVPPPPPKGGCGHHH"
FT   gene            complement(254000..255868)
FT                   /locus_tag="Tmz1t_0221"
FT   CDS_pept        complement(254000..255868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0221"
FT                   /product="Cobaltochelatase"
FT                   /EC_number="6.6.1.2"
FT                   /note="PFAM: Cobalt chelatase CobT subunit; KEGG:
FT                   mag:amb3916 CobT protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53016"
FT                   /db_xref="GOA:C4ZMH2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006538"
FT                   /db_xref="InterPro:IPR025861"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH2"
FT                   /inference="protein motif:PRIAM:6.6.1.2"
FT                   /protein_id="ACK53016.1"
FT                   /translation="MTSERPRSRPLRGVANTAVFLRAVDSTLRAIAGCAGGASAPSGVD
FT                   GIETAALPPALTTAEIVRLRGEADAQALRLRHHDERLHALHDLQGERARAAYDAIAQAR
FT                   VEALGAGRMPGVAANIAALIEQRCRDRRLDRATSREQVALAEALHVLARERFCGAPPPP
FT                   AARTMAELWRPYFDAHVGPRLDGLREHLRDERTFAAGLHELIEALDLENPTSEAREPRK
FT                   LARSEGESGDEDAAEQARAGGAAARDAQPSLRHASSGRNEGGRAAQADLAAAPARTGAA
FT                   GGDAVRDAASARGPSASYRAYTTAFDQTVGAEELCDASELHPLRARLDRELMRLPELVG
FT                   RLAKRLQRRLLASQLRDWAFDLEEGWLDPGRLDRIVVSPDHGLSFRMEKASGFRDTVVG
FT                   MLIDNSSSMRGRPLAVAAMSADILARTLERCGIKVEILGFTTRTWKGGRAREQWRREGE
FT                   PVAPGRLAELRHIVYKAADTPWRRARKNLGLMLRDGIPKENIDGEALLWAHRRLVARPE
FT                   QRRILVVVSDGAPADEATLAANPGDYLERHLHEVIAWIERRSPVELLAIGIGHDVTRHY
FT                   RRAVTLRDADALGAALLEQLARLFDERPRAPAGARMRPRASETAPR"
FT   gene            complement(255879..256871)
FT                   /locus_tag="Tmz1t_0222"
FT   CDS_pept        complement(255879..256871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0222"
FT                   /product="cobalt chelatase, pCobS small subunit"
FT                   /EC_number="6.6.1.2"
FT                   /note="KEGG: rce:RC1_3077 cobaltochelatase, CobS subunit;
FT                   TIGRFAM: cobalt chelatase, pCobS small subunit; PFAM:
FT                   ATPase associated with various cellular activities AAA_5"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53017"
FT                   /db_xref="GOA:C4ZMH3"
FT                   /db_xref="InterPro:IPR006537"
FT                   /db_xref="InterPro:IPR011704"
FT                   /db_xref="InterPro:IPR025865"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH3"
FT                   /inference="protein motif:TFAM:TIGR01650"
FT                   /protein_id="ACK53017.1"
FT                   /translation="MTEIPMTAAGPLPPLPDTECPVREAFGLDSDMRVPAFSRGSEHVP
FT                   PRDDTYRFDPDTTLAILAGFAFNRRVMIQGYHGTGKSTHIEQVAARLNWPCVRINLDSH
FT                   VSRIDLIGKDAIVLRDGKQVTEFREGILPWALQHACALVFDEYDAGRPDVMFVIQRVLE
FT                   VEGRLTLLDQSRVIHPHPAFRLFATANTIGLGDTTGLYHGTQQINQAQMDRWNIVATLN
FT                   YLDHDAEVEIVVAKMPAYDTKAGRARVGAMVMLAGLTRSGFIDGDLSTVMSPRTVLTWA
FT                   ENALIFADLRFAFRVSFLNRCDEIERAVVAEYYQRCFGEELIDPRAAAG"
FT   gene            256992..257501
FT                   /locus_tag="Tmz1t_0223"
FT   CDS_pept        256992..257501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0223"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: regulatory
FT                   protein MarR; KEGG: mag:amb2018 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53018"
FT                   /db_xref="GOA:C4ZMH4"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH4"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACK53018.1"
FT                   /translation="MPPDDPNPGKPAVVSHGPMADELGFHLRCAQLAAFKHFAHAVGAV
FT                   EGITPGLYGMLQAIDNNPGLSQSALAVAMDVDRSSIVKVVDRLEGKGLIVRDASPTDRR
FT                   RYRLHMTATGARALRRIQDAVIRQDRVFSARLDDTERATLIALLTRLYRPDSETPTARA
FT                   GIGAES"
FT   gene            257498..257983
FT                   /locus_tag="Tmz1t_0224"
FT   CDS_pept        257498..257983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0224"
FT                   /product="4-hydroxybenzoyl-CoA reductase, gamma subunit"
FT                   /note="TIGRFAM: 4-hydroxybenzoyl-CoA reductase, gamma
FT                   subunit; PFAM: [2Fe-2S]-binding domain protein; ferredoxin;
FT                   KEGG: mag:amb2019 4-hydroxybenzoyl-CoA reductase gamma
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53019"
FT                   /db_xref="GOA:C4ZMH5"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017606"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH5"
FT                   /inference="protein motif:TFAM:TIGR03193"
FT                   /protein_id="ACK53019.1"
FT                   /translation="MKNILRLTLNGRLREDLVPDNMLLLDYLREAVGLTGTKQGCDGGE
FT                   CGACTVLVDDRPRLACSTLAHQVAGRKVETVESLSTHGTLSKLQAAFHEKLGTQCGFCT
FT                   PGMLMASEALLRKNPDPSREEIKTALAGNLCRCTGYVKIIESVEAAAAARLCAEEAK"
FT   gene            257980..260289
FT                   /locus_tag="Tmz1t_0225"
FT   CDS_pept        257980..260289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0225"
FT                   /product="4-hydroxybenzoyl-CoA reductase, alpha subunit"
FT                   /note="TIGRFAM: 4-hydroxybenzoyl-CoA reductase, alpha
FT                   subunit; PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; aldehyde oxidase and xanthine
FT                   dehydrogenase a/b hammerhead; KEGG: mag:amb2020
FT                   4-hydroxybenzoyl-CoA reductase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53020"
FT                   /db_xref="GOA:C4ZMH6"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR017607"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH6"
FT                   /inference="protein motif:TFAM:TIGR03194"
FT                   /protein_id="ACK53020.1"
FT                   /translation="MNPRLPRNGTVGARTPLVDGVEKVTGKAKYTADIAAPGALVGRIL
FT                   RSPHAHARILSIDTAAAEALEGVFAVCTGAETPVPYGVLPIAENEYPLAREKVRYRGDP
FT                   VAAVAAIDEATAEKALGLIRVDYEVLPAYFTPKAARKAGAVAIHDDKPDNVLREVHAEF
FT                   GDVAAAFAEADLIREKTYTFAGVNHVHMELNATLAEYDPVRDMLTLNTTTQVPYYVHLK
FT                   VAACLQMDSARIRVIKPFLGGGFGARTETLHFEIIAALLARKARGTVRLMQTREETFIA
FT                   HRGRPWTEVKMKLGLKKDGKIAALALEATQAGGAYAGYGIITILYSGALMHGLYHIPAI
FT                   KHDAWRVYTNLPPSGAMRGHGTVDTRAAFEALLTEMAEELGIDSLRIRQINMLPEIPYV
FT                   TMYAQRVMSYGVPECLEKVKAASGWEERKGRLPKGRGLGIALSHFVSGTSTPKHWTGEP
FT                   HATVNLKLDFDGGITLLTGAADIGQGSNTMASQVAAEVLGVRLDRIRVISADSALTPKD
FT                   NGSYSSRVTFMVGNASISAAEELKGILVKAAAKKLDAREEDIEVIDELFMVSGSQDPGL
FT                   TFQEVVKAAMVDSGTITVKGTFTCPTEFQGDKRIRGSAIGATMGFCYAAQVVEASVDEI
FT                   TGKVTAHKVWVAVDVGKALNPLAVEGQTQGGVWMGMGQALSEEIVYDKGRMLHGNILDY
FT                   RVPTMMESPDIEVIIVESLDPNGPFGAKEASEGMLAGFLPAVQEAVYEAVGVRATEFPL
FT                   SPDRITELLDAKEAAA"
FT   gene            260286..261260
FT                   /locus_tag="Tmz1t_0226"
FT   CDS_pept        260286..261260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0226"
FT                   /product="4-hydroxybenzoyl-CoA reductase, beta subunit"
FT                   /note="TIGRFAM: 4-hydroxybenzoyl-CoA reductase, beta
FT                   subunit; PFAM: molybdopterin dehydrogenase FAD-binding;
FT                   KEGG: mag:amb2021 4-hydroxybenzoyl-CoA reductase beta
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53021"
FT                   /db_xref="GOA:C4ZMH7"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR017608"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH7"
FT                   /inference="protein motif:TFAM:TIGR03195"
FT                   /protein_id="ACK53021.1"
FT                   /translation="MNILADFRTHRPATLADAVSALAADGAVPLAAGTDLLPNLRRGLG
FT                   QPAVLVDLTGIGGLETISILADGSLRIGAGATLEAIAEHGLVRNAWPALAEAAAAVAGP
FT                   THRAAATLGGNLCQDTRCIFYNQSEWWRAGNGYCLKYQGDKCHVIVKNDRCYATYHGDV
FT                   APALMVLGARVEIAGPAGRRSLAVEELFREDGAGHLSLGRGELVVAVEVPPASGWRTVY
FT                   AKARIRDAVDFPLAGVAVALRRDGDRVAGLKVAITGTNSAPLRVPTDELVGGRWDAAAA
FT                   ETLSQLVRKTSNVLKTTVTGVGYRRRVLLALAPRTVDALWQGG"
FT   gene            261493..262203
FT                   /locus_tag="Tmz1t_0227"
FT   CDS_pept        261493..262203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0227"
FT                   /product="two component transcriptional regulator PhoB,
FT                   winged helix family"
FT                   /note="KEGG: azo:azo0164 phosphate regulon transcriptional
FT                   regulatory protein; TIGRFAM: phosphate regulon
FT                   transcriptional regulatory protein PhoB; PFAM: response
FT                   regulator receiver; transcriptional regulator domain
FT                   protein; SMART: response regulator receiver"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53022"
FT                   /db_xref="GOA:C4ZMH8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH8"
FT                   /inference="protein motif:TFAM:TIGR02154"
FT                   /protein_id="ACK53022.1"
FT                   /translation="MPANILLVEDEPAIQELIAANLARAGHHVVRANDAESAQRIVREA
FT                   LPDLVLLDWMLPGASGVEFARRLRADERTRDIPIIMLTARGEEQDKVTALEVGADDYVT
FT                   KPFSPRELVARIKAVLRRRAPQTTEDVVELGGLRLDPATHRVSAGETALALGPTEFRLL
FT                   HFLMTHPERVHSRAQLLDQVWGDHVFVEERTVDVHIRRLRCALEPSAHDALIQTVRGSG
FT                   YRFSVHTAQAAAAS"
FT   gene            262238..263554
FT                   /locus_tag="Tmz1t_0228"
FT   CDS_pept        262238..263554
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0228"
FT                   /product="histidine kinase"
FT                   /note="KEGG: azo:azo0165 phosphate regulon sensor protein;
FT                   TIGRFAM: phosphate regulon sensor kinase PhoR; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53023"
FT                   /db_xref="GOA:C4ZMH9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR014310"
FT                   /db_xref="InterPro:IPR021766"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMH9"
FT                   /inference="protein motif:TFAM:TIGR02966"
FT                   /protein_id="ACK53023.1"
FT                   /translation="MIRRPLSYVALVIVLPLGTLMVLAALAAAYRGSDAALALLVVGLV
FT                   GWTIMLVHNLRQLVIWARQPVGTPVPQVEGLWGRIFAEIGDRMQSECEVKERLSAELGR
FT                   FQQAALAMPDGVIYLAEDDTIEWMNPMAEQHFDLDRRKDLRMALPGLVRQPEFVRYLAG
FT                   REYAEPLVMRSLRRRERSLQVQVIGFAGNRRMVLSRDVSQLERLETMRRDFVSNVSHEL
FT                   RTPLTVVCGFLETLIDGLDDFGRDEVLQYLSLASEQSSRMQRLIEELLTLSALETGAPA
FT                   PAEEQVDAQALVRDVVRDCELLSAGRHEVRLVLEGGGELLGSHKELRSAFSNLASNAVR
FT                   YTPAGGHIEIGWRSGAGGGEFWVADDGIGIDSAHIPRLTERFYRVDRGRSRETGGTGLG
FT                   LAIVKHVTTRHQGELAIESEPGRGSRFTLRFTPARVRPA"
FT   gene            complement(263541..265160)
FT                   /locus_tag="Tmz1t_0229"
FT   CDS_pept        complement(263541..265160)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0229"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53024"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI0"
FT                   /inference="similar to AA sequence:KEGG:azo0166"
FT                   /protein_id="ACK53024.1"
FT                   /translation="MDYSQPAVCLALLQKLHPTDFRATHASLGRIVNGLLEASPAPNQH
FT                   LEVLEAARETLAFVQGEMAHAYAIHPQPPARNQEGGALERVVSLWKAVARSYARIADAD
FT                   AREGTLEDQRALLAQRRVFYEGLVLVEYYRAHLELPQGLWRAVHVAYNDAVRNGLAQVR
FT                   VTDPLNEVWRAQSAQEAYVATLLAELANPYGRGERELNWVVRWAQRFAPYCTLDTGIEG
FT                   HKPSTYGIDTDGDSGLRPLGLLARTPTVLRFDGSGLATQIQAVLAQFKRGVTPASLGLG
FT                   NDCSASSSARLLLSLYRPWGLAASGRRFPRRQKAGAIDFTGDWLAIGYAIKGELFQQPV
FT                   GEQRARAFRDDISLLTFGERVATVDGSTSESRRREAQAADLGMECERWELMDQSVGGFR
FT                   LRRSGNGARLDHHQLVGIRPPDADQLLIADLSWLMYRTDGTLEVGVNVLPGVPRVVGVR
FT                   RTAARTGAREPFHQAFVLPPSPALKTAGALVLPPAWFKKDRIVEVRDGEERQQVRLLKV
FT                   LMRGANFDQCSFVPVEQEVRPA"
FT   gene            complement(265175..265594)
FT                   /locus_tag="Tmz1t_0230"
FT   CDS_pept        complement(265175..265594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0230"
FT                   /product="histidine triad (HIT) protein"
FT                   /note="PFAM: histidine triad (HIT) protein; KEGG:
FT                   azo:azo0167 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53025"
FT                   /db_xref="GOA:C4ZMI1"
FT                   /db_xref="InterPro:IPR001310"
FT                   /db_xref="InterPro:IPR011146"
FT                   /db_xref="InterPro:IPR026026"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI1"
FT                   /inference="protein motif:PFAM:PF01230"
FT                   /protein_id="ACK53025.1"
FT                   /translation="MDCPLCALPSELVLWEDERCRVIRVDDAAHPGFCRVVWGEHVGEM
FT                   TDLSPADRRHLLDVVMATEAALRNLLDPDKINLASFGNMVPHLHWHVIPRYRDDRHFPE
FT                   SVWGAPQRDGVIHPAADAVALARAIDGALHPSGPD"
FT   gene            complement(265672..266505)
FT                   /locus_tag="Tmz1t_0231"
FT   CDS_pept        complement(265672..266505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0231"
FT                   /product="glutamine amidotransferase class-II"
FT                   /note="PFAM: glutamine amidotransferase class-II; KEGG:
FT                   eba:ebA3026 putative glutamine amidotransferase,subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53026"
FT                   /db_xref="GOA:C4ZMI2"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR026869"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI2"
FT                   /inference="protein motif:PFAM:PF00310"
FT                   /protein_id="ACK53026.1"
FT                   /translation="MCQLLGMNCNVPTDICFSFAGFRARGGLTDHHRDGWGIAFFEGRG
FT                   VRVFLDPAPSAHSPVAELVNRYPIRSLNVIAHIRKATQGEIRLENTHPFQRELWGRYWI
FT                   FAHNGNLKDFAPPLSGRFLPVGSTDSELAFCHILDTLAARFPAGKPAPAELHAALRELA
FT                   REIGSRGEFNFLLSDGDWLFAHCSSRLCYIVRRAPFAEAHLADEDLTVDFRRLTGPQDR
FT                   VAVIATTPLTDNEHWTQIAPGNLVAFRDGDTIALGETATVAQDYPRRGIDKAPSA"
FT   gene            complement(266539..267999)
FT                   /locus_tag="Tmz1t_0232"
FT   CDS_pept        complement(266539..267999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0232"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, B subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, B
FT                   subunit; PFAM: GatB region; GatB/Yqey domain protein; GatB
FT                   central domain protein; KEGG: azo:azo0170
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53027"
FT                   /db_xref="GOA:C4ZMI3"
FT                   /db_xref="InterPro:IPR003789"
FT                   /db_xref="InterPro:IPR004413"
FT                   /db_xref="InterPro:IPR006075"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR017958"
FT                   /db_xref="InterPro:IPR017959"
FT                   /db_xref="InterPro:IPR018027"
FT                   /db_xref="InterPro:IPR023168"
FT                   /db_xref="InterPro:IPR042114"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI3"
FT                   /inference="protein motif:TFAM:TIGR00133"
FT                   /protein_id="ACK53027.1"
FT                   /translation="MSRSDWEVVIGLEVHAQLDTASKIFSGASTAFGAEPNRQASAVDI
FT                   ALPGVLPVLNRGAVERAIRFGLAIGAHVAEKSVFARKNYFYPDLPKGYQISQMDLPVVV
FT                   GGTITIRVGEGESAYEKTVRLTRAHLEEDAGKSLHEDFHGMTGIDLNRAGTPLLEIVSE
FT                   PDMRSSAEAVAYARTLHALVRWIDICDGNMQEGSFRCDANVSVRRKGATEFGTRREIKN
FT                   LNSFRFLQQAIDYEVQWQIDTLEDGGRIEQATVLFDPDTGETRMMRSKEDAHDYRYFPD
FT                   PDLLPLMIAPEWKARVQAEMPELPGAMKGRFMDDWGLSAYDATTLTASKEVADFYQATV
FT                   SAAGAALAKPCANWVMGELAARLNKAELDVAASPVSPAQLAGLVARIADNTISNAIARK
FT                   VFEALWNGEGATADEVIDKQGLRQVTDTGAIEAMIDEVLAANQKSVEEFRAGKEKAFNA
FT                   LVGQVMKASKGKAGPAQVNALLRKKLGA"
FT   gene            complement(268037..268552)
FT                   /locus_tag="Tmz1t_0233"
FT   CDS_pept        complement(268037..268552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0233"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0171 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53028"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI4"
FT                   /inference="similar to AA sequence:KEGG:azo0171"
FT                   /protein_id="ACK53028.1"
FT                   /translation="MSALSRPTLRPLHGRLAALAAAVLLSACALPVLPPSDAPISDEVL
FT                   ASPSSAGKHLRPMPWRPLDVRADCRFRDEAGYTTRITLDIAQSKVNAFNADVDIPRRGS
FT                   CSFHGPFTQTREKPSVQLRAPDGCTVDIFEQGKAVTVGFANCASRCTRGASDYLWPILV
FT                   DRTNGQCH"
FT   gene            complement(268563..270035)
FT                   /locus_tag="Tmz1t_0234"
FT   CDS_pept        complement(268563..270035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0234"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, A subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, A
FT                   subunit; PFAM: Amidase; KEGG: eba:ebA3030
FT                   aspartyl/glutamyl-tRNA amidotransferase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53029"
FT                   /db_xref="GOA:C4ZMI5"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR004412"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI5"
FT                   /inference="protein motif:TFAM:TIGR00132"
FT                   /protein_id="ACK53029.1"
FT                   /translation="MINASLPELRRALDARQISAVELAGLFLDRIDALNPALNAFITVD
FT                   REGALAAARAADARIAAGSAGPLTGIPLAHKDVFCTEGVLTTCGSKMLANFVSPYDAHV
FT                   VSLLEAAGAVSLGKANMDEFAMGSSNESSYFGAVKNPWNLGRIPGGSSGGSAAAVAARL
FT                   APIATGTDTGGSVRQPAAYCGITGIKPTYGLVSRYGMIAYASSLDQGGAFGASAEDCAL
FT                   LLGAMTGFDARDSTSLERPTEDYAAALAGPACARPLEGLRIGLPREFFAEGMSDDVRAA
FT                   VEAAVEQYRVLGATTVEVSLPNAKLAIPAYYVIAPAECSSNLSRFDGVRYGHRAADYGD
FT                   LADMYAKSRAEGFGAEVKRRILVGTYVLSHGYYDAYYLQAQRLRRLIAQDFQAALQHCD
FT                   LIAGPTTPTTAWTLGEKADDPVQMYLSDIYTIAVNLAGLPGLSHPVGFGADGLPVGLQL
FT                   IGDYFAESRLLHAAHRFQHATDWHARRPACAA"
FT   gene            complement(270121..270408)
FT                   /locus_tag="Tmz1t_0235"
FT   CDS_pept        complement(270121..270408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0235"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase, C subunit"
FT                   /note="TIGRFAM: glutamyl-tRNA(Gln) amidotransferase, C
FT                   subunit; PFAM: Glu-tRNAGln amidotransferase C subunit;
FT                   KEGG: azo:azo0173 aspartyl/glutamyl-tRNA amidotransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53030"
FT                   /db_xref="GOA:C4ZMI6"
FT                   /db_xref="InterPro:IPR003837"
FT                   /db_xref="InterPro:IPR036113"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI6"
FT                   /inference="protein motif:TFAM:TIGR00135"
FT                   /protein_id="ACK53030.1"
FT                   /translation="MSLSNDQIGHIARLARIALSDTELEATRAKLDGIFGLIEQMQAVD
FT                   TTGVEPMSHPQEFPTRLRPDVVTETDRRDAFQKVAPQTEAGLYLVPKVIE"
FT   gene            270578..271621
FT                   /locus_tag="Tmz1t_0236"
FT   CDS_pept        270578..271621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0236"
FT                   /product="cell shape determining protein, MreB/Mrl family"
FT                   /note="TIGRFAM: cell shape determining protein, MreB/Mrl
FT                   family; PFAM: cell shape determining protein MreB/Mrl;
FT                   KEGG: azo:azo0174 rod shape-determining protein MreB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53031"
FT                   /db_xref="GOA:C4ZMI7"
FT                   /db_xref="InterPro:IPR004753"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI7"
FT                   /inference="protein motif:TFAM:TIGR00904"
FT                   /protein_id="ACK53031.1"
FT                   /translation="MFGFLRSYFSNDLAIDLGTANTLIYVRGKGIVLDEPSVVAIRTEG
FT                   GPNAKRSIQAVGHQAKQMLGKTPGNITAIRPMKDGVIADFVVTEQMIKQFIKKVHDSRL
FT                   LSPSPRIIICVPCGSTQVERRAIRDAALAAGASQVFLIEEPMAAAIGAGLPVSDATGSM
FT                   VVDIGGGTTEVGVISLGGIVYSGSIRVGGDKFDESIVNYIRRNYGMLIGETTAEKIKKQ
FT                   IGSAFPGSEVREMEVKGRNLAEGIPRSFTISSNEILEALTEPLNQIVSAVKIGLEQTPP
FT                   ELGADIAERGMMLTGGGALVRDLDRLLMEETGLPVVVAEEPLTCVARGCGMALDKMDKL
FT                   ASIFTSE"
FT   gene            271693..272571
FT                   /locus_tag="Tmz1t_0237"
FT   CDS_pept        271693..272571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0237"
FT                   /product="rod shape-determining protein MreC"
FT                   /note="TIGRFAM: rod shape-determining protein MreC; PFAM:
FT                   Rod shape-determining protein MreC; KEGG: azo:azo0175 rod
FT                   shape-determining protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53032"
FT                   /db_xref="GOA:C4ZMI8"
FT                   /db_xref="InterPro:IPR007221"
FT                   /db_xref="InterPro:IPR042175"
FT                   /db_xref="InterPro:IPR042177"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI8"
FT                   /inference="protein motif:TFAM:TIGR00219"
FT                   /protein_id="ACK53032.1"
FT                   /translation="MSLVGHQPPPIFRRGPAPLARLFVFVALCLVLLVADLRFRYLEVL
FT                   RNALSVVTYPLQMAASTPADVVRNASRYFGTLVDVQLENAELRRHQLGAGERLLRFEQL
FT                   EQENLHLRELLQMSQRVQTKSIAADILYNAPDPFARKVILDRGTQQGVEAGLAVLDANG
FT                   VIGQVTRVHPVQSEVTLLTDRNQSIPVSVVRNGVRGVLYGVGRGMLEMRHVLAEVDIQP
FT                   GDRLVTSGLDGIFVPGLPVATVTRVDRDQDAFARIECEPLAAIERSVQVLVIGRAAYPP
FT                   PPPPPEPAGGR"
FT   gene            272575..273096
FT                   /locus_tag="Tmz1t_0238"
FT   CDS_pept        272575..273096
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0238"
FT                   /product="rod shape-determining protein MreD"
FT                   /note="TIGRFAM: rod shape-determining protein MreD; KEGG:
FT                   eba:ebA3038 rod shape-determining MreD transmembrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53033"
FT                   /db_xref="GOA:C4ZMI9"
FT                   /db_xref="InterPro:IPR007227"
FT                   /db_xref="InterPro:IPR026034"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMI9"
FT                   /inference="protein motif:TFAM:TIGR03426"
FT                   /protein_id="ACK53033.1"
FT                   /translation="MHPTNRSSRILQPVKLWFVYLSLFVALGLEYIPTGRTPGLPDWVA
FT                   LALAFWCVREPLAIGMGAGFAFGLLMDVGLGAAMGQHALAYVVLAYLANALARRVLWFP
FT                   AWQQALHVLPLLLLAQAIMALVRLVAGAEFPGWAYFLSSFGSALLWTPLSFLLLLPQYQ
FT                   PDERDDNRPI"
FT   gene            273109..275154
FT                   /locus_tag="Tmz1t_0239"
FT   CDS_pept        273109..275154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0239"
FT                   /product="penicillin-binding protein 2"
FT                   /EC_number="2.4.1.129"
FT                   /note="KEGG: eba:ebA3040 penicillin-binding protein 2;
FT                   TIGRFAM: penicillin-binding protein 2; PFAM:
FT                   penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53034"
FT                   /db_xref="GOA:C4ZMJ0"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR017790"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ0"
FT                   /inference="protein motif:TFAM:TIGR03423"
FT                   /protein_id="ACK53034.1"
FT                   /translation="MTEFRAPAVELARFRLRVVVAAVFVLVCFGLLAARFHHLQVKRHD
FT                   YFLTRAEDNRIALLPVVPHRGTIVDRKGVVLARNYATYTLEITPSQVRDLDATLDELAS
FT                   LLPIDGRDRRRFRKLYEESRNFESVPLRSRLTDEEVARVVSQRYRLPGVDVKARLLRDY
FT                   PQGTTASHVIGYIGRITERDVERIEEAGNAANYRGSQHMGKAGLEQSYEHELHGTTGFE
FT                   QVEVNAGGRAVRALSHTPATSGNDLELTLDIELQKVAEKAFGDRRGALVAIEPSTGGVL
FT                   ALASMPTYDPNLFVDGISTQDWKALNDSPDHPMLHRAIYSTYPPGSTFKPFMALAGLET
FT                   GKRTARQAIHDVGYFNSGGHRFMDDKIGGHGMVDLHKSIVVSCNTYYYQLANDLGIEGI
FT                   AGFMAPFGFGERTGIDLPGEATGVLPSPEWKRKRFKKAEQQRWFGGETISVGIGQGYNA
FT                   YTPLQLANALAALVSRGRLYRPHVVKYVVDSRTGERRAVEPEPLRQIPLRDAHLRAVLD
FT                   AMVDVNRTGTGKRAFKGAPYTVGGKTGTAQVFSLRGQRYVEGRVRERLRDHSWFVAYAP
FT                   AENPKIALAVLVENGGFGAQSAAPIARQVIDYYLLDQRAGAPAAEDEEGAESEEGAEGG
FT                   GEASPATPAVESATPAEEPTAPPQPRPVPQPAAVPAPQPGVARSTR"
FT   gene            275151..276293
FT                   /locus_tag="Tmz1t_0240"
FT   CDS_pept        275151..276293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0240"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: azo:azo0178 rod shape-determining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53035"
FT                   /db_xref="GOA:C4ZMJ1"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ1"
FT                   /inference="protein motif:TFAM:TIGR02210"
FT                   /protein_id="ACK53035.1"
FT                   /translation="MNDNRFNPLALVLGFLRPLDPLLLLLLAVLLGYAHVLMQSASPER
FT                   LDSQITHIGIALAGMWLLAWLKPQRLLSMAVPLYLLGVVLLLAVELFGEISKGAQRWLD
FT                   LGVARIQPSELMKIAMPLMLAWFFQMREGQTRLVDFILAGVLLLVPVGLILIQPDLGTS
FT                   LLVAASGIYVIYFAGLSWKLLIPIVVAGVIGLGSIVAFGDTLCQPDVDWQVLREYQKQR
FT                   VCTLLDPTRDPLGRGFHIIQSTIAIGSGGLTGKGWMDGTQTHLAFLPERHTDFIFAVLA
FT                   EEFGLVGAVLLLVIYVLLLLRGFHIAANAPTHASRLLGGAITMIFFTYAFVNMGMVSGI
FT                   LPVVGVPLPFISYGGTALVTLCLGIGILMSIQRSRFAEKT"
FT   gene            276311..277456
FT                   /locus_tag="Tmz1t_0241"
FT   CDS_pept        276311..277456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0241"
FT                   /product="rare lipoprotein A"
FT                   /note="TIGRFAM: rare lipoprotein A; PFAM: Rare lipoprotein
FT                   A; Sporulation domain protein; KEGG: azo:azo0179
FT                   lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53036"
FT                   /db_xref="GOA:C4ZMJ2"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR009009"
FT                   /db_xref="InterPro:IPR012997"
FT                   /db_xref="InterPro:IPR034718"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ2"
FT                   /inference="protein motif:TFAM:TIGR00413"
FT                   /protein_id="ACK53036.1"
FT                   /translation="MTPVPPVLPAAFAARPQAARAPRALVAAGLACAVALLSACSSAPK
FT                   REGPVAEVPAQAGKPGRSPVRGGGYYKDDGPGDDIPDNLDAIPDAEPRDEPLHRFANRP
FT                   YHVMGQSFVPATELRPFRQRGHGSWYGRRFHGNPTSSGEPYDMYAMTAAHPTLPIPSYA
FT                   RVTNLANGRSVVVRVNDRGPFLRGRVIDLSYAAAHKLGYVNGGSAEVEVEQILPGEAPL
FT                   VAMARPVPPLPARANEGLMPGSGPATGMKALAPLPVAQAPLPAPVASPPRAAGSAIALA
FT                   PPECEEGPVCGAAGGFAPPVASASAGIFLQLGAFSSFANAEGFRDTVRSQASDLAERFE
FT                   LFADGERFRLHAGPYDTVEAARDAAERMGNVLKLKPFVVVR"
FT   gene            277565..278692
FT                   /locus_tag="Tmz1t_0242"
FT   CDS_pept        277565..278692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0242"
FT                   /product="Beta-lactamase"
FT                   /EC_number="3.5.2.6"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: azo:azo0180 D-alanyl-D-alanine
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53037"
FT                   /db_xref="GOA:C4ZMJ3"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ3"
FT                   /inference="protein motif:PRIAM:3.5.2.6"
FT                   /protein_id="ACK53037.1"
FT                   /translation="MRFLIAVLVSLFSLSALAQTVPPPALAAKAWALVDHATGQTLAEK
FT                   DADARIEPASLTKLMTAYITFSKLKEGSLKPDQVVPVSTKAWRMEGSRMFIEPNKPVSV
FT                   DELIRGVIVQSGNDACVALAETIAGSEEAFAALMNREAQRLGMTNTHFTNSTGLPDPQL
FT                   YTSARDLAVLASAIVRDFPEYYGLYSLKEFTYNGIKQPNRNRLLYMDPSVDGMKTGHTS
FT                   SAGYCLVSTARRGERRLVSVVLGAASDSVRAQESLKLLNFGYQFYETVKLYSADEALSK
FT                   FRVWKGKLNELPVGFTKDFALTVPKEAANKIQVSLESRQPLVAPLQRGQEVGTLTVAVD
FT                   GKPLGQYPVVALQDVEVAGFFGRLWDAIVMFFKSL"
FT   gene            278735..279019
FT                   /locus_tag="Tmz1t_0243"
FT   CDS_pept        278735..279019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0243"
FT                   /product="protein of unknown function DUF493"
FT                   /note="PFAM: protein of unknown function DUF493; KEGG:
FT                   azo:azo0182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53038"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ4"
FT                   /inference="protein motif:PFAM:PF04359"
FT                   /protein_id="ACK53038.1"
FT                   /translation="MADQQDAQTRQSLIEYPCDFPIKVMGARVDGFAQAVIDVVLRHAP
FT                   DFEPAGAEMRPSSKGNYLAVTCTFRALSQVQVDAMYRELTAHPMVKVVL"
FT   gene            279016..279684
FT                   /locus_tag="Tmz1t_0244"
FT   CDS_pept        279016..279684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0244"
FT                   /product="lipoate-protein ligase B"
FT                   /EC_number="2.3.1.181"
FT                   /note="KEGG: azo:azo0183 LipB protein; TIGRFAM:
FT                   lipoate-protein ligase B; PFAM: biotin/lipoate A/B protein
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53039"
FT                   /db_xref="GOA:C4ZMJ5"
FT                   /db_xref="InterPro:IPR000544"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR020605"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ5"
FT                   /inference="protein motif:TFAM:TIGR00214"
FT                   /protein_id="ACK53039.1"
FT                   /translation="MIVKRLGLVEYAPALEAMRVFTAARGADTPDELWLLQHPPVYTLG
FT                   QAGKPEHLLQNPANIPLVRIDRGGQITYHGPGQLVAYLLLDLPRRRLKVRELVHLMEQA
FT                   IIDTLADYGLAAERKDGAPGVYIAGDKIAALGLRVRNGCSYHGLAINVDADLSPFGWIN
FT                   PCGYEGLKTIRMKDFGIDASVDGVGERLLGHLQALLPPIGTADAADQPPGAAAGARAGP
FT                   "
FT   gene            279807..280754
FT                   /locus_tag="Tmz1t_0245"
FT   CDS_pept        279807..280754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0245"
FT                   /product="lipoic acid synthetase"
FT                   /EC_number="2.8.1.8"
FT                   /note="KEGG: azo:azo0184 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53040"
FT                   /db_xref="GOA:C4ZMJ6"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ6"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ACK53040.1"
FT                   /translation="METPARKQRGADKTARIPIKIVPAERLKKPEWIRIKLGAGMEAER
FT                   FNEIKATLRDHKLHTVCEEASCPNIHECFGKGTATFMIMGDICTRRCPFCDVGHGRPEP
FT                   LNPDEPRDLAKTIAAMRLNYVVITSVDRDDLRDGGAQHFVDCIRETRAASPSTRIEVLV
FT                   PDFRGRMEIALDIFDAAPPDVMNHNLETVPRLYKQARPGSDYAYSLELLKQFKARHPDV
FT                   ATKSGLMVGLGETDDEILEVMRDLRAHDVEMLTIGQYLQPSGGHLPVLRYVHPDTFKMF
FT                   ETEALKMGFRNAACGPMVRSSYWADQQAHGAGVV"
FT   gene            complement(281307..281954)
FT                   /locus_tag="Tmz1t_0246"
FT   CDS_pept        complement(281307..281954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0246"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   rce:RC1_0668 pentapeptide repeat family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53041"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ7"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACK53041.1"
FT                   /translation="MPTIRATLHATLAASLLLALLPPAHAQRAGNIGGCDIRRGTLCTN
FT                   LNLNGANLEGVNLANSQFTRSDLSGANLRGATLNEANFSQAEMAGATLDKASMLRANLR
FT                   GARLTGASFKEADLRNAILQNADLHDADLTAAQLGGADLTNARAERSRFDGAELTRSNL
FT                   RAAKLAGASFVGANLLGANFTRAQLSNADLTGANLDQAIFLNAQTDGCKGCP"
FT   gene            complement(281975..282472)
FT                   /locus_tag="Tmz1t_0247"
FT   CDS_pept        complement(281975..282472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0247"
FT                   /product="Redoxin domain protein"
FT                   /note="PFAM: Redoxin domain protein; alkyl hydroperoxide
FT                   reductase/ Thiol specific antioxidant/ Mal allergen;
FT                   Thioredoxin domain; electron transport protein SCO1/SenC;
FT                   KEGG: mpt:Mpe_A0318 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53042"
FT                   /db_xref="GOA:C4ZMJ8"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ8"
FT                   /inference="protein motif:PFAM:PF08534"
FT                   /protein_id="ACK53042.1"
FT                   /translation="MKLKIAAAVAVLVLAVAGFFVFTQKPAAPDVAFSTLQGQSFRTAD
FT                   LRGKVVLVNFWATTCTTCIKEMPALKATQEKFEARGYRTVAVAMDYDPPAQVAAFVERS
FT                   ALPFTFVLDRDGSIARGFEGVRLTPTSYVLDKHGRIVQKILGEPDFDKLHGLLEQLLTE
FT                   PA"
FT   gene            282687..283127
FT                   /locus_tag="Tmz1t_0248"
FT   CDS_pept        282687..283127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0248"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   dar:Daro_2762 hemerythrin HHE cation binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53043"
FT                   /db_xref="GOA:C4ZMJ9"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMJ9"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACK53043.1"
FT                   /translation="MSNPPVFTWSDRFLLGHRTIDDTHREFVDCVDALLRARDAEIPAA
FT                   LDAFARHAEAHFAQEDAWLSAADFPTGGDCHIDEHAKVMASVREVQELVAKGEVEIARE
FT                   LAQALMDWFPGHADYMDSALATWLVKKSHDGRPLVLRRKENL"
FT   gene            283268..285259
FT                   /locus_tag="Tmz1t_0249"
FT   CDS_pept        283268..285259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0249"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: azo:azo0186
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53044"
FT                   /db_xref="GOA:C4ZMK0"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005752"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK0"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACK53044.1"
FT                   /translation="MSALLNAPQREAIRYLDGPCLVLAGAGSGKTRVITHKIAHLINEC
FT                   GISPNNIAAITFTNKAAKEMQERVAHIMGGRVPGGLTVCTFHALGVRIVRQEAKHCGLK
FT                   PQFSILDASDTVQIVSDVAGDSDKGIAKQMQWQISSWKNAMITPEEAAQLADNEIASVA
FT                   ARLYKEYERTLRAYQAVDFDDLIALPVRLFDEHPEVRERWQNKLRYLLVDEYQDTNRAQ
FT                   YRLLKLLSGVRGAFTAVGDDDQAIYAWRGADVENLKLLQQDYPKLKVIKLEQNYRSSRR
FT                   ILEAANTVIANNEKLFDKRLWSEHGQGEQIVVTNCRDAEHEAEWVATKITAHKFEHRTR
FT                   FKDYAILYRGNHQARLIEQQLRNHRIPYVMSGGQSFFDKAEIRDLIAWLRLLVNEDDDL
FT                   AFIRAITTPRRGIGAATIEALGAYAGHRHSSLFAAVFEEGLTQHLNAKQLQGVQEFAAY
FT                   INRLQYRAPREPAAQLLEDLLGAIRYEAWLFEHCDTREAESKWSNVRDFVGWLGRKGEE
FT                   DGKNLLELTQTIALMSMLDKEDPDFDGVQMATLHASKGLEFPHVFLVGVEEGLLPHQSS
FT                   IDEDKVEEERRLMYVGITRAQRSLNLTWCERRKSGKEFRTCEPSRFIAEMGGDIKMNDR
FT                   KTAQPVTKEEGKARLANLMAMFENRDKA"
FT   gene            complement(285398..285844)
FT                   /locus_tag="Tmz1t_0250"
FT   CDS_pept        complement(285398..285844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0250"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: azo:azo0187
FT                   cytochrome c5"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53045"
FT                   /db_xref="GOA:C4ZMK1"
FT                   /db_xref="InterPro:IPR002323"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK1"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACK53045.1"
FT                   /translation="MSNPRPLRPARLAMPVALVAAALLAGCGDSGKVDEELRATLIQPV
FT                   ARVEIQAVTITPGTRTGEQIYKSICAACHDAGAVGAPKTGDAAAWGPRLALGHDGLTAS
FT                   AIAGKNAMPPRGGGSDLTDTEVKRAVAYLANLAGAGYTEPPVEQ"
FT   gene            285992..286068
FT                   /locus_tag="Tmz1t_R0001"
FT                   /note="tRNA-Arg1"
FT   tRNA            285992..286068
FT                   /locus_tag="Tmz1t_R0001"
FT                   /product="tRNA-Arg"
FT   gene            complement(286222..286440)
FT                   /locus_tag="Tmz1t_0251"
FT   CDS_pept        complement(286222..286440)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0251"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   pol:Bpro_0373 transcriptional regulator, Cro/CI family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53046"
FT                   /db_xref="GOA:C4ZMK2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK2"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACK53046.1"
FT                   /translation="MVRCHLSRLMGEHKLKIADVARETGLHRNTITLLYNETANRVDLE
FT                   TIDRLCALFECTVGELFEYIPDATNTA"
FT   gene            286589..286822
FT                   /locus_tag="Tmz1t_0252"
FT   CDS_pept        286589..286822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0252"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53047"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK3"
FT                   /inference="similar to AA sequence:KEGG:Daro_1323"
FT                   /protein_id="ACK53047.1"
FT                   /translation="MSLTYLTTDELSGRIKYDPRTIRERLKDSVLLEGTHYIRPFGGRK
FT                   ILYIWEHIERDMGCTSEQSFAIPMANGGVCHG"
FT   gene            286815..288122
FT                   /locus_tag="Tmz1t_0253"
FT   CDS_pept        286815..288122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0253"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: dar:Daro_1324
FT                   phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53048"
FT                   /db_xref="GOA:C4ZMK4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR022000"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK4"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACK53048.1"
FT                   /translation="MASIRARKDNGMLFIDFRYQDKRYREQTALGDTAANRKRLQKVLD
FT                   RIEADIAAGTFDYRRFFPGSKNAAKFDPAPGGMVGPVSAAAVALPSAAASVASTPLFKD
FT                   FAETWYGEKEVEWRRSYKTTLRATLDRALIPRFGEKEVGQISKADVLAYRAELGKATAK
FT                   GKQTKLSAARINKMLNPLRQVLNEAADRFDFRTPFDSVKQLKTKRTDVDPFTLAEVKQI
FT                   LDTVRPDFRNYFTVRFFTGLRTGEVDGLQWKYVDFDNRLILVRETIVGGEEEYTKTDGS
FT                   QRDIQMSQLVFDALQAQFEATGKLGKFVFCNRLGTPLDHKNVTNRVWYPLLRHLNLKQR
FT                   RPYQCRHTAATLWLASGEAPEWIARQLGHTTTEMLFRVYSRYVPNLTRRDGSAFERLIT
FT                   QTLGTQLLPVKTAPAEEAEQEAELLAENAAQGGDHE"
FT   gene            288115..289077
FT                   /locus_tag="Tmz1t_0254"
FT   CDS_pept        288115..289077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0254"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: dar:Daro_1325 metal-dependent
FT                   phosphohydrolase, HD region; TIGRFAM: metal dependent
FT                   phophohydrolase; PFAM: metal-dependent phosphohydrolase HD
FT                   sub domain; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53049"
FT                   /db_xref="GOA:C4ZMK5"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK5"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACK53049.1"
FT                   /translation="MSEYRLPIPTAAPDNVVAKLPPVFRVQSISRLPLDEHCVLNRAGL
FT                   FHERASLMVEWPSRKVDVRLGAGCLVSIRWLGRPVSLGGAVRISRLVVLGRPEASLDLF
FT                   QTIPTVWVKERTLVRRASALWQRLPVHFQHLFNAIFWDSRRLHRYLVGASSLKGHHSCV
FT                   HGNLWHTLEVAEQALRMAQGQPLACPEVLLMAALLHDAGKADEYRLGYSGLELTTRGKL
FT                   VGHRNTIIEWIAAAIAHARIALPESHYLGLIHALTSARGAPDWLGLREPCTLDAVLLSA
FT                   ADRLSGQIELMARHSPAESGFGRFHPHLRGRPYVVGAAF"
FT   gene            complement(289415..290116)
FT                   /locus_tag="Tmz1t_0255"
FT   CDS_pept        complement(289415..290116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0255"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_0796 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53050"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53050.1"
FT                   /translation="MTRWQVELLGEAYDLEELPYFFATGEICCLAEDGTFFLIAQAFEG
FT                   QQEPSQVHAMAESLVDDITGAMATHIGRYPRPRVGPVHERGTDGQTKKHYFLKAERSTV
FT                   YSRSSLGAAPDGPTYPQLFIRAGQRSQHLRHAMLIWADPNRTWPRLYRILEEVQQHLGT
FT                   DPYRRSLCAKSEQKRFERTANSAEVAGKDARHALGRNEPPTNPMTLEEAVHFVGSVLQG
FT                   AVKLESQRGTA"
FT   gene            complement(290559..290738)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0256"
FT   gene            complement(290991..292352)
FT                   /locus_tag="Tmz1t_0257"
FT   CDS_pept        complement(290991..292352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0257"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:p1B277 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53051"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C4KAN4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53051.1"
FT                   /translation="MPRFEVKQSAKLNLTSYSGLALIGQCCQAAQVEAVIDPRLPVSQG
FT                   MRSSDLVKSVVGLLSLGKSDFEAIEPFRGDRFFKEALGLAKVPGSVWMRQRLDARAAEL
FT                   RELTDELSLRLLERTEAPITAHKGYVCADLDTFVMDNSDTKKEAVSRTYQGVDGYTPIA
FT                   LYLGNEGWNLGLELRAGSHHSALETEYFFERAFPRLRRVCAADAKLLWRADSGFDSARL
FT                   LFALADERDRWAALGRSFDYLTKWNPRRQDKTAWVDRAEAAGVFEEVRAGKRVGLLDLK
FT                   IDRAWKKAKRTLRLVVRVTERTIDKKGQHLLTPEIEIEGWWTSLEVAMADVIELYKHHG
FT                   THEQFHSEIKTDLDLERLPSGKFDTNDAVMHLAAFAYNCLRLIGQLGLTGELSPIRHPA
FT                   KRRRIKTVLQEVMYRAAKFVEHARRLVLDFGRGVAAHVKVFTTVQARLCAVASP"
FT   gene            complement(292438..293661)
FT                   /locus_tag="Tmz1t_0258"
FT   CDS_pept        complement(292438..293661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0258"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53052"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53052.1"
FT                   /translation="MANFSTEFPIDTKNSVEDVVRLACKWVTGSPHTRIPSTAFDELPL
FT                   DLEQRYSNGPEEVTTAIAKNADYDIGGLRHVRTENGLEWVTSIVSLKTPERHMLSLQVS
FT                   CEALSTAVRLPPPKKPYFIRQALTELGGGMDGEIPVTDKPFRLGEGEAGIAAALMMGVA
FT                   NNKLPIVYVSAGFDGTHLINPDELAKFVSGMAHVVVEPSRIFSFKVKTLTNSGNVFGGT
FT                   IGVYWPESNARNAYFIDDETPNPRAIQIEIAKDIRLALSNRRARTNCTWAHLKESISRK
FT                   RYDLLKSQGSTALQEYIEAFDADQAAKDVKLADAEQEISRLNAELRRVTSSSQSSTRGL
FT                   VNAGKEQDLYEHEIADIIVDALREALRAARENSRRHHVLTDLLAANKSSDTRQKLEEEI
FT                   KSLFKTYT"
FT   gene            complement(293992..294141)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0259"
FT   gene            294215..295252
FT                   /locus_tag="Tmz1t_0260"
FT   CDS_pept        294215..295252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0260"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3243 IS5 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53053"
FT                   /db_xref="GOA:C4ZMK9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMK9"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53053.1"
FT                   /translation="MKPRSAIKTDLFADEHHRKKIDSLGDPLIDIESHIDFAALAAEVD
FT                   RVAPRTVSAQGGRPPYPTETMVRILVLKRLYNLSDEQMEYQLLDRMSYKRFCGLANAAN
FT                   IPDRTTVWTFENRIGELGAKALFEGVSAQLLKRGFIARGGQIIDATLVPAPKQHNSRGE
FT                   KALIDQGAMPADWKPAKRRQKDTDATWTKKHGKSHFGYKLSINVDKKYKFIRALETDTA
FT                   STHDSQHFDNVFDTSNTSRDVYADRGYPSEERAAWLKANGFRNQIQRKGQRNKPLSECQ
FT                   QRRNTRIARTRARVEHPFAAIAQMGGKLIRTIGQARASFAMTMMAACYNLKRLTYFQKA
FT                   GIVAF"
FT   gene            complement(295366..295893)
FT                   /locus_tag="Tmz1t_0261"
FT   CDS_pept        complement(295366..295893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0261"
FT                   /product="putative tyrosine recombinase XerD"
FT                   /note="KEGG: azo:azo2306 putative tyrosine recombinase
FT                   XerD"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53054"
FT                   /db_xref="GOA:C4ZML0"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML0"
FT                   /inference="similar to AA sequence:KEGG:azo2306"
FT                   /protein_id="ACK53054.1"
FT                   /translation="METREHPLREAWNKGKLVGQKAPLKPKDIWAIRIHLQNAHEVRDL
FT                   AMFNLAIDSKLRGCDLVSLRVRDVTHGNQVLSRAMVVQRKTQRPVQFELTEPTRTAVAA
FT                   WIAKAGLRAEDFLFPSRLHDSPHVSTRQYARIVEHWVVAAGLDPSAYGTHSMRRTGTSN
FT                   NPRYSVNPAVQR"
FT   gene            296122..296997
FT                   /locus_tag="Tmz1t_0262"
FT   CDS_pept        296122..296997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0262"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: bvi:Bcep1808_7209 phage
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53055"
FT                   /db_xref="GOA:C4ZML1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML1"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACK53055.1"
FT                   /translation="MDTPTRPVSPLRQRMLDDMRMRKLTPKTQSAYIRAVCRFTRYLGR
FT                   APDSATVEDLRNYQLHLVDTGTSPMSLNAAISGLKFFFDITLQRGELMARMQPVRLPQR
FT                   LPVVLSREEVARLIAACNNLKHQTALSLAYATGLRASEVVSLKVSDVDSGRMTLRVEQG
FT                   KGRKDRYAMLSPLLLERLRVWWRVARAQGKMLDGGWLFPGLNPIESLSPRQLNRAVQAA
FT                   ALAAGIDKRVSMHTLRHCFATHLLEQKVDIRIIQALLGHKKLDTTVIYTQVATDLLREV
FT                   VSPLETLQSA"
FT   gene            297005..298210
FT                   /locus_tag="Tmz1t_0263"
FT   CDS_pept        297005..298210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0263"
FT                   /product="putative transposase"
FT                   /note="PFAM: putative transposase; KEGG: rfr:Rfer_1195
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53056"
FT                   /db_xref="GOA:C4ZML2"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML2"
FT                   /inference="protein motif:PFAM:PF04986"
FT                   /protein_id="ACK53056.1"
FT                   /translation="MARPALEVADIFRAFGPAWRLAQHGHLSLGQLKVMSAIEQCRTAA
FT                   LGGHVLRCEACEQIDISYNSCRNRHCPKCQARAAQRWLEARQADLLPVEYYHVVFTLPA
FT                   PISAFAYTNKALVYRLLFEVAAETLLTIAADPKHLGATIGATLVLHTWGSAMTHHPHVH
FT                   GIVPGGGLSADGQRWIACRHGFFLPVRVLSRLFRRRFLEELAKAHRAGALRFFGEFAPL
FT                   AQLAAFLRWLAPLRTSEWVVYAKRPFAGPEAVLAYLSRYTHRVAISNRRLVSLDAGSVS
FT                   FRWKDYRAKGRTRHKTMTLTAEEFMRRFLLHVLPCGFHRIRHYGLLANAGRRQHLAHAR
FT                   ELLVATPPDDPHAIAVEPAAALSTTPTAGFVCRCCGSVMRVIETFARGATIRAPPLHGA
FT                   TS"
FT   gene            complement(298717..299316)
FT                   /locus_tag="Tmz1t_0264"
FT   CDS_pept        complement(298717..299316)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: amc:MADE_04077 outer membrane protein and
FT                   related peptidoglycan-associated (LipO)protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53057"
FT                   /db_xref="GOA:C4ZML3"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53057.1"
FT                   /translation="MTIKARVLTHTRVTARAKRQCPLLPAFVLLGLVGCTVVPDQGLQS
FT                   GNSAEGMRVQGASTHPIAGGSSAELAASRASQSSFGAADTGMPSLAEEPVAVIELPPIA
FT                   DSLSPEMTARLREVAEAAKADERVTLSLEGFVPDGGSPQLNIGLAEQSLMVVRKQLIAM
FT                   RVPVGRIQIIPFGEHHNRARSPTNHWVEIYVRVRDR"
FT   gene            complement(299368..300330)
FT                   /locus_tag="Tmz1t_0265"
FT   CDS_pept        complement(299368..300330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0265"
FT                   /product="Integral membrane protein TerC"
FT                   /note="PFAM: Integral membrane protein TerC; KEGG:
FT                   azo:azo0914 putative tellurium resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53058"
FT                   /db_xref="GOA:C4ZML4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="InterPro:IPR022369"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML4"
FT                   /inference="protein motif:PFAM:PF03741"
FT                   /protein_id="ACK53058.1"
FT                   /translation="MESIGTWWMWAAFAAIVVTMLLVDLFAFGGGKQHRVSLKEAAGWS
FT                   LAWVTVAMLFAAGLWWYLDGTLGRALANEQATAFVTGYLVEKSLAVDNVFVWMMIFSFF
FT                   AVPLELQRRVLLYGIVGAIVLRTIMIFAGSWLINEFHWLLYVFGAFLIVTGIKMAWFSE
FT                   HDPDLEKNPLIRWIRNHYPVTEKLEGERFFVMRDGVRMMTPLFLALVLVEISDVIFAVD
FT                   SIPAIFAITTDPFIVLTSNLFAILGLRAMYFLLADLGDRFELLKYGLAAILVFIGTKML
FT                   IVEWVKIPVLVSLSVVATILACSVFASLWYSARKAKPVV"
FT   gene            300959..302293
FT                   /locus_tag="Tmz1t_0266"
FT   CDS_pept        300959..302293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0266"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: protein of unknown function DUF21; CBS domain
FT                   containing protein; transporter-associated region; KEGG:
FT                   eba:ebA4147 CBS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53059"
FT                   /db_xref="GOA:C4ZML5"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML5"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACK53059.1"
FT                   /translation="MEIALLIALIVLNGVFAMSEIALVTARRARLARLADDGDGSAAVA
FT                   MKLGEDPTRFLSTIQIGITSIGILNGIVGEAALAGPLAEWLQTLGMEQRTSEIGSTVLV
FT                   VVVITYVSIVVGELVPKRIGQINPEGIARLVARPMNVLAMASRPFVYLLAGSTALLLRL
FT                   MGQRETTGPSVTEEEIHAMLNEGSEAGVIEKSEHEMVRNVFRLDDRQIGSLMVPRADIV
FT                   TLDVDRPLDENLALVAESAHSSFPVCRDGLDEILGIVSAKQIFSQMVRGESVDFTQNLQ
FT                   APVYVPESLTGMELLDQFRASGTYIVFVIDEYGEVQGMVTLHDVIESVTGEFLPHDTKE
FT                   SWAVQREDGSWLLDGLIPIVEFKDRLGIKAVPEEEKGRYHTLSGMVMWLLGRLPNTGDI
FT                   ATWENWRFEVIDLDGKRIDKVLAMQRPEPAPETIVESESQAPSQA"
FT   gene            302331..303206
FT                   /locus_tag="Tmz1t_0267"
FT   CDS_pept        302331..303206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0267"
FT                   /product="HtpX domain protein"
FT                   /note="PFAM: HtpX domain protein; peptidase M48 Ste24p;
FT                   KEGG: cti:RALTA_A3064 membrane-associated Zn-dependent
FT                   endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53060"
FT                   /db_xref="GOA:C4ZML6"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR022919"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML6"
FT                   /inference="protein motif:PFAM:PF06509"
FT                   /protein_id="ACK53060.1"
FT                   /translation="MKRVLLFLATNLAVVLVLGIVANLLGVNRFLTANGLNLGALLGFA
FT                   AIMGFGGAFISLLMSKPIAKWSTGAHVIDQPRNATEQWLVESVARMAKGAGIPMPEVAI
FT                   YEGDPNAFATGASKSSSLVAVSTGLLQTMSREEAEAVLAHEVAHIANGDMVTLTLIQGV
FT                   VNTFVVFLSRVVGYLVDSFLRRNDEESSGPGIGYMVTTIVCDILFGVLASIIVAWFSRQ
FT                   REFRADAGAAQLMGSAQPMVGALRRLGGLEAGELPQNVATAGIAGRPAWMALFASHPPI
FT                   EERIRALQSR"
FT   gene            303232..304323
FT                   /locus_tag="Tmz1t_0268"
FT   CDS_pept        303232..304323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0268"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   rfr:Rfer_2147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53061"
FT                   /db_xref="GOA:C4ZML7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML7"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACK53061.1"
FT                   /translation="MIDQVAEKIVRRVILGFLLGGLLVLSYAVLHVFIVPVAWAIIIAF
FT                   ATWPLYRKLRARLRRYPTVSALLMTLLLSAAFILPALWMGALLRTEVGVAIATVTAQIK
FT                   AGSLALPDFIRSMPWVGDWLQSLLDSLTGDPDAFRAQLTEWVRQGSDQAVALIGDVGRN
FT                   AAKLGFALITVFFLYRDGDRVLAQVQVVLHRFLGERVDAYLAAVGGMTKAVVWGLIATA
FT                   LGQGLVAGLGYWWAGLPAPVLLGAVTALIAMIPFGTPFAWGSLGVWLLVSGDTAAGIGL
FT                   LLWGTLVVSWVDNLIRPLVISNATQIPFLLVMFGVLGGLAAFGLVGLFLGPVVLAVLMA
FT                   VWREWIEESDLVSLNHASSTSKS"
FT   gene            304354..304653
FT                   /locus_tag="Tmz1t_0269"
FT   CDS_pept        304354..304653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0269"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll3965 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53062"
FT                   /db_xref="GOA:C4ZML8"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML8"
FT                   /inference="similar to AA sequence:KEGG:mll3965"
FT                   /protein_id="ACK53062.1"
FT                   /translation="MAVKRAFPTYFSARWNGHRPARSLFWWDLTIVGTLVNGVMGLIAL
FT                   ILLAKGVDGSVWLALHLLLIPYNLFLVFSVHRNTGSNLIHRGGSIAWFGCTLLV"
FT   gene            304978..307653
FT                   /locus_tag="Tmz1t_0270"
FT   CDS_pept        304978..307653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0270"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: E1-E2 ATPase-associated
FT                   domain protein; cation transporting ATPase domain protein;
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   eba:ebA4146 cation transport ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53063"
FT                   /db_xref="GOA:C4ZML9"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZML9"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ACK53063.1"
FT                   /translation="MDTNTRPSVVPWHAIPDKAVCRKLEVAPDTGLLQTEVAVRLQRHG
FT                   PNRLAEKPPRPAWLKFLDQFRSVLIGILIGAALLAGLIGDIKDAAVIAVVVLLNATLGF
FT                   FQERRAENALAALRGMLAPSARVRRDRETRVVPAEELVPGDILLLEAGDRVPADARVLQ
FT                   AHGAEVAEAALTGESHAVGKTAGAVDGGASLAERVCMVFMNTVITRGRIEAVVIATGMH
FT                   TEMGRLAGLLAQTAESSTPLQIQLDALGKRLAFIAAVVVGLMFVAGLMRGDDLITTAMT
FT                   AIALAVAAIPEGLPAVVTVTLALGMHRMARRHVIVKKLAAVETLGCTTVICSDKTGTLT
FT                   LNQMTARVLHAAGRRYAIEGEGYVAAGRILDEEGRAAGTELHGLLLPAALCADARLQDG
FT                   QLIGDPTEGALLALAVKAGVDPALQNRHTPRIAELPFDSAHKFMATFHHDGDAVQIWVK
FT                   GAPDVLISRAARMQGPDGEVALDTDAQETLLRANQQLAEGAMRVLALAGRRIPASAFDP
FT                   SADLMDWVKDLNLYGLVGIIDPPRPEARESIAQCNAAGIQVKMITGDHPLTAAAIAREL
FT                   GLVGEVHEGRELDGLSEEATTALVERSAVFARVAPEHKMRIVESLQRRGHVVAMTGDGV
FT                   NDAPALKRADIGVAMGITGTEVTKEAATLVLTDDNFASIVGAVREGRTIYENIVKFVRF
FT                   QLSTNIGAILTVLGAPFMGLATPFTAVQILWVNIIMDGPPAMTLGVEPARPGIMDQPPR
FT                   SDDAAILSPQRMWRIALYGLTMAVGTLGVYAWAMASGDTARAMTLAFTTFVLFQFFNIF
FT                   NARTEHGSAFNRQFFSNGKLWVALLGVVLLQVVVVHWAPAQTVFDTVDLSVNDWLIASA
FT                   VASSTLLLEEARKLLFRLVR"
FT   gene            307976..308389
FT                   /locus_tag="Tmz1t_0271"
FT   CDS_pept        307976..308389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpt:Mpe_A1717 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53064"
FT                   /db_xref="GOA:C4ZMM0"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM0"
FT                   /inference="similar to AA sequence:KEGG:Mpe_A1717"
FT                   /protein_id="ACK53064.1"
FT                   /translation="MFYALSWFSVFGLLALWSLSAWALHSVAVWSVSNASALTGVASGV
FT                   EGLRLPEWLPSWVPPEIAQAMTSLLAGFVPVMEGLLQAMPVLAGGLTMVAWVIWGLGSA
FT                   LLLLLGAGLHLSIAMWRRHSGDSGPQPASRLAA"
FT   gene            308518..309594
FT                   /locus_tag="Tmz1t_0272"
FT   CDS_pept        308518..309594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0272"
FT                   /product="Na+/Ca+ antiporter, CaCA family"
FT                   /note="TIGRFAM: Na+/Ca+ antiporter, CaCA family; PFAM:
FT                   sodium/calcium exchanger membrane region; KEGG:
FT                   mpt:Mpe_A1716 Ca2+/H+ antiporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53065"
FT                   /db_xref="GOA:C4ZMM1"
FT                   /db_xref="InterPro:IPR004481"
FT                   /db_xref="InterPro:IPR004837"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM1"
FT                   /inference="protein motif:TFAM:TIGR00367"
FT                   /protein_id="ACK53065.1"
FT                   /translation="MNLLLFLGGLTLLVIGADILVRGASKLAMSVGISPLVVGLTIVAF
FT                   GTSAPEVAVSVGAILDGKTDIAIGNVVGSNIFNVLFILGISALITPLVVNIQLIRQEVP
FT                   IMLGASLLLLALTLDGRLSFLDGGFLFALLLAYTVFLVVQSRRETQAAKDEFAEEIKPA
FT                   QTGAWDSHWAVQIGLIAAGLVALVFGSDYLVQASVNFAKAMGVSDLVIGLTIVAAGTSM
FT                   PEVATSITAAIKGERDIAVGNVVGSNTFNILGCLGLSGLVSGDLGLAMAPSLLAFDIWV
FT                   MLAVALACLPVFMTGREIARWEGGVFLGYYIAYVAYLLLAAQQHDVLPVFSSVMMSFVV
FT                   PLTVVTLVVVVIRRPSAT"
FT   gene            complement(310121..311716)
FT                   /locus_tag="Tmz1t_0273"
FT   CDS_pept        complement(310121..311716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0273"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: eba:ebA859
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53066"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM2"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACK53066.1"
FT                   /translation="MPAPSSAPVPTLAEAAQWAPERVVELAQAHEDLQRQVQTIQHQLE
FT                   WFRRQLFGQKSEKRLVSPDPAQMHLGELPIPDTQPELAGKTVAGHTRRAPRTDYAQDKD
FT                   ESALFFDETRVPIETITLANPETEGLAADQFEVIGEKVSHRLAQRPGSYVILKYVRPVI
FT                   KRRDTQTIHCPAAPAGVLEGSRADVSFLVGLLLDKFAWHLPLYRQHQRLADAGITVSRA
FT                   WLTQLAAQAAALLVPIYEAQLASIRASRVKAMDETPIKAGRAGPGKMKACYFWPVYGEL
FT                   HEICFPFFDSRAHSNVEKVLGLKPTEGGVLLSDGYGAYETYASKTGLTHAQCWTHCRRE
FT                   FINAEAAEPELAAKALEFIGALYTVEAKIRDDKLKGEAKREYRLDHARPIVAAFFTWVQ
FT                   ERLDAQGLLPSSPLTKALIYAHKRRAALEVFLADPDVPIDTNHLERALRPIPLGRKNWM
FT                   FSWTELGAQHVGVVQSLIATCRLHELDPYDYLVDVLQRVDQHPAADVAQLTPRLWKQHF
FT                   GKAPLRSDISRRAA"
FT   gene            complement(311746..312105)
FT                   /locus_tag="Tmz1t_0274"
FT   CDS_pept        complement(311746..312105)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0274"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: azo:azo2034
FT                   putative transposase helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53067"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM3"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ACK53067.1"
FT                   /translation="MFFPEGAVRVHVYGRPVDMRKSFDGLYALTRQALGCDPLSGELFV
FT                   FINRRGTQMKVLYWDRTGFCVWAKRLEQGRFVSNWAQVRTRQMDWTGLKLLLEGIEPIR
FT                   YKRRFRLPENAVQPA"
FT   gene            complement(312105..312413)
FT                   /locus_tag="Tmz1t_0275"
FT   CDS_pept        complement(312105..312413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0275"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53068"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM4"
FT                   /inference="similar to AA sequence:KEGG:azo2035"
FT                   /protein_id="ACK53068.1"
FT                   /translation="MTRATATNNKWRRRSRQEWQAAIARFAESGLGVEPFCAREGLSES
FT                   TFRRWRSLLGEPSTQCAAPAMERIGFVDAGTLKLGGTGRLELRLDLGEGVILHLSRG"
FT   gene            312542..312922
FT                   /locus_tag="Tmz1t_0276"
FT   CDS_pept        312542..312922
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0276"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   bxe:Bxe_A3776 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53069"
FT                   /db_xref="GOA:C4ZMM5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM5"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACK53069.1"
FT                   /translation="MDTNLDERPHRGPRGPYRRHSIDFKRTVVEQSLQPGASVSRLARQ
FT                   HDVNANQIFAWRKAYQEGRLGVAAFVPIILADTDDEDAPEMLDTPAAAFGRLTIERKGA
FT                   RLTVEGRPDAQVLAQVLAALLR"
FT   gene            312919..313265
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0277"
FT   gene            313322..314848
FT                   /locus_tag="Tmz1t_0278"
FT   CDS_pept        313322..314848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0278"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: cti:pRALTA_0535
FT                   transposase, IS66 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53070"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM6"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACK53070.1"
FT                   /translation="MSNTPVSSPDEVIALRAKVSEQAAEIEHLKLVIAKLRRMQFGRSS
FT                   EQMNEMLGQLELSLEELETLRAETPAEPTTPADTREAPPPRKPLPDHLPRDIEEHLPSA
FT                   CDCPACGASLKKLGETVSEMLEYVPASFRVIRHVRPKFACSRCDTIVQANAPARPIARG
FT                   LAGAGLLAHVLVAKYCDHLPLYRQSTIYAREGVELERSTLADWVGQCNALLRPLVEALR
FT                   KHVLSATKLHADDTPVPVLSPGEGQTRTGRLWTYVRDDRPAGDATPPAVWFAYSPNRRG
FT                   EHPQRHLAHFKGVLQADAFAGFAPLYLGGAIQEAACWAHVRRKFFDLHKAQASPLAAEA
FT                   LKQIGLLYAVEEAIRGKPPELRRAERQARAGPVLVALRAWLDATLKQLSQKSALAEAIR
FT                   YALARWDALVRYSTDGRIEIDNNAAERALRTVALGRKNFLFAGSDAGGERAAAIYGLIG
FT                   TAKLNGLDPEAYLRHVIGRIAEHPVNRVAELLPWNVAAELAPPELQAAAA"
FT   gene            314942..315280
FT                   /locus_tag="Tmz1t_0279"
FT   CDS_pept        314942..315280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53071"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53071.1"
FT                   /translation="MLAEQLDADFVFVLMEAYSLRADKVARYEEILDEYGSLADCPASW
FT                   RIDVVSLALETRHGVWVAQVPIRPKGISKKKRTIGAPEFRHYTEVQGRFTDLLPVKEGE
FT                   GGAGGVLH"
FT   gene            complement(315427..315825)
FT                   /locus_tag="Tmz1t_0280"
FT   CDS_pept        complement(315427..315825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0280"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aca:ACP_0363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53072"
FT                   /db_xref="GOA:C4ZMM8"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53072.1"
FT                   /translation="MPPEVQAAFDKYQVQYYAFLGQQTEVAIENFRWQQRASEVLMWTV
FT                   LAVVFCGLGFSGYQLYHATRLGKDPAANEIEISANKVRVTSSIVGLVVLFMSIAFLYLF
FT                   LIEVYRIKPVNLLQQSPSAQQVGSGATR"
FT   gene            complement(316204..317799)
FT                   /locus_tag="Tmz1t_0281"
FT   CDS_pept        complement(316204..317799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0281"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: eba:ebA859
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53073"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM2"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACK53073.1"
FT                   /translation="MPAPSSAPVPTLAEAAQWAPERVVELAQAHEDLQRQVQTIQHQLE
FT                   WFRRQLFGQKSEKRLVSPDPAQMHLGELPIPDTQPELAGKTVAGHTRRAPRTDYAQDKD
FT                   ESALFFDETRVPIETITLANPETEGLAADQFEVIGEKVSHRLAQRPGSYVILKYVRPVI
FT                   KRRDTQTIHCPAAPAGVLEGSRADVSFLVGLLLDKFAWHLPLYRQHQRLADAGITVSRA
FT                   WLTQLAAQAAALLVPIYEAQLASIRASRVKAMDETPIKAGRAGPGKMKACYFWPVYGEL
FT                   HEICFPFFDSRAHSNVEKVLGLKPTEGGVLLSDGYGAYETYASKTGLTHAQCWTHCRRE
FT                   FINAEAAEPELAAKALEFIGALYTVEAKIRDDKLKGEAKREYRLDHARPIVAAFFTWVQ
FT                   ERLDAQGLLPSSPLTKALIYAHKRRAALEVFLADPDVPIDTNHLERALRPIPLGRKNWM
FT                   FSWTELGAQHVGVVQSLIATCRLHELDPYDYLVDVLQRVDQHPAADVAQLTPRLWKQHF
FT                   GKAPLRSDISRRAA"
FT   gene            complement(317829..318188)
FT                   /locus_tag="Tmz1t_0282"
FT   CDS_pept        complement(317829..318188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0282"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: azo:azo2034
FT                   putative transposase helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53074"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM3"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ACK53074.1"
FT                   /translation="MFFPEGAVRVHVYGRPVDMRKSFDGLYALTRQALGCDPLSGELFV
FT                   FINRRGTQMKVLYWDRTGFCVWAKRLEQGRFVSNWAQVRTRQMDWTGLKLLLEGIEPIR
FT                   YKRRFRLPENAVQPA"
FT   gene            complement(318188..318496)
FT                   /locus_tag="Tmz1t_0283"
FT   CDS_pept        complement(318188..318496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53075"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMM4"
FT                   /inference="similar to AA sequence:KEGG:azo2035"
FT                   /protein_id="ACK53075.1"
FT                   /translation="MTRATATNNKWRRRSRQEWQAAIARFAESGLGVEPFCAREGLSES
FT                   TFRRWRSLLGEPSTQCAAPAMERIGFVDAGTLKLGGTGRLELRLDLGEGVILHLSRG"
FT   gene            319157..319888
FT                   /locus_tag="Tmz1t_0284"
FT   CDS_pept        319157..319888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0284"
FT                   /product="protein of unknown function DUF159"
FT                   /note="PFAM: protein of unknown function DUF159; KEGG:
FT                   eba:ebA145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53076"
FT                   /db_xref="GOA:C4ZMN2"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN2"
FT                   /inference="protein motif:PFAM:PF02586"
FT                   /protein_id="ACK53076.1"
FT                   /translation="MCGRYALYGPVSRLREAFDAVPEGFDFEPRWNAAPMQWLPVVRQR
FT                   SNGERVIHRLRWGLVPSWAKDATIATRLINARGESVAERPSFRAAFRRRRCIVPANGFY
FT                   EWQQLSDQQGGGKQPFYIHPVGGEFFALAGLWERWTRPADGEALDTFTIVTTEANAAMR
FT                   PLHDRMPVILAPGDWWAWLNGATAADQVQALVRPCPEAALAVYPVGRAVGNVRNEGAGL
FT                   IDPLSSDHSSCRSQIARGSRG"
FT   gene            319985..321607
FT                   /locus_tag="Tmz1t_0285"
FT   CDS_pept        319985..321607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0285"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: bvi:Bcep1808_6255
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53077"
FT                   /db_xref="GOA:C4ZMN3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN3"
FT                   /inference="protein motif:PFAM:PF08378"
FT                   /protein_id="ACK53077.1"
FT                   /translation="MAQISPALDTLRHDAGLFRELDVLDRLQQSLPDGYDVFHSVAWQT
FT                   AHQGEDRHGEIDLVVLAPSGNMLLVEVKAGDVALIDGKLVKLYGRREHDVARQTRMQHA
FT                   AMLNRLAESGLNAHVTGCVVLPDFRVDEAAIVAMPRERIIDASAYAQLGTRVRELLEQG
FT                   SSRSDVEALRRFLGNVFKVSIDLQVLGDQVRQTSRRLADGLATWVPRIASPSGVVRIQA
FT                   TAGSGKTQLALRLLDDAAAAGQRALYVCFNRTLADHIGRIAPARARVSSFHELCVEHWR
FT                   RTQGEPDFTAEGIFQAVVERYGSDAQDFEALYDLAIIDEGQDFDPAWVTCLLPHLKEDG
FT                   RLYLLEDEAQRLYERDGFELHGAVAVRCNDNFRSPRAIVDVINAMNLAEGIVEARSPYV
FT                   GDLPTFRAYDDERGLRRETLAAVESLRERGIPLAEIVVLSARGHGRSHLLKEAKLGVFA
FT                   LRKFLGRYTADGEPVWSEGELLIESVHRFKGQSAMGVVLAEVDFDQLDEAARRRLFVGM
FT                   TRAQLGLEVVVSRRTEADLAALL"
FT   gene            complement(321720..323045)
FT                   /locus_tag="Tmz1t_0286"
FT   CDS_pept        complement(321720..323045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0286"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: pol:Bpro_5544 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53078"
FT                   /db_xref="GOA:C4ZMN4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACK53078.1"
FT                   /translation="MMAMRKRTDTVFPNAAGIDVGASSHWVAVPPDAAEESVREFGVMT
FT                   DDLRALADWLMACKVEIVALESTGVYWIPLFEILEQRGLQVWLVDARQMKYVPGRKSDV
FT                   QDCQWLQRLMSYGLLRAAWRPAGEVCELRAIARLRETLLAEQASWVQRMQKALVQMNIQ
FT                   LTEVLTDVMGMSGQAIIRDIVAGERNPEVLARHRHRRVKASTEEVIRALTGNWRQEHLF
FT                   VLGQALSMYDDIARHLRECDAQMQVLLGQRAQCAINVGAVPRAGSKARAAFDVRQMLAN
FT                   WAGVDLTRINGLEVSSVMKILTEIGPDLSRFANVKHFCSWLGLCPGTKVSGGKVLSAGT
FT                   KRSANRVRQALKMAAMTLSHSNSALGAFYRRLCSRMDKPKANTATAHKLARMVYFMLTR
FT                   GEAFVDQGQQRYEELQRERSIAALKRRATALGFQINPIGAAA"
FT   gene            complement(323362..325185)
FT                   /locus_tag="Tmz1t_0287"
FT   CDS_pept        complement(323362..325185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0287"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: maq:Maqu_1313 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53079"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN5"
FT                   /inference="similar to AA sequence:KEGG:Maqu_1313"
FT                   /protein_id="ACK53079.1"
FT                   /translation="MAGQMAELLKKAFAEKGVQLPGAKVETRKVLPTGSGESSQHTGQS
FT                   AETPTVSPPAGPKAPTAPKEGKRSDPIAEACKKWRAEHPVARAKAPVKSSQRAAPLACY
FT                   DSSPVRAGKSPEGKVSPYEVRLGSAARLALTLDEQVELEVLDVYEELGRSSQCCRETAD
FT                   DEHLIAMGVDFGTSSIKVVIGDPALGKAFAVPFTTASDVARYLLPTRLHESAGRFSLCE
FT                   GEETHRDLKLALIANPGDLLLRERVSAVLALVIRQARGWLFATHADVFARTRLLWKLSI
FT                   GLPVAHHLDDELTQTFNDVAHVAWLAACTPRDISRTTIAAARDRKREIAAAPERMSEDE
FT                   DVEISVVPEIAAQIYGFVNSSRFNRKEQNIYLMVDVGAGSVDSSLFHVKPARGGKWDFE
FT                   FFTSIVEPHGVMNLHRHRVGWWEEALSRCSEPTAGLISNALAEHKYPTDRTVALPSRFT
FT                   RYVHDAKVFLRKPSDDPDDTFFQKKVVSQVRGKSYWHAWKDGHLTQAQLIGVPAFYCGG
FT                   GMRMEFYSRLQSQMQSMPGYSWLRAEPRRVELPKNLEAPGLHRSNYDRMTVAYGLSFLE
FT                   VGKVTRALPPPKLPLDPETSWAANYVGKEHC"
FT   gene            complement(325210..328323)
FT                   /locus_tag="Tmz1t_0288"
FT   CDS_pept        complement(325210..328323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0288"
FT                   /product="helicase domain protein"
FT                   /note="PFAM: helicase domain protein; SNF2-related protein;
FT                   SMART: helicase domain protein; DEAD-like helicase; KEGG:
FT                   maq:Maqu_1312 helicase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53080"
FT                   /db_xref="GOA:C4ZMN6"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN6"
FT                   /inference="protein motif:PFAM:PF00271"
FT                   /protein_id="ACK53080.1"
FT                   /translation="MQPGDKVRLKANPGRVGILGNETDGPPHRLRVLVTFTDGDEQFVL
FT                   KNSLEKVDRASAGPYAMVASGRYGRVEDLRGAITYYRLSGRLANLIYSLNTTNTQFLAY
FT                   QFKPVLQFLDSPSNGILIADEVGLGKTIEAGLIWTELRARVDAKRLLVICPAMLREKWK
FT                   AELSERFGVSAEIVDARGLLDHLQSVRERPQQQFALIASMQGLRPAKGWNDDEEPSQAT
FT                   TAKLARFLNEADLEEPLLDMLIIDEAHYLRNDETATHRLARLLRPVVQSMVMLSATPIQ
FT                   LRSDDLFNLLNLIDEDSFPFPTSFQYSLQENAPIVALRDRILSHVVTPTDFVETLREAV
FT                   GGRIFGDNAQLEHLINHPPSAEDLSSPRGRSEIADQLDRINPLTKVVTRTLKRDVQEMR
FT                   VQRDPVTVRVEMNPIEREFYDQVTEAVREFCARIDISEGFMLTIPQRQLSSCVAAACKG
FT                   WLDRTEVDDEELESEVFELYGDAEDNEKRPNLGALLRTLVGIARRVGDHTALESVDSKY
FT                   DMLVRNLKQYWAAYPGKKIVLFSFYRNTLHYLARRLAAEGIQSAVLHGGMDKHGVLRHF
FT                   ESTEGPDILISSEVASEGVDLQFSSLLINYDLPWNPARIEQRIGRIDRIGQEAEKILIW
FT                   NFIYTHTIDERIYDRLLERLDIFRQALGSMEAMLGTEIRTLSYELLSHKLTPEQEQERI
FT                   DRASLAIERVSRQQALLEEEATQLIAHGDFIQNKVQAAKELGRFIRGEDLLAYVKDFLE
FT                   REFPGTRLLADDDDELEHVIELSTEARVAFSEFLQQQRLQGATRLLGAAPPRLIFENRH
FT                   GRNPSGKERITQDHPLVRFVADELKKAGKGPLYSPVAAVEILGNTVGNIERDIYVYAIA
FT                   RWTVSGARDIERLEYLVQRLADGWLLDGEQAEFLVNAAGLQGRDWLGASTSLNHAHTAG
FT                   VLDDCRAELEERFRAFRDAQIRENRDRVSFMVNTLRHHLDNQRRRFHERIEKYRLHGTD
FT                   KQRRLIPAEEGRLKKLTQRIEARIAELRLKESIQAHDSMVSGGVIRVV"
FT   gene            328449..329336
FT                   /locus_tag="Tmz1t_0289"
FT   CDS_pept        328449..329336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0289"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA5218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53081"
FT                   /db_xref="InterPro:IPR016634"
FT                   /db_xref="InterPro:IPR026881"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN7"
FT                   /inference="similar to AA sequence:KEGG:ebA5218"
FT                   /protein_id="ACK53081.1"
FT                   /translation="MQLPLSHSQRERLAYLELKAFFVGELRRGDLEARFSIKPAAATRD
FT                   LNAYRECAPDNLAYDRYVKAYIPTEHFRPLFPFSAERILSWLLHGFGDGQAPTVARTFP
FT                   CEGAGELVRPDFGLLGVITRAMHGNRPLQVTYLSLNSGPAKRVIVPVALADNGLRWHVR
FT                   AYDRQRKRFSDFVLTRIAKAKPLDERAEPYEGIEADEQWNRRVELQLVPHPRLKHPEGV
FT                   VADYGMKDGRLTLDVSAALAGYALLRWAVDCSAGHSLDCARHHLCLANRAVLDGVESGV
FT                   LAPGYVQPAAGGEA"
FT   gene            329333..329932
FT                   /locus_tag="Tmz1t_0290"
FT   CDS_pept        329333..329932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0290"
FT                   /product="Protein of unkown function DUF1819 putative inner
FT                   membrane"
FT                   /note="PFAM: Protein of unkown function DUF1819 putative
FT                   inner membrane; KEGG: eba:ebA5220 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53082"
FT                   /db_xref="InterPro:IPR014948"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN8"
FT                   /inference="protein motif:PFAM:PF08849"
FT                   /protein_id="ACK53082.1"
FT                   /translation="MSAAIYNAEISAGSLMLPESRRVARFMLTQPDRATWFDTLRTENI
FT                   LQKKSPATARRQARLIRNRLETLDEQAWQLVAEGDQELALQILLAASVKHSRLLGDFMR
FT                   DVVAGHVRRFEEHLVPSDWDAFLADCIQRDPAVAGWSDTTKAKLLQVILRILAEARYLE
FT                   STRSLRLTPPLLHPEVQHYLKSRSEAAVLATMELTH"
FT   gene            329935..330519
FT                   /locus_tag="Tmz1t_0291"
FT   CDS_pept        329935..330519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0291"
FT                   /product="Domain of unknown function DUF1788"
FT                   /note="PFAM: Domain of unknown function DUF1788; KEGG:
FT                   eba:ebA5221 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53083"
FT                   /db_xref="InterPro:IPR014858"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMN9"
FT                   /inference="protein motif:PFAM:PF08747"
FT                   /protein_id="ACK53083.1"
FT                   /translation="MTMTQTFEERLNQILPRITSEDFLQNRGLGNEIGFWIFEYPPEQE
FT                   MAVRSFLSEVVEPALRRRQPPLRYVCVNLLELVVDVLEHRKLFDKVIKMQAEKGDDAVF
FT                   ASLQGVLNQEKLAQRIVGLHNPDELDMMIFTGVGAAYPLVRSHTLLNALHPLMKNTPLL
FT                   MFFPGRYDGYSLRLFNKLTDKHYYRAFRLVP"
FT   gene            330563..334174
FT                   /locus_tag="Tmz1t_0292"
FT   CDS_pept        330563..334174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0292"
FT                   /product="ATPase-like protein"
FT                   /note="KEGG: eba:ebA5222 ATPase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53084"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP0"
FT                   /inference="similar to AA sequence:KEGG:ebA5222"
FT                   /protein_id="ACK53084.1"
FT                   /translation="MKIGDLFTKPINRPINGVIKADQKDAESVWQELDEYVVTKQLTEY
FT                   FRRFFDAYLAAADNPNDPVLAARMGVWVSGFFGSGKSHFIKILSYLLENLDATNPATGE
FT                   KKRAAAFFDEHKIKDSMLLADIQRAVRGSADVVLFNIDAKADSKDERDVILQVFLRVFN
FT                   EKLGFSADAPHIAHMERYLVEKGAYDAFRAAFAESNGSTWEAERDAVDFLRDDVVHALS
FT                   VALGQSEESAGQWFDRSRDEYRINIESFARLVNAYLETRPAGHRIIFLVDEVGQFIGDN
FT                   TKLMLNLQTITEQLGTATQGRAWVIVTSQEDIDAALGEANKAKSQDFSKIQGRFHTRLS
FT                   LASSNTDEVIGERLLAKREGAHDALRDTFEKSGDIINNQLAFVGNSVNLRGYKDAAEFV
FT                   SVYPYAPYQFTLLQKIFESIRKVGATGKHLSRGERSLLDAFQSATVRNMDRDVGLLIPL
FT                   YDFYPSIESFIDTVAKRSIDEAPNNGALEAFDVLLLKALFLIRYIADIVKPNVDNLATL
FT                   CVDRIDTDKLALKRQIQESLGRLEQQRLVSRNGDLWFFLTNEERDVAREIGNVEVSSAE
FT                   KARLLCELLFDDILQGSTRIRHRDTKGDYDVNRLLDGAPYKNASHELSVEVVSPLGDDW
FT                   DALNDARAVLRSSEGNGRALIRLAEGERFDIELTLYRQIEKYIDSPKASNATPSLRNIL
FT                   INRKDENRERRARLREQLATMMLQGDFYALGQRVELKASNPGSLLDELGNYLITNTYTK
FT                   LGYLKHRNADPIAEIKAVLLADDTAQRKLALGGEEGNPLALVELREFLQLKASNTRVIL
FT                   DEVVNRFTGIPWGWKPDWEVVLLVARLFMAGEIKLMMDSADLEPKAAIEPLTKSARFKH
FT                   VSILKRKVADAASIKRARELHRDLFAEMPPEAEDGLVAATRERLAALQADLKGYAHVAA
FT                   TPHHPGKAVIDSAIAAIGKQLGVADSYEFIDAFVKAKDDWLDLSDDIHDVISFYKTQTP
FT                   TWRRLLEALERFEPNREALDKDVKAAVALSNLEGIRDNPNPWGAVSQIEPLITTVDAVN
FT                   EALAQSKREHALLSIDAKIAEVEKALDAAQASDGLRNRALLKLQELKTKVVGLTSIPMI
FT                   FYSQERAGDALDAAMTMIESATPKAAPITAAEKGSTTAATKTSGPVVAPKPTKAVRAAD
FT                   FSPKTYLETEADIDAYLAKLKAELLAVIQSGGRARLQ"
FT   gene            334228..334845
FT                   /locus_tag="Tmz1t_0293"
FT   CDS_pept        334228..334845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vei:Veis_2691 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53085"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP1"
FT                   /inference="similar to AA sequence:KEGG:Veis_2691"
FT                   /protein_id="ACK53085.1"
FT                   /translation="MPATVSADLSRLGQGARLHAGKVFRRKDLAASLPSVDRELGRALK
FT                   AGLVRRVAQGLYYVPRHTPFGEAPPSEEELVRSFLDDDHFLLFNPSVYNSLGLGTTQLY
FT                   RRNVVYNHKRHGLFTLAGFEFDFRDKPRFPARDQVSREYLLVDMLNNLEQLAEDPETLL
FT                   DAVHRKLDTFDSARLEQALRDYGSARTRRLFRPWMSEHDAQA"
FT   gene            334832..335821
FT                   /locus_tag="Tmz1t_0294"
FT   CDS_pept        334832..335821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0294"
FT                   /product="Domain of unknown function DUF1814"
FT                   /note="PFAM: Domain of unknown function DUF1814; KEGG:
FT                   dia:Dtpsy_2171 domain of unknown function DUF1814"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53086"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP2"
FT                   /inference="protein motif:PFAM:PF08843"
FT                   /protein_id="ACK53086.1"
FT                   /translation="MPRPDAATPAPGFLHDHPNFVDLLRQLAQQTGIATYLIEKDYWLM
FT                   HGLWVLQQQGWQFQLKGGTSLSKGFGIIQRFSEDIDLRIEPPAEQQVKAGKNQDKPAHI
FT                   ETRRQYFDWLAAQTRIRALAGFESVERDTEYDDPKYRGAGIRLHYPVRTDYLPGIKEGI
FT                   LLEVGFDDTAPNTPCLISAWALDAALASPVQVIDNRAVDVPCYSPAYTFVEKLQTVSTK
FT                   FRLQQAADPAAPFPKNFLRHYYDLYCLLAHPEVLAFIGTPDYEARKRQRFRGGDELNIA
FT                   RNPAFTLSDPTVRERYQRKYEETAGLYYAGQVPFAAILARIAEHIDRL"
FT   gene            335825..339328
FT                   /locus_tag="Tmz1t_0295"
FT   CDS_pept        335825..339328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0295"
FT                   /product="type II restriction enzyme"
FT                   /note="KEGG: pol:Bpro_5027 type II restriction enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53087"
FT                   /db_xref="GOA:C4ZMP3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR003356"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP3"
FT                   /inference="similar to AA sequence:KEGG:Bpro_5027"
FT                   /protein_id="ACK53087.1"
FT                   /translation="MNKAKLKTYAPQARKDFIAAVTQRANLLGLSESAGKFEALPAERR
FT                   GDVVLIAGREWPARVAQQRERLVRRIQRDGFGYTMEAVAYTWFNRFAALRYMELHDYLG
FT                   HGHRVLSSATAGGLPDILAHAADLAASRELPGLDTAHIAELKLAGNKDGELYRLLLVAQ
FT                   CNALSTAMPFLFERIDDETELLLPDNLLRTDSVIAKLVAEIPEEDWAEVEIIGWLYQFY
FT                   ISEKKDQVIGKVVKSEDIPAATQLFTPNWIVQYLVQNSVGRLWLMANPASTLKSEWPYY
FT                   IEPAEQTPEVNAQLDVLIQTRMAEDGGSLNPESITVLDPACGSGHILVEAYALLKGIYL
FT                   ERGYRLRDIPRLILEKNLYGLDIDDRAAQLAGFALLMKARADDRRLFNDPPRLNVLSLQ
FT                   ESKGLDLDELATHLAPFGVQRATVKALLDTFEHAKTFGSLIQIPDVLNAQLPALAEALG
FT                   KAKETGDLYAQMAAQDLMALVEQARVLGRKFDAVVANPPYMGSGFMDPVLKAFVERRYP
FT                   MEKGDLFSCFIRQGEQVSTPTGFIAFVTMQGWMFLSNYESFRRDFLQRNVISSLLHLGN
FT                   GVMGIAFGTCSAVFQRSPIKAFAAKYIQVDASQLSDEGEIDLSESIATVRSINHFQSSP
FT                   GLALAYSLEPHQMALFDQNPPISEKVEAREGMTTADNGRFLRYWWEINTEQINRSALSE
FT                   ADAKNSPRRWYPYQKGGEAVKWFGNNQWVVDWQDDGAGVKGNVDPNTKRIRSHNYNGVY
FT                   SFREGITWSSFSNGGLAFRYVPPGSLFDSTGSMAFSSSNLFGYLALLNTPSVFRFLKAY
FT                   SPSPRIKIESLLAIPDILQNHDINELDELSRECVQISSKISRFEEVSPTFAINKEQDLL
FT                   SPKALSSTFKAWRSRITENEIRMEELLSKGFGFSEHGTIDNGTGGSEFNARHLISYAIG
FT                   CMMGRYSLDEPGLIYAHAGNVGFDSTRYKTFPADADGIVPITDEFWFEDDAANRVREFL
FT                   RAVWGADTLDENMAWLAESLGTKAGETADETIRRYLADKFFKDHLQTYKKRPIYWLFSS
FT                   GKQGAFQALVYLHRYHEGTLARLRAEYVVPLTGKMQTRIDMLEKDAAAAPSTAARNKLN
FT                   KQIEKLRKKHVELLAYDEKLRHCADMRISLDLDDGVKVNYGKFGDLLAEVKAVTGGTGE
FT                   E"
FT   gene            339389..339559
FT                   /locus_tag="Tmz1t_0296"
FT   CDS_pept        339389..339559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0296"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53088"
FT                   /db_xref="GOA:C4ZMP4"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53088.1"
FT                   /translation="MRLILFFVVLIGMIFLFATIRSGIRDGATLTLKVILSGLGFIALL
FT                   LLLFALGGLFG"
FT   gene            339573..340439
FT                   /locus_tag="Tmz1t_0297"
FT   CDS_pept        339573..340439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0297"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53089"
FT                   /db_xref="GOA:C4ZMP5"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP5"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACK53089.1"
FT                   /translation="MNRIRVLVFGATGSGKTSLCNVLTGRTRPTDSDARGVTSRSHSYA
FT                   PFEAQGQRIELIDTVGLHESTEGTVPADKAILELVELLEKARDGFSLLIHVTRATRITK
FT                   EHEDDYAFFVKKMTQGRIPVILAVAGCENEHPMGAWVERNRSAFASYRYRELIPCCFAS
FT                   GGPLESHYVPLREQSREALIASVVRNALLEPEKIYGGETGSSFTDALARIWNEFVEIAG
FT                   LPEKYRKNVNESAYELMKRMGVPKTLRDAAVAHIPDLLQELGNKLPVPFLGRILKFVAG
FT                   KALGAGK"
FT   gene            340483..341310
FT                   /locus_tag="Tmz1t_0298"
FT   CDS_pept        340483..341310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_2711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53090"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP6"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_2711"
FT                   /protein_id="ACK53090.1"
FT                   /translation="MSMKADCSAGQPLIRRVLLLIAIALVFFGAFPDEGRAFWGSTGKL
FT                   APIIAKISKAPEVLPNDEIVRLARLASEAKGTAWVGEELGRLNLPNEVLEDAFLRIAVH
FT                   QGRIARTEAEGMFSRLTGVPGFRTTLRKVVGNSEVGTAGHLYELRLADGAAGRGMKVLG
FT                   IGEKFDDGLKRAPTDIDVLLEHGRTTFAIEAKNYAPTTLMPLDRYRADLDSLVAYRKVH
FT                   GKRVVPVFSMSNRPEDMRYLKLLQHEAKKREVELIFGSAEESVEQIKLLGELR"
FT   gene            341307..342701
FT                   /locus_tag="Tmz1t_0299"
FT   CDS_pept        341307..342701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_2710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53091"
FT                   /db_xref="GOA:C4ZMP7"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP7"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_2710"
FT                   /protein_id="ACK53091.1"
FT                   /translation="MRGVVLLGMLVTPQLGLAGDEVATFAAFYEPSGMVNWLLISLIAI
FT                   AAGAAIFFSGGAASPAVAAIGTWVGGTMGLSGAAATKAGLALLGGGSIASGGFGMVGGA
FT                   ALLTAALTFSTELAFDYSFGALYAKYEYHELVERSKGLTTLPLPRTTGGLEKRIEALNA
FT                   LDNVDKKKPLVAPGDVELIRKAISELETAAEGGEFERHEQARLHSLLSLLLFIVNDYQS
FT                   AHDHAERAIETSEGLGLSSTLPTFIHATTRLYDERLRWRDAYADGLRTALVDEPKNKLI
FT                   PLLVAIYVDRLSLRMDDGSVGPEALAVIRAVVNDPLLEKHRTTNLIGLTGRYFVRLKLA
FT                   QQKIGALATSNSVLIQNDARSADVLEQTLSDYDVLLEGAESALTDLQGTNPSRKDAEQI
FT                   QVFTKLFADYRGDRVRLEGLVSDFRERQVQAGVAPGGVVMWLILGPVLLLVLFGLAAWR
FT                   IRGKGA"
FT   gene            342896..345514
FT                   /locus_tag="Tmz1t_0300"
FT   CDS_pept        342896..345514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0300"
FT                   /product="PglZ domain protein"
FT                   /note="PFAM: PglZ domain protein; KEGG: eba:ebA5249
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53092"
FT                   /db_xref="GOA:C4ZMP8"
FT                   /db_xref="InterPro:IPR013973"
FT                   /db_xref="InterPro:IPR014060"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP8"
FT                   /inference="protein motif:PFAM:PF08665"
FT                   /protein_id="ACK53092.1"
FT                   /translation="MSHQRIIDALEAQFVAHQLLFWDDPEGEFAAWVDGLSLEGVQVLR
FT                   LDRTPSLQVKLDVERSPGTRWLFYRPAAEPDPAKDWLLDLRLRGRAFRADSNSMLLDDL
FT                   GLTSQALRPHLKARSKFLRAKDRVEKLRRLVTPSDDAEALDRKMLAVLVRSEQADFQTI
FT                   LLRLLSSMVHEGEADLAAEPRAWQDIVANELDSAFWALALQTLGYGADGVAPAFTLRDL
FT                   LYRILVTDFCRSLSGAAPESLRHFVLPDRTLAANASVFAARWRTDMAAYESYNLLSDAV
FT                   AGEIGLDGVLSVLPGEALAETMTFAVVERRILKDLKDRVLAGAGASDEAMQALIARRRD
FT                   GHWASRLMAQSSSESRALAACYDAMEAGAAFFELKARFDAGFSFANAEAALMAYQAELF
FT                   RFDQLYRHFHEAAEKVEPMGWAVLHELRVRIEETYTGWFLPQFGTAWARVIEGEGGLLS
FT                   QWTAAGMPNQHRFFDIQVAPLLAAGAKRVFVVISDAFRYEAAEELVQQLNSKSRFKAGL
FT                   SSQLGVLPSYTTLGMAALLPHHSLAYKANSNLDVLADGQPVSTLEQRNAHLAKYEGLAI
FT                   KADELLALGKDKGRALVRDRRVIYVYHDHIDALGDKQATEGMTFRAVDEALAQLSQLVS
FT                   FIINSLNGSTVLVTADHGFIYQEAPLLAADKSALETQPEGTLKAKKRYLLGRGIGTSPK
FT                   AWCGNTALTAGTDPEASLDFWVPKGASRFHFAGGARFVHGSAMPQEILVPVITVRESES
FT                   DKEKARYVEFSLLGASNKVVTNTQRFEFIQTEAVSDKVLPRTVVIALSDGERPISNEQT
FT                   LTFDSASQLLDERKKSVFLTVLAGTYDKTRDYWLTARDVTTKVEVLRVPLRVDLAFTND
FT                   F"
FT   gene            345522..347552
FT                   /locus_tag="Tmz1t_0301"
FT   CDS_pept        345522..347552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0301"
FT                   /product="putative ATP-dependent Lon protease"
FT                   /note="KEGG: eba:ebA5250 putative ATP-dependent Lon
FT                   protease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53093"
FT                   /db_xref="GOA:C4ZMP9"
FT                   /db_xref="InterPro:IPR008269"
FT                   /db_xref="InterPro:IPR013473"
FT                   /db_xref="InterPro:IPR014061"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027065"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMP9"
FT                   /inference="similar to AA sequence:KEGG:ebA5250"
FT                   /protein_id="ACK53093.1"
FT                   /translation="MTEPVDTARLDGLLNTHFAGKVVRKDLTKLIKEGANVPVYVLEYL
FT                   LGMYCASDDEATIQNGMTMVKRILAENYVRPDEAEKIKSKIRESGSYKVIDKVTVKLNE
FT                   KRDVYAALLSNLGVKNAEVSDAFVRQFEKLLVGGIWCIVTLNYLFEENQRGSPFTVTDL
FT                   KPIQMPNMDMAGLFEGRRAFTEDEWIDALIRSTGMEPSCFKERVKWHLLARMIPLVENN
FT                   YNFCELGPRGTGKSHIYKEISPNSILVSGGQTTVANLFYNMSARKVGLVGLWDTVAFDE
FT                   VAGINFKDHDGVQIMKDYMASGSFSRGREAINANASMVFVGNINQTVESLVKTSHLLAP
FT                   FPEAMIDSAFFDRFHAYVPGWEIPKMRPEFFTNQYGLIVDYLAEYLREMRKRNFADAID
FT                   KWFKLGNNLNQRDTIAVRRTVSGLLKLICPHGEYDKEIVRRCLEYALESRRRVKEQLKK
FT                   IGGMEFYDVHFSYIDLEAGEERFVTVPEQSGGALIAEGRLNPGTLHTISLGDTEMPGAY
FT                   RIEIQTIAGGGKVSASGLAPREAVKVAFDYFKANSGRVSASIKPGEHDFHLHLVELQHT
FT                   GTPKALTLAGFIALCSGALAKPVQSQMVVMGDMSLGGTVVQVRNLAESLQVAFDAGAKR
FT                   ILLPMSSVTDIPSVPGELFAKFQTSFYSDPVDAVFKALGVE"
FT   gene            347786..348223
FT                   /locus_tag="Tmz1t_0302"
FT   CDS_pept        347786..348223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aav:Aave_2661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53094"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ0"
FT                   /inference="similar to AA sequence:KEGG:Aave_2661"
FT                   /protein_id="ACK53094.1"
FT                   /translation="MAAPGMDAWAQSLPQPSRTVFRCEVEGKVTYSDSPCLGARRIQIE
FT                   PTRGVSKLSGRERIGNDVRVERHREIMAEALQPLTGMDAKKMQLFGRRLKLEPTERQEC
FT                   FDLDGDLATLEQRESTSSGSQLQSVQGSLLKLRIRYRELGC"
FT   gene            complement(348380..348577)
FT                   /locus_tag="Tmz1t_0303"
FT   CDS_pept        complement(348380..348577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0303"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afe:Lferr_0197 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53095"
FT                   /db_xref="InterPro:IPR032568"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ1"
FT                   /inference="similar to AA sequence:KEGG:Lferr_0197"
FT                   /protein_id="ACK53095.1"
FT                   /translation="MKMFDVVASLQDLPQQQVVKGQVGTVVEELDNDHVLVEFADVNGV
FT                   AYAIATIPMGQLMKLKHAPA"
FT   gene            348707..348814
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0304"
FT   gene            349288..350010
FT                   /locus_tag="Tmz1t_0305"
FT   CDS_pept        349288..350010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0305"
FT                   /product="yecA family protein"
FT                   /note="TIGRFAM: yecA family protein; PFAM: SEC-C motif
FT                   domain protein; KEGG: har:HEAR0879 putative protein
FT                   translocase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53096"
FT                   /db_xref="InterPro:IPR011978"
FT                   /db_xref="InterPro:IPR036255"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ2"
FT                   /inference="protein motif:TFAM:TIGR02292"
FT                   /protein_id="ACK53096.1"
FT                   /translation="MTETELEELEALLSSVEGGSASLPVDGLHGFLSALVMSGGDTRAE
FT                   PLLPWILSPMPGSPLDLDHVPQARRVGELVSKMLTSIDIELDDPDYLFSPMVRVYPHRG
FT                   EERADGCVWCAGFLRGMAHAWDRWSSLCDLQDMASLLWPIHQLAALAQEPALEVDRTFC
FT                   RTVPDRPLSPAQCEALTEALTRTLEEIAERITEHEVRHAMGAIARGEEASAWREDGPCP
FT                   CGSGRGFSVCCGGQRVLH"
FT   gene            350020..350298
FT                   /locus_tag="Tmz1t_0306"
FT   CDS_pept        350020..350298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0306"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53097"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53097.1"
FT                   /translation="MGAEAVYWLRSRLRWGAEVSKNQDASVAKAKKAIGQPEGLAVLMV
FT                   FFCECATGRDSDVGLHVARRLGQNLGYGVGDNMDDLLAKHGFDGGPR"
FT   gene            350282..352636
FT                   /locus_tag="Tmz1t_0307"
FT   CDS_pept        350282..352636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0307"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: type III restriction protein res subunit; DNA
FT                   primase small subunit; SMART: DEAD-like helicase; KEGG:
FT                   cti:RALTA_A1310 putative nucleic acid ATP-dependent
FT                   helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53098"
FT                   /db_xref="GOA:C4ZMQ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ4"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACK53098.1"
FT                   /translation="MADHDELRALRAENGRLIALLESHGIEWRAQQRPASSPVEPARLS
FT                   AEEKVSLFRRLFRGRTDAYPVRWESKTTGQSGYAPACANEWRAGVCEKPRIKCGDCANR
FT                   LLIPLSDAVIYDHLAGEHTVGVYPLLEDDTCYFLAVDFDEAAWRDDARAFMQSCEELGV
FT                   PAVLEISRSGKGAHAWVFFASRVAARDARRLGTAIISHTCSRTRQLKLESYDRLFPNQD
FT                   TMPKGGFGNLIALPLQKRPRGSGCSVFVDADLRPYPDQWAFLASVRPMAPHDIEPTILL
FT                   ATGGVHPLDVTFIEDEELATPWKRQSTSIKKLAGQMPKSLTVTLANLIYFEKAQLPQVL
FT                   ANRLIRLAAFQNPEFYKAQAMRISVWGKPRVVGNAENYPQHIALPRGCLDAALDLLRDN
FT                   GIACDLRDERFGGDPIDVAFAGTLRLDQEAAVAGMLHHDTGVLCAPTAFGKTVTAAAMI
FT                   ARRGVNTLVLVHRTELLKQWQERLQAFLGVGQGVVGTIGGGKAKPTGKIDIAVMQSLSR
FT                   QGEVNPLVENYGQVIVDECHHVGAVSFDAILKRSKAKYVRGLTATPIRRDGQQPIIFMQ
FT                   CGPIRYTAAKPVGAPHDLEVLPRSRFTRIDLPTDAGIQDVFRHLANDRARTEAIADEVR
FT                   DALGQGRKVLVLTERTEHLDAIKATLDGLEPAPFVLHGRMSRKQRAALVADLDALPPDA
FT                   PRVLLSTGKLVGEGFDHPPLDTLVLAMPVSWKGTLQQYAGRLHREHASKTDVRIIDFVD
FT                   AGHPALLRMWDKRQRGYRAMGYKVGPDGPAE"
FT   gene            complement(352779..353480)
FT                   /locus_tag="Tmz1t_0308"
FT   CDS_pept        complement(352779..353480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53099"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53099.1"
FT                   /translation="MWPFLKKARASKNSDPQGAGAARRKPMRFEDLVADMGDFSDLATH
FT                   DVALKFWLPEPVSFALTEMGELGGESRSEMLRRFLTQHSYGVYAAHVMSAAVPEIFRDP
FT                   PPVMFSRSAPTPPPGKVRVDTYWVPEFGKNVAPIKVWVPSRLRNDLEALAAHVDITLSQ
FT                   YVREIVISRLLGHGALPKRPQMLEAAPLSSVEDWCEGRQVPMRLATEEEFWDHPHGEHT
FT                   VEWKDEPTSSA"
FT   gene            353614..354018
FT                   /locus_tag="Tmz1t_0309"
FT   CDS_pept        353614..354018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0309"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53100"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53100.1"
FT                   /translation="MDDLTEEKAAYLFARAWNRLNPEGFLALLAPDARYASQWVFEELI
FT                   GAPAIAAYLRGKMATLWDKAREDPGAAVRVEMGRTAEGRRGRPCAFMTQGHFEEVQAAV
FT                   VFEVEGGRIIRYDLCIPQLLGAVRTGVYPL"
FT   gene            354033..354326
FT                   /locus_tag="Tmz1t_0310"
FT   CDS_pept        354033..354326
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53101"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53101.1"
FT                   /translation="MTNQPPMSGTAVEISQGDAVEIAARKVGVRPEDLSVICQDDEAAP
FT                   FKIYNAPTEPCWWIVAPHAAGQGVLTLRSSRFVLVGRWTGVVHYDGSANDEG"
FT   gene            354387..355298
FT                   /locus_tag="Tmz1t_0311"
FT   CDS_pept        354387..355298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0311"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ypi:YpsIP31758_B0059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53102"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53102.1"
FT                   /translation="MTKVSPFPLLSRIAHQAGVVEAAPALDEIKAVLASVGINQRGWRL
FT                   LLSFGDALLAPLMPRAHGSVSPSMPSFRTICALLCLIQQCEMDVLPPPELTRAWMRMRF
FT                   PSAKQDLGDVPVGLFRASWLEAVRRQYEGYAFHLLLAEELPAVVRWFFSQEPPLSGQQL
FT                   KNPWRWFHAQAENWSLRCEQHFSFDVWKPILPTPVSAGSLRIIELLSPAAVEDEARCMR
FT                   HCVDMFIPDCECGDYRVFSVQVIPTGERVATIGMINDDRVWIIDDIRGQDNEDVDEMVW
FT                   ALAVRVRLDCNSVETLQQRFRF"
FT   gene            355423..356427
FT                   /locus_tag="Tmz1t_0312"
FT   CDS_pept        355423..356427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0312"
FT                   /product="phage/plasmid-related protein TIGR03299"
FT                   /note="TIGRFAM: phage/plasmid-related protein TIGR03299;
FT                   KEGG: pag:PLES_23551 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53103"
FT                   /db_xref="InterPro:IPR017686"
FT                   /db_xref="InterPro:IPR026325"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMQ9"
FT                   /inference="protein motif:TFAM:TIGR03299"
FT                   /protein_id="ACK53103.1"
FT                   /translation="MAHNIGEMFYYGERPWHRLGERLEQPATLEEALKHGGLDWEVELL
FT                   PLAVADEPESKAPQRCAVVRKDRKPGQAGRVIGVVHPGFGPLQNRAGAEMFDALLGQGR
FT                   PIYHTGGYLKNGEVVWLLARLPGDIQVQEKDVIETYLLFSNSHDGSSAIDIRLTTVRVV
FT                   CQNTLSLALDNTSVGKVFRRAHDGRYRVLKEEARAFFEFSVKRSEEAQALFGRLANAEC
FT                   DDRAFEDFLAQLLPDPKRPVTAGQNLQVQRAWETRLANVRATRAQVMGVRREGIPAQCV
FT                   PPEGKTWWGALNTLTGWVDHVQKTNADRYAHILFGEGDRIKTTALHRIQAIVR"
FT   gene            356439..356717
FT                   /locus_tag="Tmz1t_0313"
FT   CDS_pept        356439..356717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0313"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53104"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53104.1"
FT                   /translation="MTTHDSDPDIPAFLRLPPGERPQRMRCLTPMVSLGALAAARERYE
FT                   ARFGTAPDERYLQRHGIWHRVGLLDLACERGVALEGLPEAQLADANR"
FT   gene            complement(357018..357176)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0314"
FT   gene            complement(357308..357520)
FT                   /locus_tag="Tmz1t_0315"
FT   CDS_pept        complement(357308..357520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0315"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:p1D1 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53105"
FT                   /db_xref="UniProtKB/TrEMBL:C4K9A7"
FT                   /inference="similar to AA sequence:KEGG:p1D1"
FT                   /protein_id="ACK53105.1"
FT                   /translation="MKTDHPPSGLLRGLDLLIDADWTPEQARAVIELLDDLRERIWAHY
FT                   ELALFEHYRQDRLTQAELPFDDPSF"
FT   gene            complement(357517..358275)
FT                   /locus_tag="Tmz1t_0316"
FT   CDS_pept        complement(357517..358275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0316"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: eba:p1B4 IstB transposition helper
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53106"
FT                   /db_xref="GOA:C4ZMR2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR2"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACK53106.1"
FT                   /translation="MTTPEPLLARARALQLHGVVSHWAECAQAPWIAPLIEWEETERAR
FT                   RSLERRLRCAHIGRFKPLADFDWRWPEQCDQAAIAELMTLGFLETATNALLVGPSGLGK
FT                   TTIAQNIAHQAVLRGHTVLFTTAGQLLGELAALDSDSALRRRLRHYASPTLLVIDEVGY
FT                   LSYSNRHADLLFELISRRHEKKSTLITTNKSFAEWSEVLPNAACVVALIDRLVHHAEII
FT                   ALKGLSWRHKEAQERAATNARKRKSARSPA"
FT   gene            complement(358262..359752)
FT                   /locus_tag="Tmz1t_0317"
FT   CDS_pept        complement(358262..359752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0317"
FT                   /product="transposase, IS21 family"
FT                   /note="KEGG: cti:pRALTA_0592 transposase, IS21 family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53107"
FT                   /db_xref="GOA:C4ZMR3"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR3"
FT                   /inference="similar to AA sequence:KEGG:pRALTA_0592"
FT                   /protein_id="ACK53107.1"
FT                   /translation="MALSPEHEAQILRYYHAERWRIGTIAVQLGLHRDTVARVLAQAGL
FT                   PRHGPVQRASAIDPYLPFLHETLAQFPRLTAARLYDMVRARGYPGRPDHFRHLIARHRP
FT                   RPSAEAYLRLRTLPGEQAQVDWGHFGHLTIGRARRPLMAFVMVLSWSRQIYLRFFLDAR
FT                   MENFLRGHVGAFAHWGAVPRIALYDNLKSAVLERCGNAIRFHPTLLALAGHYRFEPRPV
FT                   AVARGNEKGRVERAIRYVREAFFAGRPFADLDDLNAQAQAWCEGAAGARRCPEDASMTV
FT                   TEAFAAERERLLALPEAPFPTDELRAVSAGKTPYVRFDLNDYSIPHTHVQRPLTVCADP
FT                   LRVRILDGEDVIATHARSYDRRQQIECAAHLEALVAHKHAARAHRATDRLTAAVPTCQA
FT                   LLAQAAERGEPLGRTTRALTDLLDRYGAGELAVAVDEALARGVPHPNAVRLALERRREA
FT                   PPPLGVPLPAHLKTRDVTVRAHPLAGYDRLLEDDHDDA"
FT   gene            complement(360500..361444)
FT                   /locus_tag="Tmz1t_0318"
FT   CDS_pept        complement(360500..361444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0318"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3243 IS5 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53108"
FT                   /db_xref="GOA:C4ZMR4"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53108.1"
FT                   /translation="MKPRSAIKTDLFADEHHRKKLDSLGDPLADIELHIDFAALAAEVD
FT                   RVAPRTVSAQGGRPPYPTETMVRILVLKRLYNLSDEQMEYQLLDRMSYKRFCGLANAAN
FT                   IPDRTTVWTFENRIGELGAKALFEGVSAQLLKRGFIARGGQIIDATLVPAPKQHNSRGE
FT                   KALIDQGAMPADWKPAKRRQKDTDATWTKKHGKSHFGYKLSINVDKKYKFIRTLETDTA
FT                   STHDSQHFDNVFDTSNTSRDVYADRGYPSEERAAWLKANGFRNQIQRKGQRNKPLSECQ
FT                   QRRNTRIARTRARVVNGGRFPHKSGVHRRHGTA"
FT   gene            complement(361479..361664)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0319"
FT   gene            361755..363740
FT                   /locus_tag="Tmz1t_0320"
FT   CDS_pept        361755..363740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0320"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pau:PA14_31070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53109"
FT                   /db_xref="InterPro:IPR021795"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR5"
FT                   /inference="similar to AA sequence:KEGG:PA14_31070"
FT                   /protein_id="ACK53109.1"
FT                   /translation="MSDRRDDDFRVRPSAPKNRGKGQGQSFVSKVLKQAGKASSGKSTV
FT                   RLPASARGTGQRPGSRLGRGHTAARFARAKLTPMSRRVTIKTLLVNHQRASPQSLAKHL
FT                   RYIERDGVGRDGEPGQAYGPQTDTADLDAFKERCADDRHHFRFILSPEDGAELEDLRTY
FT                   TRHLMGRMEADLGTGLDWVAVNHWNTDNPHTHIVVRGRDDIGKDLIIAGDYIADGFRHR
FT                   AAELATEWLGPRTELEIQQTLQREVEQERWTSLDRTLKREAGDDGLLHVERLNEPHLQR
FT                   QRLLLIGRLQRLQRLGLADETQPGTWAVHADAEKTLRALGERGDIIRTMQRAMRGEPRE
FT                   LAVFEPGDDGQTILGRVAAKGLADELRDRGYLVIDGVDGKAHYVALNAHDELANYPTGA
FT                   VVEVKGSADVRAADRNIAALASDGLYRTDHHLAIEQGRAKAGRDPQEVVAAHVRRLEAL
FT                   RRAGIVERVAEGLWKVPDDLAERGRQYDAQRLGGVAVELKSHLPIERQARVIGSTWLDQ
FT                   QLIGGGSGLGDLGFGGEAKQAMQQRADFLTEQGLAERRGQRVILARNLLGTLRNRELAQ
FT                   AAKDIAAESGLEHRPVADGQRVAGIYRRSIMLASGRYAMLDDGMGFSLVPWKPVIEQRL
FT                   GQQLAATVRGGGVSWEIGRARGPAIS"
FT   gene            363926..365086
FT                   /locus_tag="Tmz1t_0321"
FT   CDS_pept        363926..365086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0321"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   cak:Caul_5381 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53110"
FT                   /db_xref="GOA:C4ZMR6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR6"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACK53110.1"
FT                   /translation="MNRLTTYALDLHRPVPSVRETGTLSTGRSVQACTVAVLSMCVLLL
FT                   AACTDGSISSRSVATPVAAEVAVVRQARLPVTNDVTGSVVSDGRIDVASRVTGFIRQLD
FT                   VREGQAVRRGDLLLRIDASDIDAAIAQARAGVQAAQEAWRDAQYDVNQNAQLVPAGAIS
FT                   ADALRKSRVREETTRATLEQAQSALAAAQAQRNYVAITSPVDGVVVSVARRSGEMATPG
FT                   APLMTVESREVLLFKAFVPERSLAAIKSGDLIPVRIDALGDERFKGRVRGVVPSGDGVT
FT                   RRYEVDIVLPRDARLLPGMFGRLEILLDEKRAVTVPRTALVRRGGLDGVFVLQEGVARF
FT                   RWLRTGQRLGDVVEVTAGLSDGETILASVADTVHDGMPIQAVGGAR"
FT   gene            365083..368391
FT                   /locus_tag="Tmz1t_0322"
FT   CDS_pept        365083..368391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0322"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   cak:Caul_5382 acriflavin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53111"
FT                   /db_xref="GOA:C4ZMR7"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR7"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACK53111.1"
FT                   /translation="MTSRRLNFAGFLAKHFITSKLTLVFIIAVALMGVVAVLQTPREEN
FT                   PQIIVPAAAVMVGLPGASASEVESLVVTPLEGILSELPGVDHIESTSRNSQGIVQVQFK
FT                   VGESKEQSLVKLYDRVMASRAWLPADATTPLVQSVDADDVPIVTFTLASSKYDDYALNR
FT                   MAERMAERLRSTENVSVVSLRGGQHREITIELDPDRLQAYGVTLGQARAAFPISNLTLP
FT                   LPPTVRDGQVQAIKLDAAYTSAEDVRNQLIAVRDKRPVYVRDVATVTDGPPSEPTTASR
FT                   LSFGLGDPRFGTADATDLPAVTIAVAKKKGTNAVVVANAVIDRMQRMQATFVPQDIQVV
FT                   VTRNDGQKADDAVNLLLEHLTIALVTVGLVLILFLGWREALIVMITVPLIMGITLTANL
FT                   LGGVTINRVTLFALILALGLLVDAAIVVIENIHRHYASRKPKADKEAETVLATNEIGNA
FT                   TNLATFAVMLVFITLLLALTGMPRQYFFPVAVTVPVAMAASIVVAYIVVPWASNRWLHR
FT                   HDIRQEESAHGQQSHGHDTPGRIERLYLRLFSPLQQYRNVRIGFALAVLLLMTVSLMQG
FT                   AWQFVRPAGVGGAVSALGVPIGFLPKDDQNTFNVVVSMPETTPVEDTDRLVRQVTAVLA
FT                   QESQVLNYQTWVGQAGVADFNGLFKGTAARAGSHIAEIRVNLIDKRHRKESSIDIVREL
FT                   RPKVETIRAAWPGAEVALVEQPPGPPLRSTVLAEIYGPDAEGLRALSAQVRGAFAQTYD
FT                   IVDITDTEPEDVPEHRIVPDKDKAALSGVSTAQIAEALALVYGGTTLGRAHLPDEKLPV
FT                   SVRAFVPRRFEVDPARLDRVFVDNAAGQPVPLAELVKVAPASVDRPILHRDNEKVTFVG
FT                   AELSDSVPLYAVLDLQRRLHGITAPDGRPLRTGNLRFKEDVPDTIDGYQLLWGGEMRMT
FT                   MDVYRDLTISLSGALLIIYFALVAYYRSFIIPLVAMSAVPLGIIGIFPGHWLVGVDFSA
FT                   TSMVGIIALAGVVIRNSLLIIDFIQDNIRHGMPLEDAVREAGAVRLRPILLTMLAIIFG
FT                   SAIMVTDPVFGGLAISLIFGTLVSTALTVFVVPLLYELHAKRHAAPTSPGADHA"
FT   gene            368384..369874
FT                   /locus_tag="Tmz1t_0323"
FT   CDS_pept        368384..369874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0323"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: dac:Daci_0761 RND efflux system outer
FT                   membrane lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53112"
FT                   /db_xref="GOA:C4ZMR8"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR8"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACK53112.1"
FT                   /translation="MHEKDHGTSSASHRQARAGHETGPSVHHRLVGTLAVAVLAMLSGC
FT                   ASLAPALDPIALPVASNWRTQPDAPSGAAATELAWREYFTDPALQALIETALENNRDLR
FT                   VAVLRTEEARAAFRIQRAQQAPMVGVGAQQIRAGLPDGLQPLAGRSVLEVNVASVGISS
FT                   WELDLWGRVRSMKTAALEQWLATEQGQRAVELALVAQVADAYLGLRELDERISLARRTV
FT                   ENQQELAQIFQKRLELGHGSRLELTQVRTLLSQGKALQVQLELAREQQRNALALLLGSE
FT                   PQLPPSSAPMDEALVMPELRPGLPSDLLVNRPDILAAEHALRARQANIGAARAAFFPRI
FT                   ALTGGAGSVSTSLSDLFSSGTRAWLFQPTIELPIFDAGMRQANLDVSVVRRDIAIAEYE
FT                   GAIQAAFRDVSDALAARQKLTEQLIVARQAHAEQSERLKLARTLFDAGSAAHLEVLDAE
FT                   RDLLAVEQQLVQVRRAALSSQIGLYAALGGGINQPPKR"
FT   gene            369884..371629
FT                   /locus_tag="Tmz1t_0324"
FT   CDS_pept        369884..371629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0324"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: pna:Pnap_4176
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53113"
FT                   /db_xref="GOA:C4ZMR9"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMR9"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ACK53113.1"
FT                   /translation="MLWQALTAMRDLRRLHEIASILIRYGFGDMVRRMGLSNALERAGT
FT                   ALHWNEATDFAHMTPPERVRRALEEMGPTFVKLGQVLATRVDLLEPEWTAEFGKLQDSA
FT                   PPAPWAAVHQQLTEDLGAPPEEIFAAFDPEPLAAASIAQVHRARLDDGSEVVVKVRRPG
FT                   IRPILEADLRWLARLAELAETESAEWRVLHPREMVRQFGQSLRNELDFAGECRNAERIA
FT                   ENFTGYTDQDSPPVVPGEEKPDADGAHPIIVIPRVYWQWTGERVCVQEFIGGISGRRLQ
FT                   AVDQAGLDRKMLARRGANAVLKMIVEDGVFHADPHPGNVFYLPGNRIAFIDFGMVGRLE
FT                   EERRDQLIRLLLGLVRNDARSVVDVMLEWTSDGVANEQDLLSEVQSFIDRYHGVPLKQL
FT                   RLSVMLSDLVAIPRQHHLALPNDLSLLVKAFVTLEGLGRELDPGFDMANQALPLLERAM
FT                   HARYSPAALLRRGRRAAGDIFSLLAGLPQDISRLLRAARRGRLEVHIDVTHLRRVGDQL
FT                   DNAANRLVIGIVVAALIVGSSIVMTVSGGPTLLGLPVFGFLGFLGATVGSLWLLLSILR
FT                   SGRGR"
FT   gene            371626..374361
FT                   /locus_tag="Tmz1t_0325"
FT   CDS_pept        371626..374361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0325"
FT                   /product="Glycosyltransferase 28 domain protein"
FT                   /note="PFAM: Glycosyltransferase 28 domain; KEGG:
FT                   pna:Pnap_4177 glycosyltransferase family 28 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53114"
FT                   /db_xref="GOA:C4ZMS0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS0"
FT                   /inference="protein motif:PFAM:PF04101"
FT                   /protein_id="ACK53114.1"
FT                   /translation="MSTTGKVVIFYSSIGYGHISAAQSIQDEIRRQSPATRVLMQDIRT
FT                   FMHPVWRRVDERLYWFVANHLPECFESLFRTMQARGSRVASLSMLPNDYPEESVSAYLT
FT                   AQRPDAVLASHYGAAQVLGTLREKGLLSDTRIGWLHTDFFEGYFPRISKRIDRTFLAHP
FT                   ELKTRWLAAGVPADKIVTSGMPVRIPAASADARRATLQGLGLSLEVPTLLLTGGKEGAG
FT                   DYLGVVESIVRRRPGRLQIIAVCGTNTRQYEALADLRERLPDTVTLKPLGLLPRSEMAS
FT                   CMAATDILVTKAGGMTPAEAFALGVPTVLLDVISGHERENAALFLRQGLARFAASADDA
FT                   GRSVMELLGDPAEREAMLRAQQEFRQGIDIASIVRFALDDGFRPGRPLPGYGVENGAPV
FT                   QGIDQALAQLDSEAPAEVELLLSYATSKTPQRVVLENPFGHLAVRIGDTVYSANYIADP
FT                   SVDPNFLQHVSLADYLYGIHRPSRSQVHTNTYGMAYGRETLGLRVQGIPAERRAAMVAE
FT                   AHRIENGFRDASLRWSRSDLNCADVVARILAAGGYDDRSLYDRAGLPSMPLDLFERMRA
FT                   HFEADTSLREELVAYRLLPGTQASYRFSRFPLSVGQPLRSMARVLSDAPRDALEQAATR
FT                   QVTGYFGDRRLYVENLRACWPASESAHSSLTSRPHLALAQAIRADLRRLLAVYVKLPLK
FT                   RIERLGSFPAAQEFHRLADRGLQLARLATEHVEDDLHPRTDRLRALFTRLVEDYGRINP
FT                   QRLESRHVRSYLARLRAFESTLGRELVPTGTAWALLPAWWHRIAALARTSARSHPRSGG
FT                   TSGFSGMRVDPGEVELNGDAKEHGAHPLEADPAARLTLGDLEKPIQGFQEAVSLVGLGP
FT                   GGEALKGASDQPGDVPHRLETPMTVATDHEAPDFSQFHYH"
FT   gene            374411..375112
FT                   /locus_tag="Tmz1t_0326"
FT   CDS_pept        374411..375112
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0326"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: Transcriptional regulator TetR ; regulatory
FT                   protein TetR; KEGG: bid:Bind_2883 TetR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53115"
FT                   /db_xref="GOA:C4ZMS1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015292"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS1"
FT                   /inference="protein motif:PFAM:PF09209"
FT                   /protein_id="ACK53115.1"
FT                   /translation="MPNHAETTSGHEARSAKTRSQLIEATIDVVAAVGYEGATTRALSQ
FT                   AAKTTLSAIPYHFGSKKELYLAAADMIAEYAAIRFAEAAALLDDTSDVGLSARFELALI
FT                   QLLHTMLEEAEPHAWTAFVARCAYDNDDAFALIYGRAIAPLQERLVHAASQFSGRSSDD
FT                   EALRLRVIAILTAIFSFRFLRGVMLRGMDWQSIQNEAVRQITDMVRDLCRSGFLAVRPA
FT                   DDSANRKTGPT"
FT   gene            375149..375757
FT                   /locus_tag="Tmz1t_0327"
FT   CDS_pept        375149..375757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0327"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53116"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS2"
FT                   /inference="similar to AA sequence:KEGG:Bind_2884"
FT                   /protein_id="ACK53116.1"
FT                   /translation="MTLQSYVHQTIAWAKQRLDETDAILSEVEKSAASIKEDARKQADT
FT                   ARARLAASRAKLQQYYDDLRAQADTAKQEAGEIQDKLEAEWVEVESALQQFVATTGDQV
FT                   KTVRSIVVVRARAQRQAWQNSLKELRDQAADAVEKARGELDAAFDHLSTEAEKFQARIG
FT                   EVKDAGDESWRAVKQGFTNAKAAHDVTVQKIKDAFSKVL"
FT   gene            375806..376513
FT                   /locus_tag="Tmz1t_0328"
FT   CDS_pept        375806..376513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: xau:Xaut_4924 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53117"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS3"
FT                   /inference="similar to AA sequence:KEGG:Xaut_4924"
FT                   /protein_id="ACK53117.1"
FT                   /translation="MKLRFSTVALALLTQAALLSAPPALAQNAEAQAASAATQKEPSKV
FT                   HQALAWSQDRLAQLDANITALEKDASRLRDEARTKADAALADLRKQRDAYRRRAQDAAV
FT                   NAKDWSDAQIAEARQALDNDWATFQAARDKYLEESKASIATQRAVLEAELNAQQKALAG
FT                   LRADAAKLAADQRAAIEGRIAALNADVEETKARVSKASAEVWETTKKSYGEAQRLFSET
FT                   YASIRQSIDEAKK"
FT   gene            376623..376904
FT                   /locus_tag="Tmz1t_0329"
FT   CDS_pept        376623..376904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2885 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53118"
FT                   /db_xref="GOA:C4ZMS4"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2885"
FT                   /protein_id="ACK53118.1"
FT                   /translation="MNLANEIKALGVQIAEQARQRPKPDDEAPPPIEEATGVGEARSQL
FT                   HDADAFLKAVNETLDEFADDLNRHPRLTALAALSIGLAAGIVIGYQAR"
FT   gene            376935..377384
FT                   /locus_tag="Tmz1t_0330"
FT   CDS_pept        376935..377384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53119"
FT                   /db_xref="GOA:C4ZMS5"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS5"
FT                   /inference="similar to AA sequence:KEGG:Bind_2886"
FT                   /protein_id="ACK53119.1"
FT                   /translation="MSTLNSAKLYGRIAFLRRQVLLRQLMRRSVTAALAVAAFIVTSGL
FT                   ATYALFLAIKAPLGDLGATLAIATLYLVAALTLLGYTLHEPHSPELEALAEMEAAALEI
FT                   VTADTQGIVQLATAAGHRIENLGSSLTLGVGILGALRKLLASRKP"
FT   gene            377521..378441
FT                   /locus_tag="Tmz1t_0331"
FT   CDS_pept        377521..378441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0331"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: bam:Bamb_2000 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53120"
FT                   /db_xref="GOA:C4ZMS6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK53120.1"
FT                   /translation="MELRHLRCFLAVAEELHFARAAERLHIEQSPLSRAIKELEEELGV
FT                   TLFARTTRSTRLTLAGKLFLEHVRRVFAALQQARDSVKAAANGFHGQLRIALSDGITPS
FT                   RLPALLALCRQEEPEVEIRLFEVPLSQQIKGLHDDLYDVGFARSDEVGDGLIAEPVWSD
FT                   PLMVAVPARHPLLAHKRIPLEELLRYPLVLCDPTVCEGDARQVERVLRRVDMEPLIAER
FT                   VASSDLMMALVSAGFALGLTGAAHIATSREPGVVARPLAGRSPVLTTYLLRLDGVPSET
FT                   LAHFIERVQAIESPEANRPISGRPS"
FT   gene            378463..378642
FT                   /locus_tag="Tmz1t_0332"
FT   CDS_pept        378463..378642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0332"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: bmj:BMULJ_00894 probable lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53121"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS7"
FT                   /inference="similar to AA sequence:KEGG:BMULJ_00894"
FT                   /protein_id="ACK53121.1"
FT                   /translation="MKKAIPFLLAVVLTGCGQSEVPQKADLPTVEALASNPERLKELRQ
FT                   QCKLERLYALSSGN"
FT   gene            complement(378644..379969)
FT                   /locus_tag="Tmz1t_0333"
FT   CDS_pept        complement(378644..379969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0333"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: maq:Maqu_4119 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53122"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:C4KAN5"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACK53122.1"
FT                   /translation="MSSPIEALFTTALGLQPPWYVAKVDLDTAKRRIDFEVEHAGKRVP
FT                   CPACGAAHQPVHDRVRRSWRHLDFFQFEAWLHADIPRVQCSGCGKTTQLPVPWAREGSG
FT                   FTLLFEALGLSLCSELPVRQAAAQMRVAPKRLWGRIRHYVHGARARDDMSGVRYVGIDE
FT                   TSVKRGHAYITVVHDLEAKRLLFATPGRDHATLQAFAQDLRAHGGEPERIEHACIDMSA
FT                   AYAKGIAQALPTAQVSYDRFHVVALANTAMDEVRREEMRSAAAAVRAAAGTGNKKTLRQ
FT                   LLWAMRKNPPQWTPAQCDAMNWLQRSGLKSARAWRMKQGLRLVYREAAASNCEEVARGA
FT                   LMKWISWARRSRLEPFKRLGATVKAHLGGVLRGMLDGRSNAYVEAMNGQLQQTKTAARG
FT                   FRNLDNFIAVAYLRMSKLEHLPKNPMVPAIPREYGRYRHVCC"
FT   gene            380087..380206
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0334"
FT   gene            380676..381130
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0335"
FT   gene            381488..381721
FT                   /locus_tag="Tmz1t_0336"
FT   CDS_pept        381488..381721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0336"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: eba:p2A243 DNA repair protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53123"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMS9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53123.1"
FT                   /translation="MMFVSPSPINEEFLLAALDSPAIFIPTGPTPVSAGFPSPAEDYAQ
FT                   KRLDIKEYLVRNPISTFFFTVKGAPRITRGFQ"
FT   gene            complement(381855..382892)
FT                   /locus_tag="Tmz1t_0337"
FT   CDS_pept        complement(381855..382892)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0337"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA3243 IS5 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53124"
FT                   /db_xref="GOA:C4ZMT0"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT0"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53124.1"
FT                   /translation="MKPRSAIKTDLFADEHHRKKIDSLGDPLIDIESHIDFAALAAEVD
FT                   RVAPRTVSAQGGRPPYPTETMVRILVLKRLYNLSDEQMEYQLLDRMSYKRFCGLANAAN
FT                   IPDRTTVWTFENRIGELGAKALFEGVSAQLLKRGFIARGGQIIDATLVPAPKQHNSRGE
FT                   KALIDQGAMPADWKPAKRRQKDTDATWTKKHGKSHFGYKLSINVDKKYKFIRTLETDTA
FT                   STHDSQHFDNVFDTSNTSRDVYADRGYPSEERAAWLKANGFRNQIQRKGQRNKPLSECQ
FT                   QRRNTRIARTRARVEHPFAAIAQMGGKLIRTIGQARASFAMTMMAACYNLKRLTYFQKA
FT                   GIVAF"
FT   gene            complement(382911..384683)
FT                   /locus_tag="Tmz1t_0338"
FT   CDS_pept        complement(382911..384683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0338"
FT                   /product="sigma-70 region 2 domain protein"
FT                   /note="PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 1.2; Ankyrin; SMART: Ankyrin; KEGG:
FT                   bcm:Bcenmc03_0005 RNA polymerase, sigma 32 subunit, RpoH"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53125"
FT                   /db_xref="GOA:C4ZMT1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT1"
FT                   /inference="protein motif:PFAM:PF04542"
FT                   /protein_id="ACK53125.1"
FT                   /translation="MNDPAPFRKKPLNPLLKMAAVAGVQTAIRLHIRRGDDLDAVEENG
FT                   RTPLMLAAVRGHADVCKLLLDAGADPLLTDHEGRDAVGLALAAGKTGVVEVLMQFRVET
FT                   ADGSAVCPPPTGRPVSAAGSSPESGATTEDEFSPNGWEAEEESLTPPDDTRRTSSARTI
FT                   QQAISSHAPTSTDEDWSDIEIDLPEVRTGPAGGRRFDDEDLARLRLLLMQGLSVGFVNR
FT                   SDIVEACADATESHEADLEERIERLIGDLGLHIEDVSPSFGLDEHGAAESEDACEDALE
FT                   YLRDICSGDNDPLKLYIREVGPHQALTREDEAFIARAMEEGVSQAIRTIASCKAALDQI
FT                   IDAGDAVCRGEADAGSMFDRAAGNPEDEPHESAFGLSSTMQDDEQDQASDDAGRQQMQL
FT                   QPELGAALADLRRLVYSLPASTEVPVAAQGRIVSLLNALGLNFDFLEAVCNTLLASPDH
FT                   RDIGAAVAVALNSALDHRNRMIKSNLRLVISIAKKYTHTGFPFLDLIQEGNLGLMKAVE
FT                   KFDYRRGFKFSTYATWWIRQAITRGIADQQRLVRVPVHMVESINKVSRVLRELEGRAPR
FT                   KTSASPALGKITTS"
FT   gene            complement(384877..385116)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0339"
FT   gene            complement(385286..385567)
FT                   /locus_tag="Tmz1t_0340"
FT   CDS_pept        complement(385286..385567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0340"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; SMART:
FT                   helix-turn-helix domain protein; KEGG: bph:Bphy_0252 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53126"
FT                   /db_xref="GOA:C4ZMT2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT2"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACK53126.1"
FT                   /translation="MPAMDQDKAAPYCLALRRALAANVRRLRSARGWSQEVLAFESGLH
FT                   RTFVAHVERAARNISLDNIARLAVALEVTAPDLLQVPPRDAEIVNPAA"
FT   gene            385680..386144
FT                   /locus_tag="Tmz1t_0341"
FT   CDS_pept        385680..386144
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53127"
FT                   /db_xref="GOA:C4ZMT3"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53127.1"
FT                   /translation="MKCAHHPAHDAVGVCADCGLALCPDCRASDERLLCGRCLVQHNQR
FT                   VIRHFSLRLAGSLALFFTALSLVINAQLGVLEKLAICLMAAFFPFGWSALSKVFSPGDQ
FT                   YPFGLMRWVALASHAGASAALGWVVGPFQLYKGVREILKARRANVSVQQP"
FT   gene            386160..388505
FT                   /locus_tag="Tmz1t_0342"
FT   CDS_pept        386160..388505
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0342"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53128"
FT                   /db_xref="GOA:C4ZMT4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT4"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACK53128.1"
FT                   /translation="MNARNAAAAAETARRPVDSGVPDRVERLIVHLDAEHARRDRALDA
FT                   AFASIGPELRAIEQELRATLRWGALYPGLTALRRKLGLAPLELPAFLILGCALVLWILA
FT                   WEMIGSMLSGLVVAVAATLGGMVALRRYRLTGVQDRLETKLMRFAGRDDSQAFPYRFEL
FT                   LFDYPDAAPELGEMSFSNIDEPLPGGCAILLCDTLADSIAWITRGTVGWRIQVEGSAPL
FT                   VPAGMPVDARFDALVARFDALRERILERNEARQALESGCLRRDALAARWADIALPADVR
FT                   ETLLAGLVHFAYGDAAAPRGILLKGPPGTGKSLVAQAFGDCVEATFFKCSVAELKGRHI
FT                   GESAGNVRELWARAREAAPAIVFIDECEGAFPARGSDQADTFTNEVVQTFLTEWDGIGG
FT                   EHRVLVIGATNRSELLDDAIVSRFTDVVELLPPQGETRRELVLAVARVVGIASPPSDEA
FT                   IALFSGMSGREVRNALRQAMRLAAPAEPAVEHFREAVAKMRGKTSTRTDENACWERLVL
FT                   PEPVKREFEVMTEMVRESGALQQKGIPVPRALLLYGPPGTGKTQIARTLAKEAGVAFIA
FT                   RSTAELKGQYLGQAASRIAQSFESARANSPAILFIDELDALTAARGSEAGDALQAEALT
FT                   QLLQEMDGVRACSGLVFVVAATNRLDVIDAAVRSRFAKQIEIGIPDEAGRAELLRVLLT
FT                   GRPVAEELDVATLASRTEGYSGRDLGELVATAFQRAVSRTLDAGGAAADTVLLADDFGV
FT                   APCGVERSGLCRSVGARQPAFAATGGDE"
FT   gene            388502..388657
FT                   /locus_tag="Tmz1t_0343"
FT   CDS_pept        388502..388657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0343"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53129"
FT                   /db_xref="GOA:C4ZMT5"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53129.1"
FT                   /translation="MNAVGLDRNSLRAPGQVVGLLTAVAAMLFGLMALAVQSRFAASEL
FT                   VLTASG"
FT   gene            388733..390247
FT                   /locus_tag="Tmz1t_0344"
FT   CDS_pept        388733..390247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0344"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   azo:azo1861 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53130"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT6"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACK53130.1"
FT                   /translation="MKSALFVDFDNVYSGLRKLDPAMADQFAQKPQRWMQWLVASLGLP
FT                   EHSPESARRRVLVRRCYLNPQVYQRFRPSFNLAGFEIIDCPSLTSEGKTSTDIHMVLDI
FT                   IDLLQHEAHYDEFIVFSADADFTPVLRKLRRWDRRTTVLAIGFPSAAYRASADLLIDQD
FT                   LFVRDALGFREEESGASEPAPVAAPALATADIVRAARELIRRKVEESVGPVSLSHLAST
FT                   ILRDVEGVDATSWAGFGSFRQLVDEARFAPLVVSWEGGGVIFDPARHAKPEPAARKVKV
FT                   EDEVNDVTRLIRTEVEASAQPVPCARIAQLITSRHGAIAKDWNGLGSFRKMVEGLNLAP
FT                   IKVDWAGAGGRMYDPARHRLTAPNGAKTNGSAMPDWGKDADLLPIASQIHDVTNAPLWS
FT                   PADYQNLFRMLAEDLAAQPFDLAETGKRVRDRIRAQGRPINRQNVNWILQGLLFRGHVF
FT                   GRGEDDSTTLARKCADNIKSLCLREQMVIDSVVDAAIMRWIVGGSD"
FT   gene            complement(390431..391189)
FT                   /locus_tag="Tmz1t_0345"
FT   CDS_pept        complement(390431..391189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0345"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: dac:Daci_5757 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53131"
FT                   /db_xref="GOA:C4ZMT7"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT7"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACK53131.1"
FT                   /translation="MPRKPLSPAESTPFPRPLSTVDVIILTLLDDALQVLLVQRDSAPD
FT                   EPFPGQWALPGGIVDTARDLSLEDCARRKLKEKTGVDAPYLEQIGSWGDASRDPRGWST
FT                   THVYLALLPAASLHPTRGGNVSDVAWFPVHGGGSNPVAPPLAFDHDRLLAAGIARLRGK
FT                   AEYTSLPIYLLPPTFTLSELQQVFQAVLGRPLEKKAFRTRILAAGLVEELDAMRETSRR
FT                   PARLYRRRAGQGLHYFPRALEPHSVASAAD"
FT   gene            391305..392330
FT                   /locus_tag="Tmz1t_0346"
FT   CDS_pept        391305..392330
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0346"
FT                   /product="band 7 protein"
FT                   /note="PFAM: band 7 protein; KEGG: dac:Daci_5758 band 7
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53132"
FT                   /db_xref="InterPro:IPR001107"
FT                   /db_xref="InterPro:IPR036013"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT8"
FT                   /inference="protein motif:PFAM:PF01145"
FT                   /protein_id="ACK53132.1"
FT                   /translation="MFGIRFIKADPTTYLMQVRGGQIVREGAGQSFFYYAPTSSLVAVP
FT                   VGSQVLPFIFEQTTADFQSVTVQGSLAYRIADPKRIAGMLNFTLAADGCGYAAEDPENL
FT                   RTRVEGAVEVLVQQAVSRRPLRTCLQGAEAIAAEVQAALAVRGDIVGLGLEILSCSVTA
FT                   VRPKAETARALEAEVRETILKAADDAIYARRNAAVENERAIRESELDTEVAVELKQRTI
FT                   RETRMAAEASIREKEAELQAAELEARIALEGRRQEFVGLEAENTRTAAEAEAFRVGAVM
FT                   KAIGSADPKIVQALASTGMAPAQLIALAFGGIAEKAERIGQLNMSPELLQSLVGAGGRG
FT                   Q"
FT   gene            392347..395216
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0347"
FT   gene            392860..394560
FT                   /locus_tag="Tmz1t_0348"
FT   CDS_pept        392860..394560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0348"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:ebA575 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53133"
FT                   /db_xref="GOA:C4ZMT9"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMT9"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53133.1"
FT                   /translation="MHVKLTTSGGRRYVQLVESYRDEAGRVKKRTVATLGRAEQVDGSL
FT                   DAVINGLLKITGREPMGAKPPAPTVSFESARALGDVWALTELWNSLGFSGLRRVFSRTR
FT                   HTTDVEALIRLMVLNRLCDPESKLGVLRWVHTVALPDFRPKAVTHQQLLRSLDALMDHQ
FT                   DEVDAVVAGLLRPLIDQDLSVVFYDLTTIRSEGLSQMTGDVRQFGMAKEGLIARQFMLG
FT                   VVQTAEGLPIYHEVFDGNAAETRTLLPTLTKVLERFPAVQRLVLVADRGLLSLDNLEAL
FT                   KSVRLASGKPLEFIVAVPGRRYNEFIDLLEPFHEQQCVGATQEVISERAWNALRLVVAH
FT                   DPLAAADKTQQRNARIDALLRQAEQWTGKLTDQDEGVKYRGRKLSDSGAKARFYHVVSE
FT                   AHLSRIIKVDLAEELFSYDIDDKARRLAEMMDGKLLLVTNAEGLSAQNVIQRYKSLADI
FT                   ERGFKVLKSEIEIGPVYHRLPERIRAHASICFMALILHRVMRRRLKAADAGYTPERALE
FT                   QLQRIQHHRVRLNGGEPVAGVSTISTEQNEVLHALGIGKPTAPEQLALL"
FT   gene            395599..396225
FT                   /locus_tag="Tmz1t_0349"
FT   CDS_pept        395599..396225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0349"
FT                   /product="phosphate acetyltransferase"
FT                   /note="KEGG: dac:Daci_5760 phosphate acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53134"
FT                   /db_xref="GOA:C4ZMU0"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU0"
FT                   /inference="similar to AA sequence:KEGG:Daci_5760"
FT                   /protein_id="ACK53134.1"
FT                   /translation="MRPIIALDADGVLVDYHHAYADAWAKAFGRRPALRDPAAYWPMDR
FT                   WDVRRLTGDELETFRKCFDAEFWSSIPAMAGALEACRELVEAGYDLVCVTAMEMQFETA
FT                   RLRNLRGLGFPIERVIATANAQSAESPKAAALRELQSVAFVDDYLPYMRGIPPQIHAAL
FT                   VLREPNGSPNRGAELEQVHSTHKNLAAFAEWWLSGRPAGTPFSMP"
FT   gene            396605..398062
FT                   /locus_tag="Tmz1t_0350"
FT   CDS_pept        396605..398062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0350"
FT                   /product="serine/threonine protein kinase"
FT                   /note="SMART: serine/threonine protein kinase; KEGG:
FT                   mxa:MXAN_6043 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53135"
FT                   /db_xref="GOA:C4ZMU1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU1"
FT                   /inference="protein motif:SMART:SM00220"
FT                   /protein_id="ACK53135.1"
FT                   /translation="MPDLASEIIEDLTTRVRRFLNATGGYEHLDFLAAGGSAAVYRVVR
FT                   NGNSSALKAFNPRFFSGAGGDAERHRLDVQKRLIGHGCTSLVQTYQVVETEGTAFVEME
FT                   YIEWPQLTNKLGEVPDSAIVPLISQLVEAVRFLDSLNIVHRDIKPENIHVSPDFKYLKL
FT                   LDLGVVREFDSPDASDACVTDHGNQRPFLATAQYSSPEYLFRLDEPTAKLWRGLNIYQI
FT                   GAVLHDLIKKEPLFKHEMSLGNRWLVARAVLAKQPSFADPIPNRLLALKALSSRCLIKD
FT                   LDTRLAVVGWEDFVLEGASDPVSALRGRLAKGAITNRRGAGESSAARLEFERAEFMKRF
FT                   SDRIRAELIHICGAQLPLTMKPPSPGAPMDVRYELAVDKQLSISCHLGFDWQAGLYERS
FT                   ANLRVGAQFLSAGRDDEAPAIEYRPVGVAVIQEAEDEAATLVTNELANLVGRALDRIEG
FT                   GENSASLHGLNLQDTQESQSLQLGDNQ"
FT   gene            398059..399225
FT                   /locus_tag="Tmz1t_0351"
FT   CDS_pept        398059..399225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0351"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dac:Daci_3682 NERD domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53136"
FT                   /db_xref="GOA:C4ZMU2"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53136.1"
FT                   /translation="MMNRSWWRSKNELDEDQKAFIQLPAHGRYSLVGPPGSGKTNLLLL
FT                   RAQFIAGMGEKNVLIVTYTKALANFIRSGIGASGLISPNQVRTYHSWASSHILENLGQR
FT                   AVPKGADFDDATRPAILEMLREANAKLPTKQLFSAIFVDEAQDLTADELEVLLSLSDNV
FT                   AICGDARQGIYDKNGLSAVEKLALQPHTLKRHFRIGQRIAKVADRLMPPENPADSLEAM
FT                   SNYDLKAQGESSAHMNPCANRDEQFEKMLEKIEIQLDAFKDDTIGIFCGKRETLEDLRI
FT                   RFNKTKLSKQVCVHGVDDDSSFSDNKPIHVLTIHASKGTEFRAVHLFAVEELASYPLNR
FT                   RRLGFTAITRAKTALNAYRTGDTNQPLENAFAQPQHMELDDLFPGDKS"
FT   gene            399222..400667
FT                   /locus_tag="Tmz1t_0352"
FT   CDS_pept        399222..400667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53137"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53137.1"
FT                   /translation="MRHDEIRWATIDREDLLDVLLGEHQLPDLDRIQSDLSLRGAKLAV
FT                   GYRDVRGGGRYEVPALIVVPDDTATETFSWLRTFADEASPLSLYGRVALASDWRQFEMR
FT                   RNVMGTSEQRPDRWSSIAVGEALSQMESETSLQNLPLSRFSGCFTTPIARAALIWGSNE
FT                   ATHACTNRLRLLESDRRFARRPVGIEQLLPVWAIASARIEEHLSPSEAASYVLDAAGAY
FT                   YGAYDRKGAVLASSPMFNEIPGLSSDSIEERVGAFNRIASDILQRAQSSRSTPAPAFDS
FT                   LLLAAAAFQVGRGTSHVFLLQRAHGFAPMAAAWFGAMAALTGPRAWDKGWLKAAKGAER
FT                   LLRPEFSWLDISGADICWAEFEWMAETFDGLDVFLELPKMLPRTLGIEIVPGAVGQFRL
FT                   AGESTENEPKPQQEPQHTARERRLMETLAQFITLAQRAKDQVAPSFLASGGQPVQKSFG
FT                   FDSDTDAAPRARAKRGKRDANNS"
FT   gene            complement(400991..402478)
FT                   /locus_tag="Tmz1t_0353"
FT   CDS_pept        complement(400991..402478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0353"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: dar:Daro_2666 filamentation induced by cAMP protein
FT                   Fic"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53138"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK1"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ACK53138.1"
FT                   /translation="MPTIGYAQLISRLSLAVRPLAKPAEISGSVNRRVDSADRVLFPRG
FT                   VAIEDTLVGHLEFALRHEGVNLEVIDALFEHLPPQDLLARLNAAPNGAHIRRACHLWEW
FT                   LTGQELPAEALPAGGYVDLFPADDYVTAGQPTNDRKFRVRNNALGTADFSPVVRRAALP
FT                   SAPSLPELLDKARETLASVTDPSLHERALSYLYLSETRSSFEIEREHPSSDKQERFVQL
FT                   LRRAGETMQVTEDWLVSLQNAVVRDVYSQEASYRTRQNWLEDATGRVTFFPVPQAELAR
FT                   AMRGWDAFINDDHRCTDVLVKAAAAAFGFVYLHPFMDGNGRLHRFLIHHVLTHSGLLPT
FT                   GTVVPVSAVILKNIPAYLEVLSGFSLPVTRLWRYVRAEEAHVTAHPGSRAYRFFDASRE
FT                   VAFLHSMIQQAVEDEIPRELAWLSGYDKAFAQLDAEFDLPRKDLSALIRMAQSNEGRLS
FT                   VRRRKQYSHLPADVLDRVEEVVRESFGLTPEDGSEAR"
FT   gene            complement(402830..403825)
FT                   /locus_tag="Tmz1t_0354"
FT   CDS_pept        complement(402830..403825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_0628 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53139"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK2"
FT                   /inference="similar to AA sequence:KEGG:Pden_0628"
FT                   /protein_id="ACK53139.1"
FT                   /translation="MKDNQTDWFAGVDEVVSEPLKFKLQLAIGEDAYTSLRVRKAVFEA
FT                   WDVFGAATSAAAIAKSSAVASALFPSSGVLSAIGIGTATTPVGWVVGAAVVAGGAWIGI
FT                   TRYVREHADARVKTVPEFINTPLDIIGLALFDLMAPLVLKVAHVDGEIDQAEAQAIERW
FT                   FVREWGYDPSFVQKGLAFFDSRLDEVRIADIATALARYKRESPDCNYRVMTREVVRFLR
FT                   EVIEADGVIDEREEMAVERIAHIFEDEGRVHLGRSAKELGRKLSDSAETAGGAVAEGAT
FT                   WALNTTVAGASQIGLTASDALTATVRSGVAGVSRLGGLFVRGKRTTDRQD"
FT   gene            complement(403831..404301)
FT                   /locus_tag="Tmz1t_0355"
FT   CDS_pept        complement(403831..404301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0355"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_3321 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53140"
FT                   /db_xref="GOA:C4ZIK3"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53140.1"
FT                   /translation="MRVKGVSPDGKKAVEFESELIGREFIDRMVNFDLSEDDIRKRIDR
FT                   LAVSADVKSLLYSLAKASIAIGAQVVRIGRKVIDYVCMLVKEFPKVTFFALLGAIAGFL
FT                   VATIPILGVVLGPIVTPIAIAVGAAFGVLEDIRDQALKRKITEFHAQFAPLA"
FT   gene            complement(404500..405120)
FT                   /locus_tag="Tmz1t_0356"
FT   CDS_pept        complement(404500..405120)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0356"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: xca:xccb100_3258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53141"
FT                   /db_xref="GOA:C4ZIK4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK4"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACK53141.1"
FT                   /translation="MTQKFDTALSLALEAHSGQIRKGTENALGLPLPYITHPVAVATLA
FT                   QRYGGNEDQVIAALLHDVLEDGGPQWADPIRDAFGGQVLDLVRFCTDGLPDAQGQKSPW
FT                   RERKELYLAHLRAAEGEGVLVSACDKLANLQAILLDLTEIGESVWTRFTGGKDGSLWYY
FT                   VELVEAFGGRVPAALEVALRRDLAAVLELASARMDEVSKPSAE"
FT   gene            405393..405512
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0357"
FT   gene            complement(405701..407041)
FT                   /locus_tag="Tmz1t_0358"
FT   CDS_pept        complement(405701..407041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0358"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: dvm:DvMF_0823 two component, sigma54
FT                   specific, transcriptional regulator, fis family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53142"
FT                   /db_xref="GOA:C4ZIK5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK5"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACK53142.1"
FT                   /translation="MSRSKVILVIDDDRGFRGLLTAQLADMGYDTTGAASWAEASACLK
FT                   EIEPDLILLDMKLPDTTPELAVPELAAEYPVIVLTGYGSIRSAVSVIHAGALDYLTKPI
FT                   SLAELELTIARVLDNAEMRRSNALYKRQLAARQGSGLIGNSAAILALESLIDAVAPTNA
FT                   TVLIHGESGSGKEVVASAIHQRSERKNRELVTVDATTLSETLFESELFGHEKGAFTGAD
FT                   RQKKGLIEAAEGGTLFLDEIGEVSLANQARLLRLFESGTFRRVGGTKTLRADVRFIVAT
FT                   HRNLGLMVREGRFRSDLFFRLSSFVLTSPPLRDRREDIALLAEHFLSQFCRGQKKLFAR
FT                   DAITTLTAYDWPGNVRELRNVIERAVILARNAVVIRRDHVSMPELEGASVLSFSFEHPP
FT                   TLKDLERSYFLRTLERFGGNRARTAAALGISERNVYRLIGLYGAELT"
FT   gene            complement(407038..408897)
FT                   /locus_tag="Tmz1t_0359"
FT   CDS_pept        complement(407038..408897)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0359"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein; PAS
FT                   fold-4 domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; SMART:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; histidine kinase HAMP region domain
FT                   protein; KEGG: mgm:Mmc1_3010 periplasmic sensor signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53143"
FT                   /db_xref="GOA:C4ZIK6"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK53143.1"
FT                   /translation="MPIRVVAARQDSLARQMLWRILIVASAASVAFATVFVALYLDQLK
FT                   ATRADASLNLNRMLATTWENAMLKRDVEGLREIVSSLGALRDIRDVLVLAPNGEVRFAS
FT                   NPVRLGMQLPGLVASTAGGMATSRFEHGIEDEEVLRSINPVPNRTECVPCHGPVSSSPI
FT                   NGVLVIDYDATPVRQQALASAALFAAAGGLVIVLTIMAVWWLLRRRVLNPLAHLDRAAG
FT                   ALAAGDLSARVEVAHLDEIGRSAQRFNTMADALQRELGRHAAHRKYLQDLIDGLPDGLR
FT                   VIRKSDFTVVSANRAFGEQLGLSATAGQPCYLSSHGRSSPCVPTMVRCPVAELHEHGQV
FT                   LKCHHRHRRASGEEFAVEVHAGLIDVDTEQGRERYIVESVRDLSRAASISQEHRMTELG
FT                   LLAAGIAHEIHNPLGSLRLGLEAMERRLRGRPERDDRIDDYLRTMDEEIDRCLQVTQRL
FT                   LMLSRPPQARVQPVDVNPVLADTSCLLAYDAENRQIEHILEADKAAPRVWADDADLRML
FT                   MINLVQNAHHAMPSGGQVTLRSHIIGDEVLIEVEDTGVGIPEDDVPHLFEPFFSRRADG
FT                   EPGTGLGLSICRSIVDHYGGRIAVESRPGEGARFRVSLPRVLE"
FT   gene            complement(408918..409619)
FT                   /locus_tag="Tmz1t_0360"
FT   CDS_pept        complement(408918..409619)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0360"
FT                   /product="Putative anaerobic dehydrogenase-like component"
FT                   /note="KEGG: vha:VIBHAR_01582 chaperone protein TorD"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53144"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK7"
FT                   /inference="protein motif:COG:COG3381"
FT                   /protein_id="ACK53144.1"
FT                   /translation="MSEHARWPGQEAAQALAADADMLSFLHASELDAAVLESLRAVGFP
FT                   ANLALLPGDAMAREAWRALSAALREIPVQPDAAALDELAAEFAAIYLTGAYRLSPCESY
FT                   WLDQDHLLYQGPMFELRQRYAEAGLRVKDWRKRPEDHMTHQLGFVARLLSAARSEENWK
FT                   QLASFLDQHLLRWIHDFARAVHARTGASFYAALAVLTATWCASLRACIDVPPMAHAQPA
FT                   EARSDAKDVQH"
FT   gene            complement(409612..410280)
FT                   /locus_tag="Tmz1t_0361"
FT   CDS_pept        complement(409612..410280)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0361"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: shl:Shal_0406 dimethylsulfoxide reductase
FT                   chain B"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53145"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK8"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK53145.1"
FT                   /translation="MSKKLDMDEVRSALERQAAQTYRPVKPAVQLGFVHNNVDCIGCRA
FT                   CEIACKDKNGLAPGPRFRRVMYVEGGHYPDVFAYKVNMSCNHCADPACLPTCPTGAIWK
FT                   RADNGVVDIDSTLCIGCRRCEAACPYGAPQWDPTEHIVKKCNMCIDELEAGRKPYCVMA
FT                   CMMRVLDIGPIDALRAGTYPTTAVGPGDRVTGQVKDMANPALTHPSIVFVPHRRGRVDE
FT                   "
FT   gene            complement(410291..412864)
FT                   /locus_tag="Tmz1t_0362"
FT   CDS_pept        complement(410291..412864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0362"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: dal:Dalk_4207
FT                   molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53146"
FT                   /db_xref="GOA:C4ZIK9"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIK9"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACK53146.1"
FT                   /translation="MNKDTLAAPINPARRDFLKTTAAGAAAAAASSFVELASTGKEASA
FT                   FAYEPYYTDDQLTTMVTSCAHNCGSRHMLVAHKKGDVIVRLSSDDGRYQAGGAFGFETE
FT                   AVPQLRACLRGRSYRARLYSAERLLYPMVRVGERGEGRFKRVSWDEALDRIAKKMIELK
FT                   DTYGPTAILDQSYAGASYGVLHKSDQIEGLLARFLGMFGCRTSSWSVPSYQGTTFSSRT
FT                   TFGTIEDGNEDDAFAHSKLIIMWGWNPAYTFHGGNTFHYMRLAKQRGCKFVVVDPQYTD
FT                   SASAYDAWWIPIRPNTDAAMLAAMAHYIFVNELQDQAFINRFCLGVDAGTMPDWARGHE
FT                   NFKDYILGTYDGQPKTPEWAAEICGVAADDIRKLADMYARTKPAALKASWSPGRNAYGE
FT                   QYNRMAAALQAMTGNIGILGGCAEGVGKGWHAEAVAYPYDEYANVWSASIKSDRWAHCV
FT                   LNYPDVRREEIGLWPRADQFDGVIPNIKAIWWHGSDWFNQLTNINKEIEAIRKLELVVC
FT                   ADSTITPSGLWADILLPVATHFERHDVALPWYKGHYYIHRPKVIAPLGESKSDFQIFTE
FT                   LAYRLEALDPARLSGFGKRYNPKADRSYFENDDPVDEAYLVDWWHRVQSHQGVTMSWEE
FT                   FKQRGVYKFEFAQPHVAFRDQIEKGVPFNTPSGRIEIFSTTLAQVSDWTKTQYGYPIPA
FT                   IPKWIEPFEWLGDTGKAAKHPFHLISPHPRWRTHSIFNNIPWLRETYQQEVTIAARDAE
FT                   RLGIRTGDVVEVWNERGKVVVPAYVTERCMPGVLVLHEGAWMDLDDKGVDRAGNPDFLT
FT                   DDQPSPAGAFAYNTVLADVKKTTLEHRPGWDSLATARSIVFRRDY"
FT   gene            complement(412882..413964)
FT                   /locus_tag="Tmz1t_0363"
FT   CDS_pept        complement(412882..413964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0363"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_3053 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53147"
FT                   /db_xref="GOA:C4ZIL0"
FT                   /db_xref="InterPro:IPR011031"
FT                   /db_xref="InterPro:IPR036280"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53147.1"
FT                   /translation="MRLPVLILLLAGINAAMADAPAYPVAGLQPDARPAGAPVIHQHTT
FT                   SEAAKTRLQRGIVLPAPATLAVMRDQEAWYTPFDQPGMLGYYDLRGWHAAAPKKTAAKK
FT                   PAKPGGSAERPGEHMRATYSPLHFKPAIETATDAQCLACHADVLEDKPLARSPAGVAAK
FT                   GSLAWYQQVSTYQGEQDSFHRRHLVTPLAKQLMDLKCTTCHQGHDPRDEAPGTSANTAA
FT                   QGSGDFTLRKAVNTEAICLKCHGQPTDYTIMGLPGPWHEVRIDMQNDCLACHVAFRTNR
FT                   HQVNYLKPAAIEAAAEAGREHMAGGDVCFGCHGGRPWYRIAYPFARNAWPGMADEVPEW
FT                   AKDRPTRSEARFLIDKPAAK"
FT   gene            complement(414038..414592)
FT                   /locus_tag="Tmz1t_0364"
FT   CDS_pept        complement(414038..414592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0364"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53148"
FT                   /db_xref="GOA:C4ZIL1"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53148.1"
FT                   /translation="MDYLHPRMRGKSKHSINVDMGIAMKKLIVVAASALTLAMAGSVFA
FT                   QQQGMGGMSGMGGMGGMSGMGGMGGMSGMGGMGGMSGMGGMAGMGGMGGMSGMGGMSGM
FT                   GGMGGMSGMAGMGGMSGMGGTTVIINIPAGMAGMGGMSGMSGMGGMSGMGGMSGMGGMS
FT                   GMGGMSGMGGMSGMAADAPKK"
FT   gene            414890..415198
FT                   /locus_tag="Tmz1t_0365"
FT   CDS_pept        414890..415198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0365"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo2035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53149"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL2"
FT                   /inference="similar to AA sequence:KEGG:azo2035"
FT                   /protein_id="ACK53149.1"
FT                   /translation="MTRATATNNKWRRRSRQEWETVFARFAASGLGIEPFCAREGLSES
FT                   SFRRWRSLLGEPSTQPAAPAMEATGFVDAGTLKLGGTGRLELRLDLGDGVILHLSRG"
FT   gene            415198..415557
FT                   /locus_tag="Tmz1t_0366"
FT   CDS_pept        415198..415557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0366"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: azo:azo2034
FT                   putative transposase helper protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53150"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL3"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ACK53150.1"
FT                   /translation="MFFPEGAVRVHVYGRPVDMRKSFDGLYALTRQALGCDPLSGELFV
FT                   FINRRGTQMKVLYWDRTGFCVWAKRLEQGRFVSNWAHVSTRQMDWTGLKFLLEGIEPVR
FT                   YKRRFRLPTNAVQPA"
FT   gene            415587..418662
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0367"
FT   gene            416874..418199
FT                   /locus_tag="Tmz1t_0368"
FT   CDS_pept        416874..418199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0368"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: maq:Maqu_4119 transposase,
FT                   IS204/IS1001/IS1096/IS1165 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53151"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="InterPro:IPR032877"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL4"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACK53151.1"
FT                   /translation="MSNQIEALFTTALGLQPPWHVAKVELNTGKRRIDFEVEHTGKRAA
FT                   CPACGMEHQLIHDRVRRSWRHLDFFQFEAWLHAEIPRVQCTGCGKTTQLPVPWAREGSG
FT                   FTLLFEALGLSLCRELPVRQAANQMRVAPKRLWRRVRHYVEVARARDDMSGVRYVGIDE
FT                   TSVKRGHEYITVVHDLEAKRLLFATPGRDHTTLQAFAQELRAHGGDPQGVEHACIDMSA
FT                   AYAKGIAQALPGAQISYDRFHVVALANAAMDEVRREEMRSSAAAVRDAAGTHSKKTLRQ
FT                   LLWGMRKNPVSWTRAQFEAMHWLQRSNLKSARAWRLKQALRLVYREAGASNSEEIAHGA
FT                   LTKWMSWARRSRLEPFKRLAATLKAHLAGVVRGMLDGRSNAYVEAMNGLLQQTKTAARG
FT                   FRKVENFIAIAYLRMSKLEHLPKNPLLPAIARDYGRYRHVCC"
FT   gene            complement(418748..418912)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0369"
FT   gene            complement(419038..420036)
FT                   /locus_tag="Tmz1t_0370"
FT   CDS_pept        complement(419038..420036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0370"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: eba:p2A227 putative
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53152"
FT                   /db_xref="GOA:C4ZIL5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL5"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACK53152.1"
FT                   /translation="MSATPSFPALLQRFFTDRLMQQRRASPHTIGSYRDTFRLLLRFAQ
FT                   MRLGRQPSQLAFEQIDAPLIAAFLDELQDKRGITARSRNLRLTAIRSFFRYAAFEAPTH
FT                   AEQIQRVLAIPSQRFTRTQVGFLTRPEVDALLAAPDRQTWSGRRDHALLLLAVQAGLRL
FT                   SELTAMRRDTVILGSGAHVLVMGKGRKERATPLTRQTAAVLNAWLKEIPANPDATIFPS
FT                   ARGTRLSADGVQYLLAKHVAVAARSCPSLAQKRVTPHVLRHTTAMELLQAGVDRAVIAL
FT                   WLGHESVETTQIYLDANLAIKEQALARTTPPDSTPGRFRPDDQLLAFLTEL"
FT   gene            complement(420033..420965)
FT                   /locus_tag="Tmz1t_0371"
FT   CDS_pept        complement(420033..420965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0371"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: eba:p2A228
FT                   putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53153"
FT                   /db_xref="GOA:C4ZIL6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL6"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACK53153.1"
FT                   /translation="MTPLGQAIQDYLALRRRLGFKLRDAGLCLVKFAAFMEARDAPHIT
FT                   TALALEWIRQSPSVTPATWAQRLGYVRGFARHHAASDPQTEVPPAGLLPFRPRRARPYL
FT                   YSDEDIAQLLRSALDLPPAGGLRPWTYHTLLGLLSVAGLRVGEAIRLMDADVDLQEGLL
FT                   TIRGTKFGKSRLVPIHSSTLEVLQQYRAHREPFLAGHAASAFFITGRGHHLDIGDVHRT
FT                   FYRLSRQVGLRGATASHGPRLHDFRHRFAVQTLLRWYRSGEDVERRLPVLSTYLGHAHV
FT                   ADTYWYLSACPELMGLAVGRLERRWGELP"
FT   gene            complement(420962..422197)
FT                   /locus_tag="Tmz1t_0372"
FT   CDS_pept        complement(420962..422197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0372"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: sus:Acid_7643 phage
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53154"
FT                   /db_xref="GOA:C4ZIL7"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL7"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACK53154.1"
FT                   /translation="MEQLYKDARTLERMRAGLLGAYVDAFARQLIDQGYARPSIRYSLQ
FT                   LVADFGRWLMQRRILVSRVTPESLSGYLRDRTRRGHFRPGDASILRRLRNLLAEQGIVV
FT                   EDPPIAPTAVEQLETEFRYYLERERRLAPATVFHYLEFARRFLAQMVPKGEASLAHVQA
FT                   ADVVDFVQREAARLHHAKRAKLMTTAVRSFLQYARYRGLIEADLKPSVPAVANWSMASL
FT                   PRALSAVELQRLLASCERGTAVGRRNWAILLLLARLGLRAGEVTALTLDDIDWAAAELC
FT                   IQGAGVSANRLPLPHEVGAALADYLRDGRPACTSRRVFVRMRAPTRGFKSSSAVSTVVR
FT                   RALARAGLDPAHHGAHLLRHTVATQMLRQGASLAEIGELLRHRSPQTTMIYAKVDLDLL
FT                   RPLALPWPGGVS"
FT   gene            complement(422284..423063)
FT                   /locus_tag="Tmz1t_0373"
FT   CDS_pept        complement(422284..423063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0373"
FT                   /product="integrase domain protein SAM domain protein"
FT                   /note="PFAM: integrase domain protein SAM domain protein;
FT                   integrase family protein; KEGG: bvi:Bcep1808_7209 phage
FT                   integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53155"
FT                   /db_xref="GOA:C4ZIL8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL8"
FT                   /inference="protein motif:PFAM:PF02899"
FT                   /protein_id="ACK53155.1"
FT                   /translation="MDTPTRPVSPLRQRMLDDMRMRKLTPKTQSAYIRAVCRFTRYLGR
FT                   APDTATVEDLRNYQLHLVDSGTSPMSLNAAISGLKFFFDITLQRGELMARMQPVRLPQR
FT                   LPVVLSREEVARLIAACNNLKHQTALSLAYATGLRASEVVSLKVSDVDSGRMTLRVEQG
FT                   KGRKDRYAMLSPLLLERLRVWWRVARAQGKMLDGGWLFPGLNPIESLSPRQLNRAVQAA
FT                   ALAAGIDKGVSMHTLRHYSVCRTTPRRVSWGLESRQP"
FT   gene            complement(423323..424279)
FT                   /locus_tag="Tmz1t_0374"
FT   CDS_pept        complement(423323..424279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0374"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dar:Daro_1375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53156"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53156.1"
FT                   /translation="MSVEPDLRSCQLKPGEYAVINFITVDAATNPIPLKSLIEHLRKCG
FT                   SALRQINPRCPSTLVAEFPAGITVRAVIPAAANGGLFGPQDPQSSPAEPASAAIDLRSN
FT                   NASTTPTAQTLEATALRNAEYLATEARTISIKAVDVGNDLASRAEIHAMDAEDLPELLA
FT                   NSPDQAISRATYTLARGAEMKLDYITATRTIGGNRQTPANHHSRETFALRGCRLVSTNT
FT                   AFTFTMRGHRDDPEWHRLIQMFPDCMEVRLEEESPELPFVTESVLREIPIDLDICVAER
FT                   VGTGKHTAIPLRVCNRDAVIDSLASRLQLLTELAANE"
FT   gene            complement(424276..429099)
FT                   /locus_tag="Tmz1t_0375"
FT   CDS_pept        complement(424276..429099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1376 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53157"
FT                   /db_xref="GOA:C4ZIM0"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM0"
FT                   /inference="similar to AA sequence:KEGG:Daro_1376"
FT                   /protein_id="ACK53157.1"
FT                   /translation="MDDTNPCTLMPSPEGEDYLRPAEPQSTASHPEAETQSDELRHARQ
FT                   LLIRTFAVPISGIGLAALAHELRADLDALDRGIVSTELPDALRKLLDTLCQDRADAVRD
FT                   LAYLRSLPACPLRDLLTQPSLTLPPPERRCLRSVRALLALHLLSESNGLGRTLAAELSR
FT                   WMRGKGLRFAQPLELSADELRLRRDSLPPGTPQAALMAVLVEALSRKFSNPFVTRRAVQ
FT                   VISHSSGEERREAHEAASEVGSDQQARSVADPLRGRKATIGKAGCRVLSGTPALYEYAQ
FT                   PFELEAIVPKILDRWRTGQEDEALGALLTLHLGVMPSSFCQVPLTSESGAGIRINLAAG
FT                   CLEWNLDEVIGRHTPDNSFTRSSSDRYVQVPLPSETVAELRRRQQSTGGKTLADLFDSE
FT                   KGHLGKKTKLMLRELSLTSHRPALKRLSFSWGRYVLSRTGDETYAAAMGVDFTLGTTAN
FT                   LNYCLLRAARIRSIASECYRRVGLSGNCGGQPLPDVGSLRLIPDATARAFIRDSLSIVR
FT                   TAMTGVPRRCAIEVVHEAHNLVATHFYAALKFILAGRSLQEETLTRRCIDVETGLFVVT
FT                   DKRTARYHEHRLGCLPPTLREWLRAYLAWLSSVAYRMASIDPHLARAIRSVAEGDTKVE
FT                   AHPLFFCFSANGTTAPLGAHDISPILGRHQMASNAGRHFLDVLFRDAGLDSAAVMGWMG
FT                   RAMPGQEIIGAASSVAPLEFLLRCATVIEDWLSELALPPAPAMSSRKLHDARHHTHPEY
FT                   RPVLLDDCPASLKDAKGAEPCPIGRDTIHLAAQFPDLLRFWRTDSPPGGWAGIALSLIF
FT                   EDAIVLDEEVIAVLQELRQGILYRHREIHFVDARPAPLGIRRVWLSPITVRLIYQTPAL
FT                   GGSLVTLDTISEAFRLFLTMSGADSAGGSPVSYVTACARAYFALRTPGILRAWMDGSKF
FT                   SRTVRPHCVARQYLGLCEPPAPRVSRNSRTVRRPDAFRKHVRDICDDVPASKSHRRAID
FT                   ELREWLDETGSADDPSSEHELSVGYCRSLLDRHDNVHTILRYLTAAAPFLHALSRVIAS
FT                   GGLEGVDWLELINEAPEDKDAHDGHDSAPTRAAINQALDWLGIDYRLGRRVGPPPAALR
FT                   YTDLLTDRETRLAISMLAARRRTPGDEWHRAEAALRLMSDVALRWDEIINLRLTDVWIG
FT                   SSPAPHIVVTNESRAALKTRNARRVLPLNGMETIREVRALYDLRSSRFGGDKMIPLLGA
FT                   DLEDRATDSGDRIHDLVTEALRRASGAWGIHPHCTRGTVITSEIDAVLSPSRHERRPID
FT                   LRQALYSISARAGHGHPDVTVGEYFAGMDHQRRDWATEILRAADCPPRPAFLEALTGIA
FT                   AATYRKRLSRGLNDDWFDVLEGLQSDAIPTVGAKVCELGSLVQAGLEEIPWTDADLQEE
FT                   RLTATAIYLGLRMLKEEIHSARLTARLTRQETESAEQMLSELQRARLTRLAGRRDLSRQ
FT                   RFITEMAKARLPAAIAACNLDADLLREVVLAAHTAGDPLTFARPEHALRMSPLLGPIRS
FT                   ADIQTVCLVRSSGQSAVDTCWLDRFRNAGFGSVQCRPPRDFPRGSQCKVLFCPKSSDSA
FT                   GHRRASPRHAFLVTISILAVHFRKELKQ"
FT   gene            430011..431291
FT                   /locus_tag="Tmz1t_0376"
FT   CDS_pept        430011..431291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0376"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; Resolvase
FT                   helix-turn-helix domain protein; KEGG: smd:Smed_5624
FT                   integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53158"
FT                   /db_xref="GOA:C4ZIM1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACK53158.1"
FT                   /translation="METKHIEVNPVRRLVCGVQEMLEPEAVTTIVRLGQSGWGAKRIAK
FT                   ALGIARNTVRRYLNAGGPVAYRQPQRASVLGGHDAWLRERFLQHRGNCDVVRQQLSKEL
FT                   GIETSLRTVERACRGFRQELEASRRATIRFETGPGEQMQIDFGQTRVLIGGESVRVFLF
FT                   VATLGYSRRGFACAFRHERQSAWFAGIEAAFVHFGGRPQTLLIDNAKALVDKHDTQTRQ
FT                   VRLNSRFEAFCRHWDIRAKACAPFRARTKGKTENGVGYVKKNAIAGHAFESWTAMEAHL
FT                   ARWQREVADVRIHGTTGVTPAERFDLEREHLRPVAGIAPFLQVRELVRRVNAEGCIELD
FT                   TNAYSVPWRLIGETVTVVVSADTVVVEYAGEEVARHAELAGSRGRSIERSHLLGGSLPP
FT                   AQIEAPPPTDALLRPLAEYEALVGGGW"
FT   gene            431291..432079
FT                   /locus_tag="Tmz1t_0377"
FT   CDS_pept        431291..432079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0377"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein;
FT                   SMART: AAA ATPase; KEGG: gdi:GDI0976 putative insertion
FT                   sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53159"
FT                   /db_xref="GOA:C4ZIM2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028350"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM2"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACK53159.1"
FT                   /translation="MIDADRLDELLTRLRLTAIRDQLDSLLDEASRAQMTLREALLFLA
FT                   EREVARRDTRRIQMGMKLARFPCVRTLEGFDFDAQPSIDPGQIRDLSSGRWIGHGQALL
FT                   LLGPPGVGKTHLAVALGREAVDRGYTVLFTSAAALMAGLTKAHADGRLEEKLLQLSKPK
FT                   LLIIDELGYLPLEPAAAHLFFQLVSRRYERASMLITSNRPVGEWGQVFGDAVAATAILD
FT                   RLLHHSQVITIRGDSYRLRDKRRSGLLQKAAAPTPITSES"
FT   gene            432401..433381
FT                   /locus_tag="Tmz1t_0378"
FT   CDS_pept        432401..433381
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0378"
FT                   /product="phosphate binding protein"
FT                   /note="TIGRFAM: phosphate binding protein; KEGG:
FT                   eba:ebA4826 phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53160"
FT                   /db_xref="GOA:C4ZIM3"
FT                   /db_xref="InterPro:IPR011862"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM3"
FT                   /inference="protein motif:TFAM:TIGR02136"
FT                   /protein_id="ACK53160.1"
FT                   /translation="MKRTVLASAFLALAATSVQAESLVKVDGSSTVYPVTEAVAEDFQK
FT                   SVKGEIKVTVGISGTGGGFKKFCRGEIDVANASRPILKKEMEDCAKEGITYYELPVAFD
FT                   ALTVVVNPNSKITQLSVAQLKKMWEPDAQGKVSNWNQVDPSFPDAPLNLFGAGSDSGTF
FT                   DYFTEAINGKSKASRGDYTASEDDNVLVQGVSRDVNAIGYFGYAYYAENQGKLKAVAIV
FT                   NAKGDAVLPSEKSVIDGSYNPLARPIFIYVSAKALERAEVRQFVDFYMKNAPALTSEVK
FT                   YVPLPAKAYEANMEHMKSKKLGTVFGGHADVGVTIEELISREAKL"
FT   gene            433482..434408
FT                   /locus_tag="Tmz1t_0379"
FT   CDS_pept        433482..434408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0379"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eba:ebA4828
FT                   phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53161"
FT                   /db_xref="GOA:C4ZIM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM4"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACK53161.1"
FT                   /translation="MSSMHTTTVSERLSRKLSRNVRERAIELVLFLAASVSVLTTIGII
FT                   WILIFESYHFFEHVPVWDFLTDTMWTPLFSTPRYGILPLLLGTVTTSLVALAVAVPLGT
FT                   VIAIYISEFASPRVREIVKPFLELLGGVPTIVYGYFALTVVSPVLQYFFPSLPGFSMLA
FT                   AGLVMGIAIVPYISSLSEDAMRAVPMSLREGAYAMGSTRFQTAVRVVLPAAISGVLSAY
FT                   ILGISRAVGETMIVAVAAGMQPNFTMDPTQPAQTISAYIVQVAMGDLPHGSIGYQSIFA
FT                   AGLSLMLLTLFFNIMGHLIRRRYREAY"
FT   gene            434425..435348
FT                   /locus_tag="Tmz1t_0380"
FT   CDS_pept        434425..435348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0380"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: eba:ebA4829
FT                   phosphate ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53162"
FT                   /db_xref="GOA:C4ZIM5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM5"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACK53162.1"
FT                   /translation="MNNQDIASIRGIIRGNRRWDLIFAVAGFLALTVGVLAFVTLFGQM
FT                   VINGWERLNPDFFTSFPSRRAANAGILSAWVGSLLVMLVTALSAVPLGVAAGVYLEEYA
FT                   PKNLVTDIIEINVTNLAGVPSIVYGLLALGVFVYMFGFGQSVLTAGLTLGLLILPVIIV
FT                   ATREALRAIPVHVREGAYGCGATQWQVVSDHLVPYATPGIMTGVIIGLSRAIGETAPII
FT                   TIGALTFIAFLPASPISSTAPFINFDWLWSGFTVMPIQMFNWTSRPEEAFQQNAAAAGL
FT                   ILVLMTLLMNALAIWLRYRLRKSIAW"
FT   gene            435391..436173
FT                   /locus_tag="Tmz1t_0381"
FT   CDS_pept        435391..436173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0381"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: eba:ebA4830 phosphate ABC transporter,
FT                   ATP-binding protein; TIGRFAM: phosphate ABC transporter,
FT                   ATPase subunit; PFAM: ABC transporter related; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53163"
FT                   /db_xref="GOA:C4ZIM6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM6"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACK53163.1"
FT                   /translation="MAKTELKTELKAETRDFNFYYGDFHALKKVNLPVLDKRVTALIGP
FT                   SGCGKSTLLRSFNRMHDLYPGNRYEGAIVFHPDNTNIVDPKVDPIEVRMRIGMVFQKPN
FT                   PFPKSIFENVAYGLKVRGERSRSVIEGRVESALRGASLWNEVKDRLQQPATALSGGQQQ
FT                   RLCIARCLATDPELLLFDEPTSALDPIATANIEELITELREKVTILIVTHNMQQAARIS
FT                   DFTAYMYVGELVEYGVTGDIFTKPVKKETEDYITGRFG"
FT   gene            complement(436222..437577)
FT                   /locus_tag="Tmz1t_0382"
FT   CDS_pept        complement(436222..437577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0382"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; response regulator
FT                   receiver; ATPase associated with various cellular
FT                   activities AAA_5; SMART: response regulator receiver; AAA
FT                   ATPase; KEGG: eba:ebA6441 acetoacetate metabolism
FT                   regulatory protein AtoC"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53164"
FT                   /db_xref="GOA:C4ZIM7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM7"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACK53164.1"
FT                   /translation="MATPDSTPQPRICLIEDDEIIGESLSDRFRLEGFDVDWCRTGAEA
FT                   RDALATRRHAVVVSDIRLPDCNGGDLFIELLAEAPALPPFLFMTAFGAIERAVALIKAG
FT                   AADYITKPFDPDALVAKVCALAERYGVARTASGRDERLGVSPAMGRIAENMPRLARHTE
FT                   SLLITGESGVGKEHVARLFHYHAAGGEAPFVAVNCAAIPESLIESELFGYEKGAFTGAA
FT                   KARRGYFEQAQGGTLFLDEIGDMPLSMQAKLLRVLQEHRLQRLGGETTIAVDFRLVCAT
FT                   HCDLKAMVEEGRFREDLYYRINVIHLRIPPLRERKEDIVWFMQHFVEAFNRAHPEEARR
FT                   IDPRTQEALARYPWSGNVRELKHAVERACILSPGPVLGADAFFGEDQDVGAEAPTSRPL
FT                   ADYLMDCERDYLRMVLEQHGGHMTHSAEALGITRKTLWEKMRRLGLQARDDA"
FT   gene            complement(437564..439012)
FT                   /locus_tag="Tmz1t_0383"
FT   CDS_pept        complement(437564..439012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0383"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; histidine kinase HAMP
FT                   region domain protein; SMART: ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein;
FT                   histidine kinase HAMP region domain protein; KEGG:
FT                   eba:ebA6439 sensor histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53165"
FT                   /db_xref="GOA:C4ZIM8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM8"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK53165.1"
FT                   /translation="MNRLADLSLRWKIPLRVVGAVLGTAIAVTVALVARDYEIVRQNLE
FT                   GHARSMGRVLAHTLVMPVLHDDIWRAYEILQSAHEPNPAAPELQAQVVLVTDADYRVFV
FT                   STRPRTFPIGSSAATPGGAYGLLRAELSHGAPEDQRLLEPADSPLFFVMTPLISDGVAL
FT                   GHVILAYAKPALLPRVAGLVGRAGGVTVLVLILLLPVSWAWAQRTARPLLRLAEAMKQL
FT                   PLEVEAARLADLPESRDEIGQLGAAFRRMVAEMRVKQEMERQMLSSERLAAIGRLTAGI
FT                   AHEINNPLTGMLTALNTLQRHGGDAERTERTLSLLQRGLSQIRNTVCALLVEAKIADRD
FT                   FAPEDVDDLLILVEAEAHARAVRVVVDGRIAAPVPLPATLLRQIVLNLLLNAVTAAEAG
FT                   GMVRLDVRTAGRALAVAVFNDGAHIGQDEMPYLFEPFSSGRESGHGLGLWIVYQITRQL
FT                   GGEIHVESAPGSTTFSIEIPYGNS"
FT   gene            complement(439009..439911)
FT                   /locus_tag="Tmz1t_0384"
FT   CDS_pept        complement(439009..439911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0384"
FT                   /product="phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein"
FT                   /note="TIGRFAM: phosphonate ABC transporter, periplasmic
FT                   phosphonate-binding protein; KEGG: eba:ebA6438 periplasmic
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53166"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIM9"
FT                   /inference="protein motif:TFAM:TIGR01098"
FT                   /protein_id="ACK53166.1"
FT                   /translation="MNRDASARSPAPQSDLEHAPRRGFLRAVGAAVLLQGLPARAEAMP
FT                   IRIGLTPVFLDDQMRFVGQWRQWLERKLGRAVVFVQRGSYREIVDLVRAHKLDFAWVCG
FT                   YPFVRYQNEMTLVAVPLWRGQPSYQSYIIVPADDTRSTALSELRGKVFAYSDPDSNSGY
FT                   LYPRYVLTTQGEAPDNFFARSFFTWAHRKVVEAVGVALADGGAVDGYVWETLAESHPDL
FT                   TRATRIIDRSPPLGYPPFVARADIPADELNRFRTVLLEMADDPGGLELLRRLRLDGFTV
FT                   GAPTLYDEIADMAARVSHP"
FT   gene            440242..440952
FT                   /locus_tag="Tmz1t_0385"
FT   CDS_pept        440242..440952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0385"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: eba:ebA6435 molybdenum enzyme related to
FT                   thiosulfate reductase and polysulfide reductase, medium
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53167"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN0"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK53167.1"
FT                   /translation="MSEELRVSPIETREAPGKRRFAMVVDTRRCIGCMACQVACKAEYD
FT                   TPLGVNRTWVPYKVVGKYPNVRKQFLPRLCNHCDDPPCVRNCPVEATFKVEDGGFVLQR
FT                   YERCIGCRSCMAACPYNARFMLPSHRSYTPITNVVDKCTFCFHRVTQNLVPACVQTCIG
FT                   RSRVFGDLNDPNSEVSYLVATHATQVLRPEEGTKPHVFYIGADRNQTEFGRDAYRKPEV
FT                   MELDRSAFKRHFDI"
FT   gene            440963..441820
FT                   /locus_tag="Tmz1t_0386"
FT   CDS_pept        440963..441820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0386"
FT                   /product="Polysulphide reductase NrfD"
FT                   /note="PFAM: Polysulphide reductase NrfD; KEGG:
FT                   dar:Daro_2604 polysulphide reductase, NrfD"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53168"
FT                   /db_xref="GOA:C4ZIN1"
FT                   /db_xref="InterPro:IPR005614"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN1"
FT                   /inference="protein motif:PFAM:PF03916"
FT                   /protein_id="ACK53168.1"
FT                   /translation="MGDYVWFHDVSWHATYAIYFFVIGICAGLAFLSYGSWVTPELRPL
FT                   RVKAAVVSFVLLALGGLLLIGDLSQPMRFLAILNPAYLNFSSPLAWGALNIVAFGIASV
FT                   LYLLALKKGDEGRGKLLAAITALLALGLPIYTGYDLTVHQSRPVWNTPVIPVLFVAMAI
FT                   ASGSAVGALLAAGNEGAQRVLRQYLMWSCGAVGVMLISILGTTSYGGSAQELTFLILTT
FT                   GTMGLIFVGMGIVAGTAAPIALLLAPFGRQQVGIALAALLVLLGGAALRYALLMGPQQL
FT                   QTLY"
FT   gene            441845..444484
FT                   /locus_tag="Tmz1t_0387"
FT   CDS_pept        441845..444484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0387"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molybdopterin
FT                   oxidoreductase Fe4S4 region; molydopterin
FT                   dinucleotide-binding region; KEGG: eba:ebA6426 molybdenum
FT                   enzyme related to thiosulfate reductase and polysulfide
FT                   reductase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53169"
FT                   /db_xref="GOA:C4ZIN2"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR037946"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN2"
FT                   /inference="protein motif:PFAM:PF00384"
FT                   /protein_id="ACK53169.1"
FT                   /translation="MDFPKITRRTFLQASAGTTAAAALAPRMLHAMENELGGKDFSPVT
FT                   AAERKAIPVNCHVCNIQDGAIAYVENDRVVKLEGNPEHVSTRGRLCAKGNSGMWYSYDP
FT                   DRILYPLKRVGARGEGKWKRITWEEALTEVAAKLDAALKEDPNTIMLKYGRNRTGGTID
FT                   RFMKTLGSATVLNHTSVCESSKKVGQEPTWGPDIETPDFANAKYVLNFGSNILEAAYFH
FT                   NPLSQRIAEGRVDNHMKIVTFDVRLSNTAGFSDEWIPVFPATDGAVALAIGHVILREDL
FT                   QDSAFIDTWTNVTVDELKAHYAQYTPEWASKISGVPVQTIERIAREFATTKPATLFTYR
FT                   GPAKHLYGSYNEKACMMLPIMTGNVEKRGGYCLPRGMGWPQPNPQPPGPKHDSVLAHPP
FT                   EYPLASHKVSHLVPFWIAEGRQKINVAFTYQDNPVYTNPGAQAVWGKLYRDEKLIPYFI
FT                   SMSSHMGEETALADIILPDCPYLERWEPESMPNSLWPWLGIRQPVHKSLGESRENRVLL
FT                   RDIIWKLDPDGSRGMKQFWAFKDGEDYMRHHFDNVPGLKEAGGLDFLKKHGVWPIYGTL
FT                   DPKTGKVTDKTGREIQAEYGLYRKELSAADMEGAMVDAHGLITKNGKAIGIRRNGRNYV
FT                   GFPTPNRVINVRVDEWAEYGFNPMPTFKRIPWHETMKDDEMILSTFKLNVHKQSRTAAV
FT                   KWLAEIAHSNPAWMNPETAKKLGVKTGDLVRVESPVGYLVTKAYVTEGIHPQVISIATG
FT                   FGHWEYGRLATLKLKDRKGDASHGEEDPDLNNVWWDDKGVHPNAIIPAVADPIGGSQGW
FT                   YDTVVKVTKAGPNDKYGDIHGDWDKHYAAYKETMRYAYTGDLHRKMHPEMAAWAGPESV
FT                   KPKASGGH"
FT   gene            444579..445421
FT                   /locus_tag="Tmz1t_0388"
FT   CDS_pept        444579..445421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0388"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6425 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53170"
FT                   /db_xref="InterPro:IPR020945"
FT                   /db_xref="InterPro:IPR036411"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN3"
FT                   /inference="similar to AA sequence:KEGG:ebA6425"
FT                   /protein_id="ACK53170.1"
FT                   /translation="MLKTLLAIDDEHAVVVDERAPPPRPIAERRAEYDARASLCRLLAG
FT                   VFVEEADADFVRALRCPEVLASLAAAGVCFEADFLDAEEGALVERLACEYTTLFAASGG
FT                   FPPVESVRLTGRYKQDPHFQVAQDYAKWGFVVGKGRFELFPDQLGVELMFVAELLERCS
FT                   GALAAGDEALARRIERDLKRFWTQHHARWVRGYARLVEQVAEHSFYRGMAAFLQGFAGE
FT                   EIAAMGLRIDDEDHARAVVPKSEIRVEFNPDEPVCNGCESIPDTQQRAANVHTLHDLR"
FT   gene            445441..445893
FT                   /locus_tag="Tmz1t_0389"
FT   CDS_pept        445441..445893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0389"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6423 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53171"
FT                   /db_xref="InterPro:IPR023203"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN4"
FT                   /inference="similar to AA sequence:KEGG:ebA6423"
FT                   /protein_id="ACK53171.1"
FT                   /translation="MLLDLQARPILPPDRQVLSEIDWSEVATLWNSNELGVLHDLLNER
FT                   WSRLIRNSVLGTRDPEAEFLQGLAFATLALFFTQNRNQEGALLMVDDALIALGKYRPRF
FT                   MGVQIDPIIGTLQTLRPLIASLPADGENPMFPFVYAKFEHDGALPT"
FT   gene            445890..446594
FT                   /locus_tag="Tmz1t_0390"
FT   CDS_pept        445890..446594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6422 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53172"
FT                   /db_xref="GOA:C4ZIN5"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN5"
FT                   /inference="similar to AA sequence:KEGG:ebA6422"
FT                   /protein_id="ACK53172.1"
FT                   /translation="MIRCACLADTADTADRAKVSAEVELLFRFDEPGCAPLVEDGGIAI
FT                   LRQGDETRAAALLEAGAPQVLLGEAVLSDADLPLRLAARFGLDRVGLFVPARRMAVSWS
FT                   FDTVSNADFRVVTPSLCEPGWEIVRADGSATGIRVDWWLGEMKKRGIATVLVQVDVLDD
FT                   TDLNLCAGLVEALGEGFWIAPGGQFEPALADWVRYGKVTRIALPTALFERRAVLLGDLL
FT                   VPVEPMTDMEEA"
FT   gene            446591..447061
FT                   /locus_tag="Tmz1t_0391"
FT   CDS_pept        446591..447061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0391"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53173"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN6"
FT                   /inference="similar to AA sequence:KEGG:ebA6420"
FT                   /protein_id="ACK53173.1"
FT                   /translation="MITRFRRYVGGVLAVFLLTASVQAHAAASLRNEMQLGLALRVSPP
FT                   CCVVDARTAAAREASPLDEALVYREDLRINPTATVVVVADTDEAALAVADSIAAAHPGS
FT                   PVLAVEGGVLAWQRVLTRINAEPPGGRAFQFVIPKNTCEHGPALQQLRTAPR"
FT   gene            447058..448173
FT                   /locus_tag="Tmz1t_0392"
FT   CDS_pept        447058..448173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0392"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: eba:ebA6418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53174"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK53174.1"
FT                   /translation="MSLAYPELRASRCTRYRFRYSACSRCADACPHDALALTDEGGRID
FT                   PARCQNCALCVTACPTDALASEALKPVDMLRQAIRHEHFTIACAPSGASGDAVVPCLGA
FT                   VDAASLAYLAKRRIPVTLRGAAHCEHCAHGPRGAAQLASNLDACGLLEDAAASIEKPAD
FT                   WIAPQLDEADFANADSRGSAPFAAVRRQWFRRLVGRGVAEVAQSLEPPASAPSTPDKAI
FT                   RPGPYALPERRELLQIVCKRKDDQPFRVPLHDALPMMALSLQPGCNNCEACFRVCPTGA
FT                   IQIEESPADYQLKFDADRCVACAVCLEVCQPHVLDADASFDARPEQTPRVLLSMAKQRC
FT                   TRCDRHFVSHTPQQSCPICRDDEDAFTAIFG"
FT   gene            448210..448602
FT                   /locus_tag="Tmz1t_0393"
FT   CDS_pept        448210..448602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA6416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53175"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN8"
FT                   /inference="similar to AA sequence:KEGG:ebA6416"
FT                   /protein_id="ACK53175.1"
FT                   /translation="MEWEFTPEDVVKAHAAYPLEDFRRDLAEEVRINLGESDPLQQVRC
FT                   FNLLYDMCHALATGRALEDFLQPYAYDPPTCEFLREVRPLMAANVDMLGAILQRMIMEG
FT                   VEEGMPLEQALGEAASRHERIVATGA"
FT   gene            complement(448616..448921)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0394"
FT   gene            complement(448961..449656)
FT                   /locus_tag="Tmz1t_0395"
FT   CDS_pept        complement(448961..449656)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0395"
FT                   /product="Carboxylesterase"
FT                   /EC_number="3.1.1.1"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   dar:Daro_3258 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53176"
FT                   /db_xref="GOA:C4ZIN9"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIN9"
FT                   /inference="protein motif:PRIAM:3.1.1.1"
FT                   /protein_id="ACK53176.1"
FT                   /translation="MSLHSSPGLVFDTPPIELETGPDPRYSVIWMHGLGADGSDFEPVV
FT                   PALALPRSPAVRFLFPHAPYRAVTCNAGYVMRAWYDIVSLAPHSRQIDEAGLLESRTLV
FT                   RQLIQREAERGVPGERVILAGFSQGGAVAYLTGLTHPTPLAGIIALSTYIPSPGLLVDG
FT                   FVEANRQVPVFAAHGTHDDVVSPALGEHAVEVLRQLGIEPEWHRYPLPHSVSLEEIADI
FT                   GRWLRTLVH"
FT   gene            449728..450000
FT                   /locus_tag="Tmz1t_0396"
FT   CDS_pept        449728..450000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0396"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bpy:Bphyt_1761 putative cytoplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53177"
FT                   /db_xref="InterPro:IPR024530"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP0"
FT                   /inference="protein motif:COG:COG3530"
FT                   /protein_id="ACK53177.1"
FT                   /translation="MGTEKRIERMNPEHLVLLLEREMPFGKYKGRVIADLPGYYLAWFA
FT                   RKGFPPGQLGQLLALMHELDHNDLAGLLEPLRRARRQAAAGPGGV"
FT   gene            450118..451242
FT                   /locus_tag="Tmz1t_0397"
FT   CDS_pept        450118..451242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0397"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: rfr:Rfer_3043
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53178"
FT                   /db_xref="GOA:C4ZIP1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR014577"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP1"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACK53178.1"
FT                   /translation="MPRFLHTADWQIGRQYARFAPEDALALAEARFSAVERLAGIARQE
FT                   AVDAVLVAGDVFDAQTVSDRTIRRLFNAMGAYAGPWVLIPGNHDAALAESVWSRARRLG
FT                   AVAPNVHLALGAQVMAFPERGFVVLPAPLTQRQTPADETAWFDHAETAPGLVRVGLAHG
FT                   SVQGVLAEDIDSPNPIAADRATRAALDYLALGDWHGTRRIDARTWYSGTPEQDRFKAND
FT                   PGNVLLVDIPAVGAEPEVEVRAVGRHPWIALEEKLAVASDLEGTIARLEALPELAVVDL
FT                   SLSGEIHLLGRQRLEAALSVAEARFRSLRADLSGLRLQPTEDDLAALHADGYVGRVIAE
FT                   LREEQDGENAEVASEALAILAALLLEAQAQGAAA"
FT   gene            451239..453875
FT                   /locus_tag="Tmz1t_0398"
FT   CDS_pept        451239..453875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0398"
FT                   /product="putative GTP-binding protein"
FT                   /note="KEGG: rfr:Rfer_3042 putative GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53179"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP2"
FT                   /inference="similar to AA sequence:KEGG:Rfer_3042"
FT                   /protein_id="ACK53179.1"
FT                   /translation="MRLLRLKVEQLRRFRQPVEIRDLDPGINLFTGPNESGKSTLVRAI
FT                   RAAFFERYKSSSVEDLQPWGDSAAAPTVELEFESQGKRWKLVKSFLKRKRCDVSVDGVG
FT                   FSGEEAEDKLADLLGFEFPGRGASRPEHWGIPGLLWIEQGAGQEIHKPVEHAGSHLKSV
FT                   LGASLGEVTSTAGDELIARITRERARLLTATGRPTGDFAAALEAHERLAREHADLQGRI
FT                   RQYRQQVDRLGQLREEQARDESERIWEVYRQQARAADLRLAEVVSWQREQERDQQALQA
FT                   CQAGMRTSLDLLGRFEAQRKDLHRRAADRQAAEQALAAQDARRPAVERVLGDARKAFEA
FT                   ARATVRLAREHQQRKDLVRELAQVDGELAGLDQALARARELHERWLRQRALRQSLQVDA
FT                   KALKRLRKVEEELARLAIRQEAVATRLQFDLREVGALTLGGEPLSGRGERLLLEPTEIL
FT                   VAQLGSLRILPGGDDIADLVRARQGLADERASLLSALGADSLAAADARHEQCRELDESI
FT                   KRDASVLESLAPEGLEALAGRKQLTQARREDLGKRIGALPEPQEDSLSVSRAEAQLDAA
FT                   EVSLKAAEADEAGFRSALLLATQALESARAEWSRLDGELQGADRKAREKQAEDQLLELR
FT                   AGENRLDQALRERQKQIDQANPGVLRQDVERFTRSADAAEKAAEQRRLELERLRASLEA
FT                   LGAEGLEERSAELDVELARAARRSDELTRRARALDLLLVRLTDHRLQLTRQLQAPLQRH
FT                   LNRYLQLLFPEASLSVDEALVPEILVRQGHGGEERGRFAELSFGAREQMGLISRLAYAD
FT                   LLREAGRPTLVILDDALVHSDVERLGNMKRVLFDAADRHQILLFSCHPDSWRDLGVVPR
FT                   DVAALGG"
FT   gene            453887..454094
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0399"
FT   gene            454429..455955
FT                   /locus_tag="Tmz1t_R0002"
FT   rRNA            454429..455955
FT                   /locus_tag="Tmz1t_R0002"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            456032..456108
FT                   /locus_tag="Tmz1t_R0003"
FT                   /note="tRNA-Ile1"
FT   tRNA            456032..456108
FT                   /locus_tag="Tmz1t_R0003"
FT                   /product="tRNA-Ile"
FT   gene            456131..456206
FT                   /locus_tag="Tmz1t_R0004"
FT                   /note="tRNA-Ala1"
FT   tRNA            456131..456206
FT                   /locus_tag="Tmz1t_R0004"
FT                   /product="tRNA-Ala"
FT   gene            456498..459382
FT                   /locus_tag="Tmz1t_R0005"
FT   rRNA            456498..459382
FT                   /locus_tag="Tmz1t_R0005"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            459502..459614
FT                   /locus_tag="Tmz1t_R0006"
FT   rRNA            459502..459614
FT                   /locus_tag="Tmz1t_R0006"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(459773..460849)
FT                   /locus_tag="Tmz1t_0400"
FT   CDS_pept        complement(459773..460849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0400"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; SMART: helix-turn-helix- domain containing
FT                   protein AraC type; KEGG: dar:Daro_2361 AraC family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53180"
FT                   /db_xref="GOA:C4ZIP3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP3"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACK53180.1"
FT                   /translation="MTEPANRLTFSATNLLHMNERQHAPAVTVSIRMVCQILDRLGEHR
FT                   PLALECVERAGIASALLEHESARVTVEQFALFYRTLAVELDDETPGLFSRPLRPGTLKF
FT                   LCLGMLDAANLRVALHRFCWFFRLVLDDLHFELGEDEGLSRIALVERVALQPHRPLILE
FT                   LMLMLVQGIASWMIERKLLFARVDLAYPAPPHAGEYINMFAGPACFDRPLTALYIEPAF
FT                   MDAPIRQDKAALSAFLRKAPMDWIHVSVSERLFTHRVRDLLEAGLGSPQSVEDVARMLH
FT                   ISARTLARRLDAEGTHFQAVKDALRRDVAIARISRTDEPIGSIGADLGFDDPAAFNRAF
FT                   KQWTGSPPGSYRRAGAGR"
FT   gene            461016..461849
FT                   /locus_tag="Tmz1t_0401"
FT   CDS_pept        461016..461849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0401"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dar:Daro_2360 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53181"
FT                   /db_xref="GOA:C4ZIP4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53181.1"
FT                   /translation="MHPGKASPILEVEGLTLSFGGIKALTDVGFEVAPGSITTVIGPNG
FT                   AGKTSLFNTISGFYKPSVGRIRFQGADITATRPPERARLGLARSFQNIALFRGMTVLDN
FT                   IKLGRHAHLRTNVFDALVYFGRARHEEMKLREEIEERIIDFLEIDHIRHMPVSVLSYGL
FT                   QKRVEMARALAMRPKVLMLDEPVAGMNREETEDMARFILDVREEWGVTVLMVEHDMGMV
FT                   MDLSDHVVVLNFGQVIADGTPAEVQADPEVIKAYLGSGEVSELRQRLHQALAVEA"
FT   gene            461851..462741
FT                   /locus_tag="Tmz1t_0402"
FT   CDS_pept        461851..462741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0402"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dar:Daro_2359 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53182"
FT                   /db_xref="GOA:C4ZIP5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53182.1"
FT                   /translation="MSLEFDWLFLAEIMLAGLGAGGLYALTGLAFVMIYKATRVVNLAI
FT                   GEMLMIGAYLCFGLATAMNLPMWLAILVAVIGSGGAGALLERVAIRPMLGESPIAVFMV
FT                   TVGLASILVGVVELIWTSEPRRLPEFMPATPVMIGEAFVPSKVFYGFLVAAVLIGVALA
FT                   VFRFWRGGVALRATASDQQAAYSMGIDVPKVFSLSWTVAAMIAAIAGVIVGAVGGISST
FT                   MGVFGLSVLVVVIVGGLDSVLGALVAGLLIGVVESLAGGFLGGEYKLLATFLILIVVLL
FT                   VRPYGLFGTHEIERL"
FT   gene            462741..463781
FT                   /locus_tag="Tmz1t_0403"
FT   CDS_pept        462741..463781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0403"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   dar:Daro_2358 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53183"
FT                   /db_xref="GOA:C4ZIP6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53183.1"
FT                   /translation="MRIGTARSSYRHDEALFDSRTQHAWLAILAVALIGFPFLADEYWL
FT                   YLACLVAINIASTTGLNILTGYTGLVSLGQAAFMGIGAYTVAALEQKLGAPVLLNLLAG
FT                   GFVAMLGGLVVGLPSLRVKGLYLAIATIAASVVLHFVFANWHAVTGGHAGITLVPAEIL
FT                   GLSFDTSFRLYWLFVPITILMVAGAANLFRTRIGRAFIAIRDRDISAEVLGIPLLRYKL
FT                   LSFGLSSFYAGVAGGMWAYFFRVVTPESFPLILSIFFLAAVIVGGMGTILGAILGAVFM
FT                   TMVPEALKLVVGWLPLSADATLILSPVRTIVFGVLIVGFLVFEPLGLQEIWRRIRRFFH
FT                   LWPFRA"
FT   gene            463831..465000
FT                   /locus_tag="Tmz1t_0404"
FT   CDS_pept        463831..465000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0404"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   bbr:BB2288 putative amino acids binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53184"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP7"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACK53184.1"
FT                   /translation="MRRTVLKSLLATAILSATAGLPAARAADKEIVIGGSIPMSGVFAF
FT                   AGIGIHAGIQDYVKMVNAAGGIAGHTLRYVPEDSAYKVDQSVAAFKKITSQNKVNFYYG
FT                   DSTAFSKTINPELDRAGSMIMSGASFATELNDPKKYPYQFVAGPDYTQQFGILLRYIAQ
FT                   QKPGAKVAFVHSDTEFGRDPIETSRGVAKALGLDVAIEIMTPPGAVDVSTEIAKLRRAR
FT                   PDFTIFHGYILGPIPEFIGQARQMGLDTQFMGTFWTMDNSTVMQMGELAEGFMGVMPYN
FT                   YYYDQSAPAPMLDKIRAMRPEYQNVPYIQGFLSAMLYAESARRTLAAGKEMSAANLKAA
FT                   LNSIENFDTGGLIGVPVTLRGNTIPVGRIYRADTKARRMVPASDWIVLE"
FT   gene            465004..465816
FT                   /locus_tag="Tmz1t_0405"
FT   CDS_pept        465004..465816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0405"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dar:Daro_2356 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53185"
FT                   /db_xref="GOA:C4ZIP8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53185.1"
FT                   /translation="MSAAESVLEVNNIEVIYNKAVQVLRGLSLAVPRGQIVALLGSNGA
FT                   GKSTTLKTVSGLLGLENGELTRGEIRFEGRPLADSKPHELVRAGLFHVMEGRRVFEDLS
FT                   VEENLVAATYALTGRKGEKADKELVYEYFPRLYERRNGLAGYLSGGEQQMLAIGRALIA
FT                   RPRLILLDEPSLGLAPLLVENIFRIIARINAEQKVSMLLVEQNASVALAVAHYGYIMEN
FT                   GKVVTDGPAERLAGDQDVREFYLGMGGHGEMKSFRDIKHYKRRKRWLS"
FT   gene            465831..467660
FT                   /locus_tag="Tmz1t_0406"
FT   CDS_pept        465831..467660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0406"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dar:Daro_2355 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53186"
FT                   /db_xref="GOA:C4ZIP9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIP9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACK53186.1"
FT                   /translation="MSNNLPTLTLPQMLREQARLQPGRPAIRQKDFGIWQAIGWDDYYR
FT                   RASHVGLGLRALGLPAGGHVGVLAENRIEWVLAQMGCGLVGAIAVGVYPTSPAPEVAYV
FT                   LNHADVEVVVCEDQEQTDKVIEALDQLPHLRAIVVMETKGLRNADERVRDRILSFADLE
FT                   RLGVEYEATHRHLVEETLAAQRLDDLALMIYTSGSTGKPKGAMIRYANIRGVAPGIIDR
FT                   LGLAADTVHLSYLPLCHVAEQMLTTFCPIYLGSTVAFGESIRTVQEDLREIAPTMFLGV
FT                   PRIWEKLHSAITIRMQESGPVQRWLFARALAACAPFAHKSAAQRTAGERLTHAICYGLI
FT                   LRALQNFIGLRKARVALTGAAPIPPAVVHFFRTLGVPLVEVYGLTESTGMITGQPLDAV
FT                   AFGSVGTPILGVEHRIGARGELLVHGEMVFAGYYKNPEATADAIRDGWLHTGDVVEERD
FT                   GQLYIVDRLKDIMITAGGKNLTPSEIEKAMKSSPYIKECIVVADGRKFVSALIQIDYET
FT                   VSRWAEGRQIPFTHFRSLVEHPEVRALIEAEIARGNAQLAQVSHIRRFHLLNKELDHDD
FT                   GEVTATMKVRRASVYKTYADVIEAMYRGGAAHA"
FT   gene            467653..468468
FT                   /locus_tag="Tmz1t_0407"
FT   CDS_pept        467653..468468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0407"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   pen:PSEEN2560 enoyl-CoA hydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53187"
FT                   /db_xref="GOA:C4ZIQ0"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ0"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACK53187.1"
FT                   /translation="MPDPIHGDCVRLEREGGLAFITLDRPQARNALDLAMGLGLRDAVR
FT                   ELAAAPPRVLVLRSSGAHFMVGGDVRRFDALLGESQVACTDEIGRLIDAVHEAVTGLTR
FT                   LPCPVLGLVGGSVAGFGLALAMACDLLVAADDARLVLAYGAIGATPDGGASWQLPRRVG
FT                   LQRALAIALLDPQLDAAQAREIGLVADVVPAAQLAEAGLALARRLAAGPAAAQAGIKRL
FT                   LRAGLDTDLATALDAEKASFLALSATPDFAEGVRAFCERRPARFARPSG"
FT   gene            468587..469723
FT                   /locus_tag="Tmz1t_0408"
FT   CDS_pept        468587..469723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0408"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: dar:Daro_2353
FT                   acyl-CoA dehydrogenase, C-terminal:acyl-CoA dehydrogenase,
FT                   central region:acyl-CoA dehydrogenase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53188"
FT                   /db_xref="GOA:C4ZIQ1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ1"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACK53188.1"
FT                   /translation="MDFQLNPEQREIRDLARRFAEREIAPRAAQADLDKAFPTEVHQRA
FT                   QELGLLGINLPETVGGGGLGCLELVLVTEAFCRGCLGIGTALCVNALATEPIVIAGTDA
FT                   QRSRYLGAAARGALASFAMTEPGAGSDVAGIRTRAERVEGGYRLTGSKIWISNANLAEF
FT                   CVVFAKTAPDGGHRGMSAFIVPRASAGLTVGEPLGKLGQRCSPTCEVFLDQVFVPEDHR
FT                   LGEEGGGFALAMAVFDHSRPMVAAFGVGLIERCLDESLAYATQRSSMGKRLIDHQAVAH
FT                   KLAEMRMKLEAARLLTYQSAWLLDQGRPNTIEASIAKAFAADAAMWAATEAVQIFGGMG
FT                   YSTEYPVEKLFRDAKVLQIYEGTSEIQRNIIARELQRA"
FT   gene            469740..470939
FT                   /locus_tag="Tmz1t_0409"
FT   CDS_pept        469740..470939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0409"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: dar:Daro_2352 thiolase; TIGRFAM: acetyl-CoA
FT                   acetyltransferase; PFAM: Thiolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53189"
FT                   /db_xref="GOA:C4ZIQ2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ2"
FT                   /inference="protein motif:TFAM:TIGR01930"
FT                   /protein_id="ACK53189.1"
FT                   /translation="MNPSNPSNPNEALILGAVRTPFGRRGGALRETRPDELLATAIGGV
FT                   LARTGLPGDKVGDVLAGCVSQAGEQGANIARQALLIAGLPAEVPGVSMNRMCGSSQYAT
FT                   HAAAQAVAAGDLDFAIGCGVESMSRVPMFLDLTLGRGDFRGFDNLHPKILERFAIPHQV
FT                   ESAERIAGQWKISRTEMDDYAIESHRRAEAARAAGVHSEILPVAGVDKEGGAITLAHDE
FT                   GIRAVIDVERMRAMQPVFRQPGEGGVTAANASQMSDGAAAVLVGRRAAAEALGIRPRAR
FT                   FRARVAVASDPVLQLTGVIPAARRALEMAGLSIRDMDWIEVNEAFASVALCFVREFAPD
FT                   LDRLNPWGGAIAHGHPLGGSGAGLLAKMLAGLECRDGRFGLQVMCIGHGMATATVIERI
FT                   "
FT   gene            470959..471726
FT                   /locus_tag="Tmz1t_0410"
FT   CDS_pept        470959..471726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0410"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: azo:azo1338 short-chain dehydrogenase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53190"
FT                   /db_xref="GOA:C4ZIQ3"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ3"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACK53190.1"
FT                   /translation="MKIANSVFLVTGGASGLGAATARMVVEGGGRVVLADLNEEAGKAL
FT                   AAELGAAARFVRTDVTDEASTQAAVEAAVQGCGGLHGLVCCAGVAPGEKVVGKDGPHGL
FT                   DRFVRGVMINLVGTFNPIRLAAAAMSKAAPNEEGERGVIVTTASVAAFDGQIGQATYAA
FT                   SKAGVVGMTLPIARELARYGIRVMSIAPGIFETPMLRGLPQAVQDSLGEMVPFPSRLGR
FT                   SSEYAQLVRSICENPMLNGEVIRLDGAIRMAAK"
FT   gene            471737..473305
FT                   /locus_tag="Tmz1t_0411"
FT   CDS_pept        471737..473305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0411"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dar:Daro_2351 acyl-CoA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53191"
FT                   /db_xref="GOA:C4ZIQ4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACK53191.1"
FT                   /translation="MNPVHTTMIPADVRRAGRNLIGDAFARSVRRNPEREALRFEGRSW
FT                   RYAQLDRAANRVANRLLGLGLAVGDRVAAYGRNSDAYVLLWLGCVKAGLIHVPINYALL
FT                   DAELRYIVEQSGARALFCDADMATHVEALGSDLPCEWRGTLHGGQERDVLEWAQAGGTD
FT                   TAPAIALDEEAIAQLLYTSGTTAAPKGAMMSHRALLAEYTSTLLATDIRAEDCALAALP
FT                   LYHSAQMHVFLMPQLLVGATTLLIQAPQPERCFELIERERVTSFFAPPTVWIAFLRHPA
FT                   FEPARLASLQKGYYGASIMPVPVLQELAASLPALQLYNCYGQSEIAPLATVLRPEEHAE
FT                   RPASAGRPIFNVETRIVDSDLNDVPAGEMGEIVHRSPQLMSGYWDKPEETAASFRDGWF
FT                   RSGDVGYLDEAGYLYITDRIKDIIKTGGVVVASREVEECLYTHPAVAEVAVIGLPDERW
FT                   IEAVTAVVALKQGAQATAAELIAHVHARLAAFKVPKRVFFVEDMPRNASGKLLKRELRV
FT                   RYAET"
FT   gene            complement(473340..473831)
FT                   /locus_tag="Tmz1t_0412"
FT   CDS_pept        complement(473340..473831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0412"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /note="TIGRFAM: transcriptional regulator, Rrf2 family;
FT                   PFAM: protein of unknown function UPF0074; KEGG:
FT                   pla:Plav_2689 BadM/Rrf2 family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53192"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ5"
FT                   /inference="protein motif:TFAM:TIGR00738"
FT                   /protein_id="ACK53192.1"
FT                   /translation="MNITQHTDYALRLLMYLGTCTERRVTIKEVAERFDISRSHLMKVV
FT                   TGLVAKGFVDGARGKGGGLRLARAATQIGLGDVVRGMEPSFELVECFGSGSHCLLDPAC
FT                   RLKGALAGALQAFFAALDRLTLADLIGDDGQLHAVLGIPQADAQAPRPTIEIRPGTRAD
FT                   "
FT   gene            473952..474308
FT                   /locus_tag="Tmz1t_0413"
FT   CDS_pept        473952..474308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0413"
FT                   /product="Hemerythrin HHE cation binding domain protein"
FT                   /note="PFAM: Hemerythrin HHE cation binding domain protein;
FT                   KEGG: tbd:Tbd_1443 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53193"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ6"
FT                   /inference="protein motif:PFAM:PF01814"
FT                   /protein_id="ACK53193.1"
FT                   /translation="MKRHPHLVRLSREHHAALRLGRHLLAGGAAAELRAEHVALVTHFA
FT                   EEERELAPLLETGGHGALAARLRAEHAHLRSLFATAADGVREAAAGQALIDHVRFEERE
FT                   LFPAIETLFEEVLP"
FT   gene            474305..474658
FT                   /locus_tag="Tmz1t_0414"
FT   CDS_pept        474305..474658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0414"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: tbd:Tbd_0035 7Fe ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53194"
FT                   /db_xref="GOA:C4ZIQ7"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR022569"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ7"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACK53194.1"
FT                   /translation="MTHVVTEACIRCKYTDCVSMCPVDAFREGPNFLVIDPEECIDCTL
FT                   CVAECPVDAIVPEDELSDEQREYLALNAALAKDWPRIVEAHAPLPDADAWAKVADKRAW
FT                   LDTARAGDPDAKA"
FT   gene            474818..475525
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0415"
FT   gene            complement(475636..476736)
FT                   /locus_tag="Tmz1t_0416"
FT   CDS_pept        complement(475636..476736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0416"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; SMART:
FT                   chemotaxis sensory transducer; KEGG: dar:Daro_2497
FT                   methyl-accepting chemotaxis sensory transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53195"
FT                   /db_xref="GOA:C4ZIQ8"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR025991"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ8"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACK53195.1"
FT                   /translation="MFFSGPRDRLRASEAENLLLEQANAALQERIRDLEAEQSELRAQT
FT                   DALRRERTVLGGVFASLGSFGDSLGGVRESFLGLAGTLNQEKASALEAAAQSDTSRAAF
FT                   ERIAGNLHATFERMGEASGNVGILSRRAEEIGGIVRLIKEIADQTNLLALNAAIEAARA
FT                   GDAGRGFAVVADEVRKLAERTAKATTEIATLVENIQDETRAAREVMEFGAADAGRHAAD
FT                   STQAVSSMKHLLELSRRMERAVTSSALLANVELANIDELALKLEVYKVFLGVSTLRPAD
FT                   LPDERHCRLGQWYYDGEGREHFAGLPGYGELEDPHRAVHVHARRAVELHAQGRLEEALA
FT                   ELQAMERANLMVMRGLGRMLDKAVGR"
FT   gene            476908..477516
FT                   /locus_tag="Tmz1t_0417"
FT   CDS_pept        476908..477516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0417"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: azo:azo3862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53196"
FT                   /db_xref="GOA:C4ZIQ9"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIQ9"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACK53196.1"
FT                   /translation="MEFAKIFITLAALINPFGAIPAFIGLTQGQSSLERRRTARTAALA
FT                   TVLVITVTALAGQYILAGFGITVPSLQVGGGVLLFIVAISMFNAQPAPSRTTPEETDEA
FT                   AERANIAVVPLTIPLLTGPGTVSTVIIYADQGTRTVLMLLGAGLVMGVVVWFAFNLAGP
FT                   ISRLAGRTGLNIMTRLMGLVLAALAVEFIAAGIRAYVNA"
FT   gene            complement(477525..478421)
FT                   /locus_tag="Tmz1t_0418"
FT   CDS_pept        complement(477525..478421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0418"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: azo:azo1925 LysR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53197"
FT                   /db_xref="GOA:C4ZIR0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK53197.1"
FT                   /translation="MRKKIPSTAALLAFEAAARHESFTRAAEELALTQSAICRQIGALE
FT                   DFLGVPLFRRTRRGVQLTEAGLSYSRQIAPRLDAIEHDTLAVMAHHGAGSVLELAVVPT
FT                   FATRWLLPRLAGFQARNPDVVVNMHTQTRPFLFDQTEFDAAIYFGDTGWPGTEAHFLMR
FT                   EYPVPVCSPALPGVREQMSPDEVAELPLLQQTTRPYAWRQWFASAGVRPANDMGGMRLE
FT                   LFSMLAQAAIERMGVALIPPFLIQQELAAGSLISPCLRSFPSTRAYYLIVPEGKAERPA
FT                   LTNFREWLVEEARATPL"
FT   gene            478564..479751
FT                   /locus_tag="Tmz1t_0419"
FT   CDS_pept        478564..479751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0419"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: eba:ebA2993
FT                   glutaryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53198"
FT                   /db_xref="GOA:C4ZIR1"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR1"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACK53198.1"
FT                   /translation="MASNKASFNWEDPLLLDLQLTETERMVRDTARAYSQDKLLPRVQE
FT                   AFRHEKTDAAIFREMGELGLLGATIPEQYGGSGLNYVCYGLIAREVERVDSGYRSMMSV
FT                   QSSLVMVPINEFGTEAQKQKYLPKLATGEWIGCFGLTEPNHGSDPGSMITRARKVDGGF
FT                   SLSGSKMWITNSPIADVFVVWAKDDEGQIRGFILEKGWKGLSAPAIHGKVGLRASITGE
FT                   IVMDEVFVPEENAFPTVRGLKGPFTCLNSARFGIAWGALGAAEACYETARQYTMDRNQF
FT                   GRPLAANQLIQKKLADMLTEITLGLQAVLRVGRMKDEGIAPVEITSIIKRNSCGKALDI
FT                   ARMARDMLGGNGISDEYPVARHLVNLEVVNTYEGTHDVHALILGRAITGIAAFSN"
FT   gene            479769..480992
FT                   /locus_tag="Tmz1t_0420"
FT   CDS_pept        479769..480992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0420"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: azo:azo1923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53199"
FT                   /db_xref="GOA:C4ZIR2"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR2"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACK53199.1"
FT                   /translation="MPGALSHVRVLDLSRILAGPWAGQMLADLGADVIKVERPGAGDDT
FT                   RGWGPPWLKDEQGADTDVAAYYLCANRNKRSITIDITQAEGQALVRRLAAESDVVLENF
FT                   KVGGLAQYGLDYDSLKAVNPRLVYCSITGFGQDGPYAPRAGYDFLIQGLGGLMSITGRP
FT                   DGEEGGGPMKVGVALTDILTGLYATNAVLAALAWRERSGEGQYIDMALLDVQVACLANQ
FT                   AGNYLATGQSPQRLGNAHPNIVPYQDFPTADGYMILAIGNDGQFARFCAAAGAPQLATD
FT                   ERFATNRARVVNRATLIPLLKKLTVERGTAEWIAKLEALAVPCGPINTLADVFADPQVQ
FT                   AREMKVTMPHPVAGQVPLVASPMKLSATPVDYRLPPPMLGEHTDEILAATLGLDAGAIA
FT                   RLRADGVV"
FT   gene            481033..481782
FT                   /locus_tag="Tmz1t_0421"
FT   CDS_pept        481033..481782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0421"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: azo:azo2492 electron transfer
FT                   flavoprotein, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53200"
FT                   /db_xref="GOA:C4ZIR3"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR3"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACK53200.1"
FT                   /translation="MKILVPVKRVVDYNVKVRVKADGSGVDLANVKMSMNPFDEISVEE
FT                   AVRLKEAGVATEVVAVSCGVGACQETLRAAMAIGADRGILVETDVELQPLAVAKLLKAV
FT                   CDKEQPQLVICGKQAIDDDANQTGQMLAALAGWPQATFASKVTLADGKAAVTREIDGGL
FT                   ETLSVKLPAVVTTDLRLNEPRYATLPNIMKAKKKPLDTVKPADLGVDVAPRLATLKVAE
FT                   PPKRSAGERVADVAQLIDKLKNVAKVI"
FT   gene            481785..482717
FT                   /locus_tag="Tmz1t_0422"
FT   CDS_pept        481785..482717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0422"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein alpha subunit ;
FT                   Electron transfer flavoprotein alpha/beta-subunit; KEGG:
FT                   azo:azo1700 electron transfer flavoprotein subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53201"
FT                   /db_xref="GOA:C4ZIR4"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR4"
FT                   /inference="protein motif:PFAM:PF00766"
FT                   /protein_id="ACK53201.1"
FT                   /translation="MAILVIAEHDNQSIKAATLNTVSAAAKLGGDVHVLVAGAGCAAAA
FT                   EAAAKVAGVARVRVCDAPQYEAQTAENVAELVKGLAGGYSHVLAPATPAGKNMLPRVAA
FT                   LLDVAQISDIVAVESADTFVRPIYAGNALATVKSADAIKLITVRTTAFDAAEAGGNAAP
FT                   VEAVAAAADLGVTALVGREIVKSARPELGAAKVIVSGGRGLGSGDNYHKLLEPLADKLG
FT                   AALGASRAAVDAGYVPNDYQVGQTGKIVAPQLYIAVGISGAIQHLAGMKDSKVIVAINK
FT                   DPEAPIFQVADYGLVADLFDAVPALVAAA"
FT   gene            complement(482792..484276)
FT                   /locus_tag="Tmz1t_0423"
FT   CDS_pept        complement(482792..484276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0423"
FT                   /product="transcriptional regulator, GntR family with
FT                   aminotransferase domain"
FT                   /note="PFAM: regulatory protein GntR HTH; aminotransferase
FT                   class I and II; SMART: regulatory protein GntR HTH; KEGG:
FT                   bpl:BURPS1106A_A2364 GntR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53202"
FT                   /db_xref="GOA:C4ZIR5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR5"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACK53202.1"
FT                   /translation="MDCRLSCELIAHAYAEQAPSSSARARLYLAIREAIIARRLAPGTA
FT                   LPPTRTLAADLALGRNTVVRVYDQLIVEGYLDSRVGSGTFVSDAVAATAPQQKPRRMVG
FT                   ARSEGLSRRGCRIAADALSSRVQAGAFMPGFPDVTHFPFATWRKLVAKQMRLEQRHLAQ
FT                   YGYGGYGPLKLVLAEYLRVTRMMSCSPQQILILNGSHQALDLCARMLADVGDVAWMEDP
FT                   GYWGARNVLSACDLAIHPVPVDAQGIHPQAEDWDHPPRLIFVSPSSQYPTGAVMSLERR
FT                   LRLLEYAEKNRIWIIEDDYDNEIRYHDHPVASLFGLSAAQRVIYVGTFSKVMYPGLRLA
FT                   YLVVPEDLVEAFTTGNAELYREGRMLEQAALAEFIDGGHFTTHIRRMRGIYEERRDRLI
FT                   AVLRRHLAGIATPAGGLAGLHIPVHFERPLDDVLLSSQALREGVVMRPLSLYAIDAANR
FT                   RPGMNLGFAAVPVEQIEAPALKLVRLIHGLLPAGGR"
FT   gene            484397..485503
FT                   /locus_tag="Tmz1t_0424"
FT   CDS_pept        484397..485503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0424"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: psb:Psyr_4615 spermidine/putrescine ABC
FT                   transporter ATP-binding subunit; TIGRFAM:
FT                   spermidine/putrescine ABC transporter ATPase subunit; PFAM:
FT                   ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53203"
FT                   /db_xref="GOA:C4ZIR6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR6"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ACK53203.1"
FT                   /translation="MEAVHNSQAPHVSFRNVQKTYDGETLIVRDLNLDIRRGEFLTLLG
FT                   PSGSGKTTCLMMLAGFETPTGGEIRLDGEVINRVPPYRRNIGMVFQNYALFPHMTVADN
FT                   LRFPLRVRKLAANEVEARVKRALGMVQLEAFGSRYPQQLSGGQQQRIALARALVFDPQL
FT                   VLMDEPLGALDKNLRERMQLEIKHIQQNLGITVVFVTHDQSEALTMSDRIAVFNHGVIQ
FT                   QIDAPEALYEYPTNSFVADFIGENNALDGTVVAVAGEECDVRLDCGTVLRARTGNVGAG
FT                   GRARIAVRPERVQLAGEGEGANRLDATVRELIYLGDQIRLRVELAGKHEFTIKAPISQL
FT                   DRSLRPGDAIRVGLDPAHTRALDVPAAH"
FT   gene            485591..486631
FT                   /locus_tag="Tmz1t_0425"
FT   CDS_pept        485591..486631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0425"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: pap:PSPA7_0748 putative binding protein component of
FT                   ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53204"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACK53204.1"
FT                   /translation="MKHAASFLRAAVLVALGGAVGTASADITVISFGGASQKAQDKAYY
FT                   APFTKATGVKVVAGEYNGEQAKVKAMVEAGNVTWDVLEVESPELVRGCEEGLFEKIDFA
FT                   QVGDKADFVPAAVSECGVGIFVWSTALAYNADRLKEAPTSWADFWNVDKFPGKRGLRKG
FT                   AKYTLEFALLADGVPTSDVYKVLATPAGVDRAFAKLDKLKANIQWWEAGAQPPQLLASG
FT                   DLVMSAAYNGRISAAQVEGKNLKVVWNGSIYDVDSWTIPKGSPNKAEALKFIRFASQPE
FT                   NQAVFSGEIAYGPVNLKAVPAIDAKVAAGLPTAPANMKGAMATDTEFWVEHGENLEQRF
FT                   NAWAAR"
FT   gene            486749..488023
FT                   /locus_tag="Tmz1t_0426"
FT   CDS_pept        486749..488023
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0426"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pmy:Pmen_4001
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53205"
FT                   /db_xref="GOA:C4ZIR8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACK53205.1"
FT                   /translation="MSTAVDTSAAVPLPAEGNGTPLKKRLRRAERRRNLLFGALILPLA
FT                   LVVLVAFIWPIGSLLTIGVDNPEIHDNLPRTLAALEDWDGRAPPAEAAFRALADELAAA
FT                   KGSPAIAAIAKRLNREDAGYRSLVMKTARKLPLDPAVPAREALLAIDAQWGELATWQAI
FT                   HRAGGALTPFYLLAAIDRTIDADGNIVAAPADERIYVDVLLRTFWMSLVVTVCCLVLGF
FT                   PVAYLMANLSTRHSNMLMVFVLLPFWTSVLVRVAAWIVLLQNEGLVNRLLMWLGLTDSP
FT                   LQLLFNRFGVYVAMVHILLPFMVLPLYSVMKGISPVYVRAALSLGCPPFRSFWKIYFPQ
FT                   TLPGIGAGGLLVFIMCMGYYITPALLGGPKEQMLSYFIAFYTNQTINWGMAAALSAVLL
FT                   AATLLLYMVYARYLGPTRVKYMKAR"
FT   gene            488035..488859
FT                   /locus_tag="Tmz1t_0427"
FT   CDS_pept        488035..488859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0427"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: pfl:PFL_5636 ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53206"
FT                   /db_xref="GOA:C4ZIR9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIR9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACK53206.1"
FT                   /translation="MLQPYASPVERAWYYGMRGLVGLILAFLFLPILVIVPLSFNADSF
FT                   LMYPMSGFSLRWYEEFATSPAWRQALMNSLIVSPLATLLAMVLGTLASIGLVRADFPGK
FT                   ALLTAVLISPMVVPVVVIGVAMYIFFAPLGLTGSYTGLVLAHAILGVPFVVTTVTATLQ
FT                   GFDFNLVRAASSLGANPLTTFFRVTLPMVAPGIISGGLFAFATSFDEVVVTLFLASPEQ
FT                   ATLPRQMFAGIRENISPTIAAVATILIVLSTLMLMTLEWLRRRAERMRGARR"
FT   gene            488936..490396
FT                   /locus_tag="Tmz1t_0428"
FT   CDS_pept        488936..490396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0428"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.24"
FT                   /note="KEGG: eba:ebA2996 succinate-semialdehyde
FT                   dehydrogenase; TIGRFAM: succinic semialdehyde
FT                   dehydrogenase; PFAM: Aldehyde Dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53207"
FT                   /db_xref="GOA:C4ZIS0"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS0"
FT                   /inference="protein motif:TFAM:TIGR01780"
FT                   /protein_id="ACK53207.1"
FT                   /translation="MSLNLKDPDLFRTRCHVDGQWIDADDGATTSIRNPATGEVLGTIP
FT                   RMGAAETRRAIAAANAAWPAWRALTAGARAKILRRWFELILANQEDLAVLMTSEQGKPL
FT                   AEARGEVLYAASFIEWFAEEGKRIYGDVIPGHQPDKRIVVTKEPIGVCAAITPWNFPAA
FT                   MITRKAGPALAAGCTMVLKPATQTPYSALALAVLAERAGVPKGVFSVVTGGAAEIGGEL
FT                   TANPIVRKLTFTGSTEIGVKLMAQCAPSVKKLSLELGGNAPFIVFDDADLDAAVEGAIA
FT                   SKYRNTGQTCVCANRLLVQDGVYDAFAARLAAAVARLKVGNGLAEGSTQGPLIDMNAVA
FT                   KVEEHIADAVEKGARVLAGGKRHALGGSFFEPTILVDVTPAMKVAREETFGPVAPLFRF
FT                   KDEAEAIRMANDTEFGLAAYFYASSMNRVWRVGEALEYGIVGINTGIISTEVAPFGGMK
FT                   SSGLGREGSKYGIEDYLEVKYLCMGGVQ"
FT   gene            490434..491735
FT                   /locus_tag="Tmz1t_0429"
FT   CDS_pept        490434..491735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0429"
FT                   /product="4-aminobutyrate aminotransferase"
FT                   /note="TIGRFAM: 4-aminobutyrate aminotransferase; PFAM:
FT                   aminotransferase class-III; KEGG: pna:Pnap_2630
FT                   4-aminobutyrate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53208"
FT                   /db_xref="GOA:C4ZIS1"
FT                   /db_xref="InterPro:IPR004632"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS1"
FT                   /inference="protein motif:TFAM:TIGR00700"
FT                   /protein_id="ACK53208.1"
FT                   /translation="MNANTLPPGLHNADFMARRAAALPRGVGQAHPLFATKALNAEVWD
FT                   VEGRRFIDFVAGIAVVNTGHSHPRVVAAVQAQLTHFSHTCFQVVAYDGYLRLAERLNAL
FT                   APGDAAKKTMLVSTGAEAVENAVKIARAFTGRPGVIAFNGAFHGRTLLALGLTGKVDPY
FT                   KLGVGPFPGEIYHAPYPCALHGISVEDAIHGIELLFKNDIEARRVAAFIVEPVQGEGGY
FT                   YPAPAEFLQRLRALADKHGILLIADEIQSGIGRCGKMFAVEHSGVVPDIITLAKGLGGG
FT                   FPVAAVVGRAEVMDALAPGGLGSTYAGAPMACAAALAVLDVMEEEKLCERALAIGEHMQ
FT                   RRLRDMAARHKCIGDVRGLGAMVAVEFFHDGDHARPAPEIAKAVIAAALQRGLLLLSCG
FT                   SYGNVLRLMVPLTIEQAVLDEGLDLLAAAMDAAA"
FT   gene            complement(491773..492885)
FT                   /locus_tag="Tmz1t_0430"
FT   CDS_pept        complement(491773..492885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0430"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   eba:ebA7030 flavin-dependent dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53209"
FT                   /db_xref="GOA:C4ZIS2"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS2"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACK53209.1"
FT                   /translation="METVDTVVIGAGVVGLACAHSLARSRREVVIVERETAFGTGISAR
FT                   NSEVIHAGLYYPPGSLKARLCVEGRQRLYAWCAQHGVNHARCGKLVVASTATQAPALQA
FT                   IAERARANGVDDLRHIDAAELTALEPALAGHGALLSPSTGIVDSHGLMLSLLGEAERHG
FT                   AMLALGSPVLEGRAEADGIVLRIGGEAATALKAKRVVNAAGLDAPALGRAILAPASAQA
FT                   PQAHYARGVYFSYAGKAPFSRLIYPIPEPGGLGVHLTLDLGGQAKFGPDVEWIAAPDYT
FT                   VDPTRVERFAGAIRRWWPDLDAQRLQPGYAGVRPKIVGPGEPDADFRIDGPSAHGTPGL
FT                   VHLYGIESPGLTAALAIGEHVAALLAAEGR"
FT   gene            493185..494135
FT                   /locus_tag="Tmz1t_0431"
FT   CDS_pept        493185..494135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0431"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: azo:azo1918 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53210"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS3"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ACK53210.1"
FT                   /translation="MKSLIRKCALGTVFVAMTTAASAATFVNVLTGGTSGVYYPLGVTL
FT                   SQLYGEIIPDSKVQVQATKASAENLNLLQAGRGEIGFSLADSVSDAWKGNADAGFAKPL
FT                   DKLRAIASVYPNYIQIVALADADVKTLADLKGKRISVGAPRSGTEINARAILKAAGLSY
FT                   ADFAKVEYLPFGESVELMKNRQIDVTLQSAGLGVAALRDLSAAVKVNFVPVPAEVVAKV
FT                   GDPAYRAAAVPANTYEGQAAEVPTVAINNLLVTNDKVSNEVAYQMTKGLFDNLERLGNS
FT                   HSAGRQIKLEKAVEGLPIPLHPGAEKFYREKGLIQ"
FT   gene            494212..496245
FT                   /locus_tag="Tmz1t_0432"
FT   CDS_pept        494212..496245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0432"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /note="TIGRFAM: TRAP transporter, 4TM/12TM fusion protein;
FT                   PFAM: TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: azo:azo1917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53211"
FT                   /db_xref="GOA:C4ZIS4"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS4"
FT                   /inference="protein motif:TFAM:TIGR02123"
FT                   /protein_id="ACK53211.1"
FT                   /translation="MSSSVDSPVAVAGKGMLRVVFYSAILFSVFQLVTSAFSPLSSTVV
FT                   RALHVGFLLLLTFLLHPVQGGQGRTSLATKVIGFGALLLSGYHWIYEADLVQRAGELTQ
FT                   ADMVVGVVTLVLVFEAARRIMGLALPLICLGFLAYALFGEYLPGELAHRGYGLDQVVGQ
FT                   LAFGTEGIYGTPTYVSSSYIFLFILFGAFLEQAGMIDLFTNFALGTVGHTKGGPAKVAV
FT                   VSSGLMGTINGSGVANVVTTGQFTIPLMKKFGYTPAFAGAVEATSSMGGQIMPPVMGAV
FT                   AFIMAETINVPYVEIAKAAAIPAMLYFFTVFWMVHLEAGRAGLKGLPKEECPDPWVAIR
FT                   ARWYLLLPLVGLVYLLFAGFTPMFAGMVGLALTVVLLFGSSLARHLNGTSLRLLFWIVL
FT                   GLACSAFAKVGIISVVAVVAVLAVLLAPRADGRHTLRLAARALVDGALHALPVGVACAL
FT                   VGVIIGSLTLTGGATAFAGYIIQIGDDSLFVSLLLTMLTCLVLGMGIPTIPNYIITSSI
FT                   AAPALLELGVPLIVSHMFVFYFGIMADLTPPVALAAFAAAPIAKESGLKIGVRAVQIAI
FT                   AGFIVPYMAVYAPELMLQGDKGFEATLYVVFKALLAVTLWGTAVVGYFRSPMNPLERVL
FT                   AFVAASMLVVALPITDELGFGLAALVLGWHIWRSRDTQALTV"
FT   gene            496245..496628
FT                   /locus_tag="Tmz1t_0433"
FT   CDS_pept        496245..496628
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0433"
FT                   /product="Domain of unknown function DUF1850"
FT                   /note="PFAM: Domain of unknown function DUF1850; KEGG:
FT                   azo:azo1916 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53212"
FT                   /db_xref="InterPro:IPR015001"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS5"
FT                   /inference="protein motif:PFAM:PF08905"
FT                   /protein_id="ACK53212.1"
FT                   /translation="MAVCLATSVAAAVVAANAFTLAWTHSIERVRWEEAWRVEDGGLVL
FT                   ERVRVRGHGAGMEPAEGAVLRDGAWEWHPRSRHAVLRLTRSAYTADYEWCADGESCRPL
FT                   SALIASDGGVTELRACPGGEAVR"
FT   gene            complement(496648..497196)
FT                   /locus_tag="Tmz1t_0434"
FT   CDS_pept        complement(496648..497196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0434"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: eba:ebA4644
FT                   subunit of chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53213"
FT                   /db_xref="GOA:C4ZIS6"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS6"
FT                   /inference="protein motif:PFAM:PF02417"
FT                   /protein_id="ACK53213.1"
FT                   /translation="MNTLPAGELLALFLHFLTLSLLSIGGAMSTAPEMHRYFVVERGWI
FT                   GDADFTTAIALAQAAPGPNVLFVPVLGFQAAGLPGAAAALVGILLPSTLLSLGVSRWGA
FT                   SRRDTPLVRAFTAGLAPVTVGLVFATGWLLALPFLGDPAHRNGALVLITLTALVTLRTK
FT                   LAPIWMILVGALLGAAGIA"
FT   gene            complement(497193..497822)
FT                   /locus_tag="Tmz1t_0435"
FT   CDS_pept        complement(497193..497822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0435"
FT                   /product="Chromate transporter"
FT                   /note="PFAM: Chromate transporter; KEGG: eba:ebA4646
FT                   chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53214"
FT                   /db_xref="GOA:C4ZIS7"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS7"
FT                   /inference="protein motif:PFAM:PF02417"
FT                   /protein_id="ACK53214.1"
FT                   /translation="MSTPSPDVAPSGPAGNRPASPFALFIAFSLLALQGFGGVLAVAQR
FT                   ELVDRRGWLSRAEFVELYSIAQMLPGPNVVNLSLMIGDRYFGWRGALAAITGMLLAPFL
FT                   IVIALAASYERLAEYPAVAGALRGMGAVAAGLILAMAFKMLGTLRGNLLGPWLCAALGL
FT                   ASLVAIAVFRLPLAWIVIGLGLLGWGLARWRVTVLDARAAHGEEMR"
FT   gene            complement(497819..498586)
FT                   /locus_tag="Tmz1t_0436"
FT   CDS_pept        complement(497819..498586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53215"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS8"
FT                   /inference="similar to AA sequence:KEGG:azo0068"
FT                   /protein_id="ACK53215.1"
FT                   /translation="MTDPATLRRRFLAEAQTLRNERRDFHEWHRGRPHYLLWAIDVDLP
FT                   AVRARVVAAQRALDGLLLDGYRRQPHITLALCGFPAQGAEPAADEFDHAWLQARVEALA
FT                   AARIKPFTLTIGGLESFSSAPFLHVDGALGALAALRACLHTDTPHPQGEYVPHVTVGLY
FT                   ADALHTAAVAPRLDAFAPQPPLHCTVEHISLMGYAATEIGGALFTLAEWDLATRRLHWR
FT                   DAVPAVERLPAPDARGDADQAPTPAAGRHPETP"
FT   gene            498681..499583
FT                   /locus_tag="Tmz1t_0437"
FT   CDS_pept        498681..499583
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0437"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: dar:Daro_3230
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53216"
FT                   /db_xref="GOA:C4ZIS9"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIS9"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACK53216.1"
FT                   /translation="MPARMHYTVLEPSSTERVAIRGLEYNVRRWGPADAPKVFLLHGWM
FT                   DTSATFQFVVDALRHDWQLIAPDWRGYGETTWLHRPYWFPDYYADLEALLAHYAPAGPV
FT                   RLVGHSMGANIAGIYAGLRPQRVARLAMLDFIGLKAPADVDAPQQLGRWLDAQLAPPPA
FT                   RIYADRAALAERLRAVNPRLTPARAEFLCRHLGRVRADGQVEIAGDPWHKIPSPAVYRI
FT                   EDAMACWRRVRAPVLMLVSAEGYVHDRFGDEPEELQRRIDCFADARVVTVADCGHNLQH
FT                   DQPEVVAAELEAFLDREIP"
FT   gene            499580..500776
FT                   /locus_tag="Tmz1t_0438"
FT   CDS_pept        499580..500776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0438"
FT                   /product="domain of unknown function DUF1745"
FT                   /note="PFAM: domain of unknown function DUF1745; KEGG:
FT                   azo:azo0140 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53217"
FT                   /db_xref="InterPro:IPR013702"
FT                   /db_xref="InterPro:IPR016741"
FT                   /db_xref="InterPro:IPR019494"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT0"
FT                   /inference="protein motif:PFAM:PF08495"
FT                   /protein_id="ACK53217.1"
FT                   /translation="MNPTRFAAGHAAHADWRVALARALDALLLDLRAAGGHDHAGRDGL
FT                   PEYTLGFCYLSDRFAADADEIVAELQRRLPGVHWVGTVGIGVAATGAEHFDEPALALML
FT                   APLPRRAFRVFSGVQPLRADAEDFHPHTALVHADGRTPDLQELLPELAERTASGYLFGG
FT                   LTASRGRSVQIADGVFDGGGLSGVAFSAEVGVVSRVTQGCQPIGPRRLVSRARDNFVIT
FT                   LDGRGALDCVMEDLGLPPDMALEPVAEALSNTLVGLHPGADAELVAPAAFGADMLVRNI
FT                   IGLDPRAGVVAIGDEVEQGAWLIFCRRDPAAALADLRRVAREIRDELVDSDRVALGAVY
FT                   VSCSGRGGPHFGRPAAELELIRDVLGDVALAGFFAGGEIAHSRLYGYTGVLTVFAAPR"
FT   gene            complement(500829..502154)
FT                   /locus_tag="Tmz1t_0439"
FT   CDS_pept        complement(500829..502154)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0439"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: DEAD/DEAH box helicase domain protein;
FT                   helicase domain protein; SMART: DEAD-like helicase ;
FT                   helicase domain protein; KEGG: azo:azo0316 putative
FT                   ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53218"
FT                   /db_xref="GOA:C4ZIT1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT1"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACK53218.1"
FT                   /translation="MNFENLGLAEELLKAVASTGYTTPTPVQQRAIPAAIAGRDLLVSS
FT                   HTGSGKTAAFTLPALNRIIDRRPAPGSGPRVLVLTPTRELAQQVEKAVQTYGKALRWLN
FT                   TACLVGGAPMFAQIKQLQRQCDVVVATPGRLLDHLTRRKIKLSDVEVLILDEADRMLDM
FT                   GFAEDIDAIVAATPAKRQTLLFSATLDGVVGSMATRMTRDAERIEIEVAQEDRGQIEQR
FT                   LMFADDLGHKSRLLHALLGEDGMNQAVVFTATKRSADELSLALQEKGISAAALHGDMHQ
FT                   TQRNRTLDRLRQGRIGVLVATDVAARGIDVAGISHVINFDPPRQAEDYVHRIGRTGRAG
FT                   RDGIAITLSGPRETGLIRAIERFTGDRLAVHTIPGMEPSPRKPAGPRPGGNSGRRFGSG
FT                   AKPSGSSYGRPGGDARRSGGGFSRDGHPSRSERSHDDRRSRG"
FT   gene            complement(502685..502960)
FT                   /locus_tag="Tmz1t_0440"
FT   CDS_pept        complement(502685..502960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0440"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   SMART: histone family protein DNA-binding protein; KEGG:
FT                   azo:azo0315 DNA-binding protein HU (DNA-binding protein
FT                   II)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53219"
FT                   /db_xref="GOA:C4ZIT2"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT2"
FT                   /inference="protein motif:PFAM:PF00216"
FT                   /protein_id="ACK53219.1"
FT                   /translation="MNKGEFVEALADRLDVHRAQADRALSAVLDIIAEQLAKGEKVAFT
FT                   GFGSFEVSQRAARTGRNPQTGATIEIAASSVPKFTAGATLKASVNK"
FT   gene            503163..504356
FT                   /locus_tag="Tmz1t_0441"
FT   CDS_pept        503163..504356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0441"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA1702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53220"
FT                   /db_xref="InterPro:IPR029014"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT3"
FT                   /inference="similar to AA sequence:KEGG:ebA1702"
FT                   /protein_id="ACK53220.1"
FT                   /translation="MHTSDDMSTQDSTGEDPIRVLATHAAGQVLAVSLHIPDRAWMGGA
FT                   VIGMAPAEGVEHLRRHASHSPQAHAHALAHACAAAAGEPPPERAEQLRTERRLAAEMID
FT                   MHLRRLLLDWPPSLGFEPRINRYAEFHRRLLHAGEHDNDFVLGGEVLDLVARELLAGFF
FT                   NQIRMPHGIGEFLDRLAGGGSLSSILGELIAHGPSTVLPEKRTALLGTLSADAWAAEVG
FT                   TWPSAQFIRHPRYAGEPAETGPLARHAASPLVRILLERGNRISARLFAKAIDVADCAST
FT                   MRHPGSAEVAPLIDACRVAPDVGLARVISARGVLLCWVRLAEGRIADCAIVPAGAWNLE
FT                   PDGVYCREAMCLQVTDGDPEALKKRLEWLMLAIDPSLPFVVELVAAGEGAGVAPASA"
FT   gene            complement(504390..504890)
FT                   /locus_tag="Tmz1t_0442"
FT   CDS_pept        complement(504390..504890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0442"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   KEGG: azo:azo3811 nitrilotriacetate monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53221"
FT                   /db_xref="GOA:C4ZIT4"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT4"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACK53221.1"
FT                   /translation="MTQQQASGEDFQRHFRNALGMFATGITVVTTRTPVGEPIGLTVNS
FT                   FNSVSLDPPLIVWSLANELPSRTLFEGCEYYAINVLAEDQADLSQRFASRLGEKFAGLE
FT                   FDSGVGGVPLLAGCCARFQCRNTVRHAGGDHVVFISEVVDFDRAEERAPLLYFGGAYRQ
FT                   LRA"
FT   gene            505002..506081
FT                   /locus_tag="Tmz1t_0443"
FT   CDS_pept        505002..506081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0443"
FT                   /product="A/G-specific adenine glycosylase"
FT                   /note="KEGG: azo:azo3812 putative A/G-specific adenine
FT                   glycosylase; TIGRFAM: A/G-specific adenine glycosylase;
FT                   PFAM: HhH-GPD family protein; helix-hairpin-helix motif;
FT                   SMART: HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53222"
FT                   /db_xref="GOA:C4ZIT5"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR004035"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT5"
FT                   /inference="protein motif:TFAM:TIGR01084"
FT                   /protein_id="ACK53222.1"
FT                   /translation="MSDFSIRLIEWQRKHGRHDLPWQGGHDPYRIWLSEIMLQQTRVET
FT                   VIPYYERFLARFPDVAALAAAPVEDVMALWSGLGYYARARNLHRAARVVMDAHGGAFPR
FT                   SAAAIAGLPGIGRSTAAAIAAFAWGERAAILDGNVKRVLCRVFGIEGFPGDKAVETRLW
FT                   ALAESLLPERGIGRYIQAQMDLGATLCTRARPACARCPFHDDCVARRDGRVAALPTARP
FT                   KKVVPRRGARCAVILHQGAVLLERRPPAGIWGGLLALPELPAEVDDAQAWSAQRFGLAT
FT                   AAPRPLAPLTHAFTHFVLELQPLLLHASAIQGLADDGALCWLPLGAHAEAALPAPVRRI
FT                   LDGLAAPGLFDEGAPARGA"
FT   gene            complement(506126..506728)
FT                   /locus_tag="Tmz1t_0444"
FT   CDS_pept        complement(506126..506728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0444"
FT                   /product="peptidase S16 lon domain protein"
FT                   /note="PFAM: peptidase S16 lon domain protein; SMART:
FT                   peptidase S16 lon domain protein; KEGG: azo:azo3813
FT                   ATP-dependent protease La"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53223"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT6"
FT                   /inference="protein motif:PFAM:PF02190"
FT                   /protein_id="ACK53223.1"
FT                   /translation="MTPPPDTLPLFPLKTVLFPGGVLPLRVFEPRYMDMVTRCMREGGS
FT                   FGVCLIAAGDEVGEAAVPHPVGTEALIEHWDMEQPGVLELLVRGGRRFRIVDHELERDG
FT                   LLVGSVRWLEEPPAEPVPAAQAELLPLLRSIVEELGDRLPPPHDFDDAAWVGARYIELL
FT                   PIPLLAKQKLLELDDIVSRLEILQQFLREHGLMPKKA"
FT   gene            complement(506770..507396)
FT                   /locus_tag="Tmz1t_0445"
FT   CDS_pept        complement(506770..507396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0445"
FT                   /product="3-octaprenyl-4-hydroxybenzoate carboxy-lyase"
FT                   /note="TIGRFAM: 3-octaprenyl-4-hydroxybenzoate
FT                   carboxy-lyase; PFAM: flavoprotein; KEGG: azo:azo3814
FT                   aromatic acid decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53224"
FT                   /db_xref="GOA:C4ZIT7"
FT                   /db_xref="InterPro:IPR003382"
FT                   /db_xref="InterPro:IPR004507"
FT                   /db_xref="InterPro:IPR036551"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT7"
FT                   /inference="protein motif:TFAM:TIGR00421"
FT                   /protein_id="ACK53224.1"
FT                   /translation="MTPPRTITVAFTGASGLPYGVRLVECLLQAGCRVWLLYSQVAQIV
FT                   ARQEMDWNLPARPAEVEAELSARFTAAPGQLRVFGREEWFAPPASGSNPPDAMVVCPCT
FT                   VATLASIAGGLSQNLIERAADVVIKEGRKLVLVPRETPYSAIHLENMLKLARLGVCILP
FT                   PNPGFYHHPQTVQDLVDFVVARILDQLGVPHSLMARWGEDREQAG"
FT   gene            complement(507855..509021)
FT                   /locus_tag="Tmz1t_0446"
FT   CDS_pept        complement(507855..509021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0446"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   azo:azo3818 putative leucine-specific binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53225"
FT                   /db_xref="GOA:C4ZIT8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT8"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACK53225.1"
FT                   /translation="MSPLRRLALALASSLSLACALPATAAGVSADEIVVGTVSDLSGPI
FT                   AMLGVPVRDGMLMRFDEANAGGGVHGRKIRLAVEDAGYDPKRAVLAARKLVQHDQAFAF
FT                   IANMGTPVVMASMPIIVDAGRLHLFPFSPHRATYEPLHPLKFQNFAPYQDYMEAATRHM
FT                   VRERGYQRSCLLYQDDDYGLEVMKGVEKALAGLGTELVERTSYKRGATDFSSQIARLRA
FT                   ARCDLVVLATVVRETVAAMSEARKIGWDVDMLVTASGYSAQTHELGGAAVEGLYGVSVL
FT                   PHPYAEGANSQLAAWIERYRARFNTEPNVWSVMGYTLADLFVRTAEATGRELTPERFAH
FT                   TLEGMAFTRDYFGSPAYRFSADDHLGNRKGRLAQIRNGRWELITDYLE"
FT   gene            complement(509134..509358)
FT                   /locus_tag="Tmz1t_0447"
FT   CDS_pept        complement(509134..509358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_1714 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53226"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIT9"
FT                   /inference="similar to AA sequence:KEGG:AnaeK_1714"
FT                   /protein_id="ACK53226.1"
FT                   /translation="MSAWSCPHDLDGICQRVRGAICSPGMRGCELEGKVRFALDEFNEP
FT                   RKPVKARPAETRPEPKPGAAAAPRRRLPF"
FT   gene            complement(509453..510427)
FT                   /locus_tag="Tmz1t_0448"
FT   CDS_pept        complement(509453..510427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0448"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: azo:azo3819
FT                   putative branched-chain amino acid transport permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53227"
FT                   /db_xref="GOA:C4ZIU0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53227.1"
FT                   /translation="MSAPILRGGVPAVRAALPWLAVLLLALAGLGTDYALGKATLVATY
FT                   AIAGLGVVVVVGQAGQIALGQAALVALGAYAQALLVARGVPAPLALPVAAAAGALGGAL
FT                   ASLPARRLGGLYFGMSTLAFALIVEEALARWESLTHGAAGLTVGAFTLAGWRADSTLAQ
FT                   ATVSVAVLALAMLACARLFASRHGRAWRAVRDDEIAAAACGIDNDAAKMQAFVVGGALS
FT                   GLAGGLYAHWIGFISPEQFGLVFSFELLMLAFIGGARRLAGAAWGALVIVAIPPLISLL
FT                   RDRLPGDWARASGLELLLFGAVIVGVVLLRPAGLAGEAKGHDR"
FT   gene            complement(510424..511290)
FT                   /locus_tag="Tmz1t_0449"
FT   CDS_pept        complement(510424..511290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0449"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG: azo:azo3820
FT                   ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53228"
FT                   /db_xref="GOA:C4ZIU1"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU1"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53228.1"
FT                   /translation="MLAFVQVLASGVAIGCVYGLVALSFVLIYKATETVSFMQGDLLML
FT                   GAFAALGLHAFAGWPLVAAAVAAVLAVGVLGAVLERAVLRRALGQPHLVAVLLTFGLGM
FT                   MMRGGVASVPAAAQDMHRLPFAADTLAIGPLVLAASHLWVIAATVLLAGLLAAFFRHTR
FT                   TGLALRACSEDARSAALMGIPVARMHTLAWALGAALAAVAGLLLAPITFVHLNMGFIAL
FT                   KAFPAAVLGGLTSLPGALVAGIFLGVAEALAGLALPEGTKDFVPYVLLLAALLLFPQGL
FT                   GGARGRA"
FT   gene            complement(511584..513758)
FT                   /locus_tag="Tmz1t_0450"
FT   CDS_pept        complement(511584..513758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0450"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE1277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53229"
FT                   /db_xref="GOA:C4ZIU2"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU2"
FT                   /inference="similar to AA sequence:KEGG:NE1277"
FT                   /protein_id="ACK53229.1"
FT                   /translation="MSDETNKKGYQWRFFRSGGFDQVRIETADDLRHLGELDQKLWSVL
FT                   ACPTSGLEFDSRTLQLLDVDDDGSIRAPEIIDATRWVCAVLKDPGVLFRGADGLPLAAI
FT                   DENNAEGAKLLATASKVLAYVGKADAGEISMGDLAETEKLFAPEHQNGDGVVPAELAGD
FT                   PRLAGAITRIVETYGAAEDRSGKPGVDRARVDAFFAAAQEVSDWHAQADADAANVLPLG
FT                   DATAAAAAVFEAVREKIEDYFTRCRLAAFDERAAAALNPADTAYVELSLQSLDAASAAV
FT                   AALPLALVGPGRALPLSVALNPAWEARIAAFRDEVVTPILGMREALTQAEWQDLAGRFA
FT                   AYRAWVAAMPANPVAVLPVADVRALLADGTCAALTRLIDEDLAAETAAGQVDALERLVR
FT                   YNRDLVRLLRNFVTLSDFYSRHDKAIFQAGTLYLDQRSCELCLRVGDMARHATLAPLSG
FT                   TYLVYCECQRQGEAPMNIVAAMTGGDADEMMVPGRNGIFYDRQGRDWRASVVKVVEAPI
FT                   SVRQAFWSPYKRIGRMIGEQLQKFAAARDKAVNDQAATGVAGASAKIEAAPAAAAAPAA
FT                   PAAPFDIAKFAGIFAAMGLAVGAIGTALAAVVSAFLGLPVWQMPLVVVGAVLVISGPSM
FT                   LLAWLKLRQRNLGPLLDANGWAVNTRARINIPFGGALTGVAALPPGASRALTDPYAEKK
FT                   TPWKSWLFLVLLIAAVVVAWQQGYLDRFLG"
FT   gene            complement(513947..514588)
FT                   /locus_tag="Tmz1t_0451"
FT   CDS_pept        complement(513947..514588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0451"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   eba:ebA2717 putative metallo-beta-lactamase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53230"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU3"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACK53230.1"
FT                   /translation="MIQATIVPVTPFQQNCSILWCERTKKAAVVDPGGDLDRILAAVAE
FT                   LGVTVEKILITHGHIDHAGGTAKLARELGVPIEGPQEEDRFWIEGMPQQSKMFGFPDVE
FT                   SFEPDRWLHDGDTVTVGEQTLKVIHTPGHTPGHVVFVHEGARLAIVGDVLFAGSIGRTD
FT                   FPRGDHQTLIRSIREKLFPLGDDITFIPGHGPTSTFGEERDSNPFVGAYG"
FT   gene            complement(514867..516210)
FT                   /locus_tag="Tmz1t_0452"
FT   CDS_pept        complement(514867..516210)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0452"
FT                   /product="Glutamate dehydrogenase (NADP(+))"
FT                   /EC_number="1.4.1.4"
FT                   /note="PFAM: Glu/Leu/Phe/Val dehydrogenase ;
FT                   Glu/Leu/Phe/Val dehydrogenase dimerisation region; KEGG:
FT                   eba:ebA5425 glutamate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53231"
FT                   /db_xref="GOA:C4ZIU4"
FT                   /db_xref="InterPro:IPR006095"
FT                   /db_xref="InterPro:IPR006096"
FT                   /db_xref="InterPro:IPR006097"
FT                   /db_xref="InterPro:IPR014362"
FT                   /db_xref="InterPro:IPR033524"
FT                   /db_xref="InterPro:IPR033922"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU4"
FT                   /inference="protein motif:PRIAM:1.4.1.4"
FT                   /protein_id="ACK53231.1"
FT                   /translation="MKYQSLEEFLAYVEQRNPGQPEFLQAVTEVMESLWPFISANKRYA
FT                   EHSLLDRLIEPERAISFRVSWVDDRGEVQVNRGYRIQHSSAIGPYKGGLRFHPSVNLSI
FT                   LKFLAFEQTFKNALTTLPMGGGKGGSDFDPKGRSPGEVMRFCQAFMTELYRHVGPDTDV
FT                   PAGDIGVGGREVGFMAGMMKKLSNNSACVFTGKGLSFGGSLIRPESTGYGTVYFANAML
FT                   ERAGRDIKGMRVSVSGSGNVAQYAIEKLMELGAKPITCSDSSGTVIDEAGFTPEKLAIL
FT                   MEIKNHYYGRASEYAERVGARFEPGVRPWHVPVEVALPCATQNELDGNDAATLVKNGVI
FT                   AVAEGANMPSTMEAAKIFEHNGVLYAPGKASNAGGVATSGLEMSQNAMRLSWTREEVDA
FT                   RLKEIMLGIHAACLKYGEREDGTVSYVDGANVAGFVKVAEAMLAQGVI"
FT   gene            516515..516991
FT                   /locus_tag="Tmz1t_0453"
FT   CDS_pept        516515..516991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0453"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM;
FT                   transport-associated; SMART: Peptidoglycan-binding LysM;
FT                   KEGG: eba:ebA3069 LysM domain/BON superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53232"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU5"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACK53232.1"
FT                   /translation="MGLFAFIKEAGEKLFRTGEANAAAADPAAANARAAQAIHNYIVAL
FT                   KLAPADLGVSFDAAKSLVVVSGTAPDQATREKILLAAGNVAGVAEVENRLSVARAEPEA
FT                   QFHTVARGDTLSAIAKKYYGNANQYPAIFEANKPMLSHPDKIYPGQVLRIPPQA"
FT   gene            517088..517516
FT                   /locus_tag="Tmz1t_0454"
FT   CDS_pept        517088..517516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_1883 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53233"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU6"
FT                   /inference="similar to AA sequence:KEGG:Daro_1883"
FT                   /protein_id="ACK53233.1"
FT                   /translation="MARIRIELPERFTFSTDIPLLVSHINYGNHLDNAQLLGIVSEARV
FT                   RFLKSMGYGELDVEGLGIIVADAALQYRSEAFHGETMRVEMGAADFHEHGCDLVWRMAE
FT                   AASGREVARGKTGIVFFDYGQRRKATVPEGFGRRFVPA"
FT   gene            517523..518821
FT                   /locus_tag="Tmz1t_0455"
FT   CDS_pept        517523..518821
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0455"
FT                   /product="HI0933 family protein"
FT                   /note="PFAM: HI0933 family protein; FAD dependent
FT                   oxidoreductase; KEGG: azo:azo3772 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53234"
FT                   /db_xref="InterPro:IPR004792"
FT                   /db_xref="InterPro:IPR022460"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU7"
FT                   /inference="protein motif:PFAM:PF03486"
FT                   /protein_id="ACK53234.1"
FT                   /translation="MERARVAVVGGGPAGLMAAGALAERGCTVTVYDAMPSVGRKFLLA
FT                   GRGGLNLTHAEPLADFLGRYGARRDTLAPRIEVFPPQALREWAHGLGVETFVGSSGRVF
FT                   PQEMKAAPLLRAWLARLRATGVRFAVRHRWLGWAEDPAQDGALRAGLQHLRFATPDGEQ
FT                   TVEADALVLALGGGSWAKLGSDGAWVAPLRAAGVEIADLLPANCGFDVVGPAGTGWSAH
FT                   FLDHFRGQPLKSVAARCTDPAGRVHARAGECLISATGIEGGLVYALSAPLRDTLLARGE
FT                   AVLELDLAPGRSLERLAAELARPRGSRSFSSHLHSQAGIKGVKAGLLRECLAKAEFDDP
FT                   ARLAAAIKAMPLRLVATRPLDEAISSAGGVRFEALDAQLMLRARPGVFVAGEMLDWEAP
FT                   TGGYLLTACFATGLAAGTAAADWLSQQPRPPCP"
FT   gene            518871..519503
FT                   /locus_tag="Tmz1t_0456"
FT   CDS_pept        518871..519503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0456"
FT                   /product="protein of unknown function UPF0126"
FT                   /note="PFAM: protein of unknown function UPF0126; KEGG:
FT                   har:HEAR0704 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53235"
FT                   /db_xref="GOA:C4ZIU8"
FT                   /db_xref="InterPro:IPR005115"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU8"
FT                   /inference="protein motif:PFAM:PF03458"
FT                   /protein_id="ACK53235.1"
FT                   /translation="MNLHPFLVAIEVGGTLAFAMSGLIEATRKRMDIVGVFSVAFVSAF
FT                   GGGTLRDILLDRRPLFWIENQEYLWLVLAMVATTPLWLQTLRHKVGGRLMELADALGLG
FT                   LFAISGATLADAAGMPVLVSMMMGAITAVFGGVSRDVLCNEVPKVYSDHRPYAMCALFG
FT                   CGVFLALDAIGLPLPIATLAGIAAATGSRLLALVFDVRLPAWPAHRD"
FT   gene            complement(519534..520736)
FT                   /locus_tag="Tmz1t_0457"
FT   CDS_pept        complement(519534..520736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0457"
FT                   /product="Rh family protein/ammonium transporter"
FT                   /note="PFAM: Rh family protein/ammonium transporter; KEGG:
FT                   dar:Daro_3703 Rh-like protein/ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53236"
FT                   /db_xref="GOA:C4ZIU9"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIU9"
FT                   /inference="protein motif:PFAM:PF00909"
FT                   /protein_id="ACK53236.1"
FT                   /translation="MQPVQTSNDVLFILLGAIMVLAMHAGFAFLEVGTVRRKNQVNALV
FT                   KILSDFAVSTLAYFFIGYGIAYGVHFFSGAGALVEHHGFELTRFFFLLTFAAAIPAIIS
FT                   GGIAERARFQPQLAATFLLVGFVYPFFEGIAWNQAFGIQAWLKASFGAEFHDFAGSVVV
FT                   HAMGGWIALPAVLLLGARRGRYARNGQISAHPPSSIPFLALGAWILIVGWFGFNVMSAQ
FT                   RLENISGLVAINSLMAMVGGTVAALAAGRNDPGFVHNGPLAGLVAVCAGSDVMHPLGAL
FT                   VVGAVAGGLFVVMFTLTQNRWKIDDVLGVWPLHGLCGAWGGLAAGIFGSQALGGLGGVA
FT                   FASQAIMTALGIAVALAGGVLVYGGLKLAVGLRLDHEEEFNGADLSIHRITATAERESN
FT                   W"
FT   gene            521082..522416
FT                   /locus_tag="Tmz1t_0458"
FT   CDS_pept        521082..522416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0458"
FT                   /product="H(+)-transporting two-sector ATPase"
FT                   /EC_number="3.6.3.14"
FT                   /note="PFAM: cation transporter; KEGG: eba:ebA5555 cation
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53237"
FT                   /db_xref="GOA:C4ZIV0"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIV0"
FT                   /inference="protein motif:PRIAM:3.6.3.14"
FT                   /protein_id="ACK53237.1"
FT                   /translation="MKVREVQHPAHIVPLAFLITILIGTALLMLPVSRADAVGAPWIAA
FT                   LFTAVSAVCVTGLVTVDTGTYWSSFGQWVIMALFQIGGFGMMTAATLLGLLVNRSFRLR
FT                   TRLTAQAETHTLGIGDVSSVAKLVLFVTVIVEVMTALALALRLHLGYDLPLAEAAWSGL
FT                   FHSVSAFNNAGFSIHADGLIRYASDSYFLAPVMLAIVIGGLGFPVLQDLRNKLRDPQHW
FT                   SVHTKLTLVGTAVLLAGGAILLLAFEWANPRTLGSMPAGDKLLSAIFASVSARTAGFNS
FT                   IDIGGLTHESLGLHYFLMFIGGGSAGTAGGVKVGTAMILVMLVIAEIRGRMDTEAFGRR
FT                   ISHSAQRQAITVLVLSSAVVVLGTVFILHTTEIATDRVIFEVISAFATVGLSTGITADL
FT                   PDSAQLMLILLMYIGRVGTITLAASLALGEHRMPFRYPEEHPVVG"
FT   gene            522409..523104
FT                   /locus_tag="Tmz1t_0459"
FT   CDS_pept        522409..523104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0459"
FT                   /product="TrkA-N domain protein"
FT                   /note="PFAM: TrkA-N domain protein; TrkA-C domain protein;
FT                   KEGG: eba:ebA5556 TrkA family potassium uptake protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53238"
FT                   /db_xref="GOA:C4ZIV1"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIV1"
FT                   /inference="protein motif:PFAM:PF02254"
FT                   /protein_id="ACK53238.1"
FT                   /translation="MARLFTEQFAFSKGDSVVVIGLGRFGGAVANSLMQLGHDVMGIDR
FT                   DAEPVHEWADLLTHAVQADSTSAMTMRQLGVGDFAHAIVGIGGDLAASLMTVMALTELE
FT                   IPDIWVKAMTPEHGKIAERIGAHHVVYPEADMGERVAHLISGRMMDYIEFDDGFAIAKI
FT                   QAPSVTHERSLAESAVREHFGVTVVGIKRAHEDFQHGKPGSVVLPGDLLIVSGPTKKVE
FT                   AFAASGRRR"
FT   gene            523185..523406
FT                   /locus_tag="Tmz1t_0460"
FT   CDS_pept        523185..523406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0460"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebD95 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53239"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIV2"
FT                   /inference="similar to AA sequence:KEGG:ebD95"
FT                   /protein_id="ACK53239.1"
FT                   /translation="MLNWILNQFKRQSAEDLERAREMVKAAERGHSHPDLGKARDVART
FT                   LGIEVDVHASAEQLIQAIRRYLARHGEM"
FT   gene            complement(523750..524087)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0461"
FT   gene            complement(524202..524453)
FT                   /locus_tag="Tmz1t_0462"
FT   CDS_pept        complement(524202..524453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0462"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4189 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53240"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIV3"
FT                   /inference="similar to AA sequence:KEGG:Daro_4189"
FT                   /protein_id="ACK53240.1"
FT                   /translation="MTNTSDGGTTLTLHDAAKLLAGGGISTHDAEVLLANAIQQCELHA
FT                   NVKRWATEQWDGPLLPGNINPRETHIERSDLDAWRSGR"
FT   gene            complement(524567..525751)
FT                   /locus_tag="Tmz1t_0463"
FT   CDS_pept        complement(524567..525751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lch:Lcho_4313 peptidase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53241"
FT                   /db_xref="GOA:C4ZIV4"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="InterPro:IPR025139"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZIV4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53241.1"
FT                   /translation="MGLKIYISSTFEDLKDYRRRVYEQLRTLRHDVIAMEDYVAADERP
FT                   LDKCLRDVRDSDVYIGLFAWRYGYVPRAGNPQRRSVTELEYLEAKKHKKPCLIFLTDNR
FT                   APWPPDQMDSTTGDNDSGKKIAALRKALREKGLVSTFETPEALAIKVVTALYSWQSETS
FT                   RAQSQLGHAAVEEALAPGVQAAARRTNPLMWVPGSRLRVRFLGADGAFAARILRLAQIW
FT                   SAYANIFFVASEDKDAEVRVAFDKDGGSWSYEGTNALAVPPSEPTMNLGWLVPALPIDD
FT                   VESVVLHEFGHVLGLAHEHNNPSGDIPWDRKEVLKLLGGPPNHWDQNTIDQYLYRTWET
FT                   DRFPFAKPFDPLSIMSYFFPKEVTGGKQIFSTNTTLSSGDKEFISRLYPYATGG"
FT   gene            525955..526368
FT                   /locus_tag="Tmz1t_0464"
FT   CDS_pept        525955..526368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0464"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: saz:Sama_1110 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53242"
FT                   /db_xref="GOA:C4ZL58"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL58"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACK53242.1"
FT                   /translation="MNTLGWQELKVVALAVDDLARAEDFYRSKLGLEPRPQADGDVGFA
FT                   LGSLTLLLKPLAGPGGAAEKSPYPRLTVAVADAPRMERELAARGVTISDAVQLYEDGCY
FT                   WVGAFLDSEGNKLWFCSEAGKPAPSVSGGRSSP"
FT   gene            complement(526418..526804)
FT                   /locus_tag="Tmz1t_0465"
FT   CDS_pept        complement(526418..526804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0465"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   gbm:Gbem_4009 hemerythrin-like metal-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53243"
FT                   /db_xref="GOA:C4ZL59"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL59"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACK53243.1"
FT                   /translation="MPIAIWTPALSLGVDSLDADHQKLIDTLNMVFDAMLFDRSSAALH
FT                   SALATLDDYVTGHFAREEAWMQARDHPDLARHRQEHEALRDQLALLCAMSDLSDQERSV
FT                   ELLMVLRDWLLGHIAHSDRDASGP"
FT   gene            complement(526812..528461)
FT                   /locus_tag="Tmz1t_0466"
FT   CDS_pept        complement(526812..528461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0466"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; KEGG:
FT                   xau:Xaut_3234 xanthine/uracil/vitamin C permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53244"
FT                   /db_xref="GOA:C4ZL60"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL60"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACK53244.1"
FT                   /translation="MMFPGIRRGSDSLMARRPDSLIHGLDDKPRALTLAALGLQHFMVA
FT                   APNLAIVVMICRAAGVDAAAAEGVLSFSLIALAIATLVQCSRRLGSGYFIVSCNSGIYL
FT                   SASLAAATGGLPVVCGMTLVAGIFQAFFASLLVRARRFFPNEIVALSIIIVGIEIGVIG
FT                   LNRLSGAGVPGLVVGGATFFVSVVFGVFGRGRWRLYCSLLGMACGYLVYLTTGIPGPSS
FT                   ASDAFSSALFGLPSSAHLGLEFDVGYLLPFLFAAVAASLKTMGAVDICARINDAAWVRP
FT                   EMHAIRRGVLVDGLSTTLSGLFGSTGTNSSTSSVGVSHASGATSRVIGIAVAAWMLVFA
FT                   LSPAFTHLVVTLPDPVVGGMLVFTGCLVIANGFQVLGTVPMDMRRAGVVAFPLLVAIAR
FT                   VANAPLFAQLPDSVKPLMSSALAIGVFAALLVNAFLSWGNARQATVALDPGHPVGERLR
FT                   QVRRILDEWNVAHNVKVRVMLTLRELLDERASSLKLAFNGCTLHIGLTRAAPAQDAQTT
FT                   PDGRFFADRVSDAMAHRKRADGSSVISLCFEQ"
FT   gene            complement(529025..529099)
FT                   /locus_tag="Tmz1t_R0007"
FT                   /note="tRNA-Gly3"
FT   tRNA            complement(529025..529099)
FT                   /locus_tag="Tmz1t_R0007"
FT                   /product="tRNA-Gly"
FT   gene            complement(529182..530912)
FT                   /locus_tag="Tmz1t_0467"
FT   CDS_pept        complement(529182..530912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0467"
FT                   /product="phosphoenolpyruvate-protein phosphotransferase"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein;
FT                   PEP-utilising protein domain protein; PEP-utilising protein
FT                   mobile region; KEGG: azo:azo3782 putative
FT                   phosphoenolpyruvate-protein phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53245"
FT                   /db_xref="GOA:C4ZL61"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR024692"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL61"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACK53245.1"
FT                   /translation="MSFTLHGLAVSQGIAIGHVHLVSHALLEVNHYHVAPRYLDDELAR
FT                   LDEALATVQGELIGLKAITTSGQAHSEVGAFVDLQLMMLADPMLVDAARQLVTERRCNA
FT                   EWALVQQMEHLVEQFRQIEDPYLRERQADVVQVVERLVKVLLGHPGHLPPRRRDGLGSI
FT                   VVAHDLSPADTIGFRDHNIAGFVTDVGGPTSHTAIVARSLKIPAVVGLHHVRDLLEDDE
FT                   LIIVDGTRGVIIVAPDEQIVEEYRLRRSELEIERSKLNRLRDTRAATLDGEEVNLLANI
FT                   EGPKDLPAVKSANADGIGLYRTEFLFIGRDTLPDEEEQYEAYRAVVKALPGKPVTIRTF
FT                   DVGADKALNGAQAREEPNPALGLRAVRYSLAEPKMFKTQLRALLRASAHGRLQIMVPML
FT                   AHAQEVDQCLTLLEKAKAELRAEKIKFDEGIRIGGMIEVPAAALSLGMFIRRLAFLSIG
FT                   TNDLIQYTLAIDRSDEAVAHLYDPLHPAVLKLIAGTISSGARFGLPVSVCGEMAGDPLY
FT                   TELLLGMGLRNFSMHPGSILEIKQQVLRADLGELAPRVQRILKMDEPARIREAVERLTA
FT                   "
FT   gene            complement(530914..531183)
FT                   /locus_tag="Tmz1t_0468"
FT   CDS_pept        complement(530914..531183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0468"
FT                   /product="Phosphotransferase system, phosphocarrier protein
FT                   HPr"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: azo:azo3781 putative
FT                   phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53246"
FT                   /db_xref="GOA:C4ZL62"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR002114"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL62"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACK53246.1"
FT                   /translation="MPRGDAPIINKLGLHARASAKLTQLASSFPCEVWLERNGRRVNAK
FT                   SIMGVMMLAAARGSTITIDTQGEGADAALQAIQELVADRFGEGE"
FT   gene            complement(531237..531626)
FT                   /locus_tag="Tmz1t_0469"
FT   CDS_pept        complement(531237..531626)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0469"
FT                   /product="PTS system fructose subfamily IIA component"
FT                   /note="PFAM: PTS system fructose subfamily IIA component;
FT                   KEGG: azo:azo3780 putative IIA component of sugar transport
FT                   PTS system"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53247"
FT                   /db_xref="GOA:C4ZL63"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL63"
FT                   /inference="protein motif:PFAM:PF03610"
FT                   /protein_id="ACK53247.1"
FT                   /translation="MIGLFLVTHGTLGEALIQCVCHVLDKRPPLLGQLGLSAGEDPADA
FT                   LPLARRMIATVDDGEGVLLLADLYGATPCNVATRLIEPGRIELVAGVSLPMLLRVLTHR
FT                   DGNLDTLIRRAVSGAGDGVTRVQPG"
FT   gene            531839..532015
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0470"
FT   gene            complement(532120..533301)
FT                   /locus_tag="Tmz1t_0471"
FT   CDS_pept        complement(532120..533301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0471"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: dps:DP1829 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53248"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="InterPro:IPR040198"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL64"
FT                   /inference="protein motif:PFAM:PF02661"
FT                   /protein_id="ACK53248.1"
FT                   /translation="MIASEIPELALRVETDRFGPFLFQVGVDTGRLQLPMQRVEDAHRR
FT                   FIASPLAQVANQLEREVIASSIYGTNTIEGGTLTEDETRSAIDLDPAQVQEIEQRRVLN
FT                   IKAAYERARQAALDPGWKLSIDFMTEVHGLITHDLPHADNRPGLLRDTPKGRTAQVGSP
FT                   QHGGRYKPPQYGGDIWRLLEALITWHGQLEDAGIHPLVRAPLVHYYYELIHPFWDGNGR
FT                   VGRVVEATLLQAAGYEYAPFALARYYLEHIDAYFTLFNTCRKGADKHRPHPNTDFVLFH
FT                   QEGMLATIDALHDRVNRLVGVLLFQSRCRELLDNKTLNPRQYTIVSQLLAQGQAQGLDA
FT                   VRHAPWYASLYLKLNDKTRSRDLKKLRELELVLLDTDNRLWPGCIRPKNVKAP"
FT   gene            complement(533511..535136)
FT                   /locus_tag="Tmz1t_0472"
FT   CDS_pept        complement(533511..535136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0472"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azo:azo3779 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53249"
FT                   /db_xref="GOA:C4ZL65"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL65"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53249.1"
FT                   /translation="MLVAANITQQFGAKPLFENVSVKFGDGNRYGLIGANGAGKSTFMK
FT                   ILCGILDPSAGNVSKDPHERMAYLRQDQFAYEDMRVLDVVMMGHEELWAAIKERDAIYA
FT                   NPDATEDDYMHAAELEGKVGEYDGYTAEARAGELLLGVGIPTELHNGPMSEVAPGWKLR
FT                   VLLTQALFANPDILLLDEPTNNLDINTIRWLEDVLNNRDCTMVIISHDRHFLNQVCTHM
FT                   ADLDYGTITIYPGNYDDYMEASTMARERQSSANARAKDKIQELQAFVRRFSANKSKAKQ
FT                   ATSRLKLIDKLKPEDVKPSSRQYPWIRFDYDDKDKLHRLACEVDNISFAYPGMDKPLIN
FT                   RFSIAIEAGEKVAIIGENGVGKTTLLKLLVGELAPQKGAIKWAEKAKPGYYAQDHSADF
FT                   AEDVSLTDWIAPYSRITAAATGEDNETLLRGTLGRLLFSGDEVKKSVKVISGCEQGRML
FT                   FGKLMLSRPNVLLMDEPTNHLDMESIESLNTGLDKFNGTLVFVSHDREFVSSLATRIIE
FT                   IKLDHQIIDYRGTYEEYLSSQGLD"
FT   gene            535357..535521
FT                   /locus_tag="Tmz1t_0473"
FT   CDS_pept        535357..535521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0473"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   tbd:Tbd_2238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53250"
FT                   /db_xref="GOA:C4ZL66"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL66"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ACK53250.1"
FT                   /translation="MLHYAVVFFVIALIAAVFGFGGIAAGAAEIAKVLFVVFLVMAVAS
FT                   FVINLVKGR"
FT   gene            535611..536246
FT                   /locus_tag="Tmz1t_0474"
FT   CDS_pept        535611..536246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0474"
FT                   /product="two component transcriptional regulator, LuxR
FT                   family"
FT                   /note="PFAM: response regulator receiver; regulatory
FT                   protein LuxR; SMART: response regulator receiver;
FT                   regulatory protein LuxR; KEGG: tbd:Tbd_2237 two component
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53251"
FT                   /db_xref="GOA:C4ZL67"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL67"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK53251.1"
FT                   /translation="MLRIAIVDDHQIVRAGFRELLADELGLEIVFEAASGEAALESLRE
FT                   QPVDVLLLDLSLPGQSGVDVLRAVRQRYEGMRVLMLSGFPEERYALAMIRNGADGYLCK
FT                   DCSREALLQAIRTVAQGRRYVSARTAELLADELGGGGGGAPHEKLSDRELQVFLRLARG
FT                   ESVSDIAAVLNLSVKTISTYRTRLLEKLGVASNAELATYALRHGLILD"
FT   gene            536260..536691
FT                   /locus_tag="Tmz1t_0475"
FT   CDS_pept        536260..536691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0475"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; SMART: response
FT                   regulator receiver; KEGG: tbd:Tbd_2236 response regulator
FT                   receiver domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53252"
FT                   /db_xref="GOA:C4ZL68"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL68"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK53252.1"
FT                   /translation="MSAPLNSESATVPALRVVLVEDSAMLRGMLCEMLAELDGVGVVAE
FT                   AEDEQGALAALEAQRPDLAIIDLELRMGSGLGVLRQLQAEPERFGRPRAVVFSNYGHAP
FT                   VRARCEQLGVERFFDKSFQLDELIDFVQGAIPGIPGIPG"
FT   gene            complement(536698..538092)
FT                   /locus_tag="Tmz1t_0476"
FT   CDS_pept        complement(536698..538092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0476"
FT                   /product="histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="KEGG: azo:azo0568 putative sensory box histidine
FT                   kinase; PFAM: ATP-binding region ATPase domain protein;
FT                   CHASE3 domain protein; histidine kinase dimerisation and
FT                   phosphoacceptor region; SMART: ATP-binding region ATPase
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53253"
FT                   /db_xref="GOA:C4ZL69"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="InterPro:IPR011712"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL69"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACK53253.1"
FT                   /translation="MNADPEPLPLPPAPSRLPHPRAGRLIAVLLLSFVLGLAWLLAGQW
FT                   QSESSRVALEDLRARSVRLHHLDTLLLQMLDAESSVRGYLLTQNPVYLRPYQDGQAALE
FT                   STLAALRADTWADERQHETVDHLALLIDMRWSLLTQAIERGVPPGADQPDGGTGKQVTD
FT                   DIRTRILALRTATQAEIDATQDGAFARFGDARTMNRVLGASVLALLLVLVVVLYRQDRL
FT                   RERMAQLLRSENERLHTEVAHRTEELSSLATYLTNAREAEQARLARELHDELGALLTAA
FT                   KLDAAWIARKLPADTVAPMRSRFDRLLDTLNQGIALKRKVVAGLRPPLLSELGLLEALR
FT                   ALPDSGDIGEQGGRLAIELPDALPDVPAQTALALYRIAQEALTNVRRYAQASSVRLRLG
FT                   VEGDELVLAVEDDGVGFDPAARGHNRHGLAGMAHRVQMLAGRLEIDSAPGKGTRITARV
FT                   PFARMH"
FT   gene            complement(538203..538514)
FT                   /locus_tag="Tmz1t_0477"
FT   CDS_pept        complement(538203..538514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0477"
FT                   /product="transport-associated"
FT                   /note="PFAM: transport-associated; SMART:
FT                   Transport-associated and nodulation region; KEGG:
FT                   pna:Pnap_0916 transport-associated"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53254"
FT                   /db_xref="InterPro:IPR007055"
FT                   /db_xref="InterPro:IPR014004"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL70"
FT                   /inference="protein motif:PFAM:PF04972"
FT                   /protein_id="ACK53254.1"
FT                   /translation="MKHTAATLALSGLLAFTAVGCAVTRDQSTVGEYVDDATVTTRVKA
FT                   KFAEDPTVSAMSISVETLKGTVQLSGFAKSTAERNRAVEIARTTPGVKSVKNDIVIRP"
FT   gene            complement(538772..539227)
FT                   /locus_tag="Tmz1t_0478"
FT   CDS_pept        complement(538772..539227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0478"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mag:amb4284 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53255"
FT                   /db_xref="GOA:C4ZL71"
FT                   /db_xref="InterPro:IPR003251"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL71"
FT                   /inference="similar to AA sequence:KEGG:amb4284"
FT                   /protein_id="ACK53255.1"
FT                   /translation="MSYTMPEFLAHAIAMEREAAERYLELADMMEAHNNLEVASLFRDM
FT                   VRYSNMHGDSIVERAAGHELPRLKSWQYRWVAPTEVGDEDAFDYTMNAWQALEYARENE
FT                   ARAMNFYRTVSETSTDPEIKTLAMEFATEEADHTMALDKMIAQTQRP"
FT   gene            539568..539813
FT                   /locus_tag="Tmz1t_0479"
FT   CDS_pept        539568..539813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0479"
FT                   /product="prevent-host-death family protein"
FT                   /note="TIGRFAM: prevent-host-death family protein; KEGG:
FT                   sfu:Sfum_1406 prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53256"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL72"
FT                   /inference="protein motif:TFAM:TIGR01552"
FT                   /protein_id="ACK53256.1"
FT                   /translation="MNLEIGSYEAKTKLPELLRGVQAGKRYTITLRGEPIADLIPAEGA
FT                   KQADAAAAVDAMRQFMRVAPAVEGIDIKALINEGRA"
FT   gene            539810..540235
FT                   /locus_tag="Tmz1t_0480"
FT   CDS_pept        539810..540235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0480"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   sfu:Sfum_1407 PilT protein domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53257"
FT                   /db_xref="GOA:C4ZL73"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL73"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACK53257.1"
FT                   /translation="MSFVLDNSVAMCWLLADGKPADVAYAEAVLDALREQQALVPSLWA
FT                   LEASNMIARAEAKGLLTEARSQAFVVLLQRLNIATDPATAAHALGDTLHLARRHKLSAY
FT                   DAAYLELALRTGLPLATLDADLEKAAQAAGVEAFAPN"
FT   gene            complement(540238..540345)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0481"
FT   gene            complement(540730..542463)
FT                   /locus_tag="Tmz1t_0482"
FT   CDS_pept        complement(540730..542463)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0482"
FT                   /product="protein of unknown function DUF87"
FT                   /note="PFAM: protein of unknown function DUF87; KEGG:
FT                   neu:NE2095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53258"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL74"
FT                   /inference="protein motif:PFAM:PF01935"
FT                   /protein_id="ACK53258.1"
FT                   /translation="MPIFNFRDEEALGKVASVDTTNVIVEVENVDQLKRLQVNHLAVLQ
FT                   SSRPGQHLIGLITQVTRKRGIEEIINDSINGHASELNLCRIALIGTMLDRDGEKENVFR
FT                   RTLESVPEIDANCFSLESENLTGFMRTLSSVSAGGNALTLGKYTLDEHAVAYLNGNKFF
FT                   QRHAFIGGSTGSGKSWTTAKIIEQMSGLTTANAIVFDLHGEYSPLVGQGIQHFKVAGPA
FT                   DVEAKKTIGDGVLYLPYWLLSYEALVSMFVDRSDQNAPNQAMIMAREINQAKQRYLEEN
FT                   GQQDVLKHFTVDSPVPFDLDVLMGRLNDINVEMVPGAKVGTEKQGDFFGKLARMISRLE
FT                   NKISDRRLGFMFNGGGDVLDFTWLEKFTTAVLGSADENGKAGIKVINFSEVPSDVLPLI
FT                   VSLVARVTFSVQQWTPSELRHPIALLCDEAHLYMPQRNMADSADDISLDIFERIAKEGR
FT                   KYGVSLVVISQRPSEVNKTMLSQCSNFVSMRLTNAEDQGVIKRLLPDSLGGFSDVLPTL
FT                   DTGEALVVGDASLLPSRIRIDEPKNKPNSGTVNFWDEWQKPVKDNRLSIAVDNWRKQNI
FT                   Q"
FT   gene            complement(542473..543393)
FT                   /locus_tag="Tmz1t_0483"
FT   CDS_pept        complement(542473..543393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: neu:NE2094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53259"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL75"
FT                   /inference="similar to AA sequence:KEGG:NE2094"
FT                   /protein_id="ACK53259.1"
FT                   /translation="MSGMWALANHLVTNTDISGLNAAEIEAWQKFCQLLKDNVDLETAL
FT                   HQVTASEELTSRIVKATWILIDSEDSEIFQKSLQDNAIFPLSRLLEHMFKSSLKVINIV
FT                   TTNYDRLAEYACDHGRIHHYTGFTHGFCRQLAAPTEITSARRANIWKVHGSLDWFQSPL
FT                   EDTVALSNIQGIPDGYQPQIVTPGTQKYQKTHLEPFRSIINNADQALNEAGSYLCIGYG
FT                   FNDEHIQPKLMVKCLRQRTPITIITYTLSDSAKKIILDGKAQNYLAIERGETDDQSIVY
FT                   SSLDSAPLKVEKNIWSLEGYLSLIM"
FT   gene            complement(543732..545093)
FT                   /locus_tag="Tmz1t_0484"
FT   CDS_pept        complement(543732..545093)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0484"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:p1B277 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53260"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C4KAN4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53260.1"
FT                   /translation="MPRFEVKQSAKLNLTSYSGLALIGQCCQAAQVEAVIDPRLPVSQG
FT                   MRSSDLVKSVVGLLSLGKSDFEAIEPFRGDRFFKEALGLAKVPGSVWMRQRLDARAAEL
FT                   RELTDELSLRLLERTEAPITAHKGYVCADLDTFVMDNSDTKKEAVSRTYQGVDGYTPIA
FT                   LYLGNEGWNLGLELRAGSHHSALETEYFFERAFPRLRRVCAADAKLLWRADSGFDSARL
FT                   LFALADERDRWAALGRSFDYLTKWNPRRQDKTAWVDRAEAAGVFEEVRAGKRVGLLDLK
FT                   IDRAWKKAKRTLRLVVRVTERTIDKKGQHLLTPEIEIEGWWTSLEVAMADVIELYKHHG
FT                   THEQFHSEIKTDLDLERLPSGKFDTNDAVMHLAAFAYNCLRLIGQLGLTGELSPIRHPA
FT                   KRRRIKTVLQEVMYRAAKFVEHARRLVLDFGRGVAAHVKVFTTVQARLCAVASP"
FT   gene            complement(545584..550099)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0485"
FT   gene            complement(546625..547743)
FT                   /locus_tag="Tmz1t_0486"
FT   CDS_pept        complement(546625..547743)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0486"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   azo:azo2983 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53261"
FT                   /db_xref="GOA:C4KBH2"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR032806"
FT                   /db_xref="UniProtKB/TrEMBL:C4KBH2"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53261.1"
FT                   /translation="MSYLDEIDDPRKPSNGTLHDFREILVILIAAVLSDCDTVEDITFW
FT                   ARTKEAWLRRFLVLKNGIPSEETFLRILRALDPKQFENMFRRWVGGVVGALSDDAGLAG
FT                   TIAIDGKTVRGSGSGGESAIHMVSAFATELGLVLGQEKVAAKSNEITAIPELLEALSIK
FT                   GLLVTIDAMGCQKSIAKQIVAKKGDYLLMVKGNQPKLLEAIETAFIDQHGVESVDRSSL
FT                   VERGHGRTVGQIASVLSAKGIVDLADWPKCVTIGRIDSMRVVGDKQSDLERRYYISSRA
FT                   LSAEQLAAAIRAHWGVENRLHWILDVSFSEDASTVAKDNAPQNLSLLRKIALNIIRADK
FT                   TDTRKSSLRLKRKGAAWDDGVRERMLGIRAIC"
FT   gene            548091..549452
FT                   /locus_tag="Tmz1t_0487"
FT   CDS_pept        548091..549452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0487"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:p1B277 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53262"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C4KAN4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53262.1"
FT                   /translation="MPRFEVKQSAKLNLTSYSGLALIGQCCQAAQVEAVIDPRLPVSQG
FT                   MRSSDLVKSVVGLLSLGKSDFEAIEPFRGDRFFKEALGLAKVPGSVWMRQRLDARAAEL
FT                   RELTDELSLRLLERTEAPITAHKGYVCADLDTFVMDNSDTKKEAVSRTYQGVDGYTPIA
FT                   LYLGNEGWNLGLELRAGSHHSALETEYFFERAFPRLRRVCAADAKLLWRADSGFDSARL
FT                   LFALADERDRWAALGRSFDYLTKWNPRRQDKTAWVDRAEAAGVFEEVRAGKRVGLLDLK
FT                   IDRAWKKAKRTLRLVVRVTERTIDKKGQHLLTPEIEIEGWWTSLEVAMADVIELYKHHG
FT                   THEQFHSEIKTDLDLERLPSGKFDTNDAVMHLAAFAYNCLRLIGQLGLTGELSPIRHPA
FT                   KRRRIKTVLQEVMYRAAKFVEHARRLVLDFGRGVAAHVKVFTTVQARLCAVASP"
FT   gene            complement(550400..551353)
FT                   /locus_tag="Tmz1t_0488"
FT   CDS_pept        complement(550400..551353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0488"
FT                   /product="restriction endonuclease"
FT                   /note="PFAM: restriction endonuclease; DNA topoisomerase
FT                   type IA zn finger domain protein; KEGG: eba:ebA6362
FT                   putative endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53263"
FT                   /db_xref="GOA:C4ZL79"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR013498"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL79"
FT                   /inference="protein motif:PFAM:PF04471"
FT                   /protein_id="ACK53263.1"
FT                   /translation="MPRPYRKSRRDPGLIEIAATSDWKVSAAMAAVCVLAATVIIPALL
FT                   GSSRVLDSLVLIFVPLAWLMAVVFGGISLIRLLRQRPQDSPVPPRSPTNRPAQAAARAT
FT                   EASLPEVDKAPLAESFAPPTSAAAPEARPTAWSRELIDRIEWKRFEDLCCEFYRVKGIR
FT                   AETTRLGADGGVDIRLFQDAADPQRCTAVVQCKAWNQAVGVKPVRELRGVMAHERVDKA
FT                   FFMAPNGFTDEARSFAAENRITLLDGKLFLAMLERLPAALRRQLLDFATEGDWTTPTCP
FT                   SCGVKMAARDGTHGRFWGCVRFPKCRATLQMRGSAV"
FT   gene            complement(551487..552824)
FT                   /locus_tag="Tmz1t_0489"
FT   CDS_pept        complement(551487..552824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0489"
FT                   /product="Ferric reductase domain protein protein
FT                   transmembrane component domain protein"
FT                   /note="PFAM: Ferric reductase domain protein transmembrane
FT                   component domain; Oxidoreductase FAD-binding domain
FT                   protein; FAD-binding 8 domain protein; KEGG: eba:ebA3186
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53264"
FT                   /db_xref="GOA:C4ZL80"
FT                   /db_xref="InterPro:IPR013112"
FT                   /db_xref="InterPro:IPR013130"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL80"
FT                   /inference="protein motif:PFAM:PF01794"
FT                   /protein_id="ACK53264.1"
FT                   /translation="MIPTLSTLPALAAFVALVAAAWGLNVAALDGGIASLPWLIREQGL
FT                   YLSGLLAIGLMSLAMVLATRPTVLERPLGGMDRIFRLHKWAGILAAVFAALHWLIEMSD
FT                   DVIKSLYGKAGKPAHDEFGGLYEMLRDAGEELGEFAIYLVLAMVVLSLWKRFPYKFWRH
FT                   LHRAMPVFYLLLAFHAAVLAPPDYWTQPVGVLLALLLAAGTVASVIALTGRIGHDRKVQ
FT                   GVVTAVSSPAPDVTEIVCRLDGAWRGHQAGQFAFVGLERFEGSHPFTIASADHGDRSLT
FT                   FQIKALGDYTRQLASRVAVGQAVTVEGPYGRFVLGRQDHKARQIWIAGGIGVTPFLAWL
FT                   DALRADPAAAPTVELHYSTRGAAHDPFVERLRSLCAELPSVSLHIHDRAAGDDLTPERL
FT                   ATTATDGQRAEVWFCGPRGFGDQLKAGLARLWGRRLSFRREAFEMR"
FT   gene            complement(552989..553318)
FT                   /locus_tag="Tmz1t_0490"
FT   CDS_pept        complement(552989..553318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0490"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA7151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53265"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL81"
FT                   /inference="similar to AA sequence:KEGG:ebA7151"
FT                   /protein_id="ACK53265.1"
FT                   /translation="MRATTLIATLALTGGLIGAGAAIAPAFAQSVTPAASPAAATTPAA
FT                   QSSWMSLKDVQTKLEAAGYTDFREIERDKNKYEVKATDPQGQRVELDVDPVTGDVLKTE
FT                   VKRSK"
FT   gene            complement(553469..554353)
FT                   /locus_tag="Tmz1t_0491"
FT   CDS_pept        complement(553469..554353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0491"
FT                   /product="rRNA (guanine-N(1)-)-methyltransferase"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: tbd:Tbd_1059
FT                   rRNA (guanine-N1-)-methyltransferase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53266"
FT                   /db_xref="GOA:C4ZL82"
FT                   /db_xref="InterPro:IPR016718"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL82"
FT                   /inference="protein motif:PRIAM:2.1.1.51"
FT                   /protein_id="ACK53266.1"
FT                   /translation="MPATPFTALACPLDGAPLQRHGGSLRCADGHCFDLAAQGYVNLLP
FT                   VQNKRSRDPGDSKEMVAARRRFLEAGHYAPIAAAVARTVFEGAAPGQTLACLDAGCGEG
FT                   YYLRQLSAAAVVEARTLALAGLDISKWAVQAAAKRDLQDARSRAGADPSTAWIVGSNAG
FT                   LPVLPATLDRVLCMFGFPVYPEFARVLRPGGELLQVDAGPDHLRELREVIYPALKPERP
FT                   ASRAAPPGFEHLASDTLRFQIHVDGAAQIADLLAMTPHLYRASAEGRARAAALVALTMT
FT                   VDVRLARYRRQPG"
FT   gene            554473..556080
FT                   /locus_tag="Tmz1t_0492"
FT   CDS_pept        554473..556080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0492"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_1406 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53267"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL83"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_1406"
FT                   /protein_id="ACK53267.1"
FT                   /translation="MHASETLLNTLRRPGVLPGSEGGVELIETHISWVLLAGEHAWKLK
FT                   KPLDLGFLDFSTPARRREACEAELRLNRRTVPEIYEAVVAVRGSPEAPRLDGGGEPFDW
FT                   LLRMRRFDQAGLFSRLLDEGRLAPALFDRLARHVAAFHAAAAVALPGGAFGDAAAVHAP
FT                   VRQNFAQMREHLDPGVHADLLAMLARVEAWAEAQYAALAPVFAVRLAEGRVRECHGDLH
FT                   LGNLVVLDGEPRLFDAIEFSAELRWTDVVADVAFLVMDLQARGRAALGWRFLNAWLERC
FT                   GDYAGLRVLPYYLSYRAMVRAKIAAIRASQLDGAERSESVDECRRYLALAEAQRALGAP
FT                   ALLVACGVAGAGKTSQSQALVEAGGVIRVRADVERKRLAGLAAEATSGSGLGGGLYTPE
FT                   ATARTYARLAVLARVVLEAGRPVLVDATFLKRAQRAAFAGLAQELGVPFAILAFDAPED
FT                   VLRARVRARLAAGGDASEADEAVLEAQLRSREGFAAEELARVLPIDTRPVPDWRSLLPA
FT                   LSRLWPGAPRTDGRLTSN"
FT   gene            556154..557245
FT                   /locus_tag="Tmz1t_0493"
FT   CDS_pept        556154..557245
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0493"
FT                   /product="membrane-bound metal-dependent hydrolase"
FT                   /note="PFAM: membrane-bound metal-dependent hydrolase;
FT                   KEGG: eba:ebA4590 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53268"
FT                   /db_xref="GOA:C4ZL84"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL84"
FT                   /inference="protein motif:PFAM:PF04307"
FT                   /protein_id="ACK53268.1"
FT                   /translation="MDTLTHALSGALVGRVLASRRPAAGTRAANAAAVPVWQMVVAGTA
FT                   AAIFPDLDFVLGWISELTYLRGHRGVTHSLILLPLWGVLIAWLLARFWQRGGRVAAGWR
FT                   SFYPVVCAAIFVHILGDLITQFGTMILAPFSDHRFGWGTSFIIDLPFTGILLAGLLASA
FT                   LWRSSRVPATAALVLLAGWVGVQATGRAEAIDAARAYAAAKGIAAVEVDAAPRPASPFN
FT                   WTAIVFDGERYHYAHLNTRRSEPLLATEDDNFIRRFSAPYLPVAMAQWEVRERFGTGST
FT                   RALAEQVWNAEDFAFYRWFAMFPVLDHAGEAGDGQACASFKDLRFLTPGRDAQPFIYGL
FT                   CNAAGGWRLFEREAGGLRWIDPR"
FT   gene            557242..557874
FT                   /locus_tag="Tmz1t_0494"
FT   CDS_pept        557242..557874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0494"
FT                   /product="alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen"
FT                   /note="PFAM: alkyl hydroperoxide reductase/ Thiol specific
FT                   antioxidant/ Mal allergen; Redoxin domain protein; KEGG:
FT                   dar:Daro_3452 suppressor for copper-sensitivity D,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53269"
FT                   /db_xref="GOA:C4ZL85"
FT                   /db_xref="InterPro:IPR013740"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL85"
FT                   /inference="protein motif:PFAM:PF00578"
FT                   /protein_id="ACK53269.1"
FT                   /translation="MTKPTDDMGDSRPAPAPHAEAEGAGARSPANAECETAEPVRKPPR
FT                   WRRWGVEIGIFVVIFFAVQAWMARDVPAGLAPDFATVAADGRGLSLAEWRAAHPGKAVG
FT                   VYFWADWCPICTAQQGTIDGVQADHPVLTVAMQSGGAAEVTGVLAERGLAWTTAIDADG
FT                   RIAEAYGLRGVPAFVIVDPAGKIRSVSLGYATGWGLRARLWWAGLQS"
FT   gene            557914..558219
FT                   /locus_tag="Tmz1t_0495"
FT   CDS_pept        557914..558219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afe:Lferr_1417 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53270"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL86"
FT                   /inference="similar to AA sequence:KEGG:Lferr_1417"
FT                   /protein_id="ACK53270.1"
FT                   /translation="MSNMKATPLIRRRVVLAPDAFAEIAVWRVPEPVPPSGHPFKYRLA
FT                   YVVGGECGLRYDNERGKGDHRHYGDTEAEYVFSDPDQLTRDFGADIARWNHEHGRS"
FT   gene            558200..558547
FT                   /locus_tag="Tmz1t_0496"
FT   CDS_pept        558200..558547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0496"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: afe:Lferr_1418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53271"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL87"
FT                   /inference="similar to AA sequence:KEGG:Lferr_1418"
FT                   /protein_id="ACK53271.1"
FT                   /translation="MNTVVLEVRSLTDTLADAARAMKTGRGDAQVRIAFATPELLWKVL
FT                   SAKRWELLKALCAAGPVSIREAARRVGRDVKAVHGDVTALLDAGVLLRTEDGRIEFPFD
FT                   AVKVEFLLQAA"
FT   gene            558560..559540
FT                   /locus_tag="Tmz1t_0497"
FT   CDS_pept        558560..559540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0497"
FT                   /product="BAAT/Acyl-CoA thioester hydrolase"
FT                   /note="PFAM: BAAT/Acyl-CoA thioester hydrolase; KEGG:
FT                   pna:Pnap_2823 dipeptidyl
FT                   aminopeptidases/acylaminoacyl-peptidases-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53272"
FT                   /db_xref="GOA:C4ZL88"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL88"
FT                   /inference="protein motif:PFAM:PF08840"
FT                   /protein_id="ACK53272.1"
FT                   /translation="MGAPGLIAAFTAGAATLAGGRALVHWGIRKGLAAPRVPHHTDPGA
FT                   LGLAFETLRIGTEHGKSLHAWFIPAPGSACDGSDHAASPGADLADGERDDARAEFESAP
FT                   AVVVMHGWGGNAALMLPLARPLHEAGYAMLFVDARCHGASDDDSFASLPRFAEDAEHAF
FT                   AWLAAQPGVDPARIALLGHSVGAGAVLFAALRTPQVAAVVSVAAFSHPAAMMRRWLAGK
FT                   RIPEKPLGRYILDYVQKTIGHRFDDIAPVNTIARIRRPVLLVHGADDEVVPIDEAMQIY
FT                   AMRGDTPVELMTLSGDHESFVDLEHHVGRLVEFLGRVLAQGGARE"
FT   gene            559939..560970
FT                   /locus_tag="Tmz1t_0498"
FT   CDS_pept        559939..560970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0498"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: azo:azo0240 putative
FT                   C4-dicarboxylate-binding periplasmic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53273"
FT                   /db_xref="GOA:C4ZL89"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL89"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ACK53273.1"
FT                   /translation="MQKRRFTALIAGLFASTALGFSMPATAQQYKDEYKLSTVLGEAFP
FT                   WGWGAKRWADLVAEKTEGRIKIKVYPGTSLVSGDQTKEFTALRQGIIDMAVGSTINWSP
FT                   QVKELNLFALPFLMPDHKAIDALTQGRVGKKMFDILAERDVVPLAWGENGFREVSNSKK
FT                   PIRTPEDVKGMKMRVVGSPLFLATFNALGANPTQMSWADAQPAMATGAVDGQENPLAVF
FT                   NAAKLHTVGQKNLTLWGYVADPLIFVVNKSVWNSWSEADRKAVSEAAQQAAKEEIARAR
FT                   AGISAADDALLKEIEANGVAVVRLTDAERDAFRQATAGVYKEWAEKIGADLVKQAEEDI
FT                   AKR"
FT   gene            561050..561535
FT                   /locus_tag="Tmz1t_0499"
FT   CDS_pept        561050..561535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0499"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: azo:azo0241 DctQ1
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53274"
FT                   /db_xref="GOA:C4ZL90"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL90"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ACK53274.1"
FT                   /translation="MNIESPPHDAESPASYTIEQILSGTVMGLIVLITFGNVLARYFTS
FT                   QSFAATEEFSIALLIVLSFLGSSAAFAFDRHIRVDFFVRKLPPGLRAFADWLSFAVTAS
FT                   LFAFIAFYAGKLTWDQYRFEETSPALGVPQWWYTVWMPVLAAALVLRLVLTRVRGRA"
FT   gene            561532..562815
FT                   /locus_tag="Tmz1t_0500"
FT   CDS_pept        561532..562815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0500"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: azo:azo0242 TRAP-type
FT                   C4-dicarboxylate transport system, large permease
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53275"
FT                   /db_xref="GOA:C4ZL91"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL91"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACK53275.1"
FT                   /translation="MIGSVLIGLFLLALLAGMPLATGLGVASIAVLAMAGFDQLAVPTN
FT                   IYAGIAKYPLLAIPMFILAGMIFERSGVAIRLVRFVTAIVGEWTGSLAVVAVLVSMLLG
FT                   GISGSGPADAAAVAAVMLPSMIARGYPKGFSAGLIAASGSTAIVIPPSVAFIVYSVMVP
FT                   AATVPALFAAGLFPGIVAALCLLVPAIVISRKYGFGRDYKAARPPLGKSFIEAIWGLLA
FT                   PVIILGGLRTGIFTPTEAAVVAVAYGIFVGMVVYRSISFRGLFRVLVEAGELSAVVLMI
FT                   IGIASVFAWAGNTLGIFDAAAKALVGLHSSEWLMLLSINLLLLAAGMFLDAISIFLILL
FT                   PLLVPIAVAMGWDLVWFGVMMTINLAIGQFTPPMAISLMITSRIAGIGMEETFKWVIWL
FT                   VLAMGAGLTLMIVFPQLALWLPGKLGYL"
FT   gene            complement(562889..563290)
FT                   /locus_tag="Tmz1t_0501"
FT   CDS_pept        complement(562889..563290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0501"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: glo:Glov_2504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53276"
FT                   /db_xref="InterPro:IPR009337"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL92"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53276.1"
FT                   /translation="MNRLLACAAAALLLSACASTEKELADKGIKPLDAAKVRILLSGNT
FT                   ATGTTASGSGFMIYNAPDGTTRGKSGNSSDTGKWDVTADGQHCNHWTSWRGGERRCARL
FT                   YEADGEIRYFDGGNYAGRFKIEQGNPYKL"
FT   gene            complement(563419..565741)
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0502"
FT   gene            563968..565329
FT                   /locus_tag="Tmz1t_0503"
FT   CDS_pept        563968..565329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0503"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   eba:p1B277 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53277"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:C4KAN4"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACK53277.1"
FT                   /translation="MPRFEVKQSAKLNLTSYSGLALIGQCCQAAQVEAVIDPRLPVSQG
FT                   MRSSDLVKSVVGLLSLGKSDFEAIEPFRGDRFFKEALGLAKVPGSVWMRQRLDARAAEL
FT                   RELTDELSLRLLERTEAPITAHKGYVCADLDTFVMDNSDTKKEAVSRTYQGVDGYTPIA
FT                   LYLGNEGWNLGLELRAGSHHSALETEYFFERAFPRLRRVCAADAKLLWRADSGFDSARL
FT                   LFALADERDRWAALGRSFDYLTKWNPRRQDKTAWVDRAEAAGVFEEVRAGKRVGLLDLK
FT                   IDRAWKKAKRTLRLVVRVTERTIDKKGQHLLTPEIEIEGWWTSLEVAMADVIELYKHHG
FT                   THEQFHSEIKTDLDLERLPSGKFDTNDAVMHLAAFAYNCLRLIGQLGLTGELSPIRHPA
FT                   KRRRIKTVLQEVMYRAAKFVEHARRLVLDFGRGVAAHVKVFTTVQARLCAVASP"
FT   gene            565940..567139
FT                   /locus_tag="Tmz1t_0504"
FT   CDS_pept        565940..567139
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0504"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   tbd:Tbd_1418 secretion protein HlyD"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53278"
FT                   /db_xref="GOA:C4ZL94"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL94"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACK53278.1"
FT                   /translation="MKTSSQPLFRSAAAVALSALVLAACSGGKEQQGGAPGAGAPLQAP
FT                   AVTVMTVASGSVPMVTELPGRTTPYLIAELRPQVTGILTQRAFDEGSEVKAGQVLYRID
FT                   DAPYQAAHDSAKAALARAEANAQVARIKAERHAGLVKIDAVSKQANDDTQAALKQAQAE
FT                   VAAAKAALDKARIDLDYTRLKSPISGRIGRSAVTPGALVTANQTQALATVQQLDPIYVD
FT                   LTQSSADMLRMRAEIAAGRMQTGAKGEVPVKLILEDGSEYAVEGRLALSEVTVDEGTGS
FT                   VTLRAKFSNADGVLLPGMYVRARLPQGTRSDAILVPHKALSRDPLGNALVMVVNAESKV
FT                   EARPVKVAQSLGSDWVVTGGLAAGERIIVEGLQKARPGAPVQAQEAGAQPAAAPAATAS
FT                   "
FT   gene            567151..570306
FT                   /locus_tag="Tmz1t_0505"
FT   CDS_pept        567151..570306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0505"
FT                   /product="transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family"
FT                   /note="TIGRFAM: transporter, hydrophobe/amphiphile efflux-1
FT                   (HAE1) family; PFAM: acriflavin resistance protein; KEGG:
FT                   eba:ebA1972 acriflavine resistance protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53279"
FT                   /db_xref="GOA:C4ZL95"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR004764"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL95"
FT                   /inference="protein motif:TFAM:TIGR00915"
FT                   /protein_id="ACK53279.1"
FT                   /translation="MARFFIDRPIFAWVIAIVIMLGGALSIRQLPVSQYPSIAPPAIVI
FT                   NAKYPGASAKAVEDSVTQIIEQKLTGLDGLLYMKSTSDAYGNASTTLTFSADTDPDIAQ
FT                   VQVQNKMQTALPLLPQAVQQQGVTVAKSAMNFLMVVGFVSADGSMDGTDLSDFLVSSVQ
FT                   DPLSRVDGVGEVQVFGAQYAMRVWIDPARLTNYRLTPGDVRTALMAQNTQVSAGQLGGA
FT                   PAVPGQGFTATITAQSRLQTVAEFEDILLRSSQQGGEVRLKDVARIEIGAENYGTVARF
FT                   NGQPAAGVGIRLASGANALDTATAVRARLDEMKRYFPEGVQYVVPYDTTPFVKISIESV
FT                   VMTLIEAVALVFLVMYLFLQNFRATLIPTMAIPVVLLGTFGLMAAFGFSINTLTMFGMV
FT                   LAIGLLVDDAIVVVENVERVMTEEGLPPKEATKRSMDQITSALVGIGLVLSAVFVPMAF
FT                   FGGSTGVIYRQFSITIVSAMALSVLVAIVFTPALCASILKPVEKGHEHGEGGLFGRFFH
FT                   WFNVKFERSTKGYESAVGGILGRSVRFLAIYLAIVAVLGLLFVRMPTSFLPEEDQGVMF
FT                   NQIMLPAGATQERTLAVLEKVEHHFLENEKDTVRAIFTVAGFSFGGSGQHMGIGFVNLK
FT                   HWDERKAPGKDVKSVAGRAMGAFAQIREAMVFAFVPPAVIELGTSGGFTVQMQDRSGLG
FT                   HDALLAARNQFLGMAAQDKRLVGVRPNGQEDMPELKLDIDHAKAGALGLSVADINDTLS
FT                   TAWGGSYINDFLDRGRIKKVYLQGDAGSRMTPEDLDKWYVRNKAGDMVPFSAFATAHWT
FT                   YGSPRLERFNGQPSMELLGQAAPGLSSGEAMQAVEEIMAKLPPGIGYDWSGTSYEERRS
FT                   GSQAPALYALSLLVVFLCLAALYESWSVPFAVMLVVPLGVLGALLAASGRGLSNDVYFQ
FT                   VGLLATIGLSSKNAILIVEFAKAQMEEGKDLISATLTAVRMRLRPIIMTSLAFGFGVLP
FT                   LAIATGAGAGSQNAIGTGVLGGTIGATLLGLFFVPLFYVVIKRIFPDKPKGEAVAPIAQ
FT                   EGR"
FT   gene            570308..571786
FT                   /locus_tag="Tmz1t_0506"
FT   CDS_pept        570308..571786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0506"
FT                   /product="RND efflux system, outer membrane lipoprotein,
FT                   NodT family"
FT                   /note="TIGRFAM: RND efflux system, outer membrane
FT                   lipoprotein, NodT family; PFAM: outer membrane efflux
FT                   protein; KEGG: tbd:Tbd_1416 RND efflux system outer
FT                   membrane lipoprotein NodT"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53280"
FT                   /db_xref="GOA:C4ZL96"
FT                   /db_xref="InterPro:IPR003423"
FT                   /db_xref="InterPro:IPR010131"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL96"
FT                   /inference="protein motif:TFAM:TIGR01845"
FT                   /protein_id="ACK53280.1"
FT                   /translation="MKTHAKALLVPDSVPVSSARRGRAATPLRSLVVALAAATLGACSM
FT                   IPVFERPAAPVPATFPQATPTAAPVVAPLADTIAWRDYFADQRLREVIALALENNRDLR
FT                   VAALNIERARAQYGIQQADLFPSIAVSGGQSAQRVPGDLSMTGDSNVSRQYSANLGFAS
FT                   YELDFFGRVRSLEEQALQNYLATEEARRSAQISLVAEVANAWLRLAADRERLALAHNTR
FT                   QTRQASFDLVRRSLELGAVSALDVHQAETLLQSARADAARFETVVAQDRNVLAQLVGGG
FT                   VPDTLLPDGLEQAVATVAELPAGVPSEVLTRRPDIVQAERALLAANASIGAARAAFFPR
FT                   ITLTASAGTASSTLDGLFDGGSGAWSFVPQLRLPIFEAGRLQASLDLAEIQRDINVAQY
FT                   EKAIQSAFREVADALAERATVAERIDARRKQVAATQNSFKLSDARYRGGVDSYLSLLDA
FT                   QRSLYAAELELIGVRLIEATNRVELYKALGGGWQ"
FT   gene            572028..573161
FT                   /locus_tag="Tmz1t_0507"
FT   CDS_pept        572028..573161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0507"
FT                   /product="cobalamin synthesis protein P47K"
FT                   /note="PFAM: cobalamin synthesis protein P47K; cobalamin
FT                   synthesis CobW domain protein; KEGG: azo:azo0455 putative
FT                   cobalmin snthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53281"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL97"
FT                   /inference="protein motif:PFAM:PF02492"
FT                   /protein_id="ACK53281.1"
FT                   /translation="MNIPAQSADVDRRIPVTLLTGFLGAGKTTLLNHLLRQPQMEGSAV
FT                   LINEFGAVGVDHHLVEKVDESLVVLDSGCICCSVQGDLVRALKSLFMRALRRELKGLRR
FT                   VLIETTGLADPAPVIHTLMAEPFLSERYRLDGVVTAVDLTHAREQLAHHNEAVRQVAMA
FT                   DRVLLTKGDLAADAMRAEVGALVAALNPGARQIEVAGGEVGPEAVFGCGLYDPAGKTPD
FT                   VAAWLGEEAVRAAHRAPVAPLWRRPGRSGAGVHSLTAAEQENSRHTPGVSAFVLVFDEP
FT                   LDWFGFSDGLALLLQVYGGRILRIKGLLNVAGDPLPRVLQCVQHSVYPASSLPAWPDSA
FT                   PYDDRRSRLVFIVRELAEDEVISILGSFTGQLPRRTD"
FT   gene            complement(573241..573726)
FT                   /locus_tag="Tmz1t_0508"
FT   CDS_pept        complement(573241..573726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0508"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_4066 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53282"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL98"
FT                   /inference="similar to AA sequence:KEGG:Daro_4066"
FT                   /protein_id="ACK53282.1"
FT                   /translation="MQHTSTVRLALLALVLAGSLGATAAHAEALACPTLSTATQVQPCP
FT                   TEDELKYTYTGYCSDNARLYGRDVLTCASFENYKEVKNVALWEAEGGKFDGYLSCNVDA
FT                   ASIKASKAQKLSVERVKTLTRVICDYENDHRLVHRTKSECVVEAADCSGAECKARCD"
FT   gene            complement(573792..574268)
FT                   /locus_tag="Tmz1t_0509"
FT   CDS_pept        complement(573792..574268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0509"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   azo:azo1111 putative hemerythrin-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53283"
FT                   /db_xref="GOA:C4ZL99"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZL99"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACK53283.1"
FT                   /translation="MSTDLFHWTDEFSIGLQEIDEQHKELVELLNQLHVAIKEHHGSTT
FT                   SRQILDKLADYTRTHFAVEESLMRVSNYPEFATHKQNHEDLIAQVQALQDKLDSGQATI
FT                   TFELLHFLKVWLTRHINEADKRFGAYFVEAGGASKWSDHVEQAMKKRKWWWKFW"
FT   gene            574408..575931
FT                   /locus_tag="Tmz1t_0510"
FT   CDS_pept        574408..575931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0510"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA138 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53284"
FT                   /db_xref="GOA:C4ZLA0"
FT                   /db_xref="InterPro:IPR021296"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA0"
FT                   /inference="similar to AA sequence:KEGG:ebA138"
FT                   /protein_id="ACK53284.1"
FT                   /translation="MRFAGEVVILPLPDFADLSSGPRVPTSFPPNSLSLRWLAELVRRH
FT                   EERHPPLDEARAHAEARAVAGDLEARVLRRAAVLEAAGGWREAIQRWQGRARLLLVLAC
FT                   VLAFVFGFGAAAGALGDGTRPVNVVWTLGGLLGVHLLSLLLWLASLMLQGRAQGGALQH
FT                   GGLLGRAWLAVTGWLDRSREAADLPLALGGLLGSGRSAAWGVGAANHALWFGALSGATL
FT                   GVLALLATRRYGFVWETTILPADTFVALSAALGALPGMLGFPVPDAATVLASGDAPMLD
FT                   EAGRRAWAGWLVGAMTIYGVLPRLALALLCFGLWRRATRALALDLGRPGYARLRPLLMP
FT                   DSERIGVRDPEPAAMPHPQRHAAVAHGDGGAVAVALELGDDLAWPHALAGAHDAAVALA
FT                   WQDGGRLDSREQRRSVRARFAAHPPVRLVVAVDARQTPDRGSLGLIAELADHAQATRIW
FT                   LAGVDAAAEQAGRLRQWREGLAGIGLGEAAALADAGAACGWLERGDEAR"
FT   gene            575928..577316
FT                   /locus_tag="Tmz1t_0511"
FT   CDS_pept        575928..577316
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0511"
FT                   /product="GTP-binding protein HSR1-related"
FT                   /note="PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   azo:azo0252 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53285"
FT                   /db_xref="GOA:C4ZLA1"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR021871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA1"
FT                   /inference="protein motif:PFAM:PF01926"
FT                   /protein_id="ACK53285.1"
FT                   /translation="MNDILRVAVVGHTNTGKTSLLRTLARDVGFGEVSDSAGTTRHVEG
FT                   LRLMADGVPAAELFDTPGMEDAIALLEFIDDLVDPGERVDGPERVARFLARDEAAGRFE
FT                   QEAKVLRQMLASDAALYVVDARDPVLPKHRDELELLAACARPLLPVLNFIADPVARADD
FT                   WRGALARLGLHAVVSFDTVAPPLDGERELFDTLATLIHSHRGRLQALIEARAREAAARR
FT                   EAARRLVAELLVELAARRDRLADSEDDEAALQRAVERLRADVRSREQACVDALLRLYRF
FT                   RADDARMAELPLADGRWDDDLFNPETLRQMGVRLGTGAAAGAAAGVGIDLMTGGLTLGA
FT                   AAALGAIAGGLWQTFGHYGERLAAKLRGHRELTVDDAILRIVALRQRSLLVALDGRGHA
FT                   AVKPIELDAGRAGMPMIADPVSVRWRKDALPEAIGRARAHPEWAEADGGHKDEAIAELA
FT                   RSLA"
FT   gene            complement(577441..577719)
FT                   /locus_tag="Tmz1t_0512"
FT   CDS_pept        complement(577441..577719)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebD23 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53286"
FT                   /db_xref="GOA:C4ZLA2"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA2"
FT                   /inference="similar to AA sequence:KEGG:ebD23"
FT                   /protein_id="ACK53286.1"
FT                   /translation="MSNKHRHTLEAIFRDPPAGNLHWREVESLLSHLGAEVESGHGARF
FT                   RVVLNRREFYLHHPHHGSDFGKQAVKDLREFLASAGVSPSSYQDGTG"
FT   gene            complement(577754..579130)
FT                   /locus_tag="Tmz1t_0513"
FT   CDS_pept        complement(577754..579130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0513"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="PFAM: protein of unknown function DUF1555; KEGG:
FT                   rfr:Rfer_1047 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53287"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA3"
FT                   /inference="protein motif:PFAM:PF07589"
FT                   /protein_id="ACK53287.1"
FT                   /translation="MSAPRAYRFLLALAAAATVSSSHAAAIASQPFDIGVDMVQVFNDR
FT                   LGAGRFFAGAGTDRLRVSARVTPSPDTDFYDQSSNGGETAIFVTHPSTPGLDTRLQFVG
FT                   LQSGGGGGKNDYTTTFNLANPFVQGQLAAWDATPFALRIENPSAPGGETTKWVTAPDYD
FT                   SSVNLPFLQDVAITGGGLAPTLSWTVPDTTAPITNIRIQLRRIDAEEPGRITAATLVHE
FT                   AVLPLGSNGYTLDQAFSNGGLPGLPSGLEQGSKYEVAVILESAEPGLIKGRARTFFEFT
FT                   PLTDDAGDRTIYLPSVDSAGNFNFDIEVRAGETILIDPVVAVGYDYQIGSGDPLFASVT
FT                   LPNVGDGIFELWLYDLNLADFVFETFLDAGERFDFTGGGVDRFRVLGIEPSAGLDPTDV
FT                   QAFVTEIGFTGNGRFTGRMTPITTNFTPVPEPSSLALLALAVLALGGLRRSCRAGGSLR
FT                   "
FT   gene            579390..580445
FT                   /locus_tag="Tmz1t_0514"
FT   CDS_pept        579390..580445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0514"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53288"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA4"
FT                   /inference="similar to AA sequence:KEGG:azo2584"
FT                   /protein_id="ACK53288.1"
FT                   /translation="MKVTASSVELQSSHRFAQSLETRERLEVWRGTRDSGSAAESTQPP
FT                   VVALSAAGQNALAAESVTAAVDAVAEEAVEDDPRLAMLIRMIEFLTGEPVRRFSMRDLQ
FT                   SADAAEPGYETGANPGTSGQAGARRAGFGLEYDFSSRFSETETIAFGAAGVVRTADGAE
FT                   IRFELGFEMSRSYTESVAVSVRAGDQRLKDPLVLDFGGPAAALSEVRFDFDLDSDGTRE
FT                   KLPLVSGSGFLAFDRNANGRIDDGRELFGPASGDGFSELARLDDDANGWIDEADAAWSQ
FT                   LRVWRPDAAGKGSVRSLSEAGVGALHLGRVATPFSLKGAANDTQGVMRASGVYLREDGG
FT                   VGTLSQVDLKV"
FT   gene            complement(580622..582298)
FT                   /locus_tag="Tmz1t_0515"
FT   CDS_pept        complement(580622..582298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0515"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53289"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA5"
FT                   /inference="similar to AA sequence:KEGG:azo3863"
FT                   /protein_id="ACK53289.1"
FT                   /translation="MARTHPEGWRLLPAEGARGRELATLARLAAALPEDTTIYHSLHWT
FT                   RAEGRTAVFGEVDFAVVGPGGRVLLVEQQAGFLDETPTGLLRPGRRRAAQLSVELARNA
FT                   DALRARLRPLLDGTEPVLDVLLHCPDHCVRQPGTAGLDPERIVDAGRRDQLPAIVAALT
FT                   RPQEGDPALDAAHRQALHRFFADLLELVPDVQSHIGQVEDLTTRLSGGLTEWARRIVVE
FT                   PHRLRVTATAGSGKTQLALAAYTDALAAGRRPLYVCYNRPLADHFARIAPAGGEIATYH
FT                   QLCDRRVRDAGRKPAFGAPGAFRRMEADFATLVREQPDPAWQFDELIIDEGQDFTEPWR
FT                   DALLALLKPAGRAWWLEDPLQNLYDRPPVALPGWVGLSADTNYRTPADVLALLNARLPL
FT                   PAPVRAGSPVTDSEPEIFAWRDEAGLMDATKRAITRALGLGFRRDAIVLLTFRGREHSR
FT                   FTPLDHLGPHRLRAFTGRYDLLGEPEHSQGELLIDSVYRFKGQSAPCILFTEIDFETTG
FT                   GRMDELTMRKLFVGATRATMKLILVASERAAAALAPVAEAG"
FT   gene            complement(582307..582447)
FT                   /locus_tag="Tmz1t_0516"
FT   CDS_pept        complement(582307..582447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53290"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53290.1"
FT                   /translation="MGEAIRPLRPATVKADERHYILDMNPEAFELPSCQRIVARLFEPI
FT                   D"
FT   gene            complement(582513..583532)
FT                   /locus_tag="Tmz1t_0517"
FT   CDS_pept        complement(582513..583532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0517"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="KEGG: cbc:CbuK_1348 hypothetical cytosolic protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53291"
FT                   /db_xref="InterPro:IPR025587"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA7"
FT                   /inference="similar to AA sequence:KEGG:CbuK_1348"
FT                   /protein_id="ACK53291.1"
FT                   /translation="MPASAAQDDYDSPWKEAVEHAFPEFIDFYFPDAGRQIDWARGHRF
FT                   LDKELQQIVRDAALGRRHVDKLASVTTHAGEEDWLCVHIEVQGSMDPDFARRMFVYNYR
FT                   IYDSYDRPVASLAVLADDDPAWRPDRFGYERLGCRHNLQFPVAKLVDHAADEAALLCNP
FT                   NPFALVTAAHLYTRRTRRSPIARFDAKRRLVRLLYERDWTRQRILDFFSVLDWMMRLPR
FT                   EFEQRLWQDIENIEGERKVKYVTSVERLAIERGLQKGMEQGLEIGIEKGIEQGIEKGIE
FT                   KGRAQGSASVLLRLLNRRFGPLSPDIIRRLSQSTPEQLEIWAERVLEARTIDEVFAGN"
FT   gene            583712..584305
FT                   /locus_tag="Tmz1t_0518"
FT   CDS_pept        583712..584305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0518"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: dac:Daci_4011 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53292"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA8"
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /protein_id="ACK53292.1"
FT                   /translation="MPLTLAAPVHSELIIKKSRFIGCVQPMSDRAGAQKVVAALWAQHP
FT                   GARHVCWALLAGGQSAAVDDGEPSGTAGRPMLDVLRHQDLEGVLATVVRYFGGVKLGAG
FT                   GLVRAYMDAVAQALLEAEKVPIVRLATLRCVVPYAMEGLLRRELDAAGASLLAVAHGQA
FT                   VELCFSLPEDAAAALRARLAEAGQGRIEWIAEVE"
FT   gene            complement(584532..585302)
FT                   /locus_tag="Tmz1t_0519"
FT   CDS_pept        complement(584532..585302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0519"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: azo:azo0043
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53293"
FT                   /db_xref="GOA:C4ZLA9"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLA9"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACK53293.1"
FT                   /translation="MNKTINLNADLGESFGPWTMGEDEALLQVVRSANIACGFHAGDPV
FT                   VMRHTVRTALAAGVSLGAHPAYPDLQGFGRRPMKMAPAELEAMIIYQVGALAGMAAAEG
FT                   GRITHVKPHGALNNQACEDAALADAVARAVKAIDPGLILLAPVLSELHAAGARAGLRVA
FT                   GEVFADRAYTDKGTLVPRGQPGAVIHDHDELVTHVLRMLEAGGVVSQSGKVLPTSMDSI
FT                   CVHGDTLGAVESARHLRTELEARGWTIAPLPQLS"
FT   gene            complement(585397..586449)
FT                   /locus_tag="Tmz1t_0520"
FT   CDS_pept        complement(585397..586449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0520"
FT                   /product="urea amidolyase related protein"
FT                   /note="KEGG: azo:azo0044 hypothetical protein; TIGRFAM:
FT                   urea amidolyase related protein; PFAM: Allophanate
FT                   hydrolase subunit 2; SMART: Allophanate hydrolase subunit
FT                   2"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53294"
FT                   /db_xref="GOA:C4ZLB0"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB0"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ACK53294.1"
FT                   /translation="MSTRTEVEILSPGAFASIQDGGRRGHRRIGVPWAGVLDRRLMRIA
FT                   NALAGRAEDAAVIECFDGGLHVAASGGAVKLAVAGDAVVEVEGTEGRRQLAPWRSVTLA
FT                   DGEQLRIRKMEGGRIAMVAIVGLEPAAVMGSASTYARAGIGGVDGRALGAGTRLALSAD
FT                   ADPWDSDRVLAQSPAADTGPIRLVPGPQADHFSPTALDALVGGEYRVTTEADRMGIRLE
FT                   GAQLEHAGAAEIVSDATVPGSIQVPGAGQPIVLLADAQTAGGYPKIATVIGADLGRLAA
FT                   LRPGQSLRFAAVSAAEGACIARAAETETRALIASIRALPPDGIDLMALYTGNLVDGVVH
FT                   ALGTEYRPLY"
FT   gene            complement(586446..587207)
FT                   /locus_tag="Tmz1t_0521"
FT   CDS_pept        complement(586446..587207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0521"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; SMART:
FT                   Allophanate hydrolase subunit 1; KEGG: azo:azo0045
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53295"
FT                   /db_xref="GOA:C4ZLB1"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB1"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ACK53295.1"
FT                   /translation="MSFRILDAGDAALTIEFGSIIDPALLAEVNALDAAVLRRKQAGEL
FT                   PGVIETMPTFRSLTVFFDPLVTDRDAVLATLQPLIAAAEHGSTTDGRHWRLPVCYEGEA
FT                   APDLAEVAGAIGIGEDEVVALHSGAEYLVYMIGFLPGFPFMGDLPAPLRLPRRAQPRVR
FT                   VPAGSVAIATGLTAIYPWESPGGWHLLGRCPVPLFDARRTSPSLLAAGDRVRFVPVSAQ
FT                   ECRAIEAGLASAEIDPMQWLESAPTPAENAA"
FT   gene            complement(587238..587753)
FT                   /locus_tag="Tmz1t_0522"
FT   CDS_pept        complement(587238..587753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0522"
FT                   /product="putative transcriptional regulator"
FT                   /note="KEGG: cti:RALTA_A1452 conserved hypothetical
FT                   protein, COG5631 (predicted transcription regulator)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53296"
FT                   /db_xref="GOA:C4ZLB2"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR014601"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB2"
FT                   /inference="similar to AA sequence:KEGG:RALTA_A1452"
FT                   /protein_id="ACK53296.1"
FT                   /translation="MKEASRIVSSQHLISPKSPELSEMEFGLIIAWHAFARWMMRCMTT
FT                   AGVKDMTPIDVLVLHHVSHRDSEKRLADICFVLNVEDTHVVSYSLRKLAGLGLVQSVKK
FT                   GKEAFFSVTERGREICLAYRDVREACLMPGFTGSPEDNAQIGELARLLRTLSGRYDQAA
FT                   RAASTSSL"
FT   gene            587936..588924
FT                   /pseudo
FT                   /locus_tag="Tmz1t_0523"
FT   gene            588983..589501
FT                   /locus_tag="Tmz1t_0524"
FT   CDS_pept        588983..589501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0524"
FT                   /product="tripartite ATP-independent periplasmic
FT                   transporter DctQ"
FT                   /note="KEGG: ajs:Ajs_2484 tripartite ATP-independent
FT                   periplasmic transporter DctQ"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53297"
FT                   /db_xref="GOA:C4ZLB3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB3"
FT                   /inference="similar to AA sequence:KEGG:Ajs_2484"
FT                   /protein_id="ACK53297.1"
FT                   /translation="MRAFLDSLYRLSGALAAVGMVATLVLVATGVFTRPLGIYLPGTDD
FT                   YAGYAMAACGFLALAYTFKHGEHIRVSLVLERVGPRLRAALEWFSLAAGTAVAAMLAFY
FT                   AVRMVLQSHEFEEISQGVDATPLWIPQLSMAFGSVVLLIALIDDLVMTTLGRAPARLAT
FT                   HSGEAARME"
FT   gene            589514..590812
FT                   /locus_tag="Tmz1t_0525"
FT   CDS_pept        589514..590812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0525"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: dia:Dtpsy_1375 TRAP
FT                   dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53298"
FT                   /db_xref="GOA:C4ZLB4"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB4"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACK53298.1"
FT                   /translation="MEVMIAAVLIGLMLALLAGGVWIGLALMAIGILGMLGFTPRAPGD
FT                   GMAVAIWSHGSSWTLTALPLFLWMGEILFRTKLSEDMFKGLSPWLERLPGRLLHTNIIG
FT                   CTLFAAVSGSSAATCATIGKIALPELQRRGYPESMALGTLAGAGTLGLLIPPSIIMIVY
FT                   GVAADVSISKLFIGGVLPGILLASLFMGWVVVWSLMNPGKIPAADLKTDFMGKLRASKN
FT                   LIPVILLIGGVLGSIYSGIATATEAAAIGVIGSLIIAASQRTLNRKSFFGALMGATRLY
FT                   CMIALILAGSAFLTLAMGYIGLPRHLAEWIGGLGLTPGMLLVALAIFYILLGCFLDGIS
FT                   IVVLTMAVLMPTIQAAGIDPLWFGIFVVVVVEMAQVTPPVGFNLFVLQGLTGRDMTVIA
FT                   RYALPYFLLMVLAVVLLYTFPGLVTWLPGHMIG"
FT   gene            complement(590841..591803)
FT                   /locus_tag="Tmz1t_0526"
FT   CDS_pept        complement(590841..591803)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0526"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: csa:Csal_0981 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53299"
FT                   /db_xref="GOA:C4ZLB5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB5"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK53299.1"
FT                   /translation="MATSAPSQIHTRLRVFLAVARHLSFTRAGEELSITTGAVSQQIKL
FT                   LEDWLAQRLFRRLPRRLELTDAGKRLLAAVDPAYAAVELAIGRLRGGALSGVVRVRTLP
FT                   SFLATWLVPRLPRLMARFPQIELQVEAEDSTYSLRDGEFDLAIDLNDGSYPGFQSTVLL
FT                   EEEIFPVCSPRLLEGRPPLLGAEDLRHYPLLHDMTAWRGSPPYAEWERYLKAIGAPQVE
FT                   VRRGYMFNRNHITMQCAIAGMGVAIARRTLITDELDSGRLVAPFAQSVRTGKRYCVIHS
FT                   AGALADPRVATVHDWLAAEARAAELAAGPCADTAPAPGD"
FT   gene            591946..593325
FT                   /locus_tag="Tmz1t_0527"
FT   CDS_pept        591946..593325
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0527"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: csa:Csal_0982 L-serine ammonia-lyase; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53300"
FT                   /db_xref="GOA:C4ZLB6"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB6"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ACK53300.1"
FT                   /translation="MSISVLDLFKIGVGPSSSHTVGPMRAAHDFVAELQRRGLLDQVRR
FT                   IEAKLYGSLSATGVGHGTDRAVVAGLMGARPDEVDPDFLVGAVDAVRIDASLPLGGTTA
FT                   VPFEWTRDLRLLPVSLPYHPNAMRLAAHGEAGVLYENTYYSVGGGFVVDEAQAQSGAPA
FT                   EAAVAVPYPFDTGAELLAQCRRHGLRISELMLANESAWRSEAETRAALLRIWDVMRACV
FT                   TRGVGHEGVLPGGLNVRRRAPGLYRKLSEQASGRNMISDSMSALDWVNLYALAVNEENA
FT                   GGGRVVTAPTNGAAGIIPAVMHYYMKFMPGSDERDVENFLLAAAAVGVLCKKNASISGA
FT                   EVGCQGEVGSACAMAAAGLAEVLGGTPEQVENAAEIGLEHNLGLTCDPVGGLVQVPCIE
FT                   RNAMASIKAINAAQLALRGDGAHTVSLDQVIRTMRDTGRDMLDKYKETSRGGLAVSFPE
FT                   C"
FT   gene            593460..594698
FT                   /locus_tag="Tmz1t_0528"
FT   CDS_pept        593460..594698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0528"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   pfo:Pfl01_3709 serine/threonine transporter SstT"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53301"
FT                   /db_xref="GOA:C4ZLB7"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR023025"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB7"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACK53301.1"
FT                   /translation="MTTANPTALQRVMRMSLISQIAIGLVLGIALALIAPGATKSVALL
FT                   GDLFIAALKAVAPILVFVLVAAAIANHRHGQPTHMRPILVLYLLGTFAAAVVAVIASFA
FT                   FPTTLVLDTAAATGNPPGGILGVLKNLLLSVVSNPVRALMEANFIGILAWAIGLGVALR
FT                   HAAESTRKMVNDVADAVSSIVQVVIRFAPLGIFGLVAATMGESGFDALLGYGKLLMVIV
FT                   GCMVFVALVVNPLFVFWKLRTNPYPLVFTCLRESGVTAFFTRSSAANIPINLELCKRMG
FT                   LHEDTYSISIPLGATINMAGAAITISVMALAAAHTLGIATDFPTALLLCLVSALAACGA
FT                   SGVAGGSLLLIPMATSLLGVQADVAMQVVAIGFVISVVQDSCETALNSSTDVLFTAAAC
FT                   AAESGEPLQLDRT"
FT   gene            594852..596108
FT                   /locus_tag="Tmz1t_0529"
FT   CDS_pept        594852..596108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0529"
FT                   /product="2-amino-3-ketobutyrate coenzyme A ligase"
FT                   /EC_number="2.3.1.29"
FT                   /note="KEGG: bmj:BMULJ_03200 glycine C-acetyltransferase;
FT                   TIGRFAM: 2-amino-3-ketobutyrate coenzyme A ligase; PFAM:
FT                   aminotransferase class I and II; glycine
FT                   hydroxymethyltransferase; aminotransferase class-III;
FT                   Orn/Lys/Arg decarboxylase major region"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53302"
FT                   /db_xref="GOA:C4ZLB8"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR011282"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB8"
FT                   /inference="protein motif:TFAM:TIGR01822"
FT                   /protein_id="ACK53302.1"
FT                   /translation="MNKNPATAVEQSGKPQSPARERFLAHLHGVVDQIRADGFYKAERV
FT                   IDSPQGAQVHLGTGADVLNFCANNYLGLANDPRLVKAAQDGLAEDGFGMASVRFICGTQ
FT                   SVHKQLEASISKFLGTEDTILYGSCFDANGGLFETLLTEEDAVISDELNHASIIDGVRL
FT                   CKARRYRYRNNDMADLEAQLQAADAAGVRFKLIATDGVFSMDGVIADLKSVCDLADKYG
FT                   ALVMVDDSHAVGFVGTHGRGTAEYCGVEGRVDIITGTLGKALGGSSGGYTSGHKEIIEL
FT                   LRQRSRPYLFSNTLAPSIAAASIKVMELLASEEGLELCRRVKENGEHFRREMTKLGFTL
FT                   AGKDHPIVPVMLGDAQLAGRMAEELLKEGIYVIGFSFPVVPKGKARIRTQMSAAHTTAQ
FT                   IDRAVAAFAKVGKALGAIA"
FT   gene            596142..597179
FT                   /locus_tag="Tmz1t_0530"
FT   CDS_pept        596142..597179
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0530"
FT                   /product="L-threonine 3-dehydrogenase"
FT                   /note="TIGRFAM: L-threonine 3-dehydrogenase; PFAM: Alcohol
FT                   dehydrogenase GroES domain protein; Alcohol dehydrogenase
FT                   zinc-binding domain protein; KEGG: bmn:BMA10247_A0007
FT                   L-threonine 3-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53303"
FT                   /db_xref="GOA:C4ZLB9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR004627"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLB9"
FT                   /inference="protein motif:TFAM:TIGR00692"
FT                   /protein_id="ACK53303.1"
FT                   /translation="MKALAKLTPSVGLTLTSVEKPEVGPNDVLIKIKKTAICGTDIHIW
FT                   KWDEWAQKTIPVPMHVGHEYVGVIAEMGQEVRGFKIGDRVSGEGHITCGFCRNCRAGRR
FT                   HLCRNTVGVGVNRAGAFAEYLAIPAVNAFKIPDDISDDLAAIFDPFGNATHTALSFNLV
FT                   GEDVLITGAGPIGIMAVAIARHVGARHVVITDVNDHRLELARKMGATRAVNVSRENLAD
FT                   VKTELHMVEGFDVGLEMSGVPSAFTSMLEHMNHGGKIALLGIPPSNTAIDWNQVIFKGL
FT                   EIKGIYGREMFETWYKMVAMLQSGLDLSPIITHHYPVEEFKTGFETMLSGNSGKVILDW
FT                   EALAA"
FT   gene            complement(597246..598781)
FT                   /locus_tag="Tmz1t_0531"
FT   CDS_pept        complement(597246..598781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0531"
FT                   /product="deoxyribodipyrimidine photolyase-related protein"
FT                   /note="PFAM: deoxyribodipyrimidine photolyase-related
FT                   protein; KEGG: cvi:CV_3229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53304"
FT                   /db_xref="GOA:C4ZLC0"
FT                   /db_xref="InterPro:IPR007357"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR036134"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC0"
FT                   /inference="protein motif:PFAM:PF04244"
FT                   /protein_id="ACK53304.1"
FT                   /translation="MTTLRLILGDQLHAAHSWFRAPRADALYLMMEVRSETDYVRHHAQ
FT                   KVLAIFAAMRAFAAALQAAGHRVRYLKIGDADNRQSFAANLAQVAAECGATRFERMEAD
FT                   EWRVERLLDEAAQTLGLPQAVVGSEHFLAERAELAQRFAAKVPRMEFFYRDLRRRHRIL
FT                   VDADDVPVGGVWNFDAQNREKWPGDPPAPAWPWRGHDLCALWDEIVAAGVRTIGAPHAD
FT                   QLRWPITRREARAGLAHFIEHALPWFGPYQDAMSTRSTTLFHSGLSFALNVKLLHPREV
FT                   IDAALAAWQAGKVELASCEGFVRQILGWREFVRGVYWARMPGYAQANALDARRPLPEWY
FT                   WSGDTKMACLRHAIAQSLDTAYAHHIQRLMITGNFALLAGCDPDAVDAWYLGIYIDAFE
FT                   WVEMPNTRGMSQFADGGVIASKPYAGAASYIGKQSDYCKGCAYDPRRRHGASGKPACPF
FT                   NSLYWDFLLRHEARFARNPRMAMPYKAWAKMDAGERAATLAQAAHWLARLDEL"
FT   gene            598997..601441
FT                   /locus_tag="Tmz1t_0532"
FT   CDS_pept        598997..601441
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0532"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: dar:Daro_1909 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   diguanylate cyclase; PAS sensor protein; PFAM: EAL domain
FT                   protein; GGDEF domain containing protein; PAS fold domain
FT                   protein; PAS fold-4 domain protein; SMART: EAL domain
FT                   protein; GGDEF domain containing protein; PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53305"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACK53305.1"
FT                   /translation="MNDDNARLRAAIDTLRVPIYMKDADGRYVYANDLACSLLKRSRDD
FT                   VVGRCDQDLFPPDQAEVLRRNDLQVIATARAVVIEEYLSFPDAPVPRCCMNIKQPVVDA
FT                   GGRPVGVIGLAIDIEARKQQERELVGLKNDYAAILQALPDPLFEFDIEGRCHGYRTPDE
FT                   DLLAAPPEVFLGRTVREVLPPEEAEVCLEALREAAAKGRSTGKVFKVEAPQGTRWFELS
FT                   VAPMASAAGRTQRFNVLSREVTARERMERALQEQESLLRAVVDNTPVEYWARDLDGRCT
FT                   LQNAMTVAHWGDLLGQRPEESAKEPAARTEWLETNRRAYAGETVHREVEYEVDGETRIF
FT                   QCLVAPIRVGGEVVGIFGFNQDITERKRQEHQIHELAFFDPLTRLPNRRLMFDRLERAL
FT                   GSSARRRHQGALLLIDLDHFKELNDSHGHEAGDQLLMKVAARLGLSIREGDTAARLGGD
FT                   EFVVILEDLEDVADELLHIKAVADRIGRELGRPFQLQRGTAGETISYQCSASIGISAFG
FT                   EPGVGAAELLRRADTALYQAKAAGRNAVSFFDPIMQAAVTARARLHSDLRQAIRGGQFE
FT                   LHYQVQVDAQRRPAGAEALVRWRHPEKGLIHPGGFIDLAEETGLIVPLGHWVLATGCRQ
FT                   LALWARHPATAHLRLAVNVSARQFRQPSFADEVRALLEQTGAPADRLKLELTESSLIED
FT                   TEAVIERMETLRALGIRFALDDFGTGYSSLAYLKRLPLAQLKIDQSFVRDLMSDPNDAS
FT                   IVRTILALGDSLGLAVIAEGVETEAQYAFLAAHGCRAYQGYLFGQPVALDVFEAGLAAS
FT                   DG"
FT   gene            complement(601442..602869)
FT                   /locus_tag="Tmz1t_0533"
FT   CDS_pept        complement(601442..602869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0533"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: azo:azo2655
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53306"
FT                   /db_xref="GOA:C4ZLC2"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC2"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACK53306.1"
FT                   /translation="MHAPVSGSPGTAPAVPSPALSLSPALLFLLVFVEGFVSLGAEILA
FT                   LRRLVPHVGSAITVTAPTIAFFLLALALGYQAGGQVAGDYLARVRRNFLLAAALIALGL
FT                   AGPVVELAFARLQPAPVAWAVVVCGVLCPVAWLLGQTVPILTNLLRHERVGARSGAALY
FT                   WSTLGSFLGALTLSMGVMQWLGVGAAVLVCAGLLLTAVPALGRAAGARLPSAAAALAIA
FT                   GMALVANLVLPQQIETAYATYRVEAVAIPGYVAPEVLRINNSPASILDAGEPPRYARYI
FT                   RRLRDLLLDELGFRGRSVLVLGAGGFTLSHREPLNRYVYVDIDPAVKEIAERDFLREPV
FT                   RGEFVAADARAHLRETAARHDAVVVDVYSALTSIPAHLVTREFWRATRAVLKPGGVLAA
FT                   NLILDRELASPYARSLLASIQAEYGACAVEVLFRDRPQGNVLVICSAPSTAHAAQEPAL
FT                   PYTDERNRADLDVLRGS"
FT   gene            603046..603279
FT                   /locus_tag="Tmz1t_0534"
FT   CDS_pept        603046..603279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0534"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo0070 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53307"
FT                   /db_xref="GOA:C4ZLC3"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC3"
FT                   /inference="similar to AA sequence:KEGG:azo0070"
FT                   /protein_id="ACK53307.1"
FT                   /translation="MAQPTLKQRKTFALIRIFGGMVAALYLSFVVVTNMLAGHALEGEL
FT                   LYSALVALAGYGYAAWYLRELAAVAREERGGR"
FT   gene            603484..604500
FT                   /locus_tag="Tmz1t_0535"
FT   CDS_pept        603484..604500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0535"
FT                   /product="esterase, PHB depolymerase family"
FT                   /note="TIGRFAM: esterase, PHB depolymerase family; PFAM:
FT                   phospholipase/Carboxylesterase; KEGG: azo:azo0570
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53308"
FT                   /db_xref="GOA:C4ZLC4"
FT                   /db_xref="InterPro:IPR010126"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC4"
FT                   /inference="protein motif:TFAM:TIGR01840"
FT                   /protein_id="ACK53308.1"
FT                   /translation="MVSRRVRPSPLLRAIERATTAMTRRALRAGADAAGKAAARGVEAM
FT                   SAPYRLPVSAGDWIPGQAIGPAGLRRFRLFRPADVRSSDRLPLLVMLHGCGQNAAAFAR
FT                   STRMDRLAARERFLVLYPEQDLAANPQGCWNWYDTRSHRAEAEAATLIAAIDQACLLYP
FT                   VDRDAVAVAGLSAGASMAALLAVRWPERFCAVAMHAGVAPGAANSAAGVLAAMRGRSLP
FT                   PTAVERGNRPPLLVIHGSEDRVVSVRNAHAAAEQWAAALGARAADPRRVQRGARHAMTV
FT                   TDWRVRRRVCVRLCEVERLGHAWSGGAAGEHFSDPQGPDASTLIWRFVQGSLLGPEA"
FT   gene            605346..606146
FT                   /locus_tag="Tmz1t_0536"
FT   CDS_pept        605346..606146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0536"
FT                   /product="molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein"
FT                   /note="TIGRFAM: molybdenum ABC transporter, periplasmic
FT                   molybdate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: mca:MCA1378
FT                   molybdenum ABC transporter, periplasmic molybdate-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53309"
FT                   /db_xref="GOA:C4ZLC5"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC5"
FT                   /inference="protein motif:TFAM:TIGR01256"
FT                   /protein_id="ACK53309.1"
FT                   /translation="MCLSNLPLRRRVLGALLALAAGVFGPHAAAGERITVAAASDLKFA
FT                   LDEIVAEFGRAHPGDTVEVVYGSSGKFATQIRQGAPFDLYFSADIAYPRALETEGLAHG
FT                   ATRPYALGRIVLWSATRDARMLELKDLADPAIGRIAIANPRHAPYGKRAEEALRAAGVW
FT                   EAVQPRLVQGENIAQTAQFVQTGNAAVGIIALSLALNPTLAAQGGYTLIDAGLHEPLEQ
FT                   GFMLTRAAAGKPLATAFAEFIGSESARAVLRRYGFELPAVSAGR"
FT   gene            606335..607024
FT                   /locus_tag="Tmz1t_0537"
FT   CDS_pept        606335..607024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0537"
FT                   /product="molybdate ABC transporter, inner membrane
FT                   subunit"
FT                   /note="TIGRFAM: molybdate ABC transporter, inner membrane
FT                   subunit; PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: eba:ebA2720 molybdenum
FT                   transport system permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53310"
FT                   /db_xref="GOA:C4ZLC6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC6"
FT                   /inference="protein motif:TFAM:TIGR02141"
FT                   /protein_id="ACK53310.1"
FT                   /translation="MPTLSGADWSAIRLTLELAAASTAVLLLLGTPLAWWLACTRSRWK
FT                   GVVGAVVALPLVLPPTVIGFYLLVAMGPNGPVGRLTEALGLGLLPFSFAGLVVGSVVYS
FT                   LPFVVQPLANAFEAIGRRPLEVAATLRAGPWDRFFNVALPLARPGFVTATILGFAHTVG
FT                   EFGVVLMIGGNIPERTRVVSVAIYDHVEALEYAQAHWLSAGMLAFSFVVLLALYGRRRG
FT                   HAGGGVG"
FT   gene            607024..608172
FT                   /locus_tag="Tmz1t_0538"
FT   CDS_pept        607024..608172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0538"
FT                   /product="molybdate ABC transporter, ATPase subunit"
FT                   /note="KEGG: azo:azo3837 putative molybdenum transport
FT                   system, ATP-binding protein; TIGRFAM: molybdate ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   TOBE domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53311"
FT                   /db_xref="GOA:C4ZLC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR011868"
FT                   /db_xref="InterPro:IPR015852"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC7"
FT                   /inference="protein motif:TFAM:TIGR02142"
FT                   /protein_id="ACK53311.1"
FT                   /translation="MADVPQPGAAGTATGAAAGCARPAAGIEARFAVDYAGFRLDVDLR
FT                   LPGRGVTALFGHSGSGKTTLLRCVAGLEPAARGRLVVNGECWQDDARRILVPTHRRALG
FT                   YVFQEASLFPHLSVRRNLEFGLHRIPAAARRVPLDHAVALLGIEALLERMPDRLSGGER
FT                   QRVGMARALLTSPRILLMDEPLAALDHRRKQEILPYLERLHDELDIPVLYVSHAPDEVV
FT                   RLADHVVMLGEGKAMAAGELHATMARLDLPTAFTEDAGVVVDGTVAEHDDHYHLTRLDF
FT                   PGGAVWVQRQPAPPGRRLRFRIHARDVSLADHLVEGSSIQNLLPAIVEEVVGADTPAHV
FT                   LVRLDAGGTALLARITRRAAEQLGLRPGRRMWAQIKSVALLG"
FT   gene            608250..608924
FT                   /locus_tag="Tmz1t_0539"
FT   CDS_pept        608250..608924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0539"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   eba:ebA4663 glutathione S-transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53312"
FT                   /db_xref="GOA:C4ZLC8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC8"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACK53312.1"
FT                   /translation="MTTTLYHCINARSFRALWMLEELGLPYALKVLPFPPRSRDEEYLA
FT                   VNPLGTIPAFLEDDVRMSESAAICQYLAARHSPRALDVGVDEADFGAYLNYLHFGEATL
FT                   TFPQTLILRYGRFEPPERRLPQAAEDYTRWFLSRLRTLEPRLETHEFLCAGRFTAADVA
FT                   VGYALMLATDIGLQDRFKPATLAYWQRLQARPGFLRALEAQTRAALEQGVSTASVACWD
FT                   GR"
FT   gene            608998..609897
FT                   /locus_tag="Tmz1t_0540"
FT   CDS_pept        608998..609897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   eba:ebA5802 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53313"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLC9"
FT                   /inference="protein motif:PFAM:PF03641"
FT                   /protein_id="ACK53313.1"
FT                   /translation="MSKNSPLRARNFPSAEDEAKAAQPQGRYDGPGSSFRMAFTDTEFL
FT                   LRDELRPVRLQLELLKAELVQQEQGVESTVVVFGSARFKAPDVAEAMLRDALASGDEAA
FT                   TARARQMVKNARWYEEARRFGELVTRESEALGEPVIVATGGGPGIMEAGNRGAFEAGGR
FT                   SMGMSIFLPFEEAPNPYITPELCFQFHYFAIRKMHFLMRAVALVSFPGGLGTLDELFEV
FT                   LTLTQTRKIRRRPIVLIGRDFWQRLIDFDVLVEHGVISPEDKNLFHYAETAEEAWDAIK
FT                   AAYSGDNPSLTARQLKGN"
FT   gene            610043..610828
FT                   /locus_tag="Tmz1t_0541"
FT   CDS_pept        610043..610828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0541"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; SMART: regulatory protein IclR; KEGG:
FT                   reu:Reut_B5822 IclR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53314"
FT                   /db_xref="GOA:C4ZLD0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACK53314.1"
FT                   /translation="MTSSKSRALNADAPTKGQTMLRGLDILEAIADGARTVAEIAAQTG
FT                   LSLSTTHRLASSLADRNYLKFEPRKGYSLGQKLIELGFAGYREADLRKLARPYLEELAS
FT                   RTYDTIHLAALVHDEVTYLDKIAGKRPVEISSRVGGRKPVCSTGVGKALILDRSEDFWR
FT                   HCYRKEFGGEADPDAMAEWMARMRSYVGLDYAEDFGENEGAIRCVAAPIRDGSQRIVAA
FT                   VSVSSAREYMDRQRMQGLINEVRNTARAISAELGAPGKD"
FT   gene            complement(610833..612227)
FT                   /locus_tag="Tmz1t_0542"
FT   CDS_pept        complement(610833..612227)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0542"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rme:Rmet_1608 FAD linked oxidase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53315"
FT                   /db_xref="GOA:C4ZLD1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD1"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ACK53315.1"
FT                   /translation="MTALNASSAAALEALTAVFGADVLPGDASPKYLQDWSGCAGGQPL
FT                   AILRPRSTDELSRMLAICHAHGQAVVPQGGLTGLCGGAVPAGGEVVVSLERMNRIERID
FT                   IDSGTVIVEAGAILQTVQEACRDAGALLAVDLGARGSCQVGGNVSTNAGGNRVIRYGNT
FT                   RDLVLGLEVVLADGTVLSMLNQMVKNNAGMDLKHLFIGSEGVLGIVTRVVFKLQPLPKG
FT                   VSTAVVALHDYPAALRFLRHAQQSLSGQVSAFEIMWNDYLVTAVAAGKLRAPLDTNYPV
FT                   YVLIDMHCGQPETDAGRFEAMLEQAIEAGWILDGAVAQSVAEAEAFWAIRDGVAEVLRD
FT                   YAPTLNFDVSVPIAQIGECAARIRTELDRDWPALKALFFGHVGDGNLHVVVCKVPSDHD
FT                   SQMRIEDAVYSVVRSYGGSISAEHGIGTLKRDWLHYSRSEAELALMRTLKHTLDPKNIL
FT                   NPGKLI"
FT   gene            complement(612256..613536)
FT                   /locus_tag="Tmz1t_0543"
FT   CDS_pept        complement(612256..613536)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0543"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: bha:BH2671 C4-dicarboxylate
FT                   transport system (permease large protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53316"
FT                   /db_xref="GOA:C4ZLD2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD2"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACK53316.1"
FT                   /translation="MISLILFGLFALLMIVGVPIGISLGIAAMAALGYGGVVDSSYLAQ
FT                   SLVTSIDSFPLMAVPFFILAGDLMGHGGISRRLLEVGEILFGRYTGGLGLVAVATCMFF
FT                   AAISGSGPATVAAIGGILFPAMLKRGYDRNFSVGLVASAGCIGVVIPPSIPMVIYATSS
FT                   GASVSSLFLAGVVPGVLIGVVLMLMSWFIARKAGYHGIERSYTGAEIFRILWDAKWALL
FT                   VPVIILGGIYGGIFTPTEAAAVAVAYGFFVGVFVYKDLKLADVYKVLAHSALTSATVMV
FT                   IVGTATVFGRVLAIEGIPVKLANEIVALTSDPIMILLLINVLFLVVGCFMETLAAIIIL
FT                   TPILLPVVLKVGVDPVHFGILMIVNLAIGMVTPPMGINLFVGSRVGNAQLEGVIRGATP
FT                   FLLSMIVVLLVLTYVPQITLWLPNLMK"
FT   gene            complement(613533..614018)
FT                   /locus_tag="Tmz1t_0544"
FT   CDS_pept        complement(613533..614018)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0544"
FT                   /product="Tripartite ATP-independent periplasmic
FT                   transporter DctQ component"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: bha:BH2672
FT                   C4-dicarboxylate transport system (permease small protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53317"
FT                   /db_xref="GOA:C4ZLD3"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD3"
FT                   /inference="protein motif:PFAM:PF04290"
FT                   /protein_id="ACK53317.1"
FT                   /translation="MLKKLDDHFEEALIVLLMAAMTVLIVVQIFMRYVVQESLTWSEEL
FT                   ARYIFVWATYLGVAYGMKKNAHICVEAVTGYLPARTREITYIVAQVVFLLFAALVVKEG
FT                   FVLSMKIFKFGQSSAALGMPMGVIYLAPTVGFALVFIRLVQNIVAGFKRLRTLGVAA"
FT   gene            complement(614108..615148)
FT                   /locus_tag="Tmz1t_0545"
FT   CDS_pept        complement(614108..615148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0545"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: bha:BH2673 C4-dicarboxylate transport system
FT                   (C4-dicarboxylate-binding protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53318"
FT                   /db_xref="GOA:C4ZLD4"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD4"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ACK53318.1"
FT                   /translation="MSNQLATPLRRRILATGLALAAFALAGCSGEQKGTQPATTATNQK
FT                   LVIKVGHAATESNTGHKGLVEFNRLLGEKTGGRISLEIYPNSQLGSERELIEAVQLGSV
FT                   GMTFVSSAPLGGFKKEFFALDLPFVFKDRPTVYKVLDGEPGQYLLKSLQDINIQGLGFW
FT                   ENGFRQLSNSKVAVKTPDDLKGIKMRTMENEVHLAAWKELGANPAPLAFGELFTALQQG
FT                   TFDAQETPINLFRDMKFFEVQKFITKTGHLYSPFVILMSKPLYDGLSEADKQAMAEAFE
FT                   AAKAYQRDLAQKSDAEAEAQMTGITFTELSDAEKEAFRAKMGPVYGLVKKKAGEEIVKK
FT                   VLQATN"
FT   gene            615434..616084
FT                   /locus_tag="Tmz1t_0546"
FT   CDS_pept        615434..616084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0546"
FT                   /product="acetyltransferase/hydrolase"
FT                   /note="KEGG: eba:ebA5275 acetyltransferase/hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53319"
FT                   /db_xref="GOA:C4ZLD5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD5"
FT                   /inference="similar to AA sequence:KEGG:ebA5275"
FT                   /protein_id="ACK53319.1"
FT                   /translation="MVAGAESVILFVHGLWMHGVVFSAHRRELRRMGRESRVFSWHSLL
FT                   GSLDGAADDLAAHIAALGRRPLHLVGHSLGGCVVLNMLARHHPEGIGRVVLLGSPCCGS
FT                   HAGERILRVPLLRGALGRVLPQWLARPLPEVPPGYEIGVVAGNRPVGMGRIVPGMEKPN
FT                   DGMVTVAETRWPGARDHTVLPVTHMQMLWSRACLIQTLHFLDTGRFLRGGVRG"
FT   gene            complement(616238..616873)
FT                   /locus_tag="Tmz1t_0547"
FT   CDS_pept        complement(616238..616873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0547"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: lch:Lcho_3187 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53320"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD6"
FT                   /inference="similar to AA sequence:KEGG:Lcho_3187"
FT                   /protein_id="ACK53320.1"
FT                   /translation="MPAPEPLLPSCLQPRRVILFSGHMIDAPGRAEPRFPPALAPAAAA
FT                   RIAEALDRLEAGPLDLGLTQGAAGGDLLFAEAAQARALPLLFLQPFGEDEFIARSVRPV
FT                   SAGEQWVARYRAVAARLASPPHAMPPAPAAAADNPFERCNRWLLDTALACGGERVWLLC
FT                   LWDGRRGDGAGGTAHMVEEVSRHRGHVLHIDTRELRPHDPAGSPPLPD"
FT   gene            616972..619209
FT                   /locus_tag="Tmz1t_0548"
FT   CDS_pept        616972..619209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0548"
FT                   /product="UvrD/REP helicase"
FT                   /note="PFAM: UvrD/REP helicase; KEGG: azo:azo0345
FT                   ATP-dependent DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53321"
FT                   /db_xref="GOA:C4ZLD7"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD7"
FT                   /inference="protein motif:PFAM:PF00580"
FT                   /protein_id="ACK53321.1"
FT                   /translation="MSPPIETLPGPNSEPRSKTSSPRPPAADPLAALDPAQRAAVGHGI
FT                   GADGRIDAGPLLVIAGAGSGKTGTLAHRVARLAAAGADPARILLLTFSRRAADEMGRRV
FT                   RRILAQAAADRPGLARAELQWAGTFHAIGARLLRDHAGRIGLDPGFSIHDREDSADLMN
FT                   LVRHELGLSATKQRFPQKGTCLAIYSAVVNTRAALAEVLQASFPWCAQWEDELKRLFRA
FT                   YVEAKQAQQVLDYDDLLLYWAQMVGEAELGAEIGGLFDHVLVDEYQDTNALQAAILLAM
FT                   KPDGRGLTVVGDDAQSIYAFRGATVRNILDFPAAFEPPARVVTLERNYRSTQPILDAAN
FT                   AVIALAAERFAKNLWSERASAQRPRLVTVKDEAAQADFVVDSVLARREEGLKLKQQAVL
FT                   FRASAHSARLELELTRRNIPFVKYGGLRFLEAAHVKDVLALLRWAENPRDRIAGFRAIQ
FT                   LLAGIGPRTAGRVLDNVCSAPPGCVLLAEQPVPEAARPGWLEFATLVDRLSGREEASTA
FT                   AFAPGGAPARTTAPVRAEGLAGGARGGLPWPTDFELACRWYEAQMPRLYDDFQVRVLDI
FT                   QQLARIAATSPSRQRFLTELTLDPPSATSAEAGMPLLDEDYLILSTIHSAKGQEWNAVS
FT                   VLNVVDGCIPSDVATRDSAEIEEERRLLYVAMTRAKDALDLIVPQRFHVTQQTGLGDRH
FT                   VYAGRSRFIPNRLLGHFEQMSWPLPAPELQGSPASRQAAIDLAAKMRDMWR"
FT   gene            619356..621347
FT                   /locus_tag="Tmz1t_0549"
FT   CDS_pept        619356..621347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0549"
FT                   /product="coenzyme A transferase"
FT                   /note="PFAM: coenzyme A transferase; KEGG: dar:Daro_0457
FT                   propionate CoA-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53322"
FT                   /db_xref="GOA:C4ZLD8"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD8"
FT                   /inference="protein motif:PFAM:PF01144"
FT                   /protein_id="ACK53322.1"
FT                   /translation="MARKTHPMVASLRAADTGKIVSAREAVRLIRSGDTVATGGFVGIG
FT                   FAESVAIALEKRFLEAEGGPGSPRDLTLVYAAGQGDGKARGLNHLGHEGLVARVIGGHW
FT                   GLVPRLQALAVDNRIEAWNLPQGVITHLFRDIAAGKPGTLTRVGLGTFVDPRFGGGKLN
FT                   ARTTEDLVRLMPIDGEDYLFYKAFPIHVGIIRGTTADPDGNVTMEKEALTLEARAIAMA
FT                   ARNSGGIVIVQVERIAERGSLNPRQVQVPGVLVDCVVVADRPEHHMQTYSEQYNPAFSG
FT                   EIRVPMSAICAMPMSARKIIARRAAMELQSAAVVNLGIGMPEGVATVAAEEKLIDLLTL
FT                   TAEPGVVGGIPAGGLSFGAAVNTQAIIDQPSQFDFYDGGGLDIAFLGLAQADREGNLNV
FT                   SKFGPRLAGAGGFINISQNAKKVVFVGTFSAGGLEVAVEDGCLRIVREGETRKFVDAVE
FT                   HRTFSGTQAAKWRQDVLYVTERCVLRLCEDGLELIEIAPGIDLQRDILARMDFVPVMKG
FT                   PPVRMDARIFADAPMGLRHDLLDVPLGRRLAYDAQQDVFFVDFEGLSVRTPQDIAAIRD
FT                   AVRAALAPLGRKVDAVVNYDRFSIVPELVDDYVEMVKGLMDAHYHTVTRYTANGFLRMK
FT                   LGEELEKRRIPAHFYASASEAWHGLETP"
FT   gene            complement(621405..622451)
FT                   /locus_tag="Tmz1t_0550"
FT   CDS_pept        complement(621405..622451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0550"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: pna:Pnap_3249 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53323"
FT                   /db_xref="GOA:C4ZLD9"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLD9"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACK53323.1"
FT                   /translation="MFRLPWPTRKDASTPVALALQGGGAHGAYTWGVLDRLLEAGVPIE
FT                   GISGTSAGAMNAVALAEGWTTGGAEGARAALDRFWTAVGDSVPFHLELLQSLSPSGDGS
FT                   LPSPMNMMLGLARVFSPYQLNPFELNPLRDVVRAQFDFERIRRACPLKLFIAATAVRTG
FT                   KVRLFRTAELGEAALLASACLPTLHHAVEIDGEHYWDGGFTANPAIYPLLYECDTPDLL
FT                   MVLLNPLQHEQAPRSAEDIAARSMELGFSTTFLREMRMIAHARQFIAERPRWSPIGRLE
FT                   RKLLRERFHLIDAPELGDAGSASKLDATASALLRLRELGRARAETWLQAHAHEVGRRET
FT                   IDVGALFL"
FT   gene            complement(622631..623011)
FT                   /locus_tag="Tmz1t_0551"
FT   CDS_pept        complement(622631..623011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0551"
FT                   /product="protein of unknown function DUF488"
FT                   /note="PFAM: protein of unknown function DUF488; KEGG:
FT                   geo:Geob_1265 protein of unknown function DUF488"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53324"
FT                   /db_xref="InterPro:IPR007438"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE0"
FT                   /inference="protein motif:PFAM:PF04343"
FT                   /protein_id="ACK53324.1"
FT                   /translation="MTIRVRRAYDPPAAGDGCRVLVDRLWPRGLARENARIEHWLRELA
FT                   PSSELRKWFAHDPARWDEFRRRYADELRAPAAAAALAELHGLIAAHPVLTLLHAARDTT
FT                   HNNAEALRLWLACGAASRPGNA"
FT   gene            complement(623019..623996)
FT                   /locus_tag="Tmz1t_0552"
FT   CDS_pept        complement(623019..623996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0552"
FT                   /product="cysteine synthase A"
FT                   /note="TIGRFAM: cysteine synthase A; cysteine synthase;
FT                   PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: eba:ebA4678 cysteine synthase A"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53325"
FT                   /db_xref="GOA:C4ZLE1"
FT                   /db_xref="InterPro:IPR001216"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR005856"
FT                   /db_xref="InterPro:IPR005859"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE1"
FT                   /inference="protein motif:TFAM:TIGR01139"
FT                   /protein_id="ACK53325.1"
FT                   /translation="MSTWYPDNAESIGRTPLVRLNRVLDGAQATVLAKIEGRNPAYSVK
FT                   CRIGAAMVKDAIAHGRLGPGQEIVEPTSGNTGIALAFVCAARGIPLTLTMPETMSVERR
FT                   KLLVAYGARLVLTEGPKGMNGAIAKAKEIVDSDPGRYVLLQQFENPANPAIHETTTGPE
FT                   IWNDTDGGIDILVSGVGTGGTITGISRYIKRVRGKDIRSIAVEPAASPVISQTLAGQPL
FT                   TPAPHKIQGLGAGFVPKVLDLSLIDAVEQVSNEDAVLYARRLAREEGILAGISCGAAVA
FT                   AAARVAKQPENAGKTIVVILPDSGERYLSSILFEGLFDEKGMAI"
FT   gene            624170..626656
FT                   /locus_tag="Tmz1t_0553"
FT   CDS_pept        624170..626656
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0553"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: pna:Pnap_0742 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53326"
FT                   /db_xref="GOA:C4ZLE2"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR019894"
FT                   /db_xref="InterPro:IPR024282"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE2"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACK53326.1"
FT                   /translation="MKEKELRLALVLFGGVSLAVYQHGINRELLNLARASRAYHRVEGP
FT                   AAKQAPGHVYPAGAGADAWTAEVYFDLLKRLGRMVDLRVLVDVISGASAGAINGIALAR
FT                   ALAHDLSLAPVTRLWLERADMQRLIAPEARAGKWDKWYFRPLLRPLLAWARREGMLETQ
FT                   PDPETLERALAFVRSRWFSAPLDGALLSAELLDGLLAMETGSVAAGSLLPSGTCLSLAV
FT                   TVTDFRGIERALFTHDPPLLREREHRHLLRFACEHRRTGELDSDFGLDNAPSLAFAARA
FT                   SASYPGAFPPARLAEMDALLAARGLTWSTRERFLARNFAHYRASGMNPAEVVLLDGSVL
FT                   DNKPILAAVGYIRVHRAFREVDRRLIFIDPHAEARVGEGAGSDGGEGEPGWFEVLRSAL
FT                   SDLPRHQPIHQELAEISRYNRQIRRLKATIVQSRPEVEALVERATGGALSGPFTAVELR
FT                   HWRLTSTNMLGAMPLVYDPWWRALVLEALDFLAGLLGSLCGCARESPGARWLQQVVEAW
FT                   AAHAGILREHYRIADDVGEDADMPAFARVVIRFGIEYKRRRINFVLHELNTLYHALPGE
FT                   GRCTTAPGVLDVVKTRIHECLDALAIYDDCAFVDAPAAAAVRALLQPATAAAAVRSEAD
FT                   AAAFAMRNAVALDALIERIGDACRIGEANANMDAVLVSDAVRAIEPHCRRQLLTAYLGY
FT                   FYWDVILRPALGALALGSGPLEEVLIDRISPQDATALASVTEGRPALAGTAFAGFGGFL
FT                   SAAARENDYLWGRLHAAERLVGIVASAVGGPGAPDASELRVFRKRAFEAILDEEASRLR
FT                   AVPGLIARLRVAIAAL"
FT   gene            626726..627997
FT                   /locus_tag="Tmz1t_0554"
FT   CDS_pept        626726..627997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0554"
FT                   /product="modification methyltransferase"
FT                   /note="KEGG: azo:azo3757 modification methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53327"
FT                   /db_xref="GOA:C4ZLE3"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR011639"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE3"
FT                   /inference="similar to AA sequence:KEGG:azo3757"
FT                   /protein_id="ACK53327.1"
FT                   /translation="MSSPIAASSSLPAQLPLGLRDVAALGQVFTPEPVVRAMVALRRNA
FT                   GRVLEPSCGDGAFLRHLPGAVGLELDPDHCPPGAQAIDFFAYPERERFDTIIGNPPYVR
FT                   IQDIAESTRALIERGAYGDLLDGRANLYLFFIAKCLRHLRPGGELIFITPRDFLKATSA
FT                   VKLNRLLVESGSITDAIELGDARVFDDAVPNCLIWRFEKGRSARAMRYCALGVGDDLAA
FT                   GLAAPAWEERHLVEAGGHLMFARGDYPLRLADVAFVKVGAVSGADELFTDAVNGNRDFV
FT                   CSSTVSTGQTRRMIWSEPGDPPPALLAPHKARLLQRKVTRFDESNWWMWGRLHHRSAQP
FT                   RVYVNGKTRVPKPFFVHPCTDYDGAVLAIFPRRADVDIEAFRDALNAVDWEDLGFVCDG
FT                   RFLFTQRSLEHAPLPADFEAFLPA"
FT   gene            628224..628532
FT                   /locus_tag="Tmz1t_0555"
FT   CDS_pept        628224..628532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0555"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   eba:ebB115 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53328"
FT                   /db_xref="GOA:C4ZLE4"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE4"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ACK53328.1"
FT                   /translation="MENDMATKIAANPKYQKLVRTRSSFGWILTAIMMFVYYGYIALIA
FT                   FNKESLAARLGEGVMTVGIPVGFGVIVFTILITGFYVRRANSEFDQLTREIVEEAGK"
FT   gene            628529..630247
FT                   /locus_tag="Tmz1t_0556"
FT   CDS_pept        628529..630247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0556"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: azo:azo0978 acetate
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53329"
FT                   /db_xref="GOA:C4ZLE5"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE5"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACK53329.1"
FT                   /translation="MIGTNAKLAGGLVLALLSSVALAAGGDLGQAEKQATNWTAILMFA
FT                   AFVAGTLYITKWAAAKTKSAADFYTGGGGITGFQNGLAIAGDYMSAASFLGISAAVMAS
FT                   GYDGLIYSIGFLVGWPVITFLMAERLRNLGKFTFADVAAYRFQQTPIRAFAASGTLVVV
FT                   AFYLIAQMVGAGQLIKLLFGLEYWMAVVIVGALMMIYVLFGGMTATTWVQIIKACLLLA
FT                   GASFMAFMVLLNYGFSPEALFADAVRVKTEVSAATGKTALEASTVGQAIMGPGSFIKDP
FT                   ISAISFGMALMFGTAGLPHILMRFFTVPDAKEARKSVFWATTWIGYFYVLTFIIGFGAI
FT                   VLVSTNPTFLDAKGGLIGGSNMAAIHLANAVGGNVFLGFISAVAFATILAVVAGLTLSG
FT                   ASAVSHDLYATVFKKGKADSASELKVSRITTLVLGAIAVVLGIAFEKQNIAFMVSLAFA
FT                   IAASANFPVLFMSVLWKDCTTRGATIGGFLGLITAVVLTVVSPSVWEVTLGNPKGSALF
FT                   PYASPALFSMAAGFIGIWLFSILDNSARAKEDRAGYMAQKVRSETGIGAASASAH"
FT   gene            complement(630323..631765)
FT                   /locus_tag="Tmz1t_0557"
FT   CDS_pept        complement(630323..631765)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0557"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   Two-component sensor kinase domain protein; histidine
FT                   kinase HAMP region domain protein; histidine kinase A
FT                   domain protein; SMART: ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; KEGG:
FT                   mfa:Mfla_1308 periplasmic sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53330"
FT                   /db_xref="GOA:C4ZLE6"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE6"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACK53330.1"
FT                   /translation="MQTSLRRKLLSSLAAPTGLLLAIAGAVAYGTAKGMVGDAYDHNLL
FT                   NLAHAIATHVHPEADGLNLRLSSEVEAVLRSDTQDRIYFRVRDLGGRLLGGDAALPLLD
FT                   DSDAASALPVPYSPVGRETPQPPRAPSTRPLFRDLVHAGEPIRALRLYRETPAGGYYVT
FT                   VAETLVKREAAMDRLLLGFVSAGALLLLAAGIAAGLGIPSGLAPLERLEESLRRRAGTD
FT                   LSPIDPKAVPDEVREVVRALNGLLERQRNASARQREFLQDAAHQLRTPLAGLQMQLELL
FT                   ESRPLDEAARHRLRVSVARVIRLANQLLALARAEAGGRLVADASEVELTALIDPLVEDW
FT                   IERADARAIDLGVEREAVRMVGDPTLLQELIANLMDNALKYCDEGGKVSLRCAREEGQV
FT                   CIEVDDDGPGIPREVREQVFERFYRHAGTRASGSGLGLSIAREIVRGHGGSIAIDDGPD
FT                   GRGTRVRVLLPIDGHHGKTAGR"
FT   gene            complement(631743..632420)
FT                   /locus_tag="Tmz1t_0558"
FT   CDS_pept        complement(631743..632420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0558"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; SMART: response regulator
FT                   receiver; KEGG: azo:azo0979 transcriptional regulatory
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53331"
FT                   /db_xref="GOA:C4ZLE7"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE7"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACK53331.1"
FT                   /translation="MRLLLVEDDPALAEGIAEFLRGQGDEVEVEGDGMRADRLLQNNGY
FT                   DFVLLDVGLPGLGGYELVRRIRKRGQRMPVIVITARDALDDRIYGLDLGADDYLVKPFE
FT                   LAELSARMRAVQRRGGGAGARLAFGALALDLDGRLAELDGAPMTLSGREWEVLEALVRA
FT                   DGRTVTRENLQGDGSGNALEVCISRLRPRVEAAGLLIRTVRGFGYRLERSKEQRDGADQ
FT                   PPA"
FT   gene            632595..633857
FT                   /locus_tag="Tmz1t_0559"
FT   CDS_pept        632595..633857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0559"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo1681 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53332"
FT                   /db_xref="GOA:C4ZLE8"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="InterPro:IPR025105"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE8"
FT                   /inference="similar to AA sequence:KEGG:azo1681"
FT                   /protein_id="ACK53332.1"
FT                   /translation="MSDMLPLDAEQIEAFLIATGIGLLIGLERERVPSARAGLRTFGLV
FT                   GMLGALVSMLGEQLGSPAPFVAGLVLVGLTIIAAYLRHPDSSDPGTTSVAALVLCYCLG
FT                   AASWLGHAQLAVMLAVGATVLLYFKAQLRGVATRLEQRDWISILQFGVLSLVILPMLPD
FT                   EEMGPHGALNPRQIWWMVVLIAGVGLAGYAALKIAGVRYGAAFVGVFGGLASSTATTLL
FT                   YARQARELPAAGAMAALVIVIANLVMVLRVWGIAAVVAPGVAAPLLKLIVPALVLGTLG
FT                   ALWLWRRLAERHETVLPATGNPTELKTALGFGAAYALVLLAAAWLSDYAGNRGLYVLAF
FT                   VSGLTDVDAITLSSLRLYALERLELVATVTALGIAMLANLCFKLGLASVIGGRALALRA
FT                   AAGMASVALGLLAGLAWVGLG"
FT   gene            complement(633892..634059)
FT                   /locus_tag="Tmz1t_0560"
FT   CDS_pept        complement(633892..634059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpt:Bpet2890 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53333"
FT                   /db_xref="GOA:C4ZLE9"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLE9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53333.1"
FT                   /translation="MDKERLFRTGFAAFWLIALGLLVLDTMSSSRIRVEPPPIALGSGQ
FT                   AASGGHCSGR"
FT   gene            complement(634070..635242)
FT                   /locus_tag="Tmz1t_0561"
FT   CDS_pept        complement(634070..635242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0561"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: rsh:Rsph17029_1397 protein of unknown function
FT                   DUF395, YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53334"
FT                   /db_xref="GOA:C4ZLF0"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF0"
FT                   /inference="protein motif:PFAM:PF04143"
FT                   /protein_id="ACK53334.1"
FT                   /translation="MRWFFRFLLVFGALAGVLAVTLAAGLRQGLLALLGVGFGAVLQGA
FT                   RFGFTTGWRDMIERRDPQGLWAQMLLMVLAAALTLPLLAGSGGELVGAVAPLTISLVLG
FT                   AFLFGAAMQLADGCGSGTLYKAGGGSPLSLVVLPTFAFGSFLGASHQPAWIGLGGLPAV
FT                   NLLAFGWPTALALTVAGCGLVAWLAGRAARRAGGDAPPSPQAIAERLVRTGTASFVAAA
FT                   GPAQSRWATRWWLGALLLAVLYLAHLVVAGQPWGIVYGMGVWGAKAVSMLGWDLSGDAF
FT                   WGVAPHAQRLVEPILADVTSVTNIGLIYGAIAASRWNGAPKFSAPSGRRLAAAAVAGLV
FT                   MGYSARMAFGCNVGAYLGGIASASLHGWVWFALAFAGSILGVRIRRRVGA"
FT   gene            complement(635256..636251)
FT                   /locus_tag="Tmz1t_0562"
FT   CDS_pept        complement(635256..636251)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0562"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; SMART: Rhodanese
FT                   domain protein; KEGG: ajs:Ajs_1650 rhodanese
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53335"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF1"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACK53335.1"
FT                   /translation="MLKKLAPLPLTIALAASLGFATPAFASTTGQSPAAAVATTAAPAP
FT                   LLQPAELKTLLGQPGVRVLDIRAEKDYAAGHVPGAVNTPYGKYRGPKENPGQLPAEAAL
FT                   TQLLQAAGVDRDTHVVVVHAGSDHTDFGAAARVYWTLKVGGLTRLSILDGGSKAWQAAG
FT                   GALETAAPQVAPSQFSYRYDQEQVVTSEELAAAVKAGNAPLLVDARPPKFFAGETRTDA
FT                   AARYGTLPGAKSFDNAQFFPQGGTTLKPASELKALVAQSGAAAAPAVSFCNTGHWAATN
FT                   WFVMSEIAGNKAVKLYPSSVVEWSQSELPMDNQPSRLSALVQDAKRALDK"
FT   gene            636481..637272
FT                   /locus_tag="Tmz1t_0563"
FT   CDS_pept        636481..637272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3016 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53336"
FT                   /db_xref="InterPro:IPR022224"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF2"
FT                   /inference="similar to AA sequence:KEGG:azo3016"
FT                   /protein_id="ACK53336.1"
FT                   /translation="MNTLSIGLRILAVLLLLAVGLSFANDPRPAVSGAEGGWRGAARHS
FT                   AGIAPDPERFADTAIVQVYAAATYGWRGYFAVHPWIIYKRAGDTVYTRYDVIGWGRGNV
FT                   VRRNYALPDGLWFGAVPRVLVEHRGEGVEAMIGQIEAAVASYPYADAYRSYPGPNSNTF
FT                   LAHIGREVPALRLDLPANAIGKDYRPVTRPLGVSPSGSGVQFSLLGLLGLSVGVQEGVE
FT                   LNLLGLNFGLDLNRPGLRLPGIGRLGLDDAAVFDRSVAGVR"
FT   gene            complement(637345..638262)
FT                   /locus_tag="Tmz1t_0564"
FT   CDS_pept        complement(637345..638262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0564"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: gbm:Gbem_1947 protein of unknown
FT                   function DUF6 transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53337"
FT                   /db_xref="GOA:C4ZLF3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACK53337.1"
FT                   /translation="MSHTPQPARWLPFVVLGIGLAAISFGAIFARLAQAEGVSSLAVAT
FT                   WRLGFAALIITPVAFLQSRHELARLTRRQIGMALAAGFFLALHFATWISSLEYTSVASS
FT                   TALVTTNPLWIGLASFLIFRETPTKMMIGGIALSFAGSLFIFWSDSQTAGAGSNPMFGN
FT                   LLALVGSWCFSAYLLIGRRLRAGLGLPAYIWLAYGAAALFLFAASGAGGVELFSLSNTA
FT                   WLVLLAMALGPQLLGHTAYNWSLRYVSATFVAVVTLGEPVGSALLAFLVFGEGFAPLQF
FT                   VGFSLLLVGIYLAAKGEKGAGSGE"
FT   gene            complement(638607..639323)
FT                   /locus_tag="Tmz1t_0565"
FT   CDS_pept        complement(638607..639323)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0565"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rce:RC1_1834 high-affinity branched-chain amino acid
FT                   transport ATP-binding protein LivF"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53338"
FT                   /db_xref="GOA:C4ZLF4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53338.1"
FT                   /translation="MMLKMEGVHAHYGHIHALRGIDVEVQVGEIVTLIGANGAGKSTLM
FT                   MSLFGNPKASAGRIVFDGEDITRVHTHEIARRGIALVPEGRRIFPRMTVIENLQMGTAH
FT                   ADPANYAADTARVFAMFPILQERQAQRAGTLSGGEQQMLAIGRALMSRPKLLLLDEPSL
FT                   GLAPIYIRKIFQIVRELNRDHGMTILLVEQNANQALRVADRGYVLQHGEITLAGTGAEL
FT                   LASPEVRAAYLEGGHA"
FT   gene            complement(639320..640153)
FT                   /locus_tag="Tmz1t_0566"
FT   CDS_pept        complement(639320..640153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0566"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rce:RC1_1833 high-affinity branched-chain amino acid
FT                   transport ATP-binding protein LivG"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53339"
FT                   /db_xref="GOA:C4ZLF5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53339.1"
FT                   /translation="MNTPATLLSVRNLTMRFGGLTAIDDLSLEVPAGRITGIIGPNGAG
FT                   KTTLFNCLTGFYKPTTGTLRLAHPTRGEMRLEALPSHRVARDAQVVRTFQNIRLFPKMT
FT                   VLENLIVAQHNVLQRASKFSIAGLFKLPGYRQAEQQAIERAAMWLARLKLTHLADDAAG
FT                   DLPYGIQRRIEIARALCVDPVLLCLDEPAAGLNPRESAELNELLLYLCGEMGIAILLIE
FT                   HDMSVVMNVSDHIGVISYGRKIAEGTPAQVKHDPQVIKAYLGEDEEEEVTGGAAA"
FT   gene            complement(640150..641481)
FT                   /locus_tag="Tmz1t_0567"
FT   CDS_pept        complement(640150..641481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0567"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rru:Rru_A1750 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53340"
FT                   /db_xref="GOA:C4ZLF6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR021807"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53340.1"
FT                   /translation="MSAVVFARHAMTPSERLRDAGWVAFVGLILGIPLIGLTTVDVGGR
FT                   LGIETRFGLLAAAVAAVFAGRLLLRWAIDQARNRKQDRDRASTSTAADRAHGAQRVVNV
FT                   LGWVALGASIALPIVFSDNRYVVDTATTVLIYVMLGWGLNVVVGLAGLLDLGYVAFYAV
FT                   GAYSYALLSTQFGWSFWEALPVSGALAASFGILLGYPILRLRGDYLAIVTLGFGEIIRI
FT                   ILVNWTEFSGGPNGISSIPRPSFFGLDFTRSAPEGGQTFSGFFGLEFSPMHRLIFLYYL
FT                   ILVLALLTHAFVSRLRKLPVGRAWEALREDEIACQAMGMNTTNIKLSAFAIGAMLGGFA
FT                   GVFFAARQGFISPESFTFTESAIILAIVVLGGMGSQMGVVLAATLLVLIPEFGRNFAEY
FT                   RMLLFGLAMVLIMVWRPGGLLSHREPTVRLNALDKTPATPEAAR"
FT   gene            complement(641481..642395)
FT                   /locus_tag="Tmz1t_0568"
FT   CDS_pept        complement(641481..642395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0568"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rru:Rru_A1751 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53341"
FT                   /db_xref="GOA:C4ZLF7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF7"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53341.1"
FT                   /translation="MAYALQQLINGLTLGAMYGLIAIGYTMVYGIIGMINFAHGDIFMV
FT                   SAFIAVTAFTILAAADVTSIPLALTFVLIVSIFFTSAYGWAVERTAYRPLRGSTRLAPL
FT                   ISAIGMSIFLQNSVQLTQGARVKPIPPVLEGGIVLWDAPGFTVQIGWSQMLIIVTTVIL
FT                   MSAFTWMITQTPFGRQQRACEQDRTMAALLGVNVDRTISYTFMLGAALAAVAGVMVTVY
FT                   YGVVDFFIGFLAGIKAFTAAVLGGIGSLPGAMLGGLLIGLIESFWAAYLWAEYKDVATF
FT                   GILCLVLMLRPSGLLGRPEVEKV"
FT   gene            complement(642604..643698)
FT                   /locus_tag="Tmz1t_0569"
FT   CDS_pept        complement(642604..643698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0569"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rru:Rru_A1746 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53342"
FT                   /db_xref="GOA:C4ZLF8"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF8"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACK53342.1"
FT                   /translation="MKKTLLATAVLALGGFSNAALADLSVAIAGPMTGQYASAGDQIRK
FT                   GAEMAIADINARGGVLGEKLKLEVGDDACDPKQAVSVANTMVNKGIVFMHGHWCSSSTI
FT                   PASEVYVESDIPMATVSTNPQVTERGLKNIFRIMGRDDQQGLVAGSYIAEKFAGKKVAV
FT                   VDDKSAYGKGLADEMAKAMEGKGMKPTLRESITAGEKDYSGIVTKLKQAGVEVMAYGGY
FT                   HTEVALILRQAQAAGLQLTVMGGDTMTNSELVTAAGPTADNVMFTFSPDARKNPNAAPV
FT                   VEKFRAAKTEPEGYVLYAYAAMQLFEQAATAAKSTKFADLEKAMRGGSFKTVIGELSFD
FT                   AKGDQKAPGFVVYRWKGGQYDYAN"
FT   gene            complement(644045..647770)
FT                   /locus_tag="Tmz1t_0570"
FT   CDS_pept        complement(644045..647770)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0570"
FT                   /product="delta-1-pyrroline-5-carboxylate dehydrogenase"
FT                   /note="TIGRFAM: delta-1-pyrroline-5-carboxylate
FT                   dehydrogenase; PFAM: Proline dehydrogenase; Aldehyde
FT                   Dehydrogenase; KEGG: eba:ebA551 bifunctional proline
FT                   dehydrogenase/pyrroline-5-carboxylate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53343"
FT                   /db_xref="GOA:C4ZLF9"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR005933"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="InterPro:IPR041349"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLF9"
FT                   /inference="protein motif:TFAM:TIGR01238"
FT                   /protein_id="ACK53343.1"
FT                   /translation="MTDNIPSSARAAAALDAAAALPPTARSTVRHAIDAAWRTPEPECV
FT                   PALVEAARLPAALREPVRALAHDLVVGLRATRTRSSGVDALMKEFSLSSQEGVALMCLA
FT                   EALLRVPDKATADRLIRDKLADGDWRAHIGNSPSLFVNAATWGLLITGRLVSTSSEQGL
FT                   SSALTRLVARGGEPLIRKGMDLAMRMLGEQFVTGRDIDEALERGREHENKGYRYSFDML
FT                   GEAAMTASDAERYFRDYERAIQAIGVASRGRGVVDGNGISVKLSALHPRYTWSQRERVL
FT                   AELLPKLKTLCLQARRHDIGLNIDAEEADRLDLSLDLLEALATDDALAGWTGLGFVVQA
FT                   YQKRAPHVLDFVIDLARRSGQRMMVRLVKGAYWDAEIKRAQIDGLAGYPVYSRKVYTDV
FT                   SYLACAKKLLAARDVIYPQFATHNAHSLAAIFHLAAADGRAWQPGDYEFQCLHGMGEPL
FT                   YDQIVGRADRHRLVRIYAPVGSHETLLAYLVRRLLENGANTSFVNRIVDERVPVEELIA
FT                   DPVEQAAPLAGAPHPKIALPAELFGGLRTNSAGIDLASEPVRARIAAALANSRTTPFAA
FT                   GPIVAGRSAVPADVTPVSNPADRGEVVGGVAEATTDDLEHALAAASAAAADWAATPAAA
FT                   RSERLERAAALFEREADTLLALAVREAGKSWANAVAELREAVDFLRYYAQQARGFDPAS
FT                   HVALGPVLCISPWNFPLAIFSGQVAAALAAGNPVLAKPAEQTPLIAAHAVRLLHEAGIP
FT                   AAALQLLPGRGETVGAALVADARVRGVMFTGSTEVAALINRSLAARGGKVPLIAETGGQ
FT                   NAMIVDSTALPEQVVTDVLASAFDSAGQRCSALRVLCLQQDIADDVLHMLQGALAELRL
FT                   GNPADVRVDIGPVIDAGARDGLEAHVAAMLAKGARITRLPLPAACAHGTFVAPSIIEIG
FT                   ALSELGREQFGPILHVLRYRASELDSLIDAIDASGYGLTMGVHTRIDETVERVAARAHV
FT                   GNLYVNRNIIGAVVGVQPFGGEGLSGTGPKAGGPLYLHRLLARTPGPVLADGALAVTDS
FT                   DETRAADAAFSGFLEWLDGAGRGLLEGDELAALRDRADACRARRIAGLRLALPGPTGED
FT                   DSLRFTARGTIAGVADSAAAVLHQVMAALASGNRLLLADRAAARTVQAALPEALRAYVA
FT                   VDAAWFDKALGAVLFDGSDAEADALQVRVAGRSGPILQLLQPCPDYDLGRLVHERTLSI
FT                   NTAAAGGNASLMAMGA"
FT   gene            647966..648430
FT                   /locus_tag="Tmz1t_0571"
FT   CDS_pept        647966..648430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0571"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: rru:Rru_A0655
FT                   AsnC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53344"
FT                   /db_xref="GOA:C4ZLG0"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG0"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACK53344.1"
FT                   /translation="MDRIDQKILQELQADARLSIVELSRRVGLTKTPCAERIRRLEKSG
FT                   VIRGYHAALDPDAVGAGHIVVVQVLLTSTTEQDLRRFNEAVRRIPEIESCLMIAGDFDY
FT                   LLKVRTRDINEYRRVMGEQISGLPCVKQTHTYVVMEVVKDERKLPLRGSA"
FT   gene            648591..650453
FT                   /locus_tag="Tmz1t_0572"
FT   CDS_pept        648591..650453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0572"
FT                   /product="K potassium transporter"
FT                   /note="PFAM: K potassium transporter; KEGG: dar:Daro_1184
FT                   K+ potassium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53345"
FT                   /db_xref="GOA:C4ZLG1"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG1"
FT                   /inference="protein motif:PFAM:PF02705"
FT                   /protein_id="ACK53345.1"
FT                   /translation="MDSKRAMPSLTIGAIGVVFGDIGTSPLYALREIFNGHHPIPVTPG
FT                   NILGILSLVLWAIMVLVTLKYVLILMRADNRGEGGSLALLSLVVTHARSARLAWVVSML
FT                   GIFAAALFFGDSMITPAISVLSAVEGIGIVAPGLEAWVVPVTVLILTVLFAIQRRGTGV
FT                   VGLFFGPVMVVWFAVLGALGMVEIVRYPEILAALSPLHAVAFVVDHPALAFLALGAVVL
FT                   AVTGGEALYTDMGHFGPAPIRLGWFGFVLPALVVNYFGQGALLLHEPAAIESPFYHLGP
FT                   SWAMIPLLVLATLATVIASQAVISGAFSVARQAVQMGLLPRMLIVHTSGHEQGQIYVPF
FT                   TNWTLYLAVVALVVGFQNSSNLAAAYGIAVTGTMLIDTVLLGFVMVLIWRWRPLLAGLC
FT                   AGTLLLVDLAFFSANAIKIPQGGWFPIAMALVSFTVLTTWRQGRRLVQQEIAAQGLPLN
FT                   VFIDMVGEVHRVQGTAVFMTSTKDGVPAALLHNLKHNQVLHERVALVTVETADTPHVSE
FT                   LDRIYLHRIRNGFMRVIVRYGFMEDPDIPSALKHCSRFGESFEMMETTFFVSRETVIPR
FT                   LSRRLFSDWRARLFAFMSKNATSATDFFRIPNNRVVELGTQLVI"
FT   gene            650573..651886
FT                   /locus_tag="Tmz1t_0573"
FT   CDS_pept        650573..651886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0573"
FT                   /product="glutamate/cysteine ligase"
FT                   /note="TIGRFAM: glutamate/cysteine ligase; PFAM:
FT                   glutamate--cysteine ligase GshA; KEGG: azo:azo3756 GshA
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53346"
FT                   /db_xref="GOA:C4ZLG2"
FT                   /db_xref="InterPro:IPR011718"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG2"
FT                   /inference="protein motif:TFAM:TIGR02049"
FT                   /protein_id="ACK53346.1"
FT                   /translation="MVPHLTTALTGPLLELERQFLDNACDIEKWFRTQWQDHMPPFYGS
FT                   TDLRNSGFKLAPVDLNLFPGGFNNLNDVFMPLCVQAAQAAIERICPDASKLLLIPENHT
FT                   RNQFYLQNVAKLASILRLTGLDVRIGSLLPEIAAPTVLELANGATLTLEPLRRSGSRIG
FT                   LDDFDPCAVLLNNDLSAGIPQVLKGLDEQWLIPPLHAGWHKRRKSKHAECYDRVAREFA
FT                   AAIGIDPWRINPEFGVCGQINFQERTGEECLAAQVDSLLTRIRAKYKEYGVTDEPFVVV
FT                   KADAGTYGMGVMTVKDASEVVGLNRRQRNKMAVVKEGLQVHEVIIQEGVHTFETVEDGV
FT                   AEPVVYMMDHYVVGGFYRVHTERGRDENLNAPGMHFKPLAFDTSGTMPDAAQGPDAPPN
FT                   RFYAYGVVARLALLAASVEIEETAPAEEEDAGGDALAA"
FT   gene            651936..652892
FT                   /locus_tag="Tmz1t_0574"
FT   CDS_pept        651936..652892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0574"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="KEGG: azo:azo3755 glutathione synthetase; TIGRFAM:
FT                   glutathione synthetase; PFAM: glutathione synthetase
FT                   ATP-binding; RimK domain protein ATP-grasp; glutathione
FT                   synthetase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53347"
FT                   /db_xref="GOA:C4ZLG3"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG3"
FT                   /inference="protein motif:TFAM:TIGR01380"
FT                   /protein_id="ACK53347.1"
FT                   /translation="MTRKLKLLFILDPLEGLKAYKDSSIAMMRAAARRGHEVWALQRAG
FT                   LTWREGVVVGTGCVALAVCDDDAAWYRAGEAQALPLAAFDAVLMRQDPPFDFEYVTATW
FT                   LLERAAQAGVRVFNDPRAVRDHSEKIAITEFPQFTATTLVARDPADIHAFIDELGDVIL
FT                   KPLDGMGGSQIFRVRADDPNRNVIVETLAHDGTRTIMAQRYLPQIVDGDKRVLIIGGEV
FT                   VPFALARIPRAGETRGNLAAGGRGVAMALTAREREIAGFLAPTLWARGLLIVGLDVIGG
FT                   HLTEINVTSPTCMVEIAAQQGFDVAGLVIDKLERACG"
FT   gene            652883..653917
FT                   /locus_tag="Tmz1t_0575"
FT   CDS_pept        652883..653917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0575"
FT                   /product="ApbE family lipoprotein"
FT                   /note="PFAM: ApbE family lipoprotein; KEGG: azo:azo3754
FT                   putative thiamine biosynthesis lipoprotein ApbE"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53348"
FT                   /db_xref="GOA:C4ZLG4"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG4"
FT                   /inference="protein motif:PFAM:PF02424"
FT                   /protein_id="ACK53348.1"
FT                   /translation="MRLNLRILALAACALLLAACSRAQVFHHEAYVFGTRVDVAVYGEN
FT                   QAEADRAAAAVLREFDRLHRAYHAWEPSELTALNAAIARGEAATVSDELAAMLKDAQAI
FT                   AATGDGLFDPALGGLVALWGFHTDTFVPQRPDPAKLQALLAAHPSMADLVLDGNRVESR
FT                   NPAVQLDLGGYAKGYALDRAAAILRAQGVADALINIGGNVMALGAKGDQPWRIGIQHPR
FT                   APAPLATLPLYAGEAIGTSGDYQRYFELDGERYAHLLDPRTGQPAHGTQSLTVLITPRA
FT                   NAGTLSDAPSKPAYLAGDGWREQIRRFGIEHALRVAADGRVEVTRALRARLQFPSPVEA
FT                   TVVD"
FT   gene            653942..654655
FT                   /locus_tag="Tmz1t_0576"
FT   CDS_pept        653942..654655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0576"
FT                   /product="protein of unknown function DUF1043"
FT                   /note="PFAM: protein of unknown function DUF1043; KEGG:
FT                   tgr:Tgr7_1480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53349"
FT                   /db_xref="GOA:C4ZLG5"
FT                   /db_xref="InterPro:IPR009386"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG5"
FT                   /inference="protein motif:PFAM:PF06295"
FT                   /protein_id="ACK53349.1"
FT                   /translation="MDMTPQTAWLLAISAVVIVGVIAFFVGRSSAGTKGRIDELEAELA
FT                   RKAEEAERYRKEVDAHFDKTATLFVSMAGSYKELFEHLSAGYDKLSGASARERFQERVD
FT                   ALLPRRVVEPAAAGALLAGGAAGAVAGADAAEPTGSSADAVVGPAPVSVVDAAPVPEAE
FT                   DLAESVPPSVGATSGVSADEAEKAAAESVAAPAGAEEPGSAGADADAAERVRRAEGAAA
FT                   ETVGESGAESRGETR"
FT   gene            654720..655607
FT                   /locus_tag="Tmz1t_0577"
FT   CDS_pept        654720..655607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tgr:Tgr7_0585 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53350"
FT                   /db_xref="InterPro:IPR016875"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG6"
FT                   /inference="similar to AA sequence:KEGG:Tgr7_0585"
FT                   /protein_id="ACK53350.1"
FT                   /translation="MSARALHRLFLIACSALLLVGCGLRFAYSQLDWLLPWYLRDYVTL
FT                   DAGQRGEFDRRLAGLLDWHCRSHLPEYVALLRAANATLAAERVEPAQLERFLERGEALW
FT                   REIVGELEPELRRLAAGLGDEQVEELAAAFVRRGEEARAEFLSGDESAQHAARVERMEE
FT                   RLRRWFGRMTPAQRERIAAWSRALQPTTEAWLEDRARWQAELLDALRVRADAGAFAPRL
FT                   AQALAPREARWSAQHRAAVAHNRARTLELLAELHALSSAAQRRQLRDEIDMLATQFAGI
FT                   SCAEPARVSAAGGR"
FT   gene            655657..656538
FT                   /locus_tag="Tmz1t_0578"
FT   CDS_pept        655657..656538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0578"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: eba:ebA2542 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53351"
FT                   /db_xref="GOA:C4ZLG7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG7"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACK53351.1"
FT                   /translation="MHKTELDRLAIGLMVVLCSIWGLQQVAIKLASAGISPVWQAGLRS
FT                   IGATAIVVVWALLRGVKLFERDRSLAPGLLAGALFAGEFAMIFLGLQHTSASRGVIFLY
FT                   TAPFFVALGAVWLLPQEHMRRRQWMGMALAFVGVLALFGENLFAATEGAWVGDLMLLGA
FT                   ALLWAATTLTVKASALARASAEKTLLYQLGVSALVLPPLSLAMGEPGVFAPTPMVWANL
FT                   FFQAAIVAGVSYLAWFWLVREYPATRLSSFSFLTPVMGVLAGGLILGEPLTPAVYAALF
FT                   LVGSGIWVANRS"
FT   gene            656663..657271
FT                   /locus_tag="Tmz1t_0579"
FT   CDS_pept        656663..657271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0579"
FT                   /product="DSBA oxidoreductase"
FT                   /note="PFAM: DSBA oxidoreductase; KEGG: azo:azo3747
FT                   2-hydroxychromene-2-carboxylate isomerase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53352"
FT                   /db_xref="GOA:C4ZLG8"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR014440"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG8"
FT                   /inference="protein motif:PFAM:PF01323"
FT                   /protein_id="ACK53352.1"
FT                   /translation="MSRPVVEFWFEFASTYSYLSVMRIERAAAATGVDIEWKPFLLGPV
FT                   FLALGWNDSPFNIYPPKGRYMWRDLERLAEKEGLPFRHPSRFPRNGLLAARVALVGVEE
FT                   GWVAPFARAVMSANFAEDREIGEEAVIVEILGALGLPAAELMARAQADANKLALRCQTE
FT                   RAAELGLFGAPSFRVGEELFWGNDRLEDALAWACRADRR"
FT   gene            complement(657595..658329)
FT                   /locus_tag="Tmz1t_0580"
FT   CDS_pept        complement(657595..658329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53353"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLG9"
FT                   /inference="similar to AA sequence:KEGG:azo3746"
FT                   /protein_id="ACK53353.1"
FT                   /translation="MSSIAPLGHPNPETARMIRIRSLSLVVAHRSIMPGLCAALLASTI
FT                   LPAHAQTADEAARTAERTRAEALAADGKALRAEAEATYQATVPGCYEKFLVNRCIDQAK
FT                   KQRLETIRRARELEAESRGITLAERQRAAAAKPAAGERPSPPAPPAAPPAASPLAPSGP
FT                   SGDATIAPSTEAERIRAQRVEASREAEAATARQRAAQDAERASARRDAEDAAARRARQA
FT                   EEDRARYEKRLREYEQEQAGKK"
FT   gene            658444..660387
FT                   /locus_tag="Tmz1t_0581"
FT   CDS_pept        658444..660387
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0581"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: azo:azo3745 ABC transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53354"
FT                   /db_xref="GOA:C4ZLH0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLH0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53354.1"
FT                   /translation="MYPFVISLRNLRLARGAKVLIESATLQIHPGWKVGLTGANGSGKS
FT                   SLFAMLRDQLHPDQGDLDMPPGWVIAHVAQETPGLAQPAIDYVLDGDAELRRIEAELAA
FT                   AEAAHDGSHIGELHARLHEIGGYAARARAAALLDGLGFLQSDIERPVADFSGGWRMRLN
FT                   LAQALMCRSDLLLLDEPTNHLDLDAVIWLEAWLRDYRGTLLLISHDREFLDACVTHIAH
FT                   IEQQKLALYTGGYSDFERQRGERLIQQQAMFERQQRDIAHMEDYIRRFRAKATKARQAQ
FT                   SRIKALERMERIAAAHVDTPFSFAFRDAPPAPDPLLQIEDGAVGYGDKTILERITLTLR
FT                   PGERVGLLGRNGAGKSTLIKLLAHELQLASGRRLEGKGLATGYFAQHQLETLRPDESAL
FT                   QHMVRLDPQTREQELRDYLGGFDFRGDGVGGTSTPATTPCGPFSGGEKSRLALALLIWQ
FT                   RPNLLLLDEPTNHLDLEMRHALTMALQDYEGAMVLVSHDRALLRATCDRFVLVDGGRIQ
FT                   PFDGDLDDYRDWLASRRAEVAAAAACPDQAADKAARKADRAQAAADRQARLVARRPLVK
FT                   ELEQIDKRMAAWNKEKAELDAKLADPALYTGPQAGEVPALNKRQAELAERIEEAELRWL
FT                   ELHEALEAIPAD"
FT   gene            complement(660448..661650)
FT                   /locus_tag="Tmz1t_0582"
FT   CDS_pept        complement(660448..661650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0582"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; SMART: metal-dependent phosphohydrolase HD region;
FT                   KEGG: azo:azo3744 HD-domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53355"
FT                   /db_xref="GOA:C4ZLH1"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR021812"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZLH1"
FT                   /inference="protein motif:PFAM:PF01966"
FT                   /protein_id="ACK53355.1"
FT                   /translation="MIKLIPIEKLQPGMYVHDLNCSWMEHNFVRSRFAVKDEAVVRKVR
FT                   AIGTHEIYIDTARGLDLPEAPTREEIEHEVDEKIDAIAAEAAPRIAAQEVACEIERARA
FT                   LHREANLIVRDMMADVRLGKQIEMELIEPLVERIVDSIFTQQDALIPLARLKQHDAYTF
FT                   QHSVSVCALMTTFARNLQLPRPVIHEIAVGALLHDVGKASVPDAILNKPAKLTDAEFAK
FT                   MKNHVVQSKIILQATPGISAIALDVAAQHHERFDGTGYPNKLAGDAISLYGQMGAIVDV
FT                   YDAITSNRVYHKGMPPTEALRKLLDWSKFHFKPELVHAFIRAVGIYPAGSLVRLESKRL
FT                   AVVQAQNPDKLIAPKVTVMFHTDGYALTPQDLDLRHAQDRIVGHEDFATWKLNPAHWLP
FT                   K"
FT   gene            661853..662461
FT                   /locus_tag="Tmz1t_0583"
FT   CDS_pept        661853..662461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0583"
FT                   /product="phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein"
FT                   /note="TIGRFAM: phosphoserine phosphatase/homoserine
FT                   phosphotransferase bifunctional protein; PFAM: Haloacid
FT                   dehalogenase domain protein hydrolase; KEGG: azo:azo3743
FT                   phosphoserine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53356"
FT                   /db_xref="GOA:C4ZMU4"
FT                   /db_xref="InterPro:IPR011863"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU4"
FT                   /inference="protein motif:TFAM:TIGR02137"
FT                   /protein_id="ACK53356.1"
FT                   /translation="MRIVCLDLEGVLVPEIWIEFAERTGIPELRRTTRDEPNYDTLMRY
FT                   RLDILAQKKLGLPDIQDVIASMGPMPGAREFLDELRDTYQVVILSDTFYEFAKPLMKQL
FT                   GMPTLFCHSLEADAGGILVDYHLRMPDQKREAVRRFKELNFKVAAAGDSYNDTAMLGEA
FT                   HGGILFHPPENVIREFPQYPVVRDYAGLRAEIDKVFARV"
FT   gene            662507..663382
FT                   /locus_tag="Tmz1t_0584"
FT   CDS_pept        662507..663382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0584"
FT                   /product="formyltetrahydrofolate deformylase"
FT                   /note="TIGRFAM: formyltetrahydrofolate deformylase; PFAM:
FT                   formyl transferase domain protein; amino acid-binding ACT
FT                   domain protein; KEGG: azo:azo3742 formyltetrahydrofolate
FT                   deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53357"
FT                   /db_xref="GOA:C4ZMU5"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR004810"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041729"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU5"
FT                   /inference="protein motif:TFAM:TIGR00655"
FT                   /protein_id="ACK53357.1"
FT                   /translation="MHRQRFFTLSASCPDRVGIVAKVSGFIAEHRGWILETSLHAEPPL
FT                   EAGEVGRYFMRIEIKADSLPFHLAEFREKFRPLAEELEMDWKITDSAVKKRVVVLVSKQ
FT                   EHCLYDLLARWQSKELDIEIPCVISNHDTFRGFVEWHGIPFHHVPVGTDNKSAAYAEVR
FT                   RIFEEVRGDTMVLARYMQILSPDLCAAYPGRILNIHHSFLPSFVGAKPYHQAYAKGVKL
FT                   IGATCHYVTADLDQGPIIEQDVIRIDHSDAVEDMVRYGKDIEKTVLARGLRYHLEDRVL
FT                   VHGNKTIVFR"
FT   gene            complement(663393..663815)
FT                   /locus_tag="Tmz1t_0585"
FT   CDS_pept        complement(663393..663815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0585"
FT                   /product="transcriptional regulator, AsnC family"
FT                   /note="PFAM: regulatory protein AsnC/Lrp family; SMART:
FT                   regulatory protein AsnC/Lrp family; KEGG: pol:Bpro_0400
FT                   transcriptional regulator, AsnC family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53358"
FT                   /db_xref="GOA:C4ZMU6"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU6"
FT                   /inference="protein motif:PFAM:PF01037"
FT                   /protein_id="ACK53358.1"
FT                   /translation="MDTLDHQLIGLLRNDARLSVAALAHKLQVSRGTVTNRIARLEDQG
FT                   IIVGYTVRLRPDAQPHDIHAWTSIAVEGNETRAVIASLLGEPAVAELHDTNGRWDLLVG
FT                   LRAANLTELSTVLERIRLIKGIQSSETSIHLKTYRV"
FT   gene            663960..665048
FT                   /locus_tag="Tmz1t_0586"
FT   CDS_pept        663960..665048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0586"
FT                   /product="Ornithine cyclodeaminase"
FT                   /EC_number="4.3.1.12"
FT                   /note="PFAM: ornithine cyclodeaminase/mu-crystallin; KEGG:
FT                   rfr:Rfer_3883 ornithine cyclodeaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53359"
FT                   /db_xref="GOA:C4ZMU7"
FT                   /db_xref="InterPro:IPR003462"
FT                   /db_xref="InterPro:IPR023401"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU7"
FT                   /inference="protein motif:PRIAM:4.3.1.12"
FT                   /protein_id="ACK53359.1"
FT                   /translation="MSAPEARRLDTRYLSAEHVAGMVRRKGLAECIAGVASYLRQDFLR
FT                   WNDFDKCARVATHSEVGVIELMPVSDARSYAFKYVNGHPSNHRYQLPTVMAFGVLADVE
FT                   TGTPELVSELTLTTAIRTAAMSAVAARALAREDVRSMALIGNGAQSEFQALAFHHLLGV
FT                   EVFHLFDVDPSATRKLAANLERLGLAWRAFGSVRAAVRGCDIVTTATADKTRAAILTAD
FT                   MIEPGMHLNAVGGDCPGKTELHPDVLRLGPVFCEFEPQSRIEGDLQQMPADFPVTELWQ
FT                   VLAGRIQGRSGAAQVTIFDSVGFALEDYSALRYMRDLALELGMGERLALIPALDDPKDL
FT                   FGFIAAEASIAAASGAATLAAC"
FT   gene            665250..666650
FT                   /locus_tag="Tmz1t_0587"
FT   CDS_pept        665250..666650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0587"
FT                   /product="aspartate kinase"
FT                   /note="KEGG: afw:Anae109_2001 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53360"
FT                   /db_xref="GOA:C4ZMU8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU8"
FT                   /inference="similar to AA sequence:KEGG:Anae109_2001"
FT                   /protein_id="ACK53360.1"
FT                   /translation="MISVEKIGGTSMSAFGDVLRHIMLYDKSRILGRIYVVSAYSGVTN
FT                   QLLEHKKTGERGIYALFAEGSDYHGALDALAVSLKKLNAGFAELALPLDVADAFVDTRI
FT                   GEVKKYLDAMQHVLASGYIRRQDVLLAAREVLASVGESHSAFNSVEILKANGVNAILLD
FT                   LAGFHDDKAWTIDERIHNSFKGLDLDNSVIVATGYTKGTEGIMREFDRGYSEVTFSKIA
FT                   VEVRPAEAVIHKEFHLSSADPNIVGLENAVIVGATNYDVADQLADVGMEAIHPKAAKPM
FT                   ELAGIPIRLKNTFEPEHPGTLITKDYVGERARVEMVTGSDKVTLVEIHDPSMVGTVGFD
FT                   LGIMEIFCRHDISYILKATNANSIAHVLWENSVTPALIAELEARYQVVTVKNSAIVCAI
FT                   GSNISIPGVLARAAQALADAQINVNCVSQTLRQVNMQFIIERSDYKKAIIALNHSLCVT
FT                   PGVPVPRA"
FT   gene            666780..667271
FT                   /locus_tag="Tmz1t_0588"
FT   CDS_pept        666780..667271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0588"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dac:Daci_1344 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53361"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMU9"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACK53361.1"
FT                   /translation="MPKHSTPAELPVQFEPEFIAGIREIFEQKIAFNALLGLQIDDIGG
FT                   ERVHGRIAMRHELVGHFVHNRIHGGVIAACLDAMGGLAVMAAIGARHLDEPPFQRLHRF
FT                   SKLGTIDLRIDYLRPGIGESFRMEAEVLRLGSRVASTRMSFLDADGKLLSTGSAAYIVS
FT                   "
FT   gene            667279..667641
FT                   /locus_tag="Tmz1t_0589"
FT   CDS_pept        667279..667641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0589"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   eba:ebA3539 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53362"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV0"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACK53362.1"
FT                   /translation="MSAEIQAAGRGNLFAALPPSAGGEIFQTLFANPRCRVERIVSHGH
FT                   ASAPGEWYDQAGDEWVALLAGAAVLRFEGGDDDGDDVKLKVGDWLVIPAHRRHRVESTS
FT                   ADALWLAVHCAADPAK"
FT   gene            complement(667703..668410)
FT                   /locus_tag="Tmz1t_0590"
FT   CDS_pept        complement(667703..668410)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0590"
FT                   /product="protein of unknown function DUF1555"
FT                   /note="PFAM: protein of unknown function DUF1555; KEGG:
FT                   sde:Sde_2041 response regulator receiver domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53363"
FT                   /db_xref="InterPro:IPR013424"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV1"
FT                   /inference="protein motif:PFAM:PF07589"
FT                   /protein_id="ACK53363.1"
FT                   /translation="MSASLPRLLTTLAAIGGLAAAGTAHASLINGGFETGTGTPFVADA
FT                   NWALFNESAVPGWETTATDNQIEIWGNNFSSVSGGPVPAYEGRQFAEINATQFATLYQD
FT                   VFGIATGSVVGFEFAHRGRSGVDTMRMMITDLGLDNLLGGGDDTVLFSKNYSTGNTAWA
FT                   FYTSAGEAPISALGNATRFSYQAISTANGSPSVGNFIDAADFGVGVQAVPEPASIALIA
FT                   LGLAGLGLRRKRA"
FT   gene            complement(668771..669550)
FT                   /locus_tag="Tmz1t_0591"
FT   CDS_pept        complement(668771..669550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dar:Daro_3554 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53364"
FT                   /db_xref="GOA:C4ZMV2"
FT                   /db_xref="InterPro:IPR025333"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV2"
FT                   /inference="similar to AA sequence:KEGG:Daro_3554"
FT                   /protein_id="ACK53364.1"
FT                   /translation="MLFSDWHSYDHYGLAFVAFFGTLAAVFLIQWVMMRSRWAGWMQSL
FT                   QGVAPPFMNALGVLFGLVLAFLANDTWSAHDRAMSAVYREADGLRSIGALAATLPEPLG
FT                   GELRAAAAGYARASAAEWTQLARHSEAPEVLARADALLALLAAPALAEAAGANVQALLL
FT                   RKASDIRSDHDLRVALSQTHVNPLKWLGMAFLGFLTLVSVAMAHLERPRAAFAAVLLFA
FT                   LAAAPTAAIVLIQGNPFQQPSSVTPAPIVAVAKALER"
FT   gene            complement(669711..669959)
FT                   /locus_tag="Tmz1t_0592"
FT   CDS_pept        complement(669711..669959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0592"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53365"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACK53365.1"
FT                   /translation="MLLERSAVHIALSLESQTAPVRTLFERDDNVPASLADACLLRMSE
FT                   LFEPCSILTLGRNFGIYRRLGRKTISLMSPCAQVRTD"
FT   gene            complement(670414..671736)
FT                   /locus_tag="Tmz1t_0593"
FT   CDS_pept        complement(670414..671736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0593"
FT                   /product="ammonium transporter"
FT                   /note="TIGRFAM: ammonium transporter; PFAM: Rh family
FT                   protein/ammonium transporter; KEGG: eba:ebA3151 ammonium
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53366"
FT                   /db_xref="GOA:C4ZMV4"
FT                   /db_xref="InterPro:IPR001905"
FT                   /db_xref="InterPro:IPR002229"
FT                   /db_xref="InterPro:IPR018047"
FT                   /db_xref="InterPro:IPR024041"
FT                   /db_xref="InterPro:IPR029020"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV4"
FT                   /inference="protein motif:TFAM:TIGR00836"
FT                   /protein_id="ACK53366.1"
FT                   /translation="MRKLLAYLPAAALLAGVSGGAFAQEAAAAVAEVHKGDVAWIMTST
FT                   LLVLMMALPGLALFYGGMVRAKNMLSVLMQVMTVFSLNALLFAIYGYSLTFTEASPFIG
FT                   SLDKVFLSGVTIETLADTFTETVKLPEFAFIAFQATFAGITGALIVGAFAERMKFSAVL
FT                   IFSVIWFTLCYLPICHMVWGPGGYLLEDGALDFAGGTVVHINAGIAGLVGAWMVGKRIG
FT                   YGREALAPHSLTLTMVGASLLWVGWFGFNAGSNLEATAGAALAFINTLVATAAAVLAWS
FT                   LGEALIKGKPSMLGAASGAVAGLVAITPACGSVGPMGAIVIGTLSGFICLWGVNGLKHM
FT                   LGADDALDVFGVHGVGGIVGAILTGVFAAPSLGGTGAEDFSIASQVWIQTWSVLVTIVW
FT                   SAVVAFVAYKVADLLVGLRVPEDEERQGLDTTAHGETAYRY"
FT   gene            complement(671751..672089)
FT                   /locus_tag="Tmz1t_0594"
FT   CDS_pept        complement(671751..672089)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0594"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="PFAM: nitrogen regulatory protein P-II; KEGG:
FT                   eba:ebB95 P2-like signal transmitter protein GlnK"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53367"
FT                   /db_xref="GOA:C4ZMV5"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV5"
FT                   /inference="protein motif:PFAM:PF00543"
FT                   /protein_id="ACK53367.1"
FT                   /translation="MKFIAAIIKPFKLDEVREALSAIGVQGITVTEVKGFGRQKGHTEL
FT                   YRGAEYVVDFLPKVKVEAAIPDDILDQAIEAIEKSAATGKIGDGKIFVFELEQAIRIRT
FT                   GETGPDAL"
FT   gene            complement(672119..672823)
FT                   /locus_tag="Tmz1t_0595"
FT   CDS_pept        complement(672119..672823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0595"
FT                   /product="putative transmembrane protein"
FT                   /note="KEGG: eba:ebA3154 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53368"
FT                   /db_xref="GOA:C4ZMV6"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV6"
FT                   /inference="similar to AA sequence:KEGG:ebA3154"
FT                   /protein_id="ACK53368.1"
FT                   /translation="MHTKPLATALAILATIATAGTAHAGDGPFTANVGLVSDYAYRGWS
FT                   QTDERPALQGGFDYAHDSGLYAGVWGSNVSWLSDANTDVSNSLELDLYGGYKGTVGAIG
FT                   YDVGLLQYYYPGSYPKPYNSPNTLEGYVGLSWEFLSFKYSYAFTDLFGYDKSDGSQYYD
FT                   LGAAVDVGGGFTLAAHVGYSDIKGQDDYTDWKLGVTKEFGGFNFGLHYVDTDVDNADLA
FT                   DERVILSIAKSF"
FT   gene            673247..673498
FT                   /locus_tag="Tmz1t_0596"
FT   CDS_pept        673247..673498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0596"
FT                   /product="protein of unknown function DUF526"
FT                   /note="PFAM: protein of unknown function DUF526; KEGG:
FT                   azo:azo3737 putative secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53369"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV7"
FT                   /inference="protein motif:PFAM:PF04380"
FT                   /protein_id="ACK53369.1"
FT                   /translation="MSTPRILDEIGARLSELAANSPVRDIEKNAKAMLGSAFGKLDLVT
FT                   REEFEVQREVLAQARRKLAELEARVAELEAKLAGGDKA"
FT   gene            673683..675272
FT                   /locus_tag="Tmz1t_0597"
FT   CDS_pept        673683..675272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0597"
FT                   /product="Mg chelatase, subunit ChlI"
FT                   /note="KEGG: azo:azo3736 hypothetical protein; TIGRFAM: Mg
FT                   chelatase, subunit ChlI; PFAM: magnesium chelatase ChlI
FT                   subunit; ATPase associated with various cellular activities
FT                   AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53370"
FT                   /db_xref="GOA:C4ZMV8"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR001208"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV8"
FT                   /inference="protein motif:TFAM:TIGR00368"
FT                   /protein_id="ACK53370.1"
FT                   /translation="MPPVPRSAYFFVIDRGSARLTIPFRPESQMSLALVHARALDGIEA
FT                   PPVTVEVHLGNGLPQFHLVGLADTEVREARDRVRAAIQSAQFEFPQRRITVNLAPADLP
FT                   KEGGRFDLAIAIGILAASGQVAERLLPRLELCGELSLNGGLRPVRGVLSAALAAARAGR
FT                   ALVLAPANAAEAALARSATVLPADSLGAVCAHLNGHTRLEPALAAAPEDEDAAGLPDLA
FT                   DVRGQLQARRALEVAAAGGHSLLLFGPPGTGKSMLAQRLPGVLPAMDEDEAIEAAAVAS
FT                   IEGRLDPRSFHRRPFRSPHHSASAAALVGGGAVPRPGEISLAHHGVLFLDELPEFDRRV
FT                   LESLREPLETGTVTVSRARRRAEFPARFQLVAAMNPCPCGHLGDPRRACRCTPEQVARY
FT                   RGRLSGPFLDRIDLTVEVPAIAPEVLLESPPGEPSSAVRARVAAARALQATRQGCPNAR
FT                   LPAGEVERHCRPDPGGETLLRQAMQRLDLSARAYHRVLRVARTLADLAGASRPGAAQVA
FT                   EAIQYRRSLDSR"
FT   gene            675339..676547
FT                   /locus_tag="Tmz1t_0598"
FT   CDS_pept        675339..676547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0598"
FT                   /product="drug resistance transporter, Bcr/CflA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, Bcr/CflA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   azo:azo3735 putative bicyclomycin resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0598"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53371"
FT                   /db_xref="GOA:C4ZMV9"
FT                   /db_xref="InterPro:IPR004812"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMV9"
FT                   /inference="protein motif:TFAM:TIGR00710"
FT                   /protein_id="ACK53371.1"
FT                   /translation="MIRPLTHARLASLLAALSSIGPFAIDAYLPAFPAIAAALGASRLE
FT                   VQQTLTIYMVALASMVLWHGALADRFGRRRVLVALTVVFALASLVCALAPSIEWLWFGR
FT                   ALQGLSGGAGIVVGRAVVRDLHEGPQAQRLMSRVMLIFALAPALAPMLGAGLLALAGWR
FT                   AIFFFLALFGLALAWTTWRFLPETLAEEDRQPLHPRPLLRAYLAIFRHPAFMLLALGVA
FT                   LNFNGFFLYVLSAPVFILEHLSLGSGGFVWLFGPAVGGMMIGSTLSERVAGRWSPVRTV
FT                   GFGFVLMFAAVVANAAVSGLLVPAVPVSVLPIGLFSCGMAVAMPSMSLLGLEIFPERRG
FT                   MASSCQSFLQIGFNAASSALVAPLLWSSPLGLASGMGMFTALGLCAWMAWWRLGAHVRE
FT                   GAA"
FT   gene            676735..677574
FT                   /locus_tag="Tmz1t_0599"
FT   CDS_pept        676735..677574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0599"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsh:Rsph17029_1569 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0599"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53372"
FT                   /db_xref="GOA:C4ZMW0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW0"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53372.1"
FT                   /translation="MLEVDGLVKAFGGFHAVDGCTLRVAKGEILGLIGPNGAGKTTLFN
FT                   LVAGALQPTAGTIRFLGEDITALPTDARFHKGLVRTFQIPHEFHNLTARENLMMVPPRQ
FT                   PGENLFANWFAAGKVRAAEEAVRQKADDTLAFLELTHVADERAGNLSGGQKKLLELGRT
FT                   MMTDAKLVLLDEPAAGVNRTLLRKLEEKILILNRERGYTFILIEHDMEMIEKLCAPVVC
FT                   MAEGKVLIQGDFHTVRSDSRVLEAYLGETPTAVEREAAEHDPKVEELREQELHREDL"
FT   gene            677574..678278
FT                   /locus_tag="Tmz1t_0600"
FT   CDS_pept        677574..678278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0600"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: csa:Csal_1421 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0600"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53373"
FT                   /db_xref="GOA:C4ZMW1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACK53373.1"
FT                   /translation="MALLEMKDVRGGYGDADILHGVSMTVGEREIVVIVGPNGAGKSTA
FT                   MKSVFGLLTIRGGNIVFDGEDITGWAPDRIVQRGICYVPQVDNVFREMTVHENFEMGAF
FT                   LRRGDLAAAYDRIYGLFPDLKAKRRNLAGDLSGGQRQMVAMGRALMLDPKLLLLDEPTA
FT                   GLSPKYMEQIFQITRDVRDAGVSILLVEQHAKQALAFCDRGYVLATGANRHEGSGQALL
FT                   ADREVAEMFLGG"
FT   gene            678294..679163
FT                   /locus_tag="Tmz1t_0601"
FT   CDS_pept        678294..679163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0601"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   csa:Csal_1420 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0601"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53374"
FT                   /db_xref="GOA:C4ZMW2"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW2"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53374.1"
FT                   /translation="MSFMDFLNFHIVPGVVLGSIYAVGAIGITLVFGILRFSHFAHGDM
FT                   ATLGAFVALALVTAGLTPWAALPIAMAAVAVVAIVVDKLFYDYLKARPKIMTVMASLGV
FT                   ALMLRAVVQVVFGVDPRTYASGIVRPDEYFGILLRDRELYTLAAVVAIVIGLTLFLRHS
FT                   RWGKAMRAMSDNPDLARLSGVDNRKVTMLTWAIVGALCAASGFMLGINNELHSMMGWQV
FT                   LLPMFAAAILGGVGRVEGAVLGGLIVGIAEELSIFILPAQYKAATAFALLLLILLVRPR
FT                   GLLNGKVL"
FT   gene            679163..680107
FT                   /locus_tag="Tmz1t_0602"
FT   CDS_pept        679163..680107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0602"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   csa:Csal_1419 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0602"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53375"
FT                   /db_xref="GOA:C4ZMW3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACK53375.1"
FT                   /translation="MDLLGLANYAVFMAILIGIYALLALGLNIQWGFTGLFNAGIAGFF
FT                   AVGAYTSAILTSLPATGRLGGYELPLVVGWLAAMAAAALIAWPIGKICLRFRSDYLAIA
FT                   TIGIAEIIRLVIRTEGWLTGGVRGVTGVPRPFGDLDYMPSQIAYLAIVATLVLIAYLLV
FT                   ERQVKAPWGRMMRAIRDNELAAAAMGKQVEARRLQAFVFGSALMGLAGALFVHFNRSIT
FT                   PEAIDPMIATFLIWIMLILGGSGNNRGAILGAAVIWIIWSVSELLTDRLPTEVAVQAKY
FT                   ARVFIIGLTLQLVLRFRPEGILPERQAGSPPHR"
FT   gene            680201..681406
FT                   /locus_tag="Tmz1t_0603"
FT   CDS_pept        680201..681406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0603"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   csa:Csal_1418 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0603"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53376"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW4"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACK53376.1"
FT                   /translation="MKKRTVAAVVGAMLGAAVVAAPAHAQDVKLGLMAAISGPIAALAP
FT                   PMAAASKLAVAHVNEQGGILKGGKLEVVLGDSACNPQNATDVATKAVNIDRVIAVVGPA
FT                   CSGAVLASANSVTIPAGVLMITPSGTSPEITKLKDKDLVYRTLPSDDYQGRALARTLKA
FT                   RGISKVAVAYLNNDYGKGLAESFKSEFEANGGTIAGYSGHEEGKASYRSELATLARGGA
FT                   DTLVIFDYGDGTGLSILRQSLENNFFKTFVGADGMKSEGLVKAIGAANLGGFFVSAPVG
FT                   EASASLDNFNKAFKAAGENIDAVFATTSYDAAFLAALAIEKAGGDKTKLAESLRAVATA
FT                   PGEPILAGEWAKAKKLIAEGKDIDYKGAGGDHEFDAAGDVPGNYAFFKVSGNRYESIAD
FT                   MK"
FT   gene            681640..682131
FT                   /locus_tag="Tmz1t_0604"
FT   CDS_pept        681640..682131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0604"
FT                   /product="lipoprotein"
FT                   /note="KEGG: azo:azo3728 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0604"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53377"
FT                   /db_xref="GOA:C4ZMW5"
FT                   /db_xref="InterPro:IPR007450"
FT                   /db_xref="InterPro:IPR037873"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW5"
FT                   /inference="similar to AA sequence:KEGG:azo3728"
FT                   /protein_id="ACK53377.1"
FT                   /translation="MKRILAWLCGLLSALGITACDYINVKELKPGVSTSAEVRERFGPP
FT                   HMEWRNEDGSLTWEFSRQPEGIECFMITIGPDQILRRIDQVLNEETFAKVQHGMNGDQV
FT                   RRLLGKPASSQFFQLKQETVWEWRISRGPDGTNDPVFFTVSFNNEGRVTGTGRHTQFKR
FT                   "
FT   gene            682145..682768
FT                   /locus_tag="Tmz1t_0605"
FT   CDS_pept        682145..682768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0605"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3727 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0605"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53378"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW6"
FT                   /inference="similar to AA sequence:KEGG:azo3727"
FT                   /protein_id="ACK53378.1"
FT                   /translation="MYFPSTPSVRAQASPLCWLWPVLLAVLLAGCASFEPPRPYTTEAE
FT                   ALSARGEPTRRWNNDDGTVTLEYSTQPNGRSCLMVQVDRGGIVLRQWDALAPENLARVE
FT                   RGMDKEQVSRLLGTHRSEQRFRNSGEEVWDWNIRNDGPGIAVLFNVHFIDGKVVRTSQT
FT                   YVFPRDGAVLGGWSGYYGHPWGWGIGWGYPGPFFPRPFGHPFFW"
FT   gene            682965..686663
FT                   /locus_tag="Tmz1t_0606"
FT   CDS_pept        682965..686663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0606"
FT                   /product="methionine synthase"
FT                   /note="TIGRFAM: methionine synthase; PFAM: homocysteine
FT                   S-methyltransferase; Methionine synthase B12-binding module
FT                   cap domain protein; cobalamin B12-binding domain protein;
FT                   dihydropteroate synthase DHPS; Vitamin B12 dependent
FT                   methionine synthase activation region; KEGG: eba:ebA3184
FT                   B12-dependent methionine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0606"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53379"
FT                   /db_xref="GOA:C4ZMW7"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR003726"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR004223"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR011822"
FT                   /db_xref="InterPro:IPR033706"
FT                   /db_xref="InterPro:IPR036589"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="InterPro:IPR037010"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW7"
FT                   /inference="protein motif:TFAM:TIGR02082"
FT                   /protein_id="ACK53379.1"
FT                   /translation="MQADRSIELRQLLAERILILDGAMGTMIQQEKLGEADYRGERFLD
FT                   HPKDLKGNNDLLVLTRPDVVAGIHRAYLEAGADLIETNTFNATRVSQAEYGLEALAYEL
FT                   NVEGARLVRRLCDEYTAKDPARPRFCAGVLGPTSRTLSISPDVNDPGYRNISFDALADD
FT                   YYASAKGLLEGGADILLIETIFDTLNAKAAVFAIEKLFEDLGRRWPVMISGTITDASGR
FT                   TLSGQTAEAFWNSLGHAQPISFGLNCALGADQLRQYVEELSTACDTHVSAHPNAGLPNP
FT                   LSPTGYDETPEHLAGQIREWAQSGLVNIVGGCCGTTPAHIAAIAEAVRGLAPRAVPVLE
FT                   KKLRLSGLEPFNVGGDSLFVNVGERTNVTGSKAFARMILEGRFDDALAVARQQVENGAQ
FT                   VIDINMDEAMLDSVAAMERFCKLIATEPDISRVPIMLDSSKWSVIEAGLKCIQGKGVVN
FT                   SISMKEGEAEFLRQARLARRYGAAVIVMAFDEKGQADTFRRKTEICERAYRLLVKPVAE
FT                   GGAGFPAEDIIFDPNIFAIATGIEEHDNYAVDFINAVAWIKENLPYAKTSGGVSNVSFS
FT                   FRGNDPVREAIHTVFLYHAIKAGLSMGIVNAGQLGVYDELAPELRDKVEDVVMNRKPGA
FT                   GEALVEFAQTVKGQAKESAQDLAWREWAVEERLSHALVKGITEFVVADTEEVRAKLEAA
FT                   GKPPLAVIEGPLMAGMNVVGDLFGAGKMFLPQVVKSARVMKQAVAHLIPYIEAEKLRTG
FT                   ASSKGRIVVATVKGDVHDIGKNIVGVVLGCNGYEVIDLGVMVPAAKILEAAKEHGAQAI
FT                   GLSGLITPSLEEMAHVAAEMKRQGFSVPLLIGGATTSRNHTAIKIAPHYDQPVVYVPDA
FT                   SRAVGVVTALLSEGRSEAFKAEVAADYEKIRALHANKKGMQLVSLEAARANAFRVASEY
FT                   QPPRPNMLGVQAIDVELGELVDYIDWGPFFQTWDLAGRFPAILDDEVVGEAARNVFADG
FT                   KAMLDKIVAEEWLQAKAVFGLFPANAVGDDIELYTGEDRKHLAMVWHGLRQQHERPAGK
FT                   PHWCLADFVAPKDSGVPDWVGAFAVTAGLGIEPRVAAFEAAHDDYHAIMLKSLADRLAE
FT                   ACAEWLHERVRRECWGYAADETLDNAALIAEQYRGIRPAPGYPACPDHTVKGPLFELLG
FT                   ARERIGMELTESYAMMPAAAVSGFYFAHPESHYFAISKIGRDQLEDWARRTGMEVDEAA
FT                   RWLAPLL"
FT   gene            complement(686741..687589)
FT                   /locus_tag="Tmz1t_0607"
FT   CDS_pept        complement(686741..687589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0607"
FT                   /product="S-formylglutathione hydrolase"
FT                   /EC_number="3.1.2.12"
FT                   /note="KEGG: azo:azo3624 esterase; TIGRFAM:
FT                   S-formylglutathione hydrolase; PFAM: putative esterase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0607"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53380"
FT                   /db_xref="GOA:C4ZMW8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW8"
FT                   /inference="protein motif:TFAM:TIGR02821"
FT                   /protein_id="ACK53380.1"
FT                   /translation="MTTAPEQLAANRSFGGWHRRFRHRSAVLGCDMVFAIYLPPQAEAG
FT                   PVPVLYWLSGLTCTDENFMQKAGAQRLAAELGIAIVAPDTSPRGTGVPGDPDGAWDFGL
FT                   GAGFYVNATEEPWRRHYRMYDYVVEELPALVEAHFPVSDARSISGHSMGGHGALVCALK
FT                   NPGRYRAVSAFAPIANPSACPWGEKAFARYLGAERARWLEWDACALIAGATERLPLLVD
FT                   QGEADGFLAEQLRPEALRAACTAAGHPLNLRLQPGYDHSYYFIASFIDDHLRHHAAALR
FT                   G"
FT   gene            complement(687604..688716)
FT                   /locus_tag="Tmz1t_0608"
FT   CDS_pept        complement(687604..688716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0608"
FT                   /product="S-(hydroxymethyl)glutathione dehydrogenase/class
FT                   III alcohol dehydrogenase"
FT                   /note="TIGRFAM: S-(hydroxymethyl)glutathione
FT                   dehydrogenase/class III alcohol dehydrogenase; PFAM:
FT                   Alcohol dehydrogenase GroES domain protein; Alcohol
FT                   dehydrogenase zinc-binding domain protein; KEGG:
FT                   azo:azo3623 alcohol dehydrogenase classIII"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0608"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53381"
FT                   /db_xref="GOA:C4ZMW9"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMW9"
FT                   /inference="protein motif:TFAM:TIGR02818"
FT                   /protein_id="ACK53381.1"
FT                   /translation="MIRSRAAVAWAAKQPLEVTEVDVAPPKAGEVLVRIVATGVCHTDA
FT                   YTLSGADPEGIFPAILGHEGGGIVEAVGEGVSSVAVGDHVIPLYTPECGKCKFCLSGKT
FT                   NLCQAIRATQGKGLMPDGSSRFSKDGKPIFHYMGTSTFSEYTVLPEISVAKIRKDAPLD
FT                   KVCLLGCGVTTGIGAVRNTAKVEAGASVAVFGLGGIGLSAIIGAVMNKAARIVAVDINP
FT                   EKFEIARQLGATDCINPLDYDRPIQEVIVDLTDGGVDYSFECIGNVKVMRSALECCHKG
FT                   WGESVIIGVAGAGEEISTRPFQLVTGRVWRGSAFGGVRGRSELPAYVDMAQRGEIPLDT
FT                   FITHRMGLEDINKAFDLMHEGKSIRSVILY"
FT   gene            688828..689205
FT                   /locus_tag="Tmz1t_0609"
FT   CDS_pept        688828..689205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0609"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: azo:azo3700 thioredoxin-disulfide reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0609"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53382"
FT                   /db_xref="GOA:C4ZMX0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX0"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACK53382.1"
FT                   /translation="MATLELTADNFNETVEQNPIVFLDFWAAWCGPCRNFAPTYEAAAE
FT                   ANPDIVFGKVDTEAQQDLAAAFQIRSIPTIAVIREGVMVFRESGALPASALNQVIEGVR
FT                   GLDMDQVRAEIAQQQADAQQG"
FT   gene            complement(689236..690153)
FT                   /locus_tag="Tmz1t_0610"
FT   CDS_pept        complement(689236..690153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0610"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; regulatory protein
FT                   LysR; KEGG: pol:Bpro_3867 transcriptional regulator, LysR
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0610"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53383"
FT                   /db_xref="GOA:C4ZMX1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACK53383.1"
FT                   /translation="MGSSDLNYKHLRYFWTVARVGTIAEAGRVLGLAPHSISAQLATFE
FT                   GALGVTLFRRSGRRLALTEAGERILGQAEEIFALGDQIVETLRDDSLRRSLPFRIGIPD
FT                   SMPKSMVHRLIEPALRLERPGRLVCRESPLSELLAELAVHRLDLVIADRPIPPEVSVRG
FT                   HEHLLGESTLSVFAAPALAERLRGDFPRRLDGAPFLLPGEDVAHRGALLQWFERMRIRP
FT                   AIVAEFDDSALMKAFGQAGDGVFAAPTTIADYVCRQYGVRVLGEVPEARARVYAITTER
FT                   RLSHPAMQAIHSAAARALTPAAAG"
FT   gene            690308..690700
FT                   /locus_tag="Tmz1t_0611"
FT   CDS_pept        690308..690700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lch:Lcho_3349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0611"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53384"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX2"
FT                   /inference="similar to AA sequence:KEGG:Lcho_3349"
FT                   /protein_id="ACK53384.1"
FT                   /translation="MRHYETNSTPAAARLLALTVLADGGLDRNEVDTMMHTDLARRLGI
FT                   GSVEFERILREYCDDLLLSAHYLDGMRLKVADEVLDLLLEDIADPRLQQALLRTMQDIV
FT                   SADGVETSAEVEVLARALEKWGTRPH"
FT   gene            690781..691254
FT                   /locus_tag="Tmz1t_0612"
FT   CDS_pept        690781..691254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0612"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_01698 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0612"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53385"
FT                   /db_xref="GOA:C4ZMX3"
FT                   /db_xref="InterPro:IPR020948"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX3"
FT                   /inference="similar to AA sequence:KEGG:HCH_01698"
FT                   /protein_id="ACK53385.1"
FT                   /translation="MEGMRPGAAKAHDNHLGDRVDDPLIDRLHWVIRQAIRVLAVLMVA
FT                   VILWTVADVVLVLYEKLSDPPFLLLDLNDIFVVFAAFLAVLIAIEIFVNITLYLRDDVI
FT                   HVKLVIATALMAIARKVIVLDLATLAPMYLFAIGVIVLALGVTYWLVSARPDE"
FT   gene            691415..692353
FT                   /locus_tag="Tmz1t_0613"
FT   CDS_pept        691415..692353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0613"
FT                   /product="protein of unknown function UPF0187"
FT                   /note="PFAM: protein of unknown function UPF0187; KEGG:
FT                   azo:azo1570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0613"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53386"
FT                   /db_xref="GOA:C4ZMX4"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX4"
FT                   /inference="protein motif:PFAM:PF05249"
FT                   /protein_id="ACK53386.1"
FT                   /translation="MRCAPRLSVVIVRPRPHWIHLLFVRRGSLLPRILSQQLFVLLLSC
FT                   AVVLAHGQLFHVKVTLTSAPFSLMGVALAIFLGFRINASYDRYWEARKFWGVVLVEARN
FT                   LSRHALTLTRGDVDARPFVLGLIAFAGTMRNQLRGRPRDEGLDGLLPDEVLARVRTARF
FT                   APALVLLWLGQWVRDRREAGCLSPMLAQHMEGSLDALSAALGGCERIANTPLPFTYTVI
FT                   LHRSSYTYCMLLPFGLVDTTGWMTPLVVGFVSYTFFALEALSDEIEEPFGTMTNDLALD
FT                   AIVASIDASLRELLGDTPPPAPQPDGDFVLN"
FT   gene            complement(692366..693310)
FT                   /locus_tag="Tmz1t_0614"
FT   CDS_pept        complement(692366..693310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0614"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="KEGG: eba:ebA3224 putative ribose-phosphate
FT                   pyrophosphokinase; TIGRFAM: ribose-phosphate
FT                   pyrophosphokinase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0614"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53387"
FT                   /db_xref="GOA:C4ZMX5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX5"
FT                   /inference="protein motif:TFAM:TIGR01251"
FT                   /protein_id="ACK53387.1"
FT                   /translation="MIKHGLQIFACNASRELACDISNRLGLRPGRIDISRFSNDNLRVQ
FT                   IQENVRERDVFVVQSFTEPVSEHIMELMITLDALRSASAQRITAVIPYYSYARSDKKDA
FT                   PRISITGRLIADLLQTAGANRVLTMDLHADQVHGFFSVPVDHLTAVSLIAEHFRNRYDL
FT                   SNMVAVATDAGGAKRTGRFSEKLGIPMAIIDKRRVSDTAVKQGAVVGEVAGRDVVIFED
FT                   EIATAGTLVSSVDTLKAAGARSIHAAATHGVLCGPAIERLRAAAIDSVVVTNTVALPED
FT                   KRLDKLTVLNVAPLFAAAIERIHSGQSVGALFE"
FT   gene            693589..695211
FT                   /locus_tag="Tmz1t_0615"
FT   CDS_pept        693589..695211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0615"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: sulphate transporter; Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   rru:Rru_A1906 sulfate transporter/antisigma-factor
FT                   antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0615"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53388"
FT                   /db_xref="GOA:C4ZMX6"
FT                   /db_xref="InterPro:IPR001902"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX6"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACK53388.1"
FT                   /translation="MNAQASALGRWRGDFFGGLTAGIVALPLALAFGVASGAGAAAGLY
FT                   GAIVLGFVAALLGGTRMQISGPTGPMTVVFASALVAVGGDLALAMAAVLVGGLVQVGLG
FT                   VLRSGGLVRFIPYPVVSGFMSGVGVIIVLLQSAPLLGVTPASSPLAAVLALPGVLANVN
FT                   GEALLLGGLTLLIVFRTPMAVSRIVPAPLVALVAMSALSVAAGLRVPVIGDIPAGLPVP
FT                   ALPSFTLETWTTVLLLGITLGVLGSIDSLLTSLVADSITRTRHHSNRELIGQGIGNLLC
FT                   AFVGGLPGAGATMRTVINIKSGGRGRASGVVHALFLLALLLGLGPLAERIPLAVLAGIL
FT                   IKVGVDILDYRMLRLVRTAPRADVGVMAAVFALTVLVDLIVAVGAGVILSMALIIHRLA
FT                   RHSRLRVRPLPHAGEGGREAAGHELPGLASGIRVIEIEGAFFFGSASQLLDRVDQVIGT
FT                   RVVVFDCSRVPFMDLSAQFALEEMIEGLQAQSIAARVVVPPEIHAQLLRLGAPQLPAAI
FT                   LHDELDRALAEARRLAAAMPQSG"
FT   gene            complement(695199..696422)
FT                   /locus_tag="Tmz1t_0616"
FT   CDS_pept        complement(695199..696422)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0616"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   azo:azo3699 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0616"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53389"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX7"
FT                   /inference="protein motif:PFAM:PF07075"
FT                   /protein_id="ACK53389.1"
FT                   /translation="MAHPVRFGLDRLLQEPELRRPLAGRRVALLAHPASVTRDLTHSLD
FT                   ALAALPDLTLSAAFGPQHGLRGDKQDNMVESPDYTDPLLGIPVFSLYGEVRRPTAAMMD
FT                   TFDVLLVDLQDLGCRIYTFITTLRYVLEEAARHGKAVWVLDRPNPAGRPVEGTLLRAGW
FT                   ESFVGAGPLPMRHGMTMGELAHWFVATLKLDVELRVIEMQGWQPDDAPGYGWPLGERTW
FT                   INPSPNAPNLWMARAYAGTVMLEGTTLSEGRGTTRPLELFGAPDVDARALVGEMRSLAP
FT                   EWLAGCVLRECWFEPTFHKHAGKLCNGVHIHVEDPAHYEHAAFRPWRVQALAFKAIRRL
FT                   WPDYPLWRDFPYEYEHERLAIDLINGSPLLREWVDDPAATPAALDALARPDEAAWLETR
FT                   RPFLLYPD"
FT   gene            complement(696427..697062)
FT                   /locus_tag="Tmz1t_0617"
FT   CDS_pept        complement(696427..697062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0617"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: eba:ebA3238 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0617"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53390"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX8"
FT                   /inference="similar to AA sequence:KEGG:ebA3238"
FT                   /protein_id="ACK53390.1"
FT                   /translation="MSAHTVTQPLTERPRVPVITVGLRPHPTSPDAEAPWQGLVGRLLA
FT                   TMFALPEGGAVFEFRLEESRPAQLAIPAPATPGPADELWKHTCFEVFLGAPGEAGYREY
FT                   NFSPSGQWAVYGFRAWRERIEDYVPAATPEVLFSQTDDGLVLEARVPAELLPAVPAGSD
FT                   LQVSLAAVVERKDGTLEYWALRHAAAQPDFHARDTFVLTLATATHKAD"
FT   gene            697272..698447
FT                   /locus_tag="Tmz1t_0618"
FT   CDS_pept        697272..698447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0618"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   dar:Daro_1135 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0618"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53391"
FT                   /db_xref="GOA:C4ZMX9"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMX9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACK53391.1"
FT                   /translation="MRAPPLLVIVLAQLFGTSLWFSANAAGEDLLRTWALQPADIGRLT
FT                   IAVQLGFIAGTLGFSLSGLADRFPASRIFAVCAVIGAVANAGFALLAHGLGEGLAWRFA
FT                   VGLALAGVYPLGMKLVVSWVPQQAGAALAWLVGMLTLGTALPHGVRFLDAGWGWQATLL
FT                   VSSLLALLAAAMIFTLGDGPHLARRAGAPRLRLGEGLYALRAPDFRASALGYFGHQWEL
FT                   YAFWTLVPLLVSAARGAEVGLPSGPAFAVIGIGAVGCVLGGWLSRRIGSARVAALALAV
FT                   SALCCALYPFATAWPPLALAGLMLLWGASVVADSPHFSALSARACPPESVGSALAFQNA
FT                   IGFAITMVSIELVTRLWPSIGDRVAWLLLPGPVLGLLALRPLWSRSHAEAR"
FT   gene            698542..698946
FT                   /locus_tag="Tmz1t_0619"
FT   CDS_pept        698542..698946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0619"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: azo:azo3696 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Tmz1t_0619"
FT                   /db_xref="EnsemblGenomes-Tr:ACK53392"
FT                   /db_xref="UniProtKB/TrEMBL:C4ZMY0"
FT                   /inference="similar to AA sequence:KEGG:azo3696"
FT                   /protein_id="ACK53392.1"
FT                   /translation="MMKPCNRVFAALALLALAAPGWTQAVVEDAPMLRLECGGIGLEES
FT                   ERMRAEIDMHALTVFFSTTAGGWVTDVETRVDEPLSGQRVEASCGPIGQADVPAPGRYR
FT                   ISASYAGARQEHWVDLVPQGGARLSLRWQE"
FT   gene            699052..700359
FT                   /locus_tag="Tmz1t_0620"
FT   CDS_pept        699052..700359
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Tmz1t_0620"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="KEGG: azo:azo3695 tryptophanyl-tRNA synthetase;
FT                   TIGRFAM: tryptophanyl-tRNA synthetase; PFAM: aminoacy