(data stored in ACNUC7421 zone)

EMBL: CP001313

ID   CP001313; SV 1; circular; genomic DNA; STD; PRO; 132962 BP.
XX
AC   CP001313;
XX
PR   Project:PRJNA55;
XX
DT   21-APR-2010 (Rel. 104, Created)
DT   15-MAY-2014 (Rel. 120, Last updated, Version 6)
XX
DE   Rhodobacter capsulatus SB 1003 plasmid pRCB133, complete sequence.
XX
KW   .
XX
OS   Rhodobacter capsulatus SB 1003
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhodobacterales;
OC   Rhodobacteraceae; Rhodobacter.
OG   Plasmid pRCB133
XX
RN   [1]
RP   1-132962
RX   DOI; 10.1128/JB.00366-10.
RX   PUBMED; 20418398.
RA   Strnad H., Lapidus A., Paces J., Ulbrich P., Vlcek C., Paces V.,
RA   Haselkorn R.;
RT   "Complete genome sequence of the photosynthetic purple nonsulfur bacterium
RT   Rhodobacter capsulatus SB 1003";
RL   J. Bacteriol. 192(13):3545-3546(2010).
XX
RN   [2]
RP   1-132962
RA   Strnad H., Lapidus A., Vlcek C., Ulbrich P., Paces J., Maltsev N.,
RA   Kumar V., Kogan Y., Milgram A., Rebrekov D., Mazur M., Cox R., Kyrpides N.,
RA   Kolar M., Sachova J., Ridl J., Ivanova N., Kapatral V., Los T., Lykidis A.,
RA   Mikhailova N., Reznik G., Vasieva O., Fonstein M., Paces V., Haselkorn R.;
RT   ;
RL   Submitted (17-DEC-2008) to the INSDC.
RL   Department of Genomics and Bioinformatics, Institute of Molecular Genetics
RL   AS CR, v.v.i., Videnska 1083, Prague 142 20, Czech Republic
XX
DR   MD5; 4effe388f5ea782007979f88a63166e8.
DR   BioSample; SAMN02604080.
DR   EuropePMC; PMC2876497; 20363938.
DR   EuropePMC; PMC2897665; 20418398.
DR   EuropePMC; PMC3903287; 24425735.
DR   RFAM; RF00174; Cobalamin.
XX
CC   Bacteria available from Hynek Strnad (strnad@img.cas.cz) and Robert
CC   Haselkorn (rh01@uchicago.edu).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..132962
FT                   /organism="Rhodobacter capsulatus SB 1003"
FT                   /plasmid="pRCB133"
FT                   /strain="SB 1003"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:272942"
FT   gene            complement(61..792)
FT                   /locus_tag="RCAP_rcp00001"
FT   CDS_pept        complement(61..792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00001"
FT                   /product="polar amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00001"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87259"
FT                   /db_xref="GOA:D5AVC4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVC4"
FT                   /protein_id="ADE87259.1"
FT                   /translation="MDLIYEYRVFLIAGLIETLKMSLVVAIGGTLCAIAISAAVLAKTR
FT                   ILRQIGFALMEVLRDLPLMVTVLLVYFMLPMTGLNLDPFWSCCAAISIWGGANGAQILR
FT                   AGLTSVSAGQRETAAAFGFSPLKGLLLITLPQAMPVIIPPYVSLLTALVQATSLGAVVG
FT                   AQELLRSGQVVIEQTTILRGGSPAYLVYGSILVVYFALCTLISLIGGRIERHFLRPYAP
FT                   GDDTRLEAQARDLGARLQTRA"
FT   gene            complement(798..1466)
FT                   /locus_tag="RCAP_rcp00002"
FT   CDS_pept        complement(798..1466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00002"
FT                   /product="polar amino acid ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00002"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87260"
FT                   /db_xref="GOA:D5AVC5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR010065"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVC5"
FT                   /protein_id="ADE87260.1"
FT                   /translation="MSFLDWAYILNAGPDLMRGLGMTLLVSGLAILLSLTLGAIGCVLR
FT                   VSRLRPAAWAVAAYVEFIRGTPYLVQIFFIFYGLPSLGVKLSIFWSGVLALTVWASAFH
FT                   VESFRAGLSSVSRDIRNASASLGLRPWQHALLVVIPIALRSALPSTLNTVVGTIKNSAY
FT                   LQAIGLVELTFVAVDRIAQDFRSIEMFLSICVIYLVVILGVSALGRRLEKRLNRPYAAR
FT                   "
FT   gene            complement(1527..2363)
FT                   /locus_tag="RCAP_rcp00003"
FT   CDS_pept        complement(1527..2363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00003"
FT                   /product="polar amino acid ABC transporter, periplasmic
FT                   polar amino acid-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00003"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87261"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVC6"
FT                   /protein_id="ADE87261.1"
FT                   /translation="MLNVNTTLGALLLAGVTALSGAAQAQDFPPLPAAIKEAGKIRIGV
FT                   KCDSPPFGASGPDGKPLGIEIEMARKIGTFAFGSEAGAELSCVTSEARIPSLNSGKLDL
FT                   ILATLGRTPARMDVIDYSDIYFWGSSNVLVPADSPVKTLADLSGKTVIVVKGATQIKWL
FT                   EANIPGIEILQLNTTADGVQALKQGRADGFVGDGGLVYTLAGNYPETRVVEEGLDLGVN
FT                   GIGLRKNEPELKAFVDAALDELRKDGFYERVIPEFVKEPAVAEVMKRGFLEAPPQL"
FT   gene            complement(2421..3161)
FT                   /locus_tag="RCAP_rcp00004"
FT   CDS_pept        complement(2421..3161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00004"
FT                   /product="polar amino acid ABC transporter, ATP-binding
FT                   protein"
FT                   /EC_number="3.6.3.21"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00004"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87262"
FT                   /db_xref="GOA:D5AVC7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030679"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVC7"
FT                   /protein_id="ADE87262.1"
FT                   /translation="MTRALGITFDKVNKWYGRMHVLRDVSFSVAPGEKIVVCGPSGSGK
FT                   STMIRCINRLEEHQSGTITVNGVEVNDQRRNVDQVRRQVGMVFQNFNLYPHLSILDNCT
FT                   VAPRWVRNIPRAEAEERAMHYLERVRIPDQAHKYPSQLSGGQQQRVAIARSLCMQPEII
FT                   LFDEPTSALDPELVREVLDTMVSLAEDGMTMICVTHEMGFARQVADRVIFMDRGAIVES
FT                   AAPDDFFRNPREERTRLFLSQILH"
FT   gene            3400..4401
FT                   /gene="ansB"
FT                   /locus_tag="RCAP_rcp00005"
FT   CDS_pept        3400..4401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ansB"
FT                   /locus_tag="RCAP_rcp00005"
FT                   /product="asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00005"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87263"
FT                   /db_xref="GOA:D5AVC8"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVC8"
FT                   /protein_id="ADE87263.1"
FT                   /translation="MMPRNAPPLPRIAVIAGGGTLTALALDPFEICDYGQAGSLDAQAL
FT                   IARCGPMQTRFALHPVPFTPLPSFDMGPPQWQEIRRLCTAMLQAVPDLSGFVLTHGTGS
FT                   LEETAFFLSCTWDLPVPLVLTGAQRPASALGSDGYMNFFQAACVAACPEAGAHGVLVVT
FT                   HGEIHLPAEVTKTLNFGLDTFRAPVLGPVGLVTGETVRFHRAPAAARRIWRVPADPSAL
FT                   PRVDIVLCHTGGDAVAIEAFLAAGARGIVVAGFAPGYATGVQARRLERWIKEEGGLVVI
FT                   ASRAQGMVMPNSRNDGHGFLPAGLLSPQKARIMLQLALACGMKPPQIADVFR"
FT   gene            4422..5147
FT                   /locus_tag="RCAP_rcp00006"
FT   CDS_pept        4422..5147
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00006"
FT                   /product="transcriptional regulator, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00006"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87264"
FT                   /db_xref="GOA:D5AVC9"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVC9"
FT                   /protein_id="ADE87264.1"
FT                   /translation="MEKPRESNIERLRTALLEMIRELNLSLGDRLPTEKEMAERFQVSR
FT                   PTLREALKLLEQEAVIDVHQGKGRFLAAGASLSIARPITKFESVSQMVASHGYKAQTRV
FT                   LGFATVPAPPEIAAKLDLAEGAAALRIERLRSSGGQPLIYSIDWLPRDLIVTDGETAPD
FT                   WSGSIVGLLAKLDRNPVASTANVMATLLPPEVAAMHGLEAFGPALLIEEICYAADGSRV
FT                   IYALDYHRGSAFSFSFVRK"
FT   gene            complement(5170..6033)
FT                   /gene="frlD"
FT                   /locus_tag="RCAP_rcp00007"
FT   CDS_pept        complement(5170..6033)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frlD"
FT                   /locus_tag="RCAP_rcp00007"
FT                   /product="fructoselysine kinase"
FT                   /EC_number="2.7.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00007"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87265"
FT                   /db_xref="GOA:D5AVD0"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD0"
FT                   /protein_id="ADE87265.1"
FT                   /translation="MTVVSDLIAVGDNCLDVYLTKGHMAVGGNALNVAAQWRRKGLAAR
FT                   YLGVVGPDAEGAVILDALAGVGLDPADVERRPGNTAVTLIRDHHGDRRFLLEDLGVGDG
FT                   WRPDAAHQAALQAARWVHLGTNADPGLLRWLLEAGVGFSIDVSTRHADLPLAGVPLVFA
FT                   SGPEDPAEPIEPVLAAFRARGARRTVVTCGSRGAFFDDGGTVCSVAARKIAVRDTCGAG
FT                   DSFIATFLAALIGAHRPGPEALQLATLAAAETCQHEGGFPQPLIPIPVWLLDKYADVIG
FT                   AADGGA"
FT   gene            complement(6030..6896)
FT                   /gene="frlC"
FT                   /locus_tag="RCAP_rcp00008"
FT   CDS_pept        complement(6030..6896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="frlC"
FT                   /locus_tag="RCAP_rcp00008"
FT                   /product="protein FrlC"
FT                   /EC_number="5.3.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00008"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87266"
FT                   /db_xref="GOA:D5AVD1"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD1"
FT                   /protein_id="ADE87266.1"
FT                   /translation="MTTPPPRLSTDQLIGANFSFQHWPLADVARAMQGFGMTEIELWGI
FT                   APHLDLFHADAARIDGVRRVLEETGLKLRCLTPEQVLYPINIASGDEAYRQASIARFCR
FT                   AAEIAADLGARHLFLTPGRGFESEPASRAWDRSAEALRIIAAHAADRGLRCLLEPLQRR
FT                   ESNIAHSAADLRLLLDMVDAETMDVVLDTVAMACAGDSVADYVRLFGDRLAHVHLVDGT
FT                   PSGHLIWGEGVLPLAQYLQDLAQAGYRGALSFEPFGDGSYALDPMRAWRHNMQAIAAHL
FT                   APGKALA"
FT   gene            complement(7066..8115)
FT                   /locus_tag="RCAP_rcp00009"
FT   CDS_pept        complement(7066..8115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00009"
FT                   /product="transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00009"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87267"
FT                   /db_xref="GOA:D5AVD2"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD2"
FT                   /protein_id="ADE87267.1"
FT                   /translation="MAPRKTVTLKDIAAAANVSRAAAARALNGYGYVGAATAERVIEIA
FT                   AQLGYRGNRVAQALRGGQLPLVGFVPGDIQNPFFAQIAHDIDAQLRQSRQSLLIASSAE
FT                   SVAQERDLIESFRALNVRGVIVAPAASPTRPHLEALLHEGVPLVLIDRAVEGLPCDCVS
FT                   VDNAGGARAAVGCLIAAGHRRVAVIHDDQRIVTARDRLAGYAGALADHGIALDARLIAV
FT                   AQSTVAQATEATIRLFRQPDPPTALFTLDSLMTKGALLGLRALGLSVPRDVSLVGFDDF
FT                   DLATFTEPQITVVAQPVAQIGPLAVRMLLERMRGSTEPPRHVQLPTRLIRRGSVAPPGG
FT                   GAAATDSAC"
FT   gene            complement(8308..8454)
FT                   /locus_tag="RCAP_rcp00010"
FT   CDS_pept        complement(8308..8454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00010"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87268"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD3"
FT                   /protein_id="ADE87268.1"
FT                   /translation="MSPAASAAYIAELRQQIAILSERCALFAAELAAAREAQNPPPDPF
FT                   IAG"
FT   gene            complement(8503..9528)
FT                   /locus_tag="RCAP_rcp00011"
FT   CDS_pept        complement(8503..9528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00011"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00011"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87269"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD4"
FT                   /protein_id="ADE87269.1"
FT                   /translation="MTRRSFLVLLGVLPLMACLRPQDPRFRPDPHRSLHIAGPAGVLAG
FT                   DLVLPAGPGPFPAVLLLAGSGPQDRDEHVAGHRPFLVLSDALARAGIASLRYDKRGVGG
FT                   SAGDFATATISDFARDAGAAFDALAARPEIDPARIAILGHSEGGLTAPLAARGRKVAAL
FT                   VLLAGPAVPMEQVLRHQTRAIAALQGAPADRIAALDEALAASFAALRAAPDLAAARPRL
FT                   TAALAPLPPEVRRTYAAVLATPWGFDAARPDPLALIGAFDGPVLALYGGSDTQVDATEN
FT                   AAALRDLARTAGMQVDVMAGLNHLFQADPTGDPQNYARIPQTLAPEVPARIVAFLRRAA
FT                   G"
FT   gene            complement(9558..10676)
FT                   /locus_tag="RCAP_rcp00012"
FT   CDS_pept        complement(9558..10676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00012"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00012"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87270"
FT                   /db_xref="GOA:D5AVD5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD5"
FT                   /protein_id="ADE87270.1"
FT                   /translation="MAGIFAGMAAMAALAIWLRGRGADARLTPAVGCLALFALGLAVFL
FT                   GLDGGPWEDWQVLVLPLLPILLAQHVRSLAGPARWPRIEAALAASGGLCLPFLLLPAAA
FT                   RAAIEAGQVPTLAPGWLLAALAGVGLYWLALCLGTALAGIGILRALRRHAKALAQIIAA
FT                   PPTPRLSGVALLGACLVALFAIQLLDLLSLGRVLIGPLSDLFLFALILGTALHGLTLKM
FT                   HWPDWADAVIAATEVPAAPPSYARSGLDPEAMAQLLTRIDAAMRRDSLWRAPGLSLADL
FT                   AEAARAKPFYVSQALNQGRAESFYDYVNGWRVSEAQALLRATDHTVLDIAHATGFNAKS
FT                   TFNAAFLKRTGMTPSAWRASGPIGPVAKGAQG"
FT   gene            10813..11595
FT                   /locus_tag="RCAP_rcp00013"
FT   CDS_pept        10813..11595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00013"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00013"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87271"
FT                   /db_xref="GOA:D5AVD6"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD6"
FT                   /protein_id="ADE87271.1"
FT                   /translation="MTALFRAPLLHAALLVPLLFACAPPGPEVTHAKGPTVIFEAGLGD
FT                   TATVWDRVDMPPGLGRFAWTRAGYGLGADLVAGQSWPGDADGRRTGAEVTAQLEAALTR
FT                   VQARPPYILVGHSLGALYVLDFARSHPDQVKGIVLVDPRLPGFTARCKAEQLRGCEIPP
FT                   LLRLTLTNVERLELGGVPETETALRDLGALRDIPLTILLAEKAGLGEDPRWRGVWAAHA
FT                   EAFASDFRQTSVIPVASGHYIQTSAPEQVTAAIAAVGR"
FT   gene            11979..12293
FT                   /gene="ssb2"
FT                   /locus_tag="RCAP_rcp00014"
FT   CDS_pept        11979..12293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ssb2"
FT                   /locus_tag="RCAP_rcp00014"
FT                   /product="single-stranded DNA-binding protein-2"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00014"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87272"
FT                   /db_xref="GOA:D5AVD7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD7"
FT                   /protein_id="ADE87272.1"
FT                   /translation="MDTEWHRITCFNGLGKTVAEHCEKGMKVLVHGRIHYIKWTDSMGN
FT                   DRYSCEIIAEKVDLPQAARKRPRTKTPSSSIATTRSRSENGVSPSGPAGKPAGFAALVF
FT                   "
FT   gene            complement(12302..12622)
FT                   /locus_tag="RCAP_rcp00015"
FT   CDS_pept        complement(12302..12622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00015"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00015"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87273"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD8"
FT                   /protein_id="ADE87273.1"
FT                   /translation="MISMAIFYNAYSDLDLPDLMQRLDAAARSAGDVWEAWSASDDLGP
FT                   FHLEIMAEYGVGEGFKSECFTRHSKDHTVQAREAMLAFFESFPGRKLLLNGDVLVAFHP
FT                   EQ"
FT   gene            complement(12675..13019)
FT                   /locus_tag="RCAP_rcp00016"
FT   CDS_pept        complement(12675..13019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00016"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00016"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87274"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVD9"
FT                   /protein_id="ADE87274.1"
FT                   /translation="MRDEFEKMLEQLEAGKFVYVEPSSVMLEFNEYMASRGYSVARLEV
FT                   VRVQGGSRTGRTFEYDFLANAGPGYEEEWQIFLDPQRSAANIRDIVRRASSEGGEYQYL
FT                   VWAEVPPSKG"
FT   gene            complement(13022..13693)
FT                   /locus_tag="RCAP_rcp00017"
FT   CDS_pept        complement(13022..13693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00017"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00017"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87275"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE0"
FT                   /protein_id="ADE87275.1"
FT                   /translation="MSRASRIVEGDPAAQLALGDFVQQAYNAFAESRLRRQHGTIAQGW
FT                   VKVFPELTGGERRLGELPGFTPERIDQWLETYPAETLGLPNHTGSLPVEDPDGNIISTP
FT                   IPDEAGPNIVEARRDEAFTTPGGNTIDDHGGKGDGLEYVTGKGHTAGQIDEIIANPRPD
FT                   LSGIVAGRGRYKGQEMTLLTGQDGYWVLLSPEGRVVAVSNRNRPLWETENEPDPIIRPL
FT                   E"
FT   gene            13696..14538
FT                   /locus_tag="RCAP_rcp00018"
FT   CDS_pept        13696..14538
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00018"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87276"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE1"
FT                   /protein_id="ADE87276.1"
FT                   /translation="MADTSARTRSSAAGKRCSTIARSPAHTVSQTAHALEELQLYGYRP
FT                   FDEPDPRPMPDAQRLAVAVADIFDALVATLEDTRMEPDLEEVLWGQVNLFHRATARIER
FT                   SLDENEQAQRRLQREQDGSEVKSTELERLTAEGLTPIERRNCMDMMRDHAATEFSHHTG
FT                   STWRPRPGSMVNRRHMTAALIDSRDFLAAKRRAETEVMLPVGPKVALTGGTDFNDHHLI
FT                   WGKLDQVRTKHPDMVLLHGGSPAAACSASSCGGAVPSPALARPSVITMTSGRTFGSLR"
FT   gene            complement(14376..14690)
FT                   /locus_tag="RCAP_rcp00019"
FT   CDS_pept        complement(14376..14690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00019"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00019"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87277"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE2"
FT                   /protein_id="ADE87277.1"
FT                   /translation="MVVFRHRSAEVVLPPTGSVDRAARLLAELEVGGRTPLTQGLGEAA
FT                   NVLRQVQRRDPNVLPLVIVMTDGRANAGLGTAPPHEEALQAAAGLPPCRSTMSGCLVRT
FT                   "
FT   gene            14812..15456
FT                   /locus_tag="RCAP_rcp00020"
FT   CDS_pept        14812..15456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00020"
FT                   /product="TPR repeat domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00020"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87278"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE3"
FT                   /protein_id="ADE87278.1"
FT                   /translation="MPETWVSLSRMFAPHEIAERTPQSRKGHLTFGTANNPYKYTPACL
FT                   DAWAAVLRTVLGSRFVFLRPEGGVESFRANARAAFARRDVDPDRLDFIGVRGDHMRHYN
FT                   EIDIALDTLPHVGGTTTCEALWMGVPTVSLIGPGFAERLSCSNLSNAGLGDLAVRSVAD
FT                   YVAKAAELAADPARRAALRAGARAQIAANPLGQPARFTKNFYDLARKVASQ"
FT   gene            15453..16223
FT                   /gene="rfbF"
FT                   /locus_tag="RCAP_rcp00021"
FT   CDS_pept        15453..16223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rfbF"
FT                   /locus_tag="RCAP_rcp00021"
FT                   /product="glucose-1-phosphate cytidylyltransferase"
FT                   /EC_number="2.7.7.33"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00021"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87279"
FT                   /db_xref="GOA:D5AVE4"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR013446"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE4"
FT                   /protein_id="ADE87279.1"
FT                   /translation="MKAVILAGGRGTRLSEETGRRPKPMVDIGGQPILWHILKIYAAHG
FT                   VNEFVLCLGYRGWQIKDYFLNSARLSSDLTVDLASGVVEMLRPASEPWKIHLIDTGEDT
FT                   QTGGRLKRVGHLLRDDDAFCLTYGDGLGDVHITAAIAFHRAHGKAATVTAVVPPGRFGA
FT                   LDRQGDRVSAFVEKPAGDGGTINGGFFVLSPSVLDRIEGDATVFEQELLKGLARDGELR
FT                   AFDHRGFWQPMDTLRDRDHLQALWDGGAAPWKIW"
FT   gene            16208..16474
FT                   /locus_tag="RCAP_rcp00022"
FT   CDS_pept        16208..16474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00022"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00022"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE5"
FT                   /protein_id="ADE87280.1"
FT                   /translation="MEDLVRRPDPGVWAGKRVLLTGHTGFKGAWAARMLTLLGAEVTGL
FT                   ALDPAPGPSAFAALAVGQCWPNWSRAAFPFTRPPVPPAPRNPA"
FT   gene            16396..17232
FT                   /locus_tag="RCAP_rcp00023"
FT   CDS_pept        16396..17232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00023"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00023"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87281"
FT                   /db_xref="GOA:D5AVE6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE6"
FT                   /protein_id="ADE87281.1"
FT                   /translation="MLAELVARGIPVHATARSPGSAQPGVIWHTADLREGAERARLLAG
FT                   SPAKQLLHCAWEIEHGAFWTAPANDLWRRVSCDLAREFLAAGGERVLALGTCAEYDPLA
FT                   PSALAAVRLVAPITPYGQAKASLHEELGRICGPRLIWARLFHLYGPGEDRRRLVPSLID
FT                   AAREGRPAEVRAAGLIRDFASSAHVARALVGLMDSGATGAFDIGSGQSRSLGALARIIA
FT                   EAAGRPDLLRLSHTPGPQDPAELTPHFAALAAVSGLKPEHPLQALTEHVRREIGAA"
FT   gene            17278..17541
FT                   /locus_tag="RCAP_rcp00024"
FT   CDS_pept        17278..17541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00024"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00024"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87282"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE7"
FT                   /protein_id="ADE87282.1"
FT                   /translation="MRRRLGTITGVSPPSYLREAFRRAPHERLLGPVAAVRSKGRFEAW
FT                   RSMMRPSAEGRDARYCIVSQLYWGTALPDACQSRDAITRRGR"
FT   gene            complement(17548..18006)
FT                   /locus_tag="RCAP_rcp00025"
FT   CDS_pept        complement(17548..18006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00025"
FT                   /product="hydrolase, NUDIX family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00025"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87283"
FT                   /db_xref="GOA:D5AVE8"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE8"
FT                   /protein_id="ADE87283.1"
FT                   /translation="MSADKTSLSSAQAAARPIVATIATVFRDGHVLLVRRANPPDAGTW
FT                   GFPGGKVELGEPLEKAALRELFEETGIEARAERVFTALDAFDRDEAGALRHHHVLVAVL
FT                   CSWVSGEPVAGDDALEARWFPLHALEAGDLALSRDVAKLARQGAEIAT"
FT   gene            complement(18110..19000)
FT                   /locus_tag="RCAP_rcp00026"
FT   CDS_pept        complement(18110..19000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00026"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00026"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87284"
FT                   /db_xref="GOA:D5AVE9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVE9"
FT                   /protein_id="ADE87284.1"
FT                   /translation="MEAGLKALEAVQAIARRGSFRAAALDLGLSTTALSQTIARLEANL
FT                   GVRLFNRTTRSVSLTEAGRDFAARTAPALAEIRAAMERVRAQRDTPSGRLRINASAQGG
FT                   RAVAPLVLEFLNSHPQMQVDLVTEGRLVDIVAEGFDLGIRPADLVPRDMIALPLGAPAR
FT                   HAVVAAPGWLARHPSPLSPADLDPDHCLRVRLPNGALLRWPFEKDGRALPFEARGRLTV
FT                   DDPAIARAAVLDGAGIGYFIEADVAEDIAAGRMVRLLADWTPNRPGFSLYYPGRRNASA
FT                   GFTAFLALARQRAGA"
FT   gene            19099..19425
FT                   /locus_tag="RCAP_rcp00027"
FT   CDS_pept        19099..19425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00027"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00027"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87285"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF0"
FT                   /protein_id="ADE87285.1"
FT                   /translation="MIPLPAPIRTYFTAQAPQEAAAFAAAFAPEATVEDEGARHHGPEA
FT                   IRQWWLATKAKYRHSAEPLEITEEGDKTVVRARVSGDFPGNPVVLRFRFGLTGERIRDL
FT                   RIGG"
FT   gene            19422..20201
FT                   /locus_tag="RCAP_rcp00028"
FT   CDS_pept        19422..20201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00028"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00028"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87286"
FT                   /db_xref="GOA:D5AVF1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF1"
FT                   /protein_id="ADE87286.1"
FT                   /translation="MTGFLNLRGKRALITGGTQGAGAATVALFRDLGAQVLTTARNRPE
FT                   TLPEAMFVAADLSTVQGCERVARAVQDRMGGVDVLVHMLGGSTAPGGGFAALGEAEWQA
FT                   ELNLNLMPAVRLDRALLPGMVAQRAGVVVHVTSIQRLMPLPAATTAYAAAKAALSVYSK
FT                   SLSKEVAPAGLRVLRVAPGWIATAASIRLAGRLAEAAGTDLEGGKRMIMDSLGGIPLGR
FT                   PSTPEEIASLIAFLASDRASSITGTEHVIDGGTVPTA"
FT   gene            complement(20288..20632)
FT                   /locus_tag="RCAP_rcp00029"
FT   CDS_pept        complement(20288..20632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00029"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00029"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87287"
FT                   /db_xref="GOA:D5AVF2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF2"
FT                   /protein_id="ADE87287.1"
FT                   /translation="MTEMVTIPREEYDRLLAAAEDLADLQSYDRAKARLAAGEDELIPA
FT                   DYANRLLNGESALRVYRDLRGLTQAALAEKSGVNRVTVAEIETGRKQGSIATLRALADA
FT                   LGVSLDDLAA"
FT   gene            complement(20629..20934)
FT                   /locus_tag="RCAP_rcp00030"
FT   CDS_pept        complement(20629..20934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00030"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00030"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87288"
FT                   /db_xref="InterPro:IPR035093"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF3"
FT                   /protein_id="ADE87288.1"
FT                   /translation="MLDFGRNVAQSYIMKQISTTKAAIKALRRMPSTTAALIRAKIEAY
FT                   AQDPSAQANNVKPLKGREGIRLRVGDPRVIMDDQGNVLVLLDIGPRGGVCDGKGLR"
FT   gene            complement(21012..21620)
FT                   /locus_tag="RCAP_rcp00031"
FT   CDS_pept        complement(21012..21620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00031"
FT                   /product="phage integrase"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00031"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87289"
FT                   /db_xref="GOA:D5AVF4"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF4"
FT                   /protein_id="ADE87289.1"
FT                   /translation="MAIETLPALRPTHAPWNKGRIVGQKLPLQPKHVWSICLRLEMADN
FT                   RRDLALFNRTVDSKLRGCDLVGLRVNDIYAAGHVKERASVTQSKTRKPVRFEITEITRL
FT                   ALERWIKDPEMIGNDYLWPSRVHASPHLSTRQYARTLRDWVLSIGLEPSAYGTHSMRRT
FT                   KVAQITKKTGNLRAVQLLLGHDPRWTAQFDIWGSIWRMR"
FT   gene            21967..22155
FT                   /locus_tag="RCAP_rcp00032"
FT   CDS_pept        21967..22155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00032"
FT                   /product="sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00032"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87290"
FT                   /db_xref="GOA:D5AVF5"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF5"
FT                   /protein_id="ADE87290.1"
FT                   /translation="MQPPESAAEGVRAGFSTRRASGGTGMGLAVVRNLLSAHRGGISLA
FT                   TSRPTRFRITFDADPRI"
FT   gene            22237..22740
FT                   /locus_tag="RCAP_rcp00033"
FT   CDS_pept        22237..22740
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00033"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00033"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87291"
FT                   /db_xref="GOA:D5AVF6"
FT                   /db_xref="InterPro:IPR007404"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF6"
FT                   /protein_id="ADE87291.1"
FT                   /translation="MFIAHLPAGYLLSRQIAKSHPAKGALIATGLLASVLPDTDLFWFY
FT                   LVSDRQSVHHGYMFHWPLFWGLIAALSWGLSRALGAHGAGSFILVALANLLLHLALDSV
FT                   AAGVGWLRPLSTIEVNLVEVPARHNWWVWNFVLHWTFGLELAIILAAGLTLRRDLLRRR
FT                   PATP"
FT   gene            22833..23123
FT                   /locus_tag="RCAP_rcp00034"
FT   CDS_pept        22833..23123
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00034"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00034"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87292"
FT                   /db_xref="InterPro:IPR025643"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF7"
FT                   /protein_id="ADE87292.1"
FT                   /translation="MLLSPRQPVPASGDMEKLAHALDRLGVAYSWHKVVPFVGDLIPEP
FT                   EVRNPGYAPAYVMDICSTETGLKLLETNCINAAGFYAADVMKLAAAIDALG"
FT   gene            23143..23601
FT                   /locus_tag="RCAP_rcp00035"
FT   CDS_pept        23143..23601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00035"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00035"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87293"
FT                   /db_xref="GOA:D5AVF8"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF8"
FT                   /protein_id="ADE87293.1"
FT                   /translation="MGFVLRHLLLFFLPIVLAVGLDVATAPLRRQLYQQSGVFLRDLFS
FT                   NDPERVRTTLESLGQGGISLSESLDWGLRAAVVIGFLAFSLLIPKSASSQSAVNFLTTL
FT                   CVGFGFAKLNGGFAGLDWVELGLCLIIGLCLAVVALTRRLTSLARPAR"
FT   gene            complement(23613..24362)
FT                   /locus_tag="RCAP_rcp00036"
FT   CDS_pept        complement(23613..24362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00036"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00036"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87294"
FT                   /db_xref="GOA:D5AVF9"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVF9"
FT                   /protein_id="ADE87294.1"
FT                   /translation="MRIGRAARHLALAAVLTVLTQLGGLAWLISRLFRRKLLAFALLYA
FT                   ALWLGALMIAPHFRRVPITCHGEGPLGMRSWVFCLANRNYVAPELKAAATDMATEMART
FT                   HPGTVTLALDGNFPFLNGFPLLPHLSHKDGRKLDLAFYYADHGRYLPGQTRSPLGYFAF
FT                   EPGPRTCPPRFPTLRWDLDWLQPLWPDYAPEPERMRLALRLLSRDPRIGKIFLEPHLAA
FT                   KFGAGASKIRFQGCAAARHDDHIHIQL"
FT   gene            complement(24359..24985)
FT                   /locus_tag="RCAP_rcp00037"
FT   CDS_pept        complement(24359..24985)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00037"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00037"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87295"
FT                   /db_xref="InterPro:IPR021122"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG0"
FT                   /protein_id="ADE87295.1"
FT                   /translation="MTKKYPRTFHLPISPGASSDDKIMNSLEGLICDDLVITEKMDGEN
FT                   TTLHRGGCHARSPDSRNHPSRDWLKAFAAGIAPQLAEGERIVGENLYARHSVGYDTLPA
FT                   WFLGFAWIRGDEVQPWDLTLMRFEELGITPVPVLWRGPWRPGLFETIAAGLDPVRQEGF
FT                   VARVATAFSEAEMPRRMGKYVRAGHVQSETHWMQAALVPNGLRDA"
FT   gene            complement(25027..25794)
FT                   /locus_tag="RCAP_rcp00038"
FT   CDS_pept        complement(25027..25794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00038"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00038"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87296"
FT                   /db_xref="GOA:D5AVG1"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG1"
FT                   /protein_id="ADE87296.1"
FT                   /translation="MTAPAQHRTGWIPLAMAGLIAAGYADLAPLSLLHRPRVPGDIAAA
FT                   VAAIVAAPVLPLVSALLARYARLRLPGLVLVPLTVCCAVLGVLLTLAAMMDGGSALAFL
FT                   EGLMLTLAVVGGLQMLGRATEAGELAALLMALPTLLALWSLATVPAAAVSALKIAAGHP
FT                   YCIARHGDTHPIDSWAELRGLSLYTTRTGFKSTSHWYLHAVLIVEADADWSVWNWSFGA
FT                   MGFTPLPHPDWLTERAGSECTPEPSFLATLAPF"
FT   gene            complement(25791..26204)
FT                   /locus_tag="RCAP_rcp00039"
FT   CDS_pept        complement(25791..26204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00039"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00039"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87297"
FT                   /db_xref="GOA:D5AVG2"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG2"
FT                   /protein_id="ADE87297.1"
FT                   /translation="MGGFKDCNGLKRRAMFGTALMFGMMVLILSLQLLGGFPPLYRPFG
FT                   KLPEADLRRLIPHLFLIFPAMAAFVVFKQPIRLILPGAVGLWCGGRIRRLIAAGGATPR
FT                   FVPDWPIFTLSPMLAFDLWTPGDATLVSGRRVL"
FT   gene            26321..26530
FT                   /locus_tag="RCAP_rcp00040"
FT   CDS_pept        26321..26530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00040"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00040"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87298"
FT                   /db_xref="GOA:D5AVG3"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG3"
FT                   /protein_id="ADE87298.1"
FT                   /translation="MTPYAGCLLSTFFDPYGWGSVLIGLAFAVGLARRGRGTLSLISVL
FT                   LGVVAGALLAAFHYNLNCVELYPG"
FT   gene            26682..27713
FT                   /locus_tag="RCAP_rcp00041"
FT   CDS_pept        26682..27713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00041"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00041"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87299"
FT                   /db_xref="GOA:D5AVG4"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG4"
FT                   /protein_id="ADE87299.1"
FT                   /translation="MSPAPLFWITVLGLLAGLLGLSVAGWRHAKPVQQIVLGLAGLLGI
FT                   MLTLSFLFAPLGLPVAACALVTYVACRLVAGLASRAARLVAAPLAFGLIAAPFAERISF
FT                   EIRTASARGAYARGWADLARKPLAVQFGTLRLQLPFSPQIHVATPCPPGAAAAPGVCVI
FT                   TALDARPQAHDLLQGGPPPAAPGQPARLDRITLDATDPAGRFGVVPVSSLETAPPESRA
FT                   QSCARHPEALVSPWCAAPLSRSVTLRPAPREPDIEEILLRDHLPLEGITLPPDATGTPA
FT                   RFTCSATRDAARRNDPTRIRFRLCRLSYQPLAGLEAVVEFDGIADAELHEAAPRLIGEF
FT                   GRG"
FT   gene            complement(27841..28629)
FT                   /locus_tag="RCAP_rcp00042"
FT   CDS_pept        complement(27841..28629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00042"
FT                   /product="methyltransferase, type 11 family"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00042"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87300"
FT                   /db_xref="GOA:D5AVG5"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG5"
FT                   /protein_id="ADE87300.1"
FT                   /translation="MSNFDLSEEIRAYWGLRAATFDLAFGHRIAPGAEAEAWAVPMHRL
FT                   GDAPQRVLELACGTGEVTRLLHDLGHEVTALDFCEPMLAVARAKHAGKPRLRFRLADAH
FT                   ATMEPAQSQDAILCRHLVWTLTRPAEAFADWFRVLRPGGRLLIYDGNWAQPDPRGYWAA
FT                   GLLALWERLSPDPTYHGALGDRHAGIMRRLPFGAGLTLEALEPMLRSAGFVDLMQIPHE
FT                   PIAKAQRRSNGLRNRLRTRVYTRFILLARKPEVEAPSAAR"
FT   gene            complement(28626..29051)
FT                   /locus_tag="RCAP_rcp00043"
FT   CDS_pept        complement(28626..29051)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00043"
FT                   /product="pseudoazurin"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00043"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87301"
FT                   /db_xref="GOA:D5AVG6"
FT                   /db_xref="InterPro:IPR000923"
FT                   /db_xref="InterPro:IPR001235"
FT                   /db_xref="InterPro:IPR002386"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR012745"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG6"
FT                   /protein_id="ADE87301.1"
FT                   /translation="MKLAAIPAVALLLFAAPLLAETHDVKMYNRAESGAMAYEPAFLHI
FT                   APGDTVRFLPAQPGHNAATIEGMIPEGAIPFKSKINETFSVTLTVPGSYGIRCSPHFAM
FT                   GMVMLIKVGDAPAPVLPADLPARARSRFEAILATHPQ"
FT   gene            complement(29055..29822)
FT                   /locus_tag="RCAP_rcp00044"
FT   CDS_pept        complement(29055..29822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00044"
FT                   /product="iron siderophore/cobalamin ABC transporter,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00044"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87302"
FT                   /db_xref="GOA:D5AVG7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG7"
FT                   /protein_id="ADE87302.1"
FT                   /translation="MKVSTTDLGWASAGRPIVEGVTLDIRPGETFGLVGPNGSGKSTLL
FT                   RLIAGLLPHPRGEVRLDDVPLARQSRREVARKLAFVEQQAETDAALTVRDAVELGRTPW
FT                   LSALHPFGPRDGAIVDRALTAVGMAQMGAALWSTLSGGERQRVHIARALAQEPRLLLLD
FT                   EPTNHLDIHHQLSLLRLMTRLPVTVIVALHDLNQAIGCDRLGVMAGGRMIACGPPRQVL
FT                   TPERLARIFRVGATVLTDPADNTNLFRFHCLED"
FT   gene            complement(29819..30859)
FT                   /locus_tag="RCAP_rcp00045"
FT   CDS_pept        complement(29819..30859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00045"
FT                   /product="iron siderophore/cobalamin ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00045"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87303"
FT                   /db_xref="GOA:D5AVG8"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG8"
FT                   /protein_id="ADE87303.1"
FT                   /translation="MMAAAASGWRARSLLWRGMLGAAVLTMAILAGVVIGETPLPVSTV
FT                   AAVLANELWNAGHPVDPIDAAIIWNYRMPRTLVAAGCGAGLALSGVVLQALIRNALADP
FT                   YLLGVSAGASTGAVAVTILGVGGGALGLSGGAFVGAVLAFGLVAALARAAGGGPAQLVL
FT                   AGIAGSQLFNALTSFFIAKSANAEQARGIMFWLLGNLSGVRWPDVALAAPAAALGFLVC
FT                   LWHVRAMDAFVFGAQSAAALGIAVRRVQLVLIGATTLMTATMVSLVGSIGFVGLVIPHA
FT                   VRFAVGARHGALVPGAALAGAVFLIAADITSRMLIPGQVVAIGVVTALVGAPGFALILI
FT                   RNGGRR"
FT   gene            complement(30856..31866)
FT                   /locus_tag="RCAP_rcp00046"
FT   CDS_pept        complement(30856..31866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00046"
FT                   /product="iron siderophore/cobalamin ABC transporter,
FT                   periplasmic iron siderophore/cobalamin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00046"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87304"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVG9"
FT                   /protein_id="ADE87304.1"
FT                   /translation="MFVRSLTVALACATGFASPVMAETTYPLQLKNCGVDLTFQKAPDS
FT                   VVTVGQAATEILYALGLGDKVTGTSVWFTEVLPEFRETNARVARLADNDPSFESVVAKK
FT                   PGLVAVQYEWHVGPQGIVATREQFADVGIPTYVLPADCWKKDNSTGSDGTRSAMFEMAS
FT                   IHAGVTQLGQIFDVSDRADALVADLKAREAVAIEKARALDLHDASAVFWFSSAEMDVDP
FT                   YVAGRKGPPGYMMEKLGLKNVVESDEEWPTVSWETIARANPSVIVIARMDRRRFEADDY
FT                   EKKLAFLKSDPVTRQMDAVKNNRIVILDAHAMDPSIRNVTALETLVEALPAFGLK"
FT   gene            complement(32386..33321)
FT                   /locus_tag="RCAP_rcp00047"
FT   CDS_pept        complement(32386..33321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00047"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00047"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87305"
FT                   /db_xref="GOA:D5AVH0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH0"
FT                   /protein_id="ADE87305.1"
FT                   /translation="MGSLTTPRPRLSGEPLGIALRIGSTLAFAAMTACIKALGDAVPLG
FT                   QVVFFRSAVALLPLVLFLWWTGDFPRGLATRRPFGHIARCLMGAAAMFTSFATLRYLPL
FT                   AEATLLSYLAPVVLALLGWGMLGERLGPRRLGGVGLGLAGAAAFCLPAFSGGLPPGAAL
FT                   GGTLGLATAMLTAGALLQVRRLTLAGEKAGAIAFWFAVVSAAAGLATVPAGWVWPHPAE
FT                   FALLLGAGLAGGVAHILMTLSFRHAEAAALAPYEYLSILWAAVAGMLFFAERPGTAFLI
FT                   AGPLILGGAMIATPAGRKPTVVTRDRAQGL"
FT   gene            complement(33343..34104)
FT                   /locus_tag="RCAP_rcp00048"
FT   CDS_pept        complement(33343..34104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00048"
FT                   /product="iron siderophore/cobalamin ABC transporter,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00048"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87306"
FT                   /db_xref="GOA:D5AVH1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH1"
FT                   /protein_id="ADE87306.1"
FT                   /translation="MTIAARNLTWGIRKRTIVADVSLDVARGETLGLIGPNGSGKSSLL
FT                   RLLAGLKRPQAGFVEIEGQDIARLPRRALARQLAFVRQSAATDSNVSVRDVVRLGRTPH
FT                   RSALSGWSAEDEAAVTSALARVDMEGRRAQPWQTLSGGEKQRVHIARALAQAPRILFLD
FT                   EPTNHLDIHHQIAILRMVRELDLTSIIALHDMNLAAMFCDRIVVLEAGRVVACGTPEAV
FT                   LTAELLRAVFRVEAEIATSTTAGPPHIRFRA"
FT   gene            complement(34101..35141)
FT                   /locus_tag="RCAP_rcp00049"
FT   CDS_pept        complement(34101..35141)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00049"
FT                   /product="iron siderophore/cobalamin ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00049"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87307"
FT                   /db_xref="GOA:D5AVH2"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH2"
FT                   /protein_id="ADE87307.1"
FT                   /translation="MSIRDETGSGAGKFLLLLTVSLLVLCLAVAVAMTVGDYAIALGTV
FT                   VLAVGNGLGLTTAEIPRIEQSVVWDLRLSRALVAALAGAGLAICGAILQALLRNPLAEP
FT                   FVLGVSAGASTGAVAVIVLGIGRAGCRCPMGAFAGAFAAFALVALLSNGATSGPNHTIL
FT                   AGVAASQLFNALTSYIVTTSGNAQQARDVMFWLLGSFGGVRWPDFQLLILVVMTGLAIC
FT                   LLMARSLDAFTFGDEDAAALGVPVARIRLILFGVTAMMTATIVSMVGAIGFVGLVVPHA
FT                   ARFIVGPMHLRLIPACAAAGAIFLVLADIAARVIVAQQTIPIGVVTALVGVPFFAIILY
FT                   RSRPQS"
FT   gene            complement(35138..36172)
FT                   /locus_tag="RCAP_rcp00050"
FT   CDS_pept        complement(35138..36172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00050"
FT                   /product="iron siderophore/cobalamin ABC transporter,
FT                   periplasmic iron siderophore/cobalamin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00050"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87308"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5ASJ9"
FT                   /protein_id="ADE87308.1"
FT                   /translation="MLPLKTAILGGVALSCLCSAALAERTSYPLTIENCEQKVTFAKAP
FT                   ERTVALGQNSAEILLLLGLEDRMAATAFWPNSVLPELAAAHDKVEVLTVEFPTLEAVLA
FT                   QQPDFVPAMLVTLMGPDSKVTKREDLEALGIPTYLSPSACTTEADTQSANGSAASSAYG
FT                   VRKDLWSMDLLYKEIEDMARIFDVAERGAAVIADFKAREAALRAEFAPREDLTFLFWFS
FT                   SPSPADDAYLGGGHGPSGYIADLLGGSNAIRTEAEWPTLGWEGIMAANPTVFVAAQVDR
FT                   NRWDLDRADTKIAWLTSDPAVSQMEAVKAGRIAVMSGAAMNPSIRTLYGAEQLADQLRS
FT                   FDLP"
FT   gene            36305..37183
FT                   /locus_tag="RCAP_rcp00051"
FT   CDS_pept        36305..37183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00051"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00051"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87309"
FT                   /db_xref="GOA:D5AVH4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR030150"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH4"
FT                   /protein_id="ADE87309.1"
FT                   /translation="MAPFAPDWRVTGGLRYQRDDVERRGTTSFTPEVLDYDRSFDAWLP
FT                   KLALTHDLNDTTSIGAMVSKGYNPGGVTLGFVSRQYVTFEPETVWNYELFGRTKLFDER
FT                   LDLTGNLFYSRMKNAQRYVTSVIEGGYTDAVTVNADKAESYGMELGFSFAARDDLTLRG
FT                   NLGLLHTEIVSFENALADYEGHEFGRAPSRTLSLGADWAIRPDVTLAGTVRYTDAYFSD
FT                   DTNATALLIDAHTVADARVTWTPREDLSLFAYVNNIFDDRSVTNLRSLQGSLQGTVVDP
FT                   RSAGVGLKMTF"
FT   gene            complement(37242..37922)
FT                   /locus_tag="RCAP_rcp00052"
FT   CDS_pept        complement(37242..37922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00052"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00052"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87310"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH5"
FT                   /protein_id="ADE87310.1"
FT                   /translation="MMAELACAYAARAAERAPDWAGPVAPFHAFARARASAGIDARSLE
FT                   HWVTALRDAPPPQPIRAPGAASRPATPEDAAPEDATAGGWCEIAVPPAVCAGLHALAKT
FT                   CSASLFNTVYAAISVALQRLAGLEALTIGTSAAGRTDPAWFDTIGYFTTVTAHCLRAPG
FT                   DATPRALITAVRDQITASMPHSEIPIDLVEAALSGGTAPLDAHMFEVFIQIHAQNRLNG
FT                   ALLP"
FT   gene            38130..38459
FT                   /pseudo
FT                   /locus_tag="RCAP_rcp00053"
FT                   /note="transposase, IS4 family; fragment"
FT   gene            38384..38575
FT                   /pseudo
FT                   /locus_tag="RCAP_rcp00054"
FT                   /note="transposase, IS4 family; fragment"
FT   gene            38897..39835
FT                   /locus_tag="RCAP_rcp00055"
FT   CDS_pept        38897..39835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00055"
FT                   /product="hydrolase, alpha/beta fold family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00055"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87311"
FT                   /db_xref="GOA:D5AVH6"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH6"
FT                   /protein_id="ADE87311.1"
FT                   /translation="MRLLTLLLLSLPALAMAEPVHIPGPQGQLEAEMVAVDRAGHVIII
FT                   IPGSGPTDRDGNSPQMGLSTDTYKLLAEAFAEQGIASLRIDKRGFYGSAGAISDPNNVT
FT                   IRAYAEDVRDWAAYASSVAPCVWLAGHSEGGLVALVAAQDAPENLCGLILLATPGRPIG
FT                   QLMVEQFKANPANAPLMPEIGAIVADLEAGEARDPDSMSAVLRPLFSSGLQRYMIDLFS
FT                   YDPVEIAKEWNGPVLIVQGSEDTQVRPRDADLLASALRQSQRINLVRGTHMLKTAVAGK
FT                   PFATYTDPSLPLYENLVPGIASFMDESARPD"
FT   gene            complement(40038..40631)
FT                   /locus_tag="RCAP_rcp00056"
FT   CDS_pept        complement(40038..40631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00056"
FT                   /product="nitrate/sulfonate/bicarbonate ABC transporter,
FT                   ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00056"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87312"
FT                   /db_xref="GOA:D5AVH7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH7"
FT                   /protein_id="ADE87312.1"
FT                   /translation="MTMLIRATALGLCPPGHQRALFGPLALTLGPGESLRLNGASGAGK
FT                   TALLRHLAGLPSPVRGEVIRKPGLRIGFAFAEPRLIPGLSARGNVALPLPRPQTVWLQE
FT                   ALDQLGLGACAALPAPLLSKGQAQRVALLRALAIRPDLVILDEAVSGLDPESLARSRDF
FT                   LERSRAETGFALIETSHDATRFFAPDAPCLKLAP"
FT   gene            complement(40628..41386)
FT                   /locus_tag="RCAP_rcp00057"
FT   CDS_pept        complement(40628..41386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00057"
FT                   /product="nitrate/sulfonate/bicarbonate ABC transporter,
FT                   permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00057"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87313"
FT                   /db_xref="GOA:D5AVH8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH8"
FT                   /protein_id="ADE87313.1"
FT                   /translation="MSPSPPAKAARLGAGLAGAGLLLLLWEVIARQTLPAILPGPLAVG
FT                   RALIALLGERTFWTGSLAPSLAAALAGVLLALFFGLVLGWMSFRWPLIGAALAPLRLVL
FT                   MGLPAAVLAILLILWLEGGGTMVVAAVSALLVPVFQIATTAGLGAIDPQLDEMARLFHV
FT                   PRLRRLRHVLWPALATALMPALRVAVANGLRITLLVELLGGGQGLGRAIQSAQTWLMTD
FT                   RLLALTFVVLLMIAGAEALLALADRRARRK"
FT   gene            complement(41383..42312)
FT                   /locus_tag="RCAP_rcp00058"
FT   CDS_pept        complement(41383..42312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00058"
FT                   /product="nitrate/sulfonate/bicarbonate ABC transporter,
FT                   periplasmic nitrate/sulfonate/bicarbonate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00058"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87314"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVH9"
FT                   /protein_id="ADE87314.1"
FT                   /translation="MNLLPLFAALLLGLPAPLRAEEVILTGPPIWDSAPLIALAAQQPL
FT                   AADGITFTFRPWTNPETLRKELASGRPVVAMAPVLMAPLLQARGMKGDLLAASVTGGNL
FT                   WLIGRGSDLDGPEALSGLKITVPFEGNLPDLMLRRILGTTAWQPLYTGAYPASMQMLLA
FT                   GKADLALLAEPMASAALAADPTLRRRSDLCPLWQKATGATACPPGGALLASPDLPARGK
FT                   IVTALETAHSDLAATPGQAHALLAGFFPELSTGPGASAFAGITASLLVMPADAAPLRAF
FT                   YGEIFDLAPQAIGGTLPGPEFYASGIRK"
FT   gene            complement(42309..43352)
FT                   /locus_tag="RCAP_rcp00059"
FT   CDS_pept        complement(42309..43352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00059"
FT                   /product="methyltransferase, type 12 family"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00059"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87315"
FT                   /db_xref="GOA:D5AVI0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI0"
FT                   /protein_id="ADE87315.1"
FT                   /translation="MVTPETAPRRDQGAHVLFETIEGPIRFALLDHAMQTGLFDLCAAP
FT                   VGASDLALAQGLDPDRLTLVLRALVACGFLDRAGETFQTPPDLLPLLSARSPTSLIPSL
FT                   QALARLRHAGLDRIAELLAPERPSPERPLFDAAYWNRAHESLASFHRGAAAEVMLPCLT
FT                   GLPEWESAQSLLEIGPGSGTLARALSALRHDLRITLLDLPPVAERIAAELAELSVRVHP
FT                   GSYNDPLPEGAFDMIFASMTLYFHDRGISALIGRIAERLSPRGVFVSLHATLTEGRCAP
FT                   EEHVIGRLMPALWQRDVSFDDGEIADAMAQAGLAVSSKWIGTPFGRFRVDMGRKSLSPS
FT                   DPKAPPR"
FT   gene            complement(43346..45439)
FT                   /locus_tag="RCAP_rcp00060"
FT   CDS_pept        complement(43346..45439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00060"
FT                   /product="TonB-dependent receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00060"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87316"
FT                   /db_xref="GOA:D5AVI1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI1"
FT                   /protein_id="ADE87316.1"
FT                   /translation="MCPAPLFLPPLPGPRHRGVLISVAALALGATPVGLCAQEATNLGT
FT                   IEISPSHWSETALRSASDATVIDGADLAERNAPDLEAVTARAGNVLFQRANSGERLVVR
FT                   GLSAFDNALSDPVGYQVNGVALPLGTLQLPHFFAAEQVTLLKGPQGTAFGRNSEAGLLI
FT                   YDTLRPGDFTGVKLGFGVSGSDAGAQPPGYTASVLWGAAKEGAPALLFGLERSKTDGVI
FT                   SDPRPGGDDDGGREGRTSLLAGAAWAFENGGTLRVSFLGEDETLGKEQYRYIDGPQATG
FT                   RYESRYSDPSRENRRSSVTSLDYAQTLDGFDLTTITGFTTFDRDFLLDTDSSPLPPIPG
FT                   VAVTAFDLKDRMISQEIRLSSLEGAERFKWSLGLHAYHQATDVDFDLRGMGARRVTSIT
FT                   QNGVALYGLGEVALTDRLRLGGGLRIDHIASSASQTFSLAGSYAASDATTTPLPKATLA
FT                   WDISDRTTLHASYARGYMPAGYNYAFAGNAASLIYAPEYSWNAEIGLKTIFLNDASLSL
FT                   TGFHTTVKDKQITETVVGAVQKISNAAEAESYGLEAALSAPLGHGWQIDGSLGWQHARA
FT                   TSFMTRTGAGPVDYSGNQLPMAPNLSYGLGVTWEGGDGWRARAAVNGYGSSYFDAANTL
FT                   EQDGYRIVDASISRDLGNGVLTLWAHNLFDEEYAALSLRSFYGTLVEDGQPRSFGLNWT
FT                   TQW"
FT   gene            complement(45537..46565)
FT                   /locus_tag="RCAP_rcp00061"
FT   CDS_pept        complement(45537..46565)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00061"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00061"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87317"
FT                   /db_xref="GOA:D5AVI2"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI2"
FT                   /protein_id="ADE87317.1"
FT                   /translation="MESGLSSAARSRVSDFADVAKPASAPCPDHRRGPGAAVSGRIEPA
FT                   RSLPGEGETTRITLPGVGAATRIDLLRLGPGISVALSQFAPGRGREDVILWPAGRLLIA
FT                   FNLLGIMTIRDAAGRDHDICNGEGWVLRTNSEALTRVLHPGQGCSNLVIVIEAEAVTER
FT                   LCRVIAQELPDPGMVRRFRLSRPARGLPERFFDGADTPAALLRKEGDCLALVGNVFEEL
FT                   AQQGRAGAMPEAMLLVARTEALLRDRLAETFSLDDLAQDLGLSHVTLNRCFRRETGTTV
FT                   FERLRELRLERAAELIGHQGRSLTEIAYDCGFSSPSHLSTAFRKRFGMTARSWRRHGSQ
FT                   RN"
FT   gene            47030..48040
FT                   /locus_tag="RCAP_rcp00062"
FT   CDS_pept        47030..48040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00062"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00062"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87318"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI3"
FT                   /protein_id="ADE87318.1"
FT                   /translation="MKFVSFKSLAGAALAVGLMAQGVVAQDLQFFRIGTGGTAGTYYPI
FT                   GGLIANAISNPPGSRACADGGSCGVPGLIATAVASNGSVGNVNSINGGTLEAGFSQSDV
FT                   AFWAQTGTGIWEGQPPVEKLRLIATLYPESIHLVATKASGITSVADLKGKRVSLDEPGS
FT                   GTLVDAKIILGAFGLTEADITPEYLKPDQASDRMRDGAMDAFFFVGGYPAGAIAELSSQ
FT                   HEVVMVPITGPEVDALRAEYKFFANDVVPAGTYKGQDAEVPTLSVGAQLVTSADLSEEL
FT                   VYGITKAMFNETTQKLFANGHSKGKFITLENAVQGAGIPFHPGAEKFYREVGAIK"
FT   gene            48124..50184
FT                   /locus_tag="RCAP_rcp00063"
FT   CDS_pept        48124..50184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00063"
FT                   /product="TRAP transporter, 4TM/12TM fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00063"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87319"
FT                   /db_xref="GOA:D5AVI4"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR011853"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI4"
FT                   /protein_id="ADE87319.1"
FT                   /translation="MSDGKRAMTAAELAAIEEQFDPEARFRTVTRPVATLAGVILFALA
FT                   CYHYYTSGFGIPRATTHRGIHMGVSLLLIFLSFAALSSRRHRTHGFAVLGLPVTDWLFG
FT                   IGALVSALYVPWIYDQLAFRIGNPLQIDVAMGTILLVTLLEAVRRSMGWPLPLIALMFI
FT                   GYAYFGQSMPGIFVHPGADWSGIVNHLYLSSQGVYGTALGVIATYVFHFVLFGAMAQRI
FT                   GLGQLFIDLATALTGRFSGGPAKVSVVSSALLGSISGSSIANTVTTGALTIPAMIKIGF
FT                   RRHFAAAVEAAASTGGQITPPVMGAVAFLMVEYLGIPLRTILIAAIVPAFMHFFGVLVQ
FT                   VHLEARRLGIRGLRKEELPNAMRVLREGWLSILPLILLVYMLMSGRTPFLAAFWAITAC
FT                   IVIYAIQRVMAAGLAKGIREFAAGIYESFISGAKGALAVTAAAALVGVVIGVVTLTGIG
FT                   FKIAFMLTSVAQGWAESTHAFLAFLPIELFSMSTLALLFTLMMTAVVCILMGCGIPTTA
FT                   NYIIMVAVAAPVLSMMNVEPLVAHFFVFYFGVLADVTPPVAMAAYAAAGIAGANAFKAG
FT                   NTAFRLSMGKALVPFMFVFSPSLLLVTADFSWGSFALAFSGAVLGIIALSAAITNWLLR
FT                   PLLLIERVALPIAALLMIAPEIISTVIGAAILAAVTLRQWLADRPRSPAVP"
FT   gene            50541..50783
FT                   /locus_tag="RCAP_rcp00064"
FT   CDS_pept        50541..50783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00064"
FT                   /product="prevent-host-death family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00064"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87320"
FT                   /db_xref="InterPro:IPR006442"
FT                   /db_xref="InterPro:IPR036165"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI5"
FT                   /protein_id="ADE87320.1"
FT                   /translation="MWTVQDAKNKFSAVVEAALAGQPQEVSRRGKPAVVVVSVEEYRRL
FT                   LAGAVKARESFADHLMAFPGGDVPRATVAPRNVDF"
FT   gene            50783..51184
FT                   /gene="stbB"
FT                   /locus_tag="RCAP_rcp00065"
FT   CDS_pept        50783..51184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="stbB"
FT                   /locus_tag="RCAP_rcp00065"
FT                   /product="plasmid stability protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00065"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87321"
FT                   /db_xref="GOA:D5AVI6"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI6"
FT                   /protein_id="ADE87321.1"
FT                   /translation="MYILDTNVISAVRRPDRAPKVAAWLRGKAEQDLFLSVITLGEIER
FT                   GIRLQDPRDPDFARDLRVWLDRTVLMFSDRLLPFEAEDARIWGQLSAAIGHNGADLMIA
FT                   ASALRHGATVVTGNVSDFAPTGAMLENPF"
FT   gene            complement(51353..52573)
FT                   /locus_tag="RCAP_rcp00066"
FT   CDS_pept        complement(51353..52573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00066"
FT                   /product="NnrS family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00066"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87322"
FT                   /db_xref="GOA:D5AVI7"
FT                   /db_xref="InterPro:IPR010266"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI7"
FT                   /protein_id="ADE87322.1"
FT                   /translation="MTALKRLFSEGFRLFFLLSAVWGTVAMLVWGLWLAVHAFGGMMEL
FT                   PADMVPQWWHGHEMIFGFGAAATAGFLLTAVPNWTGAAPAGPRFLILAGGLWLAGRVGM
FT                   WLWGALPAPLAAGLALAFLPVLTGRIWLMLRAAPKPANLLVLGVVALIWGAQLRVLLDL
FT                   LGWPMGDAVAGLHGALATLIALIVIIGGRITPAFTRNALARRAMLAGAAPDLGKPRAPG
FT                   LPVSFAPADRLAVGAAIAAALAITLGLPDPVIGTAELTLGAAQLIRIARWQGWAVRGEP
FT                   ILAVLHAAMALVGFGALLQGLAAFGIGSQIGALHFSAIGGIGTMVSAVMSRATLGHTGR
FT                   PLVAPFPVALAYALIPLAALLRWAAAVGPLALYTPGTILAATLWALAFMLILIALAPLL
FT                   LGPRPHS"
FT   gene            52696..52962
FT                   /locus_tag="RCAP_rcp00067"
FT   CDS_pept        52696..52962
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00067"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00067"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87323"
FT                   /db_xref="GOA:D5AVI8"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI8"
FT                   /protein_id="ADE87323.1"
FT                   /translation="MTTSSRTTPPAAIPGRLPRLSRLGLLLYPFVTAAVAVNLFMLGLM
FT                   GQALGFAALSPTAALLWALPFGLHASVLAARWVRSLIAEAGGI"
FT   gene            complement(52996..54414)
FT                   /locus_tag="RCAP_rcp00068"
FT   CDS_pept        complement(52996..54414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00068"
FT                   /product="peptidase, M4 family"
FT                   /EC_number="3.4.24.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00068"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87324"
FT                   /db_xref="GOA:D5AVI9"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVI9"
FT                   /protein_id="ADE87324.1"
FT                   /translation="MTDLPPGATPPEAQPRLNSFYFTAWRWHFYAGLYVVPFLLMLAVT
FT                   GALMVWFTAIDSEYGDRIAIAPAAQALGVGAQIAAAEAAHPGSRADKYISPRDDRTPAI
FT                   VRVEDGETARMLAVDPYSGAVVSDRPEAGTWNDWLTNLHGELLWGGNGGPGDTLVEIAA
FT                   SLAVMMLASGLYLAWPRQGKGWRAVLVPDLAARGRSFWKSLHVTTGVWVALFLAFFLLT
FT                   GMSWTGVWGGRIVQPWSSFPAAKWDAVPLSDATHAAMNHTAQEEVPWVLELVQLPASGS
FT                   QAGVQLLPPGTPVTFETVMAGARALGFDARVQVSAPADATGVWTLSRDSQSYDSPTPTS
FT                   DRTVHLDQYTGKVLADVRFADYPLMGKMMAVGIALHEGQLGWWSVALNLLICAGLVLSC
FT                   VAGVVLWWKRRPVAAGRLAAPPRGPQARLWTGGLVVAVLVGLAFPLGGAAILAVLALDA
FT                   LLLRHVPALKRVLS"
FT   gene            complement(54445..54843)
FT                   /locus_tag="RCAP_rcp00069"
FT   CDS_pept        complement(54445..54843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00069"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00069"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87325"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ0"
FT                   /protein_id="ADE87325.1"
FT                   /translation="MKAPAFRKLDRLAVWTLVLGLVLAALLPPAVRPLRAASGTLEMVL
FT                   CSGHGPVSVILDLDSGKPLDRLPASDDRHCSWACCHLAAPVAALPAGLPLPVRMARATR
FT                   IKPPPTILRDGHVTGLPPATGPPVTAVT"
FT   gene            complement(54896..55804)
FT                   /gene="nosX"
FT                   /locus_tag="RCAP_rcp00070"
FT   CDS_pept        complement(54896..55804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosX"
FT                   /locus_tag="RCAP_rcp00070"
FT                   /product="NosX protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00070"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87326"
FT                   /db_xref="GOA:D5AVJ1"
FT                   /db_xref="InterPro:IPR003374"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR024932"
FT                   /db_xref="InterPro:IPR042159"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ1"
FT                   /protein_id="ADE87326.1"
FT                   /translation="MTDFSRRRFLSISAGIAALAASPLAAASRVWEGIALGARARIVID
FT                   HPEAAAITAEAAAEIARLEAVFSLTRADSALSRLNAAGRLEDPPFELLECLALAGTVHA
FT                   ATAGLFDPTVQPLWTLYATRFGAGLAPDEAEIAAALHRVDWGSVRFDSGGIRLAPGQTL
FT                   TLNGIAQGFIADKVAALLRGRGLERILIDTGEMRALGPQTDGTPWPITLAAGGQVALQD
FT                   RALASSSALGTTFDSAGRVGHILHPGTGRPAPAVWKLVTITAPEAGLADALSTAACLMP
FT                   RAETILQAVTRFPGARVEHLA"
FT   gene            complement(55804..56364)
FT                   /gene="nosL"
FT                   /locus_tag="RCAP_rcp00071"
FT   CDS_pept        complement(55804..56364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosL"
FT                   /locus_tag="RCAP_rcp00071"
FT                   /product="nitrous oxide reductase accessory protein NosL"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00071"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87327"
FT                   /db_xref="InterPro:IPR008719"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ2"
FT                   /protein_id="ADE87327.1"
FT                   /translation="MKRFLLAFCLLAACREEAAIPQPVSLTPEAVGYFCQMNILDHGGP
FT                   KAQVHLDAHPGKPLFFSQVRDVVTYLRMPEKDGAVQASYVTDMGAGDWTKPGSLPWIAA
FT                   DTAVYVVGSSRLGGMDQPETVPFARTEDARAFIAQYGGQLMRLSEIPETVLAPVPPEVQ
FT                   AAEEADYRARMQKHDHAKMQGGM"
FT   gene            complement(56361..57182)
FT                   /gene="nosY"
FT                   /locus_tag="RCAP_rcp00072"
FT   CDS_pept        complement(56361..57182)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosY"
FT                   /locus_tag="RCAP_rcp00072"
FT                   /product="cooper ABC transporter, permease protein NosY"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00072"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87328"
FT                   /db_xref="GOA:D5AVJ3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ3"
FT                   /protein_id="ADE87328.1"
FT                   /translation="MTAILALAKAEFRIAARNRWLAIAAVLMVIFALILTAAGSGPTGS
FT                   LGVDRLSVTVASLTSLSVYLVPLIALLLSFDAVAGEAERGTLSLILTYPVGRGRILAGK
FT                   AAAHLAILMLALVAGYGAAGVAAVLLDPASVAGLGALLRLIWTSVALGATFLGLGYAIS
FT                   ARARRPSGAAGLAIGLWLLVVVLYDLALLAAVVADNGGFFTRQVFPLTLLANPADAFRL
FT                   YNLAASQATAVAAGVAAAAQAVPVWQSAASVLLWPLVSGGLALLSFKKVVP"
FT   gene            complement(57179..58066)
FT                   /gene="nosF"
FT                   /locus_tag="RCAP_rcp00073"
FT   CDS_pept        complement(57179..58066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosF"
FT                   /locus_tag="RCAP_rcp00073"
FT                   /product="copper ABC transporter, ATP-binding protein NosF"
FT                   /EC_number="3.6.3.4"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00073"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87329"
FT                   /db_xref="GOA:D5AVJ4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ4"
FT                   /protein_id="ADE87329.1"
FT                   /translation="MLKLTSLTKHYQEVAALSAVSFQVAPGERVALLGHNGAGKSTLMK
FT                   IVLGLIPFDGGQVSVLGAAPGSAQARAGVAYLPENVAFHPALTGEEQIRLFLSLRGEDP
FT                   GQARSLLDRVGLHGAARRRIGTYSKGMRQRVGLAQALVGRPKLLILDEPTSGLDPVSRR
FT                   DFYALLDELAAEGAAILLSSHALTEVEARTDRIVILSGGHLVATGTLAGLRAAADLPVT
FT                   LQITPAFGQVETVALALPEAVLSGAQFHLNVAQGQKLAWLGRIAALGAAVTDLDLIPPS
FT                   LEDIYSHFSRRDGQ"
FT   gene            complement(58041..59360)
FT                   /gene="nosD"
FT                   /locus_tag="RCAP_rcp00074"
FT   CDS_pept        complement(58041..59360)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosD"
FT                   /locus_tag="RCAP_rcp00074"
FT                   /product="nitrous oxide maturation protein NosD"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00074"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87330"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR006633"
FT                   /db_xref="InterPro:IPR007742"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="InterPro:IPR026464"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ5"
FT                   /protein_id="ADE87330.1"
FT                   /translation="MRLPCLSLLLILLACPLQAETVMVFPGKAALQGAIATARPGDVLK
FT                   LAAGSYGPAVIDKSLTLDGQGGAVIDGNGRGTVLTVTADDVTLRGLTVQNSGRRNEEID
FT                   AGIKVVKGVARTLIEGNLLRDNLHGIDFHGAIDGTARRNTILGRQDAHMIARGNGFYVW
FT                   NAPGVLIEDNEVRWGRDGIFSNASKKDIYRRNTFRDLRFAIHYMYTNDSVVEDNISIGN
FT                   HLGFAMMYSRRVQVTGNISLMDRDHGVMLNSTNDADVIGNLVIGAAKCTFLYDANKNLI
FT                   AENRFQGCDIGIHYTAGSARNAVTGNAFVGNRNQVKYVGTRDLEWSLDGRGNFWSDLAA
FT                   FDLNGDGFADQAFRPNDLMDHILWSQPAAGLLIGAPAVQLIRWSQQSFPATLPGGIVDS
FT                   HPLMAPLEIPLAPELAAAAAELGDRWTKDTEEDAETDLAH"
FT   gene            complement(59364..61310)
FT                   /gene="nosZ"
FT                   /locus_tag="RCAP_rcp00075"
FT   CDS_pept        complement(59364..61310)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosZ"
FT                   /locus_tag="RCAP_rcp00075"
FT                   /product="nitrous-oxide reductase"
FT                   /EC_number="1.7.2.4"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00075"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87331"
FT                   /db_xref="GOA:D5AVJ6"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011045"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR023644"
FT                   /db_xref="InterPro:IPR034205"
FT                   /db_xref="InterPro:IPR041114"
FT                   /db_xref="InterPro:IPR041142"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ6"
FT                   /protein_id="ADE87331.1"
FT                   /translation="MTEETRSGISRRMLLGATAGGAALAGGLAGRLALGTGIGAATLAT
FT                   AAQAEGATGGFEVAPGQLDEYYGFWSSGQSGEMRILGVPSMRELMRVPVFNRCSATGWG
FT                   QTNESLRVHQRAMTEHTKKFLAANGKKIHDQGDLHHVHMSFTEGKYDGRFLFMNDKSNT
FT                   RVARVRCDVMKCDAILEIPNAHAIHGLRPQKWPRSNYVFCNGEDETPLANDGATMDDVG
FT                   TYVNIFTAVDADKWDVAWQVIVSGNLDNCDADYEGKWAFSTSYNSEMGMNTAQMTASDM
FT                   DHVVVFNIAEIEKGIKAGDYQTLNGVKVIDGRKGSNKNYTRYIPVANNPHGCNMAPDKV
FT                   HLCIGGKLSPTVTVIDVTKLDTLFASDVDPRSVVVAEPELGLGPLHNAFDGKGNVYTSL
FT                   FLDSQVVKWNIDLAKRLYAGEKVDPILDKCDVQYQPGHLKTSMGETLEADGKWLVCLCK
FT                   FSKDRFLNVGPLKPENDQLIDISGDKMKVVHDGPNFAEPHDAIAVHASKMTGIKSIWDR
FT                   NDPFWAETRKQAEADGVDLDDEQAFVIRDKADPTKVRVYMSAVAPNYAMESFEVNEGDE
FT                   VTMVITNLDDIDDLTHGFTMGGHGVAMEIGPQATSSVTFVAANPGVYWYYCQWFCHALH
FT                   MEMRGRMFVRPKA"
FT   gene            complement(61329..63497)
FT                   /gene="nosR"
FT                   /locus_tag="RCAP_rcp00076"
FT   CDS_pept        complement(61329..63497)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nosR"
FT                   /locus_tag="RCAP_rcp00076"
FT                   /product="nitrous-oxide reductase expression regulator
FT                   NosR"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00076"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87332"
FT                   /db_xref="GOA:D5AVJ7"
FT                   /db_xref="InterPro:IPR007329"
FT                   /db_xref="InterPro:IPR011399"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ7"
FT                   /protein_id="ADE87332.1"
FT                   /translation="MRRPTFFLSLCCGLVFGLLAVLSGPARAAETVLEKYLPQIAAADL
FT                   VPGADGFGPLREDLAVAPVLQGQTQLGWVYVTSDFVGTTGYSGKPIHVMMALDPAGKVI
FT                   GAQLVKHSEPIVLVGIPEAKVKALVGSYIGVDLPKAAADKATAHDLQIISGATVTVMVI
FT                   DDSMLRSGIKVARALGLGGMSAEVASGPKAEINPEAPAPEGWLSMLGDGTVRRLSLDVG
FT                   QVNEAFAALPDPRAAARALREPPQTSFIDLNLALVSVPGIGKAVLGPAEAANLQAWLKP
FT                   GEAAVAVAANGLYSFKGSGYVRGGIFDRIVLVQDDVTVRFHDRDHRRLVSLEAKGAPGF
FT                   TETDLFRIPADLGFDPAKPFRLQLLVQRPVAATDKVFTTFDLGYQLPAGYLKPVAVAAP
FT                   APVEETAAQADLWRSIWAGKRLEIAVTGAMLTVLTLVFFFQNAMTRNARAFFWFRMSFL
FT                   TVTLVFLGFYANAQLSVVNLMALFGALTTSFSWQAFLLDPLTFILWFAVAAALLFWGRG
FT                   AYCGWLCPFGALQEITNRIARALHIPQWTLPWGLNERLWPIKYMIFLGLFGVSLGSIEQ
FT                   AEHLAEIEPFKTAIILKFVRAWPFVAYAAALLLAGLFVERFYCRYLCPLGAALAIPARL
FT                   RMFDWLKRYHDCGNPCQVCAHDCPVQAIHPTGEINPNECVTCLHCQVLYQSHARCPVVI
FT                   RQDKRRAAVAPTSASVPRDLRNHPHTPH"
FT   gene            complement(63497..63916)
FT                   /locus_tag="RCAP_rcp00077"
FT   CDS_pept        complement(63497..63916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00077"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00077"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87333"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ8"
FT                   /protein_id="ADE87333.1"
FT                   /translation="MTFTAPLARRLTPLAALALRLSLCLALVLAGAWGAAACAAQAGLQ
FT                   PMEICSDAGARDVIWLDAEGHAAPAPGAADCAACPDCLAAAAGALVPPPARLTKVADTR
FT                   FDPLWMTARAEMPARPDPVPAARGPPCAAPVRMIS"
FT   gene            64043..64543
FT                   /locus_tag="RCAP_rcp00078"
FT   CDS_pept        64043..64543
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00078"
FT                   /product="transcriptional regulator, BadM/Rrf2 family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00078"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87334"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVJ9"
FT                   /protein_id="ADE87334.1"
FT                   /translation="MRLTTFTDYALRLLIYTAGKPESRVTIDEVAEWFAISRAHVKKVV
FT                   LTLSRGGFLLSSKGRNGGFTLARPPGEINLSEVILATEPDFGLFECYLTGNECRISRPC
FT                   RLPNVANEALAAFLAVLGKYTLADAMLRPAYFLLPAAGPQPLRGPKRPATQDGPGLSPG
FT                   KVS"
FT   gene            64758..65078
FT                   /locus_tag="RCAP_rcp00079"
FT   CDS_pept        64758..65078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00079"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00079"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87335"
FT                   /db_xref="GOA:D5AVK0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK0"
FT                   /protein_id="ADE87335.1"
FT                   /translation="MVTDDTLAELAKSLAHPARLRILRVLLATPGCIGGEIVEAVGLAQ
FT                   STVSEHLRILKAAGIITGEIDGPRICYALSPPALAPLGAFIASLTPPPEGACCLPAGKD
FT                   IP"
FT   gene            65075..66121
FT                   /gene="arsB"
FT                   /locus_tag="RCAP_rcp00080"
FT   CDS_pept        65075..66121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsB"
FT                   /locus_tag="RCAP_rcp00080"
FT                   /product="arsenite resistance protein ArsB"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00080"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87336"
FT                   /db_xref="GOA:D5AVK1"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004706"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK1"
FT                   /protein_id="ADE87336.1"
FT                   /translation="MSLFERYLTLWVALCIGAGIALGQMFPAIFRVIGATEIARVNLPV
FT                   AVLIWLMIIPMLLKIDFAALGQVTRHWRGVGVTLFINWAVKPFSMAALGWLFLSVLFRP
FT                   FLPADQIESYIAGLILLAAAPCTAMVFVWSNLSNGEPHFTLSQVALNDAIMVVAFAPIV
FT                   AFLLGLSAITVPWATLVLSVVLYILVPVAVAQWIRRRKLAEGGEALPRLLSRLGPVSIL
FT                   ALLTTLVLLFGFQGEQILAQPLVIALLAVPILIQVYFNAALAYWLNRVTGEAHCVAAPS
FT                   ALIGASNFFELAVAAAISLFGFTSGAALATVVGVLIEVPVMLSVVRIVARTKPWYESGP
FT                   AVRARAGH"
FT   gene            complement(66124..66513)
FT                   /locus_tag="RCAP_rcp00081"
FT   CDS_pept        complement(66124..66513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00081"
FT                   /product="rhodanese domain protein"
FT                   /EC_number="2.8.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00081"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87337"
FT                   /db_xref="GOA:D5AVK2"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK2"
FT                   /protein_id="ADE87337.1"
FT                   /translation="MTQVDLPEARDACPTTAQKRLAEGALLVDVREADEVAACGFAGCA
FT                   VMTIPLSQFEARFAEIPRDREVILACATGDRSLKATYFLMYQGYAKVTNMKHGLARWVA
FT                   RGFPVTGSATAVSAGGCGCGSGTCC"
FT   gene            complement(66515..66754)
FT                   /locus_tag="RCAP_rcp00082"
FT   CDS_pept        complement(66515..66754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00082"
FT                   /product="thioredoxin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00082"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87338"
FT                   /db_xref="InterPro:IPR005243"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK3"
FT                   /protein_id="ADE87338.1"
FT                   /translation="MEIKVLGTGCAKCKATADLIAQVAAEAGKPVEIVKIEEMRQIVGY
FT                   GVMTTPAVVVGEKVVHKGAVPSRDQVLVWLQEEA"
FT   gene            complement(66766..67821)
FT                   /locus_tag="RCAP_rcp00083"
FT   CDS_pept        complement(66766..67821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00083"
FT                   /product="protein of unknown function DUF318,
FT                   transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00083"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87339"
FT                   /db_xref="GOA:D5AVK4"
FT                   /db_xref="InterPro:IPR005524"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK4"
FT                   /protein_id="ADE87339.1"
FT                   /translation="MSDQTLSTRPAPAWAWHLGLALALIFWALVYRQLSPAAEALTALL
FT                   PIDRHSRTGEAIAFFLYDLPKVLMLLSLIVFLMGLLRSWFSPERTRALLAGRREGVGNV
FT                   MAAALGVVTPFCSCSAVPLFIGLVSAGVPLGVTFSFLISAPMVNEVALVLLFGLVGWQV
FT                   AAVYFFFGLAVAIVSGWVIGRLHLESWLQDWVRDIHSGASAPAAFEGDRLTMVDRYRLG
FT                   LAALREIVGRVWIWILAGIGMGALIHGYVPEDLMARIMGAEAWWSVPAAVAIGIPMYTN
FT                   AAGVIPIIEALLGKGAALGTALAFMMSVIALSLPEMIILKQVLSLRLIGVFVGVVGSGI
FT                   LAVGYLFNFLF"
FT   gene            complement(67818..68108)
FT                   /locus_tag="RCAP_rcp00084"
FT   CDS_pept        complement(67818..68108)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00084"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00084"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87340"
FT                   /db_xref="GOA:D5AVK5"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK5"
FT                   /protein_id="ADE87340.1"
FT                   /translation="MILSVLTALAEPTRLAAMIRLADGREHCVCELMAALDATQSRMSR
FT                   HMQALKQAGLVVDRRDAQWVRYRLNPEMPPEIRAVLTAVLAAAATAERSAA"
FT   gene            complement(68181..69425)
FT                   /locus_tag="RCAP_rcp00085"
FT   CDS_pept        complement(68181..69425)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00085"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00085"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87341"
FT                   /db_xref="GOA:D5AVK6"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK6"
FT                   /protein_id="ADE87341.1"
FT                   /translation="MSANPIRAYAAVTAAYWAFMLTDGALRMLVLLQFNGLGFSPVALA
FT                   WLFLLYEVAGIATNLGAGWLAARFGLAATLYGGLGLQVAALVALTQLDPGWSIPASVAF
FT                   VMAVQGVSGVAKDLAKMSSKSAVKLLAPSGEGGLFRWVAALTGSKNAVKGLGFFLGAAL
FT                   LALVGFKPAIWGMAGLLAAILIAVVAFLPKGLPGKMKSDEAWGGWRSQDPQVNRLSLAR
FT                   MFLFGARDVWFVVGLPVYFQAVLSDGTAEGRREAFFLTGGFMALWIIAYGAVQAFAPRI
FT                   LGAKSQPEAAIVTKAITWAGYLVPIPFGLAAAVLIAPAPAPWLTATLLIGLLAFGFVFA
FT                   VNSSVHSYLILAFGDARRITRDVGFYYMANAAGRLIGTLLSGLSCQFGGLALCLATAGA
FT                   MAATSWWAARRLAQD"
FT   gene            complement(69422..70429)
FT                   /gene="gap4"
FT                   /locus_tag="RCAP_rcp00086"
FT   CDS_pept        complement(69422..70429)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gap4"
FT                   /locus_tag="RCAP_rcp00086"
FT                   /product="glyceraldehyde-3-phosphate dehydrogenase-4
FT                   (phosphorylating)"
FT                   /EC_number="1.2.1.12"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00086"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87342"
FT                   /db_xref="GOA:D5AV33"
FT                   /db_xref="InterPro:IPR006424"
FT                   /db_xref="InterPro:IPR020828"
FT                   /db_xref="InterPro:IPR020829"
FT                   /db_xref="InterPro:IPR020830"
FT                   /db_xref="InterPro:IPR020831"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5AV33"
FT                   /protein_id="ADE87342.1"
FT                   /translation="MARLAINGLGRMGKLLLRRLIDLGRGPEIVLLNDAMGDAETHALL
FT                   LEFDTVHGRWPTPVAATETGLQIAGQRIRLTREKTLEALPLAEIGVDLVLDCTGQFKTA
FT                   AKVQPYFDAGVRKVVVSAPVKDTGALNLVYGVNHVLYDGSQRLITAASCTTNCLAPIVK
FT                   VIHEALGIKHGSITTLHDVTNTQTIVDRPAKDLRRARSALMNLIPTTTGSATAITLIYP
FT                   ELKGRLNGHAVRVPLLNASLTDCVFELDRPTTVAEVNSLLQTAAEGGLNGILGFETRPL
FT                   VSSDFTNDPRSAVIDGPSTMVVNGTQLKLYAWYDNEWGYVCRMADIARMVAGSL"
FT   gene            complement(70433..71278)
FT                   /locus_tag="RCAP_rcp00087"
FT   CDS_pept        complement(70433..71278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00087"
FT                   /product="transcriptional regulator, ArsR family/protein
FT                   tyrosine phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00087"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87343"
FT                   /db_xref="GOA:D5AV32"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AV32"
FT                   /protein_id="ADE87343.1"
FT                   /translation="MENTCPTPEAAAAFACLGHPGRLSVFRMLMRFAPQGVRPTEIAAA
FT                   LGLKPNTLSHHLADLTACGLVTVTRQGRSLFYAVDLHKTESLIGYLALDLGRARPDLMP
FT                   KALHEKANPMPDTPFNVLFICSGNSARSIFAEALLRDLGAGKFTAHSAGTRPGTAINPF
FT                   ALEVLSRNGHDTGGLRAKHLSEFQGPAAPQMEFVFTVCDTAAAEDCPPWPGQPITGHWG
FT                   LPDPVKATGTEAERALVFAQTYGALRRRIAAFVDLPFATLDRLALQTRVDAIGALPEKA
FT                   "
FT   gene            complement(71345..72034)
FT                   /locus_tag="RCAP_rcp00088"
FT   CDS_pept        complement(71345..72034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00088"
FT                   /product="molybdate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00088"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87344"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVK9"
FT                   /protein_id="ADE87344.1"
FT                   /translation="MICGQDLILDVLSNLLRQRGVMALRAYIGSYDSLVSLYHDRVGVA
FT                   TAHLWDGASDSYNIAHVRALLPGIACTIVNVTWRMQGLYVAEGNPKRITGWADFGRDDI
FT                   RMINREKGAGSRVLLDEHLRRLGISGSRIAGYGQESASHLALASAVGRGEADIAVGTEK
FT                   IARQVDGVAFLPMQRERYDLVVKTEHLPRPEVQALLSVLRSQAFKAEFGAIGGYDLRDI
FT                   GRVICET"
FT   gene            complement(72086..72307)
FT                   /locus_tag="RCAP_rcp00089"
FT   CDS_pept        complement(72086..72307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00089"
FT                   /product="DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00089"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87345"
FT                   /db_xref="GOA:D5AVL0"
FT                   /db_xref="InterPro:IPR010093"
FT                   /db_xref="InterPro:IPR041657"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL0"
FT                   /protein_id="ADE87345.1"
FT                   /translation="MSDAASDAPTDAMTAEEVALRLKISKSGVYALIKAGAIGHYKVGR
FT                   KIRFSAAQLRAYVEGTACPAARPGPVVL"
FT   gene            72579..73166
FT                   /locus_tag="RCAP_rcp00090"
FT   CDS_pept        72579..73166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00090"
FT                   /product="membrane protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00090"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87346"
FT                   /db_xref="GOA:D5AVL1"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL1"
FT                   /protein_id="ADE87346.1"
FT                   /translation="MAVPMADLAAQWPVIVNLLAGSLAGAWFGAGWATRLRSDILFKVI
FT                   AALMAGIAVVLLTGHGVASGAALVTGGAQIGLGVVAGFAIGIVAALMGVAGGELLIPTL
FT                   VILFGADIKLAGSLSLAVSLPTMLVGFARYSRDQAFATLGRNRIFVAVMAAGSIAGSFL
FT                   GGHLLGLVPEAVLLPGLALILVISAFKVWRHK"
FT   gene            73604..75388
FT                   /locus_tag="RCAP_rcp00091"
FT   CDS_pept        73604..75388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00091"
FT                   /product="nuclease, OLD family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00091"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87347"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL2"
FT                   /protein_id="ADE87347.1"
FT                   /translation="MRISRVRIANFANFSDLDVETGESIVIVGENKVGKSNFIRALQLI
FT                   LDPGLSERDRQLGLEHFWDGLGEDKLGEAIEISIDLTDFTNDPRLMAHLNDCVVDPGPP
FT                   MVARLTYRFQPKANLGRDPESLADYEYVIFGGDDPDMAIGSSLRRMLPLDVQVALRDAE
FT                   KDLSIWRNSPLRPLIEQLATSLDEDARDEIQEQVNEAQAELAGHAEVVATAQRISDRLI
FT                   AIAGEQHAVPLTLGLAPTRVDALLRSLRLLIDNGARSIGDASLGTANLIFLALKSLELD
FT                   RLVTDGERDHTFFVVEEPEAHLHPHVQRLVYRYFLGGAADDQEDAPPLTTILTTHSPHI
FT                   ASVTPIRSIVLLRYDAGEDATTAVSTATAPLTERDEADLQRYIDVSRGEIFFARGVILV
FT                   EGDAERFLIPAFAEALDIPLDMLGITVCSVSGTNFTPYVKLLGPQGLNIPHVILTDRDP
FT                   NGTRPPLVRRRLIEVLNLVENGVDYTPLDADAVIARAEPLGYFVNGNTLEPELFCGGLA
FT                   DAMQEIIEEELPINQATRDLLQGWVDDTDTLDEERLIKLIERIGKGRFAQALAPYVEED
FT                   TCPDYIRKALEYIRDALA"
FT   gene            75375..77192
FT                   /gene="pcrA"
FT                   /locus_tag="RCAP_rcp00092"
FT   CDS_pept        75375..77192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pcrA"
FT                   /locus_tag="RCAP_rcp00092"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00092"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87348"
FT                   /db_xref="GOA:D5AVL3"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL3"
FT                   /protein_id="ADE87348.1"
FT                   /translation="MPLRSVSAAYLAQAADLASNPGQQAAYDSTGHCVVLAGPGSGKTK
FT                   TLVLKLARIMAEDVRAPRGAACITYSQECARELTRRLERLGLREAPNLFIGTVHGFCLR
FT                   HLLMPYGRLANLPVPFPLAVATQRQSDQAMNRVGDRLFGVGHPNKPMDLGRHRRSILDR
FT                   TSEAWTDEEELAAWAEGYEAELRRTGLVDFDDLVIFGQRLVSEHDWVLPLLQAKFPVLA
FT                   VDEYQDLGVALHRIVKRVAFDGGVRLFAVGDPDQSIYGFTGADGALLEELAERDDVERV
FT                   QLQLNYRSATRIVSASEMALGEDRGYRSNDPDRQAVIAFLECDDGLVGQAAHAVAEIIP
FT                   AALAAKPGRALGDIAILYRDYRAGDVVAEAVASAGLDFVRVDTAAPYRKVALTSWIEDC
FT                   AAWCSGGWRKAQPQLRGLLDRWIGFHRARISDAQASAELQSLTRLLWSLRVEEGLARNF
FT                   VAALRAGMLDALMVDEPSLADQREQVERMSAAVAVGGPLADLDLASLAGRDGSPLHLNL
FT                   LTLHSAKGCEYDVVIMVGLDLGSLPWRNEAPAAQRESRRLFYVGLTRARDEIHMLYSGF
FT                   VDTRFGRKYWGRSPFLNELEARMREAEGD"
FT   gene            complement(77675..78499)
FT                   /locus_tag="RCAP_rcp00093"
FT   CDS_pept        complement(77675..78499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00093"
FT                   /product="oxidoreductase, short-chain
FT                   dehydrogenase/reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00093"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87349"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL4"
FT                   /protein_id="ADE87349.1"
FT                   /translation="MEVTVVFGAGGIGQAIARRISIGRLIVVANRTQASADAAAEGLAR
FT                   AGFEVTAMQADISDRAAVQAVAARAGTLGAIKAVVQAAGVSPSQAPIAAILKVDLYGTA
FT                   VVLEEFGRVIAPGGSGLVISSQSGYRMPALSAEQDALLATAPADDLLALDFVKGVTDTL
FT                   HAYQMSKRCNSLRVRGEAVNWAKRDARINAISPGIIVTPLAQDELHGERAEFYQAMLKQ
FT                   MPAGRAGTPDEVASLAAHIMGPEGGFITGSDFLIDGGATANFFHGPQTASLA"
FT   gene            complement(78501..79523)
FT                   /gene="adh"
FT                   /locus_tag="RCAP_rcp00094"
FT   CDS_pept        complement(78501..79523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="adh"
FT                   /locus_tag="RCAP_rcp00094"
FT                   /product="alcohol dehydrogenase (NADP(+))"
FT                   /EC_number="1.1.1.2"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00094"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87350"
FT                   /db_xref="GOA:D5AVL5"
FT                   /db_xref="InterPro:IPR002328"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL5"
FT                   /protein_id="ADE87350.1"
FT                   /translation="MYATVLHGPGDVRYERVEDPKILKPTDAIIKLSATCICGSDLWPY
FT                   RGANPITAPMHMGHEYCGVVVEVGAEVRTVKPGQFVVGSFCLSDNTCPHCQFGFQSSCA
FT                   QREFMSGAQAPYARVPLADGTLVATKEMPDAAMIPHLLAVSDVLGTGWYGAWAADVREG
FT                   GTVVVVGDGAVGLMGVMAAHQMGAERIIAMSGHESRSALAREFGATDIVSERGAEGIAR
FT                   VMELTKGIGAASVIEAVGTVGSMAQATGVCRPGGSIGYVGVPHGVSFDGQQMFFKQQRM
FT                   LGGPAPVRRFLPDLMERVLQGRIQPGKVFDLVLPIAQVAEGYKAMDERRAIKTMLQVED
FT                   "
FT   gene            complement(79536..79931)
FT                   /locus_tag="RCAP_rcp00095"
FT   CDS_pept        complement(79536..79931)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00095"
FT                   /product="cupin domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00095"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87351"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL6"
FT                   /protein_id="ADE87351.1"
FT                   /translation="MEIHRAGSRASFVGPSAWFTGTVRVDPLFNPAAPERVQGAHVTFE
FT                   PGARTAWHTHPLGQTLIVTFGRGRVQREGGPIEEIHPGDVVCFAPEERHWHGAAPDTAM
FT                   SHIALQEVKDGQVVTWMEHVTDADYGA"
FT   gene            80047..80940
FT                   /locus_tag="RCAP_rcp00096"
FT   CDS_pept        80047..80940
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00096"
FT                   /product="transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00096"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87352"
FT                   /db_xref="GOA:D5AVL7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL7"
FT                   /protein_id="ADE87352.1"
FT                   /translation="MRRDEMGDLIAFLAVAEERSFTRAAARLGTSQSAVSAVVRRLEER
FT                   LDVRLLTRTTRSVSVTEAGQRLVDALRPAFDGIEAELAALDDIRARPQGMIRLTASRHA
FT                   AERIVMPVANRLMADYPEVRVEILLDQRFVDIAKEGFDAGIRLGESVDRDMIGVRISGD
FT                   LQMVVAGSPAYFARHPAPQTPQDLTAHNCINLRLPTLGGLYAWEFEKDGRPLTVRVEGQ
FT                   FTTNDPELAVAAALEDRGLVCLMTDYLAPHLASGRLVRVLADWCPPFSGYHLYYPSRRQ
FT                   ITPAFRLLIDALRWRG"
FT   gene            complement(80891..81451)
FT                   /locus_tag="RCAP_rcp00097"
FT   CDS_pept        complement(80891..81451)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00097"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00097"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87353"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL8"
FT                   /protein_id="ADE87353.1"
FT                   /translation="MKTRKLGPLEVSEIGFGTMSFAATYGAAPGEAEAISVIRGAYDLG
FT                   VTHFDTAEVYGPWTNEVLLGKALAPIRDKVTIATKFGWNIDQVTGARDWGLNSRPERIR
FT                   QVAEASLKRLGVEVIDLFYQHRVDPDVPMEDVAGAVRDLIAAGKAQGCPRRSLPCPTAD
FT                   ARARGGGATPASAKRRSKAGTPG"
FT   gene            complement(81664..82059)
FT                   /locus_tag="RCAP_rcp00098"
FT   CDS_pept        complement(81664..82059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00098"
FT                   /product="NAD-dependent epimerase/dehydratase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00098"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87354"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVL9"
FT                   /protein_id="ADE87354.1"
FT                   /translation="MKILILGAAGQIARVATQELLARTDATLTLYARNAARRLGPETDR
FT                   TRILTGDVLDTATLASAMTGQDLVYANLWGAMEAQAKAIVAAMQAAGVGRVIFISSMGI
FT                   YDEVPGERPARSSIPIVPRRASSKPRV"
FT   gene            complement(82072..82470)
FT                   /locus_tag="RCAP_rcp00099"
FT   CDS_pept        complement(82072..82470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00099"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00099"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87355"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM0"
FT                   /protein_id="ADE87355.1"
FT                   /translation="MDTFSNLADARQVQEQTFLFTEDGVVETWFGETALPPLRGRKAIE
FT                   DSWTPFLATFDTVYHVNGQFTAEIDGDTATATHDCTVELIGEPEGAKTRNSNGVIYSDS
FT                   YLRVNGEWLIAKRVARFIWRDVHPFIAA"
FT   gene            82492..82926
FT                   /locus_tag="RCAP_rcp00100"
FT   CDS_pept        82492..82926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00100"
FT                   /product="oxidoreductase, aldo/keto reductase family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00100"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87356"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM1"
FT                   /protein_id="ADE87356.1"
FT                   /translation="MTKDTALAESDFRKTLPRFTPEAMEKNQALVDLLRQIAAEKEATP
FT                   AQIALAWLLAQAPRIVPIPGTSKAYRLEENLGAAEIVLASEDLARIKAATANIHIEGER
FT                   HTEAGLKTVGLSYGDLKMSVHVDPRCARTFRFRARWRHSS"
FT   gene            complement(82968..83084)
FT                   /locus_tag="RCAP_rcp00101"
FT   CDS_pept        complement(82968..83084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00101"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00101"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87357"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM2"
FT                   /protein_id="ADE87357.1"
FT                   /translation="MGLIQSDAKFMDEREDIAAPINTLKAGEGLRPHDRVAS"
FT   gene            83848..84849
FT                   /gene="proX2"
FT                   /locus_tag="RCAP_rcp00102"
FT   CDS_pept        83848..84849
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proX2"
FT                   /locus_tag="RCAP_rcp00102"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   substrate-binding protein ProX-2"
FT                   /EC_number="3.6.3.32"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00102"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87358"
FT                   /db_xref="GOA:D5AVM3"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM3"
FT                   /protein_id="ADE87358.1"
FT                   /translation="MKKPFASVWLTASFAALAAPVMAAEDCGRVSIAEMNWASAGVAAH
FT                   VDKIILESGYGCEVELVTGDTMPSFTSMNEKGEPDMAPELWVNAVKVALDTAVAEGRLI
FT                   LAAPLLAEGGEEGWWVPKYIVDAHPEITTVSAALARPDLFPAPEDPGRGAVHNCPSGWN
FT                   CQITTENLYRALEAETKGFDLVDTGSAAGLDGSIANAHERKLGWLGYYWAPTAILGKYE
FT                   MVKLDFGVPLDKAHFDACTSQPDCPDPKVTAYPVSEVVTVVTRAFAEKAGVAMDYVQTR
FT                   KWSNATVNQVLAWMEANQGTNEDGARHFLETCPELWRDWVPADVAQKVKAAL"
FT   gene            84920..85831
FT                   /gene="proW2"
FT                   /locus_tag="RCAP_rcp00103"
FT   CDS_pept        84920..85831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proW2"
FT                   /locus_tag="RCAP_rcp00103"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   permease protein ProW-2"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00103"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87359"
FT                   /db_xref="GOA:D5AVM4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM4"
FT                   /protein_id="ADE87359.1"
FT                   /translation="MASDCWSLPETLCRFPAMEAKTLRLMRKSIDDGFRDIVRSWADTI
FT                   DAATVPLQMFLNTLEHAFTDTPWVLVLVVLLAAVWGTARNWKIVLGTAVALCLIGWVGL
FT                   WQDTMVTLAMVSFCTLVAVVIGLPIGIAAARSDRLQRLVSPVLDVMQTLPSFVYLIPVV
FT                   VIFGIGKVPGMIAVVIYAVPPMIRLTTLGIRLVDREVTEAAEAFGSSARQKLWNVQLPL
FT                   ALPTIMTGVNQTIMMSLSMVVVASMVGVGGLGKNVLQAINNQFFTVGFLNGFALVAIAI
FT                   VFDRSSQAFGLRLQKHREAGHD"
FT   gene            85824..86933
FT                   /gene="proV2"
FT                   /locus_tag="RCAP_rcp00104"
FT   CDS_pept        85824..86933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="proV2"
FT                   /locus_tag="RCAP_rcp00104"
FT                   /product="glycine betaine/L-proline ABC transporter,
FT                   ATP-binding protein ProV-2"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00104"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87360"
FT                   /db_xref="GOA:D5AVM5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM5"
FT                   /protein_id="ADE87360.1"
FT                   /translation="MTEAPPILPGDDDEDPVTGRSGIEIRNLYKIFGPEPERHIAAVKA
FT                   GLSKAELNRKHGHVLGLTDISLSIPPGKITVIMGLSGSGKSTLIRHINGLIAPTTGEVI
FT                   HDGADVCRMSPKDLRAFRRHKTAMVFQKFALLPHRTVLGNTCYGLDIQGVPRSESEPVA
FT                   RRWIARVGLKGYEGAYPAQLSGGMQQRVGLARALSTDADILLMDEAFSALDPLIRLDMQ
FT                   AILLELQSELRKTIVFITHDLDEALRLGERIAILRDGRLEQVGTGQDIVLRPANDYIAA
FT                   FVREVNRARVIRAATVARPVVAGAKLPEFAVPGPEVLETVARQMTAAGVSHARVLGRRG
FT                   QVRGTIAISDVLTAMVTPAAAPEHDLTKG"
FT   gene            86937..87338
FT                   /locus_tag="RCAP_rcp00105"
FT   CDS_pept        86937..87338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00105"
FT                   /product="transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00105"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87361"
FT                   /db_xref="GOA:D5AVM6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM6"
FT                   /protein_id="ADE87361.1"
FT                   /translation="MDAENPENWFSEAVATLGDRLTAARENAGLSCAEAASCLGISVET
FT                   YTSWEQDSAFPRASLCHMIAGLFGVSLAWLLTGESLGVEPPQNDLPAQGPCLPSTDADL
FT                   RCMREDMAETRLRVQQIDERLQRILLHLE"
FT   gene            87408..87554
FT                   /pseudo
FT                   /locus_tag="RCAP_rcp00106"
FT                   /note="transposase, ISSpo9; fragment"
FT   gene            complement(87616..88314)
FT                   /locus_tag="RCAP_rcp00107"
FT   CDS_pept        complement(87616..88314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00107"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00107"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87362"
FT                   /db_xref="GOA:D5AVM7"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM7"
FT                   /protein_id="ADE87362.1"
FT                   /translation="MKPDADRIARKSLLLRAVPKPAQDLILTGAHERSLDRGATIFLQG
FT                   DPATAVYMVIDGWVKLYRVAPNGSEAVVSVFTRGDSFGEAVAFTGGVYPVSAEAATDVV
FT                   LVRIETAEILRLIERQPGLAVSLLAATFAHLHRLVGQIEQLKARSGAQRVAEFLLEHVS
FT                   EERGPCAVVLPYDKVLIAGRLGMKPESLSRAFARLREKGVQVRQSVAEIEDVALLRDYV
FT                   EEDPGQSWAR"
FT   gene            complement(88398..90098)
FT                   /locus_tag="RCAP_rcp00108"
FT   CDS_pept        complement(88398..90098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00108"
FT                   /product="ABC transporter, ATP-binding/permease protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00108"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87363"
FT                   /db_xref="GOA:D5AVM8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM8"
FT                   /protein_id="ADE87363.1"
FT                   /translation="MLRKFIAHYRPHRRLFWLDFGSAVASGLLELAFPLAITFFIDRLL
FT                   PLGDWSLTIAAAAALLAVYALNTVLMGIVIYWGHMLGIEIETEMRRQAFAHLTRLSWRW
FT                   YDRARTGKLVARVTRDLEDIGELAHHGPEDLFIAIMTFVGAFALMAALHPVLALITAAI
FT                   VPLTVWLVAVYGGRMTRTWQEIYGRVGQFNVRLEEAVGGIRLVQAFANERHEERLFDRD
FT                   NRAYRATKLQAYRLMAVSSAIHYMGLRFVQVVVMVAGAGFVLAGSLSTGGFVGFLLLVG
FT                   VFFRPLEKIAAVIETYPKGIAGFRRYLELLETETEIADAPDARPVTALRGAITFDRVRF
FT                   GYDAARPVLQDVSLSIAAGETVAFVGPSGAGKTTLLALLPRFYDPDSGTIRIDGLPLHA
FT                   MTLESLRNQIGIVSQDVFLFGTSLRENIAYGRLDATEAEIRAAAEKAQLSALIAALPEG
FT                   LETLVGERGVMLSGGQKQRVAIARAFLRNPPILILDEATSALDSETEREIQAALEALSR
FT                   GRTTLVIAHRLGTIRAADRIVVMEDGRVQEIGSHAALLARGGLYARLAG"
FT   gene            complement(90113..90880)
FT                   /gene="fhuC2"
FT                   /locus_tag="RCAP_rcp00109"
FT   CDS_pept        complement(90113..90880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuC2"
FT                   /locus_tag="RCAP_rcp00109"
FT                   /product="ferrichrome ABC transporter, ATP-binding protein
FT                   FhuC-2"
FT                   /EC_number="3.6.3.34"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00109"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87364"
FT                   /db_xref="GOA:D5AVM9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVM9"
FT                   /protein_id="ADE87364.1"
FT                   /translation="MTLFTLRDLCFDVPGRRLIDGLDLTLHPGCVTALIGRNGSGKSTL
FT                   LKLISGQVRPTAGQITHLGRPLSQWPRRDLARALACLPQVTPPAEGMRLAELVALGRYP
FT                   WRGALGRFRPEDHAAVAGAIRRCGLTGLEERLVDTLSGGERQRGWIAMMLAQGARTLLL
FT                   DEPISALDVAHQVEVLGLVQAMCRDSGLSAVIVLHDVNMAARFCDRVVALEGGRLVLNG
FT                   PLGDLLTPEALARVYGLPMTVTTLGGHPVALPA"
FT   gene            complement(90877..92847)
FT                   /gene="fhuB3"
FT                   /locus_tag="RCAP_rcp00110"
FT   CDS_pept        complement(90877..92847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuB3"
FT                   /locus_tag="RCAP_rcp00110"
FT                   /product="ferrichrome ABC transporter, permease protein
FT                   FhuB-3"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00110"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87365"
FT                   /db_xref="GOA:D5AVN0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN0"
FT                   /protein_id="ADE87365.1"
FT                   /translation="MRRLALPVAALLSVGLWLLAARMALPVADWPALPWQIGQMALPQI
FT                   LLTQGLMPRAVVALLAGAALGLSGALMQAVLRNPLADPTVLGTAAGAQLAIVAATVLAP
FT                   QLLAGGNLPVALAGAGAATALGMALAAGRGFAPLATTLAGMLVGLTASALATALTLAQG
FT                   HYLLSLLIWNGGALTQDDWTPAAHLALALAVAILGAAALARPLLVLSLGAAGARGLGLA
FT                   AAPLRLITLALAVGLSALVSAELGLIGFVGLAAPAIARGLGARTLRHRLLLAPLAGAVL
FT                   LSLADSLLLAVAALGGPDLPTGALTGLIGGPLLLWLLPRMPTHVPPPLETGAAPPRRAR
FT                   HPARGLALLAGLLLAAAALTLVLGRGPAGWGVIAPGLCASFLPLRATALLAAASAGALL
FT                   AGAGAILQRLTANPMAAPEVLGVTGGAALGYAATLFLQTAPGPGALALGAGLGGAVTLA
FT                   GLSALAFGRDIAPARLLLAGLAIGAFASAVLAAIIATGDPRAWAILGWLAGSAAAVTPA
FT                   AALALAAAAAALLAALLLAARWLEILPLGPALCRALGLPLTPLRPGLILLAGLATGAAT
FT                   ILVGPVSFVGLMAPHLARSLGLVRPVPFVTASWLIGALLMLLAAFAARTLASPYDLPLG
FT                   LCATLIGGPWLFVLLLRKGRA"
FT   gene            complement(92844..93716)
FT                   /gene="fhuD2"
FT                   /locus_tag="RCAP_rcp00111"
FT   CDS_pept        complement(92844..93716)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuD2"
FT                   /locus_tag="RCAP_rcp00111"
FT                   /product="ferrichrome ABC transporter, periplasmic
FT                   ferrichrome-binding protein FhuD-2"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00111"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87366"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN1"
FT                   /protein_id="ADE87366.1"
FT                   /translation="MTRRAVLVAAASAVVAGRAGAGEGAAAVRPLRLAAIDWAMAETAA
FT                   ALGHPPQALAELAAFRRTAPMPLSADTIDLGLRGGPSLETLALAAPDLILSSSYYSFAE
FT                   ARLAGIAPVFSRPLFVPGVPPLPRLIAATQDLATRLGTPAAASAVLSRSRAEFAALARR
FT                   IPQTAAAPCLLVEIGDARHVRLFGTDSLFHGALTALGLTNAWDGESRFAFAAPVPLERL
FT                   ADFPTARIVLTGEIPVQTARGLARSELWNALPARRAGRVSALGAINGFGGLPSALRFAR
FT                   ALTKALEAA"
FT   gene            complement(93749..95860)
FT                   /gene="fhuA"
FT                   /locus_tag="RCAP_rcp00112"
FT   CDS_pept        complement(93749..95860)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fhuA"
FT                   /locus_tag="RCAP_rcp00112"
FT                   /product="TonB-dependent ferrichrome receptor"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00112"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87367"
FT                   /db_xref="GOA:D5AVN2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN2"
FT                   /protein_id="ADE87367.1"
FT                   /translation="MRKTLSSRLLLGASLAALAAGAALAEEDDSRETFLGTISVQGGAN
FT                   PTAPLAGSVAKTSASTKTGTPILETPAAVSVIPRAQIAAQGATSLAEAVGYTAGVVTEN
FT                   FGADPRFDSLYLRGFNLENDKLLDGLRLMRSTQYPTSAPSFELYGLERVEVLKGPASVL
FT                   YGAGTPAGVINMIQKRAQASGDTTELGFGFDSQGSWQVFGDANRVVNDRFAYRLTAKSS
FT                   DTNTAVKQIDNRRDYLALSASYLLTDTTELEIMASMHDDAPQSPTGVPAAMLGVVDWDR
FT                   LRSFDFGDPAINQSDRQMRTLSFGLTHDFGNGWKLNNTLRYTRHDWDYDSVYVSGGTAS
FT                   TATRGVIAQRESFESLGTDLRLSGEAATGGVSHKLTFGLDAMRLRESATTGFSSLAAID
FT                   ITAPAYGGSFGAPWYTAQKDIEVTQLGLYGVDEMSFGKFRATLGLRREWSDQDGQNVTN
FT                   YGSTDLTRKDAATTGQVSLGYVADNGLASYLSYATSYLPQPGADIDGRALDPTRGKQWE
FT                   LGVKYEPAAFEGLFSAALFDLRETDRNTTVTEGARTGLRQIGEARIRGLELEGVAELAQ
FT                   GWTLKAAYTRTDSKVLAGEQAGTALKNVPEHAASLWLSHDFAGKMQGLTLGGGLRHIGS
FT                   RYADDANTARLGAVTLLDLGASYTWQNGVTGRINVSNLTDKAYVAGVGSFASYPGDERT
FT                   VSASLGVTW"
FT   gene            complement(95947..96876)
FT                   /locus_tag="RCAP_rcp00113"
FT   CDS_pept        complement(95947..96876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00113"
FT                   /product="transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00113"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87368"
FT                   /db_xref="GOA:D5AVN3"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN3"
FT                   /protein_id="ADE87368.1"
FT                   /translation="MGQLRQTFTPRMQTRTQALRTLAPLAFRRLEGAIADVWSVRGETG
FT                   GGGFYLAPDPRIVVFLTETAMTLRAAEAGPELRGMQAFYMPPGVPLWSRLERGQDLAHI
FT                   DFHLQGAALAQRLGRAAVRPDLAQPQMIGDNPRLRALAQMAAEEVRVPRRGEMVLDGLL
FT                   SALLGEIFDRTEPGQGPGDKPVQGPGQGAAPPPGGGLTPRQRAAVEGHLRAHLSRQVTV
FT                   AELAEVAGLSESWFAHRFKQQFGETPQRWQSRLRLEAARAMMADPALSLAEIAHATGFA
FT                   DQAHLSRLFRAAHGLPPSVWRRGTNPGF"
FT   gene            97274..98476
FT                   /gene="repA"
FT                   /locus_tag="RCAP_rcp00114"
FT   CDS_pept        97274..98476
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repA"
FT                   /locus_tag="RCAP_rcp00114"
FT                   /product="plasmid partitioning protein RepA"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00114"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87369"
FT                   /db_xref="GOA:D5AVN4"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN4"
FT                   /protein_id="ADE87369.1"
FT                   /translation="MSISSKPAVSGSVAASIAANAVRLSEALDNHMRNSFQPESRKTLR
FT                   KFQPAEVSELTGISMSNLRTRHQDGDFPEVETDSRGRRLYSAAEIDQIRHIMAKTGRNG
FT                   DAYLPGRRGTDALQVISIVNFKGGSSKTTSAIHLAQRYALRGYRVLAIDMDPQASLTTM
FT                   FGYRPEIEFAEGGTIYDALKYEEPVPISQVIRKTYFHNLDLAPAGLMLSEYETETAYAL
FT                   QHKIDPPFTQRLAIALDEVEANYDLVIIDCPPQLGFTTMTALLASTGLLITVVPSMLDV
FT                   ASMAQFLEMAGETVRALEEAAGPIHWNFLKFLIARYEPTDVPQSQMAGFLRSILLDQVL
FT                   TTPMLKSTAISDAGMTQQTIYEIEPSQVLKKTLDRILESVNGVANEFETVIQNAWGRET
FT                   D"
FT   gene            98476..99453
FT                   /gene="repB"
FT                   /locus_tag="RCAP_rcp00115"
FT   CDS_pept        98476..99453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repB"
FT                   /locus_tag="RCAP_rcp00115"
FT                   /product="plasmid partitioning protein RepB"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00115"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87370"
FT                   /db_xref="GOA:D5AVN5"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN5"
FT                   /protein_id="ADE87370.1"
FT                   /translation="MARRNLFQPPAPPAEKPAEKPAPESKSRFPNTGAMSGVKSTLKDL
FT                   SSNAVREIPPELIEEGGPKDRLAFSDADVAQLAESIRLHGQQVPVMVRPIADRPGSYRI
FT                   VYGRRRLRALRLLGLPAKALVRALSDDEAILAQGQENAQRLDPSFIEKSLFAAELAASG
FT                   YETAVILDALAIDKPMLSRMQKVARSIPEAVARRIGPAHGIGRRRWEELADLVNAHGLD
FT                   LEALAETVLAPGADSSDGRFAQLATAAAAALRRAEPETAPAAPALPVVADDGIRLAQIS
FT                   ETARAVTVKLSKTEAPEFARWWREHAEAELRRLYTEWRSGPRAD"
FT   gene            99677..100780
FT                   /gene="repC"
FT                   /locus_tag="RCAP_rcp00116"
FT   CDS_pept        99677..100780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="repC"
FT                   /locus_tag="RCAP_rcp00116"
FT                   /product="plasmid replication protein RepC"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00116"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87371"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN6"
FT                   /protein_id="ADE87371.1"
FT                   /translation="MAFIQATAAFGLRARDLLSADNAPAARALPERHLLVETLRQAAPL
FT                   LGLKPTVLATLEAMLSCLAPKRNHHMVFASNLTLSSRRNGVSDRTLRRHAAVLQEAGLL
FT                   QRKDSANGKRFTRYDPDARQALHFGFDLSPLFDRLAEITALALRARQMSEQIAYLKSKI
FT                   RAQLRVLLQADPTDARGLELLRRLRGKLTVEALSDLSQALPQAVHEAAEDRPEPPAPTQ
FT                   APTQALSASDGQNVRHHQKSKKEITEEETTARENTGAEEALTLAELVTACPEAASFSLR
FT                   RIESFADVVSHAQRLAPMIGIDQATYGQAVRSIGAVPSALTVWAMVQCHTQIRNIGAYF
FT                   RAITSGARRQDFDAVRLVRRLGRRVAA"
FT   gene            100924..101766
FT                   /locus_tag="RCAP_rcp00117"
FT   CDS_pept        100924..101766
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00117"
FT                   /product="EAL domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00117"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87372"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN7"
FT                   /protein_id="ADE87372.1"
FT                   /translation="MRKYPAFPRDLAAAAEADPLSFAVAGRDRETLAMVRRAIDRGDVL
FT                   LAFQPIMQTARPEFPAFYEGLIRVLDDTGRVIPSHDFFAAAETTDLGRRLDCLALDLGL
FT                   QTLAENPKLRLSVNMSARSIGWPEWTRILTRGLARDPTAGERLILEITEASAMTMPELV
FT                   SVFMHEMHMKGICFAIDDFGAGYTSLRYLREFYFDILKISGQFISGIADNPDSQVLTRA
FT                   LMSIAGHFEMFTVAEGVETAEDAAWLAGQGVDCMQGYYFGAPTLTPPWSLAAARQAER"
FT   gene            complement(101785..102741)
FT                   /locus_tag="RCAP_rcp00118"
FT   CDS_pept        complement(101785..102741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00118"
FT                   /product="Na+-dependent transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00118"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87373"
FT                   /db_xref="GOA:D5AVN8"
FT                   /db_xref="InterPro:IPR016833"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN8"
FT                   /protein_id="ADE87373.1"
FT                   /translation="MNPLKRFGIDTYMLLLLAMVLAGVFLPAGGALAAGLKQVTWGAVW
FT                   LLFFLYGAKLDPRTVRAELLNWRLQGLTFGATYLLFPLLGIGFAAVFAPVLGPDVTLGL
FT                   LFLSVLPSTVQSSIAFTALAGGNVPGAICAASVSNLIGVALTPLLVTLLMHRAGGGTSL
FT                   GAVAGIGTQILLPFALGQILRPRIGGLVARHKRLTMAVDRGSILLIVYAAFSAGTIAGL
FT                   WQAIPALRLILLAGVIALFLALGMAAMVMAGRACRLPTADRAALFYCGATKSIATGLPI
FT                   AAALFPADQVGAIVLPAMLYHMSQLLVCAFLAQRGRG"
FT   gene            complement(102814..103383)
FT                   /locus_tag="RCAP_rcp00119"
FT   CDS_pept        complement(102814..103383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00119"
FT                   /product="BioY family protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00119"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87374"
FT                   /db_xref="GOA:D5AVN9"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVN9"
FT                   /protein_id="ADE87374.1"
FT                   /translation="MTSLSTRDIVLIALFAALTAALALFPPITLPLIGVPITAQSMGPM
FT                   LAGAVIGARRGALAMGLVVVLVALGLPILSGGRGGLGVFAGPTVGFLLGWIPAAYVTGL
FT                   LHELGWKRLTALRSFVFATIGGIVVLYGLGVPVLAVQAGLSLKAAALGSAPFIPGDLVK
FT                   AGITAAVALSVKRAWPILRARGATAA"
FT   gene            complement(103406..103999)
FT                   /gene="cbiQ4"
FT                   /locus_tag="RCAP_rcp00120"
FT   CDS_pept        complement(103406..103999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiQ4"
FT                   /locus_tag="RCAP_rcp00120"
FT                   /product="cobalt ABC transporter, permease protein CbiQ-4"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00120"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87375"
FT                   /db_xref="GOA:D5AVP0"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP0"
FT                   /protein_id="ADE87375.1"
FT                   /translation="MSPLHRCPPGPKLAALALAGTGLMLVEAPAIMLAALALTLAGFRL
FT                   AGFGRAQIRAQVAPLLWMLAILFPVQGWLAGWSLAALVVLRILTLILLAALVTLTTRTE
FT                   DLIATLERLLAPLAPLGVNPAKVGLALALALRFLPVIRDEALRVREAQAARGLGTHPLA
FT                   LILPLILRVLKTADEVAEAIEARSGHHDGAAISR"
FT   gene            complement(103996..104625)
FT                   /gene="cbiO4"
FT                   /locus_tag="RCAP_rcp00121"
FT   CDS_pept        complement(103996..104625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cbiO4"
FT                   /locus_tag="RCAP_rcp00121"
FT                   /product="cobalt ABC transporter, ATP-binding protein
FT                   CbiO-4"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00121"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87376"
FT                   /db_xref="GOA:D5AVP1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP1"
FT                   /protein_id="ADE87376.1"
FT                   /translation="MLRGISVTLTERRIGIVGANGSGKSTFARLLNGLMLPDRGTVRID
FT                   GLETAREARAVRRKVGFVFQNPDTQIVLPTVEEDIAFGLKGQKSGAAERAAKVTAILDR
FT                   FGLADLRQAPAHRLSGGQKQLLAIAGVLITAPDCIVFDEPTTLLDLRNARRIGQVIADL
FT                   AQTAIVVTHDLPLLAGFDRVLVFDQGRIVADDEPGPALRSYVERMT"
FT   gene            complement(104825..105586)
FT                   /gene="madM"
FT                   /locus_tag="RCAP_rcp00122"
FT   CDS_pept        complement(104825..105586)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madM"
FT                   /locus_tag="RCAP_rcp00122"
FT                   /product="malonate:sodium symporter, MadM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00122"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87377"
FT                   /db_xref="GOA:D5AVP2"
FT                   /db_xref="InterPro:IPR004691"
FT                   /db_xref="InterPro:IPR018402"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP2"
FT                   /protein_id="ADE87377.1"
FT                   /translation="MLDIIVGTLEKLPLITAFAIVGVIMWISYAIGKLVNNRIHGSAIA
FT                   IVAGLVLAYIGGKVTGGSKGISDVSLFAGFGLMGGAMLRDFAIVSTAFGVKLEEVKKAG
FT                   LAGGIALVISVIISTAIGAAVAYAFGYTSVVDMATIGGGATTFIVGPVTGAALGASSEV
FT                   IALSVAAGVVKSIAVMILTPLLAKPAGLTTPAAAAVYGGLMGTTSGVSAGLAATDPKLV
FT                   PYGALTATFYTGFGCLMVPSVGYMTLAALFG"
FT   gene            complement(105588..105989)
FT                   /gene="madL"
FT                   /locus_tag="RCAP_rcp00123"
FT   CDS_pept        complement(105588..105989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="madL"
FT                   /locus_tag="RCAP_rcp00123"
FT                   /product="malonate:sodium symporter, MadL subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00123"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87378"
FT                   /db_xref="GOA:D5AVP3"
FT                   /db_xref="InterPro:IPR004690"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP3"
FT                   /protein_id="ADE87378.1"
FT                   /translation="MLIYGVSLMSGCLIAGVIIGKLIGHMVGIDADVGGVGIAMLLLVV
FT                   ISRWFIDRERMSELAQDGIKFWSAMYIPIVVAMAASQNVVAAFDAGTMAFIAGFLPVVA
FT                   GFLLIRPLAALGGTAETEDAAKRAAQGAK"
FT   gene            complement(106056..106265)
FT                   /locus_tag="RCAP_rcp00124"
FT   CDS_pept        complement(106056..106265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00124"
FT                   /product="biotin/lipoyl attachment domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00124"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87379"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP4"
FT                   /protein_id="ADE87379.1"
FT                   /translation="MDVKVKMPSVIVSIEVAVGATVTKGQCVAVVEAMKMKNDTPAPID
FT                   GTVKSIAVNPGDRLKPGAVIMIIE"
FT   gene            complement(106256..107008)
FT                   /gene="mdcG"
FT                   /locus_tag="RCAP_rcp00125"
FT   CDS_pept        complement(106256..107008)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcG"
FT                   /locus_tag="RCAP_rcp00125"
FT                   /product="phosphoribosyl-dephospho-CoA transferase"
FT                   /EC_number="2.7.7.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00125"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87380"
FT                   /db_xref="GOA:D5AVP5"
FT                   /db_xref="InterPro:IPR017557"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP5"
FT                   /protein_id="ADE87380.1"
FT                   /translation="MFRIRHSLAHVSPASRPGILAAVLDALPEQMRDPGTRKLVRDAMS
FT                   KAHIPGIVCRPTGPCPDGGGQLGFSFPFRHGAERVRAAVPVRRGQVSAFFTPWEVMDRA
FT                   LILGPNLHPALPEIARAGALSGVEIGLIGSAALQTVTGLPYLRPDSDLDLVVRAESLRA
FT                   LEQLATMLATLAKRRGLAVDAEVALPGGIGVKLTELLSGARSVLGKTITGVELIERPHL
FT                   ISLFEAPPPARPDPQHPIKQPERKRQWM"
FT   gene            complement(107010..108095)
FT                   /locus_tag="RCAP_rcp00126"
FT   CDS_pept        complement(107010..108095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00126"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00126"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87381"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP6"
FT                   /protein_id="ADE87381.1"
FT                   /translation="MSDDLKALEDALSLQGAVPTLAEMPRRTLAHKGIAGPTAAHVIEE
FT                   VHTPFNLAYLTFTTGSSAFQTIVGVTHAELENRNAVAREIFGRLQIPAGERMLVTYPPL
FT                   VNVFSKQALEGCGLVWSHLERSSRDALLLAACREQPRLILGESSFLRATLEQALRLDLK
FT                   PRMPQGCVLLCAGTPLDAELLPVAEAFGYAVHDLYGCQEFGWLVLDGRPLRADISLVPS
FT                   PLGDPWRELVVGGLPMGDSFVVSDAGHVCDRAGRIITYRRARTYPEYEVIVTHTPATAA
FT                   EVIEKTARTILRIKSRVVKVAQGLTVGAGATRLELVPALGRAAPIVIEGPEATVLFDTL
FT                   VTAQRDMAQSAKTDPAWIKRR"
FT   gene            complement(108130..109023)
FT                   /gene="mdcE"
FT                   /locus_tag="RCAP_rcp00127"
FT   CDS_pept        complement(108130..109023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcE"
FT                   /locus_tag="RCAP_rcp00127"
FT                   /product="malonate decarboxylase, gamma subunit"
FT                   /EC_number="4.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00127"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87382"
FT                   /db_xref="GOA:D5AVP7"
FT                   /db_xref="InterPro:IPR009648"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP7"
FT                   /protein_id="ADE87382.1"
FT                   /translation="MDMQESMMGRGRDAIEMIVDAGSFAEGTVGAKSFDDPEFGPGAVV
FT                   GTATLQGTVCTIIASDGGAMNEKFPVVYAGIIGLEEGYKMAEAVYASIIEDAEKPLAEK
FT                   RPLVLIVDTPGNGPGKVEEIFGMNKSTAAYQLALAEARLKGHPIIAMVIGRAISGAFLC
FT                   HGLQADAILSLDAQFGTMIHVMPLTSVSRIIRKDLETLEVLSKQSAVFAAGPRFFHSLG
FT                   GVEALVETLDGMRPAIVARIAEVRAAKLEGRQDDLGPWGRGKLGEARGGRIERPRVIEM
FT                   MSRDFAAVADRYAPSR"
FT   gene            complement(109043..109999)
FT                   /gene="mdcB"
FT                   /locus_tag="RCAP_rcp00128"
FT   CDS_pept        complement(109043..109999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcB"
FT                   /locus_tag="RCAP_rcp00128"
FT                   /product="malonate decarboxylase, beta subunit"
FT                   /EC_number="4.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00128"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87383"
FT                   /db_xref="GOA:D5AVP8"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR017556"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP8"
FT                   /protein_id="ADE87383.1"
FT                   /translation="MTNWTDLQPRSFLEASARDRAIGLVDEGSFTELAGPFDRVTSPHL
FT                   ALLGDAVAFDDGIVTGVGKIGRTPVFVISQEGRFIGGSVGEIGGAKMVNTIKLAIDFHD
FT                   DLVAQFDDLDEEEKPLVVISFETGGVRLHEANAGLLAHAEVMDQLQKARGKVPVIALIG
FT                   SKVGAFGGMGFVAAATDVIIMSEFGRLGLTGPEVIEQEMGKEEFDASDRALVYRTTGGR
FT                   HKFIMGDANFLVENTVAAFREQVSALAGLSIEAFEEMRRIGSPAKVKAQLRAVALAAEM
FT                   QPSDATDVWTRAGNTDAHGLIDLPLSEFLATVRRLAV"
FT   gene            complement(110014..110322)
FT                   /gene="mdcD"
FT                   /locus_tag="RCAP_rcp00129"
FT   CDS_pept        complement(110014..110322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcD"
FT                   /locus_tag="RCAP_rcp00129"
FT                   /product="malonate decarboxylase, delta subunit"
FT                   /EC_number="4.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00129"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87384"
FT                   /db_xref="GOA:D5AVP9"
FT                   /db_xref="InterPro:IPR009662"
FT                   /db_xref="InterPro:IPR023439"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVP9"
FT                   /protein_id="ADE87384.1"
FT                   /translation="MALHTLTLDLAAAAPKTKIQARLHVGVTGSSDLEIMMHPEDLSGR
FT                   VAVTVVTPVTGFDALWTRVLQKFLDESGLCDARIEINDNNATPAVVLLRLQQALAAA"
FT   gene            complement(110337..112010)
FT                   /gene="mdcA"
FT                   /locus_tag="RCAP_rcp00130"
FT   CDS_pept        complement(110337..112010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mdcA"
FT                   /locus_tag="RCAP_rcp00130"
FT                   /product="malonate decarboxylase, alpha subunit"
FT                   /EC_number="4.1.1.9"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00130"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87385"
FT                   /db_xref="GOA:D5AVQ0"
FT                   /db_xref="InterPro:IPR005777"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ0"
FT                   /protein_id="ADE87385.1"
FT                   /translation="MTQQDKRNSWRKRAEDTAARKEAAAPLYVKGKEVLAKDTVALLEA
FT                   VIRPFDIINIEGNNQKQADFLAECLNKVDRGKIHDLHMVQSAVPLPAHLDLFENGIAKK
FT                   LDFAFGGPQAGRVAKFIANGKIELGAIHTYLELFGRYFLDLTPRVSLVCAYKADRKGNL
FT                   YTGFNTEDTPAIVEATKFREGIVIAQVNEIVDELPRVDIPGDWVDAVIQSPKPFFIEPL
FT                   FTRDPALVTDSQILLAMMCLKGIYAEYGVSSMNHGIGFLTSAIELILPTYGLELGLKGK
FT                   CCTHMILNPHPTMIPAIEEGWVDTIHCFGGELGMEDYVASRPDVFFVGPDGSLRSNRAF
FT                   AQTAGHYAIDMFIGGTLQIDKYGNSSTATAGRVAGFGGAPNMGCDAKGRRHPTDAWLKC
FT                   GQELPSLERDIGNLPRGKRLVVQGVETFGEGRAPVFVDELDAWKLARDADLPIPPVMIY
FT                   GDDLTHIVTEEGIAYLNRCKDMEARMAAIRAVAGFTDIGLAAKPEETRALREAGIVKTV
FT                   SDLGINPARANRDLLAAKSMRDLVTWSGGLYNPPARFRNW"
FT   gene            complement(112041..112871)
FT                   /gene="birA2"
FT                   /locus_tag="RCAP_rcp00131"
FT   CDS_pept        complement(112041..112871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="birA2"
FT                   /locus_tag="RCAP_rcp00131"
FT                   /product="biotin--[acetyl-CoA-carboxylase] ligase-2"
FT                   /EC_number="6.3.4.15"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00131"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87386"
FT                   /db_xref="GOA:D5AVQ1"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ1"
FT                   /protein_id="ADE87386.1"
FT                   /translation="MTAHHPDLLPNLPTLALPVRRRTGIGCAVHHRPVLSSTNSFLAGL
FT                   ARRGAPTGTIVLADHQTAGRGKYDRPWVSRPGESLLASVLLRPSRPLADLAQVTLVIAV
FT                   AAAEAITRSTGLAPQIKWPNDLMVAGRKLSGILCELVLTPEGDLDHIIAGIGINIAQNR
FT                   TDFPPELQAIATSISAETGRKVDRFDLFAALVERLDHRLTEWERLGFEPARHAWSVRSC
FT                   TLGQPVTLSAPQAPRQGIAEALGPDGALCLRTADGTLHSVIFGEIPLAATQATL"
FT   gene            complement(112907..114115)
FT                   /gene="oadB"
FT                   /locus_tag="RCAP_rcp00132"
FT   CDS_pept        complement(112907..114115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oadB"
FT                   /locus_tag="RCAP_rcp00132"
FT                   /product="Na+-transporting methylmalonyl-CoA/oxaloacetate
FT                   decarboxylase, beta subunit"
FT                   /EC_number="4.1.1.3"
FT                   /EC_number="4.1.1.41"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00132"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87387"
FT                   /db_xref="GOA:D5AVQ2"
FT                   /db_xref="InterPro:IPR005661"
FT                   /db_xref="InterPro:IPR017558"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ2"
FT                   /protein_id="ADE87387.1"
FT                   /translation="MLETLFNIFPGIGTLFIQDPLISFARLAFIGLGFLLAYLGFKRTL
FT                   EPLIMVPMGLGMMAVNAGVMILEGGQVGTLVISPLVSETNALMDIMQINFLQPIYNFTF
FT                   VNSLVACMLFMGIGTMADISFILARPWASIAVAVCAELGTFVTLVIGYYCGLTPGEAAA
FT                   VGTIGGADGPMVLFGSLMMAKNLFVPISIIAYLYLSLTYAGYPYLVRWLIKEEHRAIEV
FT                   DYDFPDVTPQAKFIFTVVAAGLLCLLLPVATPLILSFFLGVAIKEAEIEPYQKFLENTV
FT                   TYASTLLLGLVLGTLCEAGTLLDPQVALLLILGITALAVSALGGIGGGYLVWKLSKGNY
FT                   NPVIGIAGVSCMPSTAKIAQKEAFEANPHAMIMPLAMGASICGVIVSAIAVGVFASTIG
FT                   LVN"
FT   gene            complement(114125..114241)
FT                   /locus_tag="RCAP_rcp00133"
FT   CDS_pept        complement(114125..114241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00133"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00133"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87388"
FT                   /db_xref="GOA:D5AVQ3"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ3"
FT                   /protein_id="ADE87388.1"
FT                   /translation="MNIITYAAFSYLITAAISFAVIGVIVGISKLLSSPNAS"
FT   gene            complement(114249..115205)
FT                   /gene="citG"
FT                   /locus_tag="RCAP_rcp00134"
FT   CDS_pept        complement(114249..115205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="citG"
FT                   /locus_tag="RCAP_rcp00134"
FT                   /product="triphosphoribosyl-dephospho-CoA synthase"
FT                   /EC_number="2.4.2.52"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00134"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87389"
FT                   /db_xref="GOA:D5AVQ4"
FT                   /db_xref="InterPro:IPR002736"
FT                   /db_xref="InterPro:IPR017551"
FT                   /db_xref="InterPro:IPR017555"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ4"
FT                   /protein_id="ADE87389.1"
FT                   /translation="MKYALRRPLDWFSDIALSPQTSAWSIGSAFLTGALLEISTHPKPG
FT                   LVTPRSNGAHRDMNLQTFMVSSAVIAPCLYQCAEAGLDHAGPALTLLPRVRAIGEIYEA
FT                   RLLAATRGVNTQRGLLFSAGVLAAAAGLAARRDDLTEAALFDTAAAMVAGICDRELRAG
FT                   LHREAETAGEKLFRQYGVLGIRGEAEAGYPTVRNHGLPALRAARASGATLATSLCHTLI
FT                   ALMAETEDTTVLWRGGPAALSFMRTEARKILALGGALTGDGLAAIHALDARFIERHISP
FT                   GGAADLLAVTLGVDALSGGELPPIFPAEALPFAPCNP"
FT   gene            complement(115521..115691)
FT                   /locus_tag="RCAP_rcp00135"
FT   CDS_pept        complement(115521..115691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00135"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00135"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ5"
FT                   /protein_id="ADE87390.1"
FT                   /translation="MAIAARPAAAPQSPVAVDENASRKPRANSRAPLLQSWLHFCQVID
FT                   FAMNSCKTAAL"
FT   gene            complement(115706..116122)
FT                   /locus_tag="RCAP_rcp00136"
FT   CDS_pept        complement(115706..116122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00136"
FT                   /product="transcriptional regulator, HutP family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00136"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87391"
FT                   /db_xref="InterPro:IPR015111"
FT                   /db_xref="InterPro:IPR036482"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ6"
FT                   /protein_id="ADE87391.1"
FT                   /translation="MQVTADRIGKAAIMAAISSREEEDLIKEQILAHPTWKVGITYVTG
FT                   RRSEIEKGFVKSIVACALNGGVIHNRPGAVHGVIHAGLECLQGVSATVVAESNLKLKVA
FT                   LVSDGHWVAVAAHGESAFHPTTNHERIGFGVMHI"
FT   gene            complement(116228..117466)
FT                   /locus_tag="RCAP_rcp00137"
FT   CDS_pept        complement(116228..117466)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00137"
FT                   /product="PAS/PAC sensor domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00137"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87392"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ7"
FT                   /protein_id="ADE87392.1"
FT                   /translation="MTHQRDLSGQPEGEVNFRLDDLFFSRTDPRGVILAGNDVFQNVSG
FT                   FAWSELLGAPHKIIRHPDTPRAVFRILWDALGNGFPMGGYVKNRARNGDFYWVFAVILP
FT                   TEGGFLSVRLKPSTPLFAQIRKVYAELAARERAERLDPGDSARRLWTIITEAGFTSYTT
FT                   FMASALGQELAARDHRLGRPEDPRTRRLIEMNEALERVTQEQKKLLRSFESLQSIPNNM
FT                   RLVASRLEPSGGPVSAISENYRASSLVISDRLRSFVSGRENLCDRVSREVARALFLLGA
FT                   NRVMAEMIATFRQAEPVPGLDWQTEAAKLAEARGATRRDSHAALTTAVGHAEELARSSA
FT                   EIRRLMLGLDTIRVMGRVECGRLRENGAGLVSTIDQLDLFHAEIKARLETILRLSEDIG
FT                   SAMSRFVKADPDG"
FT   gene            complement(117565..118929)
FT                   /gene="chrA"
FT                   /locus_tag="RCAP_rcp00138"
FT   CDS_pept        complement(117565..118929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chrA"
FT                   /locus_tag="RCAP_rcp00138"
FT                   /product="chromate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00138"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87393"
FT                   /db_xref="GOA:D5AVQ8"
FT                   /db_xref="InterPro:IPR003370"
FT                   /db_xref="InterPro:IPR014047"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ8"
FT                   /protein_id="ADE87393.1"
FT                   /translation="MSGSIERPGLGEAARVWARIAGLSFGGPAGQIAVMHRILVEEKRW
FT                   LGDARFLHALNFCMLLPGPEAMQLATYVGWLLHGVRGAVLAGLLFLAPGVAALMTLSWI
FT                   YALWGGGGLVAGLFFGLKAGVLAIVAQAVLRLAKRALKTRAQRALAVAAFVGLFALALP
FT                   FPLIVAAAALIGVLGGLIAPAAFAPGGHGAAGGPATPDAETLLGEEHGDPTGAERRAAL
FT                   RAGAVALMLWLLPVAALWLLAPESVFTAIALFFSKLAVLTFGGAYAVLAWVAQAAVTDF
FT                   GWLRPTEMLDGLGMAETTPGPLIMVLQFVGFMAAFRAAGWEAPLLAGSLGGLLASWVTF
FT                   APCFAWIFLGAPFIERLRANRALGAALSAVTAAVVGVIANLALWFALHLLWRGVTRISL
FT                   GPVSLDLPQMATLDLPATGIAAVAVWALFRRGWGMAAVLAGSAGLGVLAHLAGIA"
FT   gene            119148..119957
FT                   /locus_tag="RCAP_rcp00139"
FT   CDS_pept        119148..119957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00139"
FT                   /product="methyltransferase, type 11 family"
FT                   /EC_number="2.1.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00139"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87394"
FT                   /db_xref="GOA:D5AVQ9"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVQ9"
FT                   /protein_id="ADE87394.1"
FT                   /translation="MADMARKDFTAANRAAWNASAPLHAQGDPWAQLLARAGEPGFSVL
FT                   DPCLTAVLHRLGLAGKSAAQIGCNNARELLSLASLGIRPALGIDQAGAFLAQARQLAEA
FT                   AGLAPRLVEADIYDLPPDLGQVDLALITIGVLNWMPDLPAFFRVTSGLLAPGGVLVIYE
FT                   THPFLEQFDPAAATPFEPAFSYFERRPQLVTEAISYDGKDHGKGETGYWFLHPLGEIVT
FT                   ACVRSGLAIEELTEFGHSIREPEYDLYEGRAAQIPMSYCLIARKPPA"
FT   gene            complement(119961..120575)
FT                   /locus_tag="RCAP_rcp00140"
FT   CDS_pept        complement(119961..120575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00140"
FT                   /product="conserved domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00140"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87395"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR0"
FT                   /protein_id="ADE87395.1"
FT                   /translation="MAICDKCGGEIAFRYVDGVLRPLHIGGGLCDGLERVTEPVPREGW
FT                   TQDCYLDPNASCPVCGARVYFYQSRHGGRVLFDDVGWPWPKHACTDDYQQSVRVKRVPS
FT                   GRARVFRDRSGALLKIYDLDDIEDRGRNHLLVLRNQMTGSRVRVLVGKRRLAQGNIRLA
FT                   DFQDAPSIVVHEFERGAPHIRLDFVCVRLGKVVRVKLRAAR"
FT   gene            120811..121119
FT                   /locus_tag="RCAP_rcp00141"
FT   CDS_pept        120811..121119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00141"
FT                   /product="protein of unknown function DUF1778"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00141"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87396"
FT                   /db_xref="GOA:D5AVR1"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR014795"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR1"
FT                   /protein_id="ADE87396.1"
FT                   /translation="MLGFHDSTRAIDERNEARMNFRTKPRIKAAIQQAAALSGVDDSVF
FT                   TMNAAYQAALATIAAHERTMLQPVDHDAFFAALDAPAAPTDTLRAAFRRHGKTVVSQ"
FT   gene            121120..121680
FT                   /locus_tag="RCAP_rcp00142"
FT   CDS_pept        121120..121680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00142"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00142"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87397"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR2"
FT                   /protein_id="ADE87397.1"
FT                   /translation="MAASQPAFCRIEPFDPERHDRAAFSCGVKQVDTYFQKTANKLAKA
FT                   DNVRLYVMVDPGGTVIGFYALNAHAVHFADLPAKFARTRPSHGNIPAAYISMIGRDQRV
FT                   RGGGYGGDLLVDALRRIAVAAEAIGVAVVMLDVLDCGDPARVARRKALYESYGFLPLAS
FT                   NPLRMFLPVSVVRTLVAEEPSGR"
FT   gene            121820..122077
FT                   /locus_tag="RCAP_rcp00143"
FT   CDS_pept        121820..122077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00143"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00143"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87398"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR3"
FT                   /protein_id="ADE87398.1"
FT                   /translation="MNQIASAANRGRVSMVKEQWAGLDALRQRLPVLRATLSQVINERR
FT                   RRGVTLYRKFVAEHQGRQIGYPCSSSELLPENGTVTEATI"
FT   gene            complement(122067..122436)
FT                   /pseudo
FT                   /locus_tag="RCAP_rcp00144"
FT                   /note="transposase, ISSpo9; frameshift"
FT   gene            122580..123728
FT                   /locus_tag="RCAP_rcp00146"
FT   CDS_pept        122580..123728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00146"
FT                   /product="transcriptional regulator, ROK family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00146"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87399"
FT                   /db_xref="GOA:D5AVR4"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR4"
FT                   /protein_id="ADE87399.1"
FT                   /translation="MTRTPLTLTGSALAVLRALVERGPSTRPQLGQDLGLSRPTMSAAI
FT                   AELIQAGLVEPIGAVQGGMGRRAVEYRVATHAGHVIAVDAGSTHIRLRLSTLDRRLLHS
FT                   SLHPLPQSQYALTPQISAVVAAAVAEALARTEADWGPLQAMVIAVPTRVVGPEGDTAAT
FT                   DQEVIYSNFTPPPQVECTLVNNVNCAAVAEYHYGAAQGRQTFAFLQVGVKIGLGLMLNG
FT                   QILRGVNGAAGEIGHISFPFAPGLTPQRGEAERYLGTEAFMARVRAGWPADAGPPPRDT
FT                   YELLARAGTGDATALAHVEEHAAQIGAVIAICVSVIDPGLVVLGGGYGASPLLRPKVEE
FT                   VVRRLAFPAEITTSTLAAEATVLGAERLAVERAVSALLGLPC"
FT   gene            123845..125101
FT                   /locus_tag="RCAP_rcp00147"
FT   CDS_pept        123845..125101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00147"
FT                   /product="polyols ABC transporter, periplasmic
FT                   polyols-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00147"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87400"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR5"
FT                   /protein_id="ADE87400.1"
FT                   /translation="MKNRHTAASLLVLALAAAGTAAGAQSLEYWVYSDFAQGEALALQQ
FT                   EFIKEFQQSHPGVSVNIVGKGDDDLTAGQIAGAASGNLPDIFMNGIGVGAQLADVGALA
FT                   NIHDKWMALPEEVRAQYNAAAVANCAPRPGEMYCLPYTGYGSLLFRNLTVLQEAGIDTA
FT                   TPPKDWAEWLAQMEKVKAAGKFAIPDQALVFNSIAEIYAVTGDVSTWGIDWDKKTTRID
FT                   PAVMTAVMQKFVAMKPLTSGTSRNDQATKDLFVTNQLAFHTVGPWVNPTYQEASANSGL
FT                   KYDFVLMPGETAGKQGGIKNFEIIGVAPGKNADLAFEFVAYITAKEQMARWAKLLSRYN
FT                   SNDAAMADPEVAALPLIAQSAAAVAGAMDVNPPYLIHPVPACYQSTVVDYVSATADGEF
FT                   TPEEGATEMIAELNACLAD"
FT   gene            125196..126086
FT                   /locus_tag="RCAP_rcp00148"
FT   CDS_pept        125196..126086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00148"
FT                   /product="polyols ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00148"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87401"
FT                   /db_xref="GOA:D5AVR6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR6"
FT                   /protein_id="ADE87401.1"
FT                   /translation="MRHTRHHLPHFLMILPFLLLFGAFFLYPILSGFYYSFHDWNGVRE
FT                   PVYVGLENYTKLLGSRDFSRAMWNLFQYIAITVPLGLSVAFGLALLVDSFTGRWANFFR
FT                   NAYFLPVVLPAFLAATIWRWIYASNFGLLNMMLGWIGAEPVSFLNDTGTMLYALIAVDV
FT                   WVSAGFNMVIILAGLKNIPADLYEAARLDGASKLQQVIHITLPMLAPVMFFVLTYSVIS
FT                   AMQVFDKPWLLTGSSFSEYGGRRGALLFPVMDMMGRAFGGVQFGLASAYGFLLTLAIIL
FT                   VTALLYALRSWSNRR"
FT   gene            126083..126937
FT                   /locus_tag="RCAP_rcp00149"
FT   CDS_pept        126083..126937
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00149"
FT                   /product="polyols ABC transporter, permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00149"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87402"
FT                   /db_xref="GOA:D5AVR7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR7"
FT                   /protein_id="ADE87402.1"
FT                   /translation="MISPLSLAPRLSVWTVLKWVIALLIAVITIFPIWWMVNVVFSLPG
FT                   EPVSINPRLWPTSLSAGFDKIGMIFTQTGYLRAYGISLAYALLTILGVLFIGSLAAFEF
FT                   ALFDFPAKRLIFGIVMLSLMVPTAVTIIPTYLLTSQLGWLNSMQGLVVPGLASAFGLFM
FT                   LVQFMRAIPQDMIEAARLDGAGHFQIYWHVALPLCRNALITLAILTFMQTWGNYMWPLI
FT                   ITTSPEMYTVGQVVGLFNAPLSHQTVDVVMTANLLAAVPPLLFFLIFQRKIVEGIAMSG
FT                   TKG"
FT   gene            126956..128059
FT                   /locus_tag="RCAP_rcp00150"
FT   CDS_pept        126956..128059
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00150"
FT                   /product="polyols ABC transporter, ATP-binding protein"
FT                   /EC_number="3.6.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00150"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87403"
FT                   /db_xref="GOA:D5AVR8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR8"
FT                   /protein_id="ADE87403.1"
FT                   /translation="MAFLEIKSLCKSFEAYPVLQDIDLSIEKGEFVVFVGPSGCGKSTL
FT                   LRMITGLETPTSGTIAIEDTVINDVDPAKRGTAMVFQSYALYPHMTVFENISFGLRMAH
FT                   QPKALIRERVEKAAAILRLEKLLDRKPGQLSGGQKQRVAIGRAIVREPRVFLFDEPLSN
FT                   LDAELRVQMRAELLELHERLGTTMIYVTHDQVEAMTLADKMVVMMGGKVQQYGRPLDLY
FT                   DDPDNKFVAGFVGSPKMNFLSARVVTAGPAGLRVDLAAGGAALVPLAVTLAPGARVALG
FT                   LRPEQISVVAAGQSLPADAVMVTGRVALIEDLGAESYLHLHLADDSRIGVRTVRHAAHL
FT                   GDEVRVAAPASAVLVFDDAGTRLRGRA"
FT   gene            128056..128997
FT                   /locus_tag="RCAP_rcp00151"
FT   CDS_pept        128056..128997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00151"
FT                   /product="ATPase, BadF/BadG/BcrA/BcrD family"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00151"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87404"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVR9"
FT                   /protein_id="ADE87404.1"
FT                   /translation="MILQTASGAAAPVVGVDIGGTKTEICLARLDGARLIKLRETVLPS
FT                   RSWRGADAAADAASLLAQVRLLVGDSPVAALGVGAHGCDDDAECETLAAALRARSALPL
FT                   RVVNDAELMPLAMGRVGQIGLVAGTGSIAVCRTAEGRMISAGGWGWLIGDDGSAAGLVR
FT                   EAARAVSLALDGGATTEDPLIGLLYHSLGQPELPRLGSTLAGLGTAAAIGAHAPAVFAA
FT                   CDAGSPLAASVIRAGAEALAGLVVNLRARGSTASHVVAGGSVIVAQPPLWQAFATAVAR
FT                   RSGGAVTAHLFQGHPVEGACRLAADLVTPALS"
FT   gene            129025..130029
FT                   /locus_tag="RCAP_rcp00152"
FT   CDS_pept        129025..130029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00152"
FT                   /product="sugar isomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00152"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87405"
FT                   /db_xref="GOA:D5AVS0"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVS0"
FT                   /protein_id="ADE87405.1"
FT                   /translation="MSYRSTIARQPEALADTHAALRSQLDAADLSDLFGPVIGVTGIGA
FT                   SFAAAVVGAAELQARGRRGIALRACDLAAGHDLADTLVGLSAGGRSIETVLGFEKLPSA
FT                   RRIGISKDGAGPLAAVSDLHLEIRQGADATPSSVGYTATLLGMGMLFERLSGAQDDSFA
FT                   DLPGVVTGVLAQAAAKMERIGTLFAARRAIDCVGAGAALGTADGASLLLREAARLPAAA
FT                   HDTRHYLHGPLEAMDATTGVLIIGDGREVELAHQVERIGCPVVLITTDATVTDGERLTV
FT                   ITVPRRDNLIAQGILDILAPQLIAATLSDAAGLTDVKFRYRMQDTKIAAPTAA"
FT   gene            complement(130309..131322)
FT                   /locus_tag="RCAP_rcp00153"
FT   CDS_pept        complement(130309..131322)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RCAP_rcp00153"
FT                   /product="sugar isomerase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00153"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87406"
FT                   /db_xref="GOA:D5AVS1"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR024713"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVS1"
FT                   /protein_id="ADE87406.1"
FT                   /translation="MFNFDETRFLRIQQGAVDLAPRIDAAIGAAIGAGATNLYFLGTGG
FT                   VAYLMEPAVQLLQRRSGFPVFKDYPAELVITGSANLTARSIVVMPSLSGTTKESVAMMA
FT                   KLQEIGATVITLVGHAETPLGQGGNPALVNFAEDDTSSESFYIQSLLVALSVMKARGEI
FT                   ANYDALLRELASVPAALVAAKKAFEPKAKDFAAIIAGSDYHMFTGAGNMWPEALYYATC
FT                   ILEEMQWIRTRPTHASDFFHGPLELIEPGVSLILFRGEDDCDPLAERVAQFARQYTDKL
FT                   TVISTADYLPRELSPELRALLSPAVMATLMERLSAHLEVMRNHPLVTRRYYKRVAY"
FT   gene            complement(131430..132929)
FT                   /gene="argH2"
FT                   /locus_tag="RCAP_rcp00154"
FT   CDS_pept        complement(131430..132929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="argH2"
FT                   /locus_tag="RCAP_rcp00154"
FT                   /product="argininosuccinate lyase-2"
FT                   /EC_number="4.3.2.1"
FT                   /db_xref="EnsemblGenomes-Gn:RCAP_rcp00154"
FT                   /db_xref="EnsemblGenomes-Tr:ADE87407"
FT                   /db_xref="GOA:D5AVS2"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/TrEMBL:D5AVS2"
FT                   /protein_id="ADE87407.1"
FT                   /translation="MKNSVSSRLTERTAAEVARTIYAPPMQGFDAAALERMCALNEAHA
FT                   VMLAECGLIPAEIARTLLRGIATIRAEGPGAIDLDPQFEDSYFAFENRLGQVIGKATAG
FT                   WLHIGRSRNDIGATLDRMAAREVCLGLLAEMAATRRACLAAAARHKMTVMPGYTHLQPA
FT                   QPITFGYYLANVARGMERDYDRLAAVYDRADACALGMAALAGTSFAIDRPRVAQMLGFS
FT                   GLATPGLDAVASRDFVTEMLWAVTSAQVLFSRVAQDFYVFTTWEFGALGFPDRVAGTSS
FT                   IMPQKKNMLPLEYFRAEAGRSIGALAGALSAVKGSNYSIGLDSVREGVTDAWPTFERFR
FT                   ATLPLLRLIFETATPDAERLLARCSANFSTATDLADGLVRDFGVSFRDAHHVVGRAVQM
FT                   VIAAGGDARQLTVQVLNAAAEEEIGRSFDLAEDKLRRWMDPVQAVSARKVPGGTAPEAV
FT                   EAMLQEMQGRLDADETARAARIGHLGGAARALSTRVAALID"
XX
SQ   Sequence 132962 BP; 23066 A; 44463 C; 43911 G; 21522 T; 0 other;
     cgcggggcgc agggcgcccg gcgaggggga ggtcggaacg gaaagtgcgg ggggtcacgg        60
     tcaggcccgc gtctgcagcc tggccccgag gtcgcgggcc tgtgcctcca gccgggtgtc       120
     gtcgccgggc gcatagggcc gcaggaagtg gcgttcgatc cggcccccga tcagcgagat       180
     cagcgtgcaa agcgcgaaat agacgacgag gatcgagccg tagaccagat aggccgggct       240
     gccgccgcgc aggatcgtgg tctgttcgat caccacctgc cccgagcgca gcagttcctg       300
     cgcccccacc accgcgccaa gcgacgtcgc ctgcaccagc gccgtcagca ggctgacata       360
     gggcggaatg atcaccggca tcgcctgcgg cagggtgatc agcaacagcc ccttgagcgg       420
     gctgaagccg aaggccgcgg cggtctcgcg ctggcccgcg ctgaccgagg tcagccccgc       480
     ccgcaggatc tgcgcgccat tcgccccgcc ccagatcgag atcgccgcac agcaggacca       540
     gaacgggtca aggttgagcc cggtcatcgg cagcatgaaa tacacgagca gcaccgtgac       600
     catcagcggc agatcgcgca gcacttccat cagcgcaaag ccgatctggc gcaggatccg       660
     ggtcttggcc agcaccgccg cgctgatcgc aatggcgcaa agcgtcccgc cgatcgccac       720
     gacgagcgac atcttcagcg tttcgatcag ccccgcgatc aggaagacgc gatattcgta       780
     aatcaggtcc atcggggtca ccgtgccgca taggggcggt tgaggcgttt ttccagccgc       840
     cgcccaagcg ccgaaacacc gaggatcacg accagataga tcacgcagat cgacaggaac       900
     atctcgatcg agcggaaatc ctgcgcgatc cggtccaccg cgacgaaggt cagctcgacc       960
     agcccgatcg cctgcagata ggccgagttc ttgatcgtgc cgacgaccgt gttgagcgtg      1020
     gagggcagcg ccgagcgcag cgcgatcggg atcaccacca aaagcgcatg ctgccagggg      1080
     cgcaggccca gcgaggccga ggcattgcgg atgtcgcggc tgaccgagga caggccggcg      1140
     cggaagcttt cgacatgaaa ggcgctggcc cagaccgtca gcgccagcac gcccgaccag      1200
     aagatcgaca gtttcacgcc aaggctgggc aggccgtaga agatgaagaa gatctgaacc      1260
     agatagggcg tgccgcggat gaactcgaca taggccgcca ccgcccaggc cgcgggccgc      1320
     agccgcgaga cgcgcaacac gcagccgatc gccccgagcg tcagcgaaag gaggatcgcc      1380
     aggccgctga ccagcagcgt catgcccaga cctcgcatca ggtccggccc ggcgttcagg      1440
     atataggccc agtcaagaaa gctcatcgtc ggtccgatgc atgagaagga acgggcgggc      1500
     cggagaagac cccggcccgc agaggatcac agctgcggcg gcgcttcgag gaagccgcgt      1560
     ttcatcacct cggccacggc gggttccttg acgaattcgg ggatcacccg ctcatagaac      1620
     ccgtccttgc gcagttcgtc cagcgcggca tcgacaaagg ccttcagctc gggctcgttc      1680
     ttgcgcaggc cgatgccgtt cacgcccagg tcgagcccct cttccaccac gcgcgtctcg      1740
     ggataattgc ccgccagcgt gtagaccagc ccgccgtcgc cgacaaagcc gtcggcgcgg      1800
     ccctgcttga gcgcctgcac cccgtcggcg gtggtgttca gctgcaagat ctcgatgccg      1860
     gggatgttgg cctcgagcca tttgatctgc gtcgcgccct tgaccacgat gacggtcttg      1920
     cccgacaggt ccgcaagcgt cttcaccggg ctgtcggccg gaacgagcac gttcgagctg      1980
     ccccagaaat agatgtcgga atagtcgatc acgtccatcc gcgccggggt ccggcccagc      2040
     gtcgccagga tgaggtcaag cttgccggaa ttgagcgagg ggatccgcgc ctcggaggtg      2100
     acgcaggaaa gctctgcccc cgcttccgaa ccgaaggcga atgtgccgat cttccgggcc      2160
     atctcgatct cgatgccgag cggcttgccg tcggggcccg aggcgccgaa gggcgggctg      2220
     tcgcatttca cgccgatgcg gatcttgccc gcctccttga tcgccgcggg cagcggcggg      2280
     aagtcctgcg cctgggcggc gccggacagg gccgtcaccc ccgccagcag cagcgcgccg      2340
     agggtcgtgt tgacgttgag catccgatgt acctttccgt tggggttggt cgattggggc      2400
     ctgccggtcc ttctgcggga tcagtgcagg atctggctga ggaacagccg cgtgcgttcc      2460
     tcgcgcggat tgcgaaagaa gtcgtcgggg gcggcgcttt cgacgatggc gccgcggtcc      2520
     atgaagatca cccggtcggc cacctgacgg gcaaagccca tctcgtgggt gacgcagatc      2580
     atcgtcatgc cgtcttcggc cagcgagacc atcgtgtcga gcacctcgcg caccagttcg      2640
     gggtcgagcg cgctggtcgg ttcgtcaaac aggatgatct cgggctgcat gcacagcgac      2700
     cgcgcgatgg cgacgcgctg ttgctgaccg cccgagagct ggctgggata tttgtgcgcc      2760
     tgatcgggga tgcggacccg ctccagatag tgcatcgccc gttcctcggc ctcggcgcgg      2820
     gggatgttgc gcacccagcg cggcgcgacg gtgcaattgt ccaggatgct cagatgcgga      2880
     taaagattga agttctggaa caccatgccg acctgacggc ggacctgatc gacgttgcgg      2940
     cgctggtcgt tcacctcgac cccgttcacg gtgatcgtgc cggactgatg ttcctcaagg      3000
     cggttgatgc agcggatcat cgtcgacttg cccgaccccg aagggccgca gaccacgatc      3060
     ttttcgcccg gtgcgaccga gaagctcacg tcgcgcagga catgcatccg gccataccac      3120
     ttgttgacct tgtcaaaggt gatcccgaga gcccgcgtca ttggcaatgc catctccctg      3180
     cagccggttg cgtcagcttg tgccaacttg tctgacaagt attaacttga tgcgggcgcc      3240
     gcctgtcaac agaaaataca tctacggatc atattcacct ataagcccgt atttgcgttg      3300
     ttttatcagg tggacttgtg caaatcacgc ctgtatcttg tcagacatca tggacggccg      3360
     gggcgcaaaa cgcgaccggc ccggcattga aaggacaaga tgatgccccg gaacgcgccc      3420
     ccgctgcccc gaatcgccgt catcgcgggc ggcggcacgc tgaccgcgct ggcgctggat      3480
     cccttcgaga tctgcgatta cggacaggcg ggcagtcttg acgcgcaggc gctgatcgcg      3540
     cgctgcggcc caatgcagac gcgcttcgcg ctgcatcccg tccccttcac gccgctgccc      3600
     agcttcgaca tgggcccgcc gcaatggcag gagatccgga ggctctgcac ggcaatgctg      3660
     caggctgtgc ccgatctgtc gggtttcgtg ctgacccatg gcaccggctc gctcgaggag      3720
     acggcgttct tcctgtcctg cacctgggat ctgccggtgc cgctggtgct gaccggggct      3780
     cagcgcccgg cctcggcgct cggcagcgac ggctacatga atttctttca ggccgcctgt      3840
     gtcgcggcct gccccgaggc gggggcgcat ggcgtgctgg tcgtcaccca tggcgagatc      3900
     cacctgcccg ccgaggtgac gaagacgctg aacttcgggc tcgacacgtt ccgcgcgccg      3960
     gtgctgggac cggtggggtt ggtgacgggc gagaccgtgc gttttcatcg tgccccggcc      4020
     gcggcgcggc ggatctggcg cgttccggcc gatccctccg cgctgccgcg ggtcgacatc      4080
     gtgctgtgcc acaccggcgg ggatgcggtg gcgatcgagg ctttccttgc ggcgggggcg      4140
     cgcgggatcg tcgttgcggg ctttgccccg ggctatgcca ccggcgtgca ggcgcgcagg      4200
     ctggagcgct ggatcaagga ggagggcggc cttgtcgtca tcgcctcacg cgcgcagggg      4260
     atggtgatgc ccaacagccg caacgacggg catggcttcc tccccgccgg tcttctgagc      4320
     ccgcaaaagg cgcggatcat gctgcaattg gcgctggcct gcgggatgaa accgccgcag      4380
     attgccgatg tgttcaggtg agccggaaca ggagtgacga gatggaaaag cctcgggaaa      4440
     gcaacatcga gcgcctgcgc accgcgcttt tggagatgat ccgtgagttg aacctgtccc      4500
     tcggcgacag gctgcccacc gaaaaggaga tggccgagcg gttccaggtg tcgcgcccga      4560
     cgctgcgcga ggcgctgaag cttctggaac aggaagcggt gatcgacgtg catcagggca      4620
     aggggcggtt tctggcggcg ggggccagcc tgagcatcgc gcggccgatc accaaattcg      4680
     aaagcgtctc gcagatggtg gccagccatg gctacaaggc gcagacccgg gttctgggct      4740
     ttgccaccgt gcccgccccg cccgagatcg ccgccaagct tgatctggcc gagggggcgg      4800
     cggccttgcg catcgaacgg ctgcgcagca gcggcgggca accgctgatc tattcgatcg      4860
     actggctgcc gcgcgatctg atcgtgacgg acggcgaaac cgccccggac tggagcggct      4920
     cgatcgtcgg gctgctggcg aagctcgacc gcaacccggt ggcctcgacc gcgaatgtca      4980
     tggcgacgct gctgccgccc gaggtcgccg cgatgcatgg gctcgaggct ttcggcccgg      5040
     cgctgctgat cgaggagatc tgctatgccg ccgatggcag ccgggtgatc tatgcgctgg      5100
     attatcaccg cggctcggcc ttttccttca gcttcgtgcg gaaatagccc gcttgcccgg      5160
     gacgggggct catgcccccc cgtccgccgc gccgatcaca tcggcgtatt tgtccagcag      5220
     ccagaccggg atcgggatga gcggctgcgg aaaaccgccc tcgtgctgac aggtttccgc      5280
     cgcggccaga gtggccagct gcaaggcctc cggccccggg cggtgcgcgc cgatcagcgc      5340
     ggccagaaag gtcgcgatga aactgtcgcc cgccccgcag gtgtcgcgca ccgcgatctt      5400
     gcgcgccgcg acgctgcaga ccgtgccgcc gtcgtcgaaa aaggcgccgc ggctgccgca      5460
     ggtcaccacc gtgcgccgcg cgccccgggc gcgaaaggcc gcaaggaccg gctcgatcgg      5520
     ctcggccgga tcctcggggc ccgaggcgaa gacgaggggc acgcccgcaa gcggcagatc      5580
     cgcatggcgg gtggagacat cgatgctgaa ccccaccccc gcctccagca gccagcgcag      5640
     cagccccgga tcggcattgg tgcccagatg cacccagcgt gccgcttgca gcgcggcctg      5700
     atgcgccgcg tcgggccgcc agccatcgcc gacgcccaga tcttcgagca ggaagcgccg      5760
     gtcgccatga tgatcgcgga tcagcgtcac cgcggtattg cccgggcgcc gttcgacatc      5820
     ggccggatca agcccgaccc cggccagcgc gtcgaggatc accgcgccct cggcatcggg      5880
     gccgaccacg cccagatacc gcgccgcaag ccccttgcgc cgccattgcg ccgcgacgtt      5940
     cagcgcattg ccgcccacgg ccatgtgccc cttggtcaga tagacatcaa ggcagttgtc      6000
     gcccacggcg atcagatcgg agacgacagt catgcaaggg cctttccggg agcgagatgg      6060
     gccgcgatgg cctgcatgtt gtgccgccac gcgcgcatcg gatcgagcgc atagctgcca      6120
     tcgccaaagg gttcgaagga cagcgcaccg cgatagcccg cctgcgccag atcctgcaga      6180
     tattgcgcca gcggcagcac cccctcgccc cagatcagat ggcccgaggg ggtgccgtcg      6240
     accagatgca catgcgccag ccggtcgccg aacagccgca cataatcggc cacgctgtcg      6300
     ccggcacagg ccatcgccac cgtatcaagc accacatcca tcgtttcggc atccaccatg      6360
     tcaagcagaa ggcgcaggtc ggcggcgctg tgggcgatgt tgctttcgcg ccgttgcagc      6420
     ggttcgagca ggcagcgcag cccgcggtcg gcggcatggg cggcaatgat ccgcagcgcc      6480
     tcggccgagc ggtcccaggc ccggctggcg ggttcggatt caaagcctcg cccgggggtc      6540
     aggaacagat gacgcgcccc cagatccgcc gcgatctcgg ccgcgcggca gaaccgcgcg      6600
     atgctggcct gccgataggc ctcgtcgccc gaggcgatgt tgatcgggta aagcacctgt      6660
     tcgggcgtca ggcagcgcag cttcaacccg gtttcctcca acacccgccg caccccgtcg      6720
     atccgcgcgg catcggcgtg aaacagatca agatgcggcg cgatgcccca aagctcgatt      6780
     tcggtcatgc caaagccctg catggcgcgg gccacatcgg caaggggcca gtgctgaaag      6840
     ctgaaattcg cgccaatcag ctgatcggtc gacaggcgcg ggggaggggt cgtcatctgc      6900
     atctctttcg gtctgggcgc agcgggggtg ccgccgcaac cggaaccgga acggcgccga      6960
     tcccggatgt cttgggaaag gatcggtcga ctgcatgaga gaccgatctc acatcgatgt      7020
     aacgcatggc cgccccggtc tggcaagagg tttttgcgcc atttctcagc aggcggaatc      7080
     cgtcgcggcc gcaccgcctc cgggcggcgc caccgatccg cgccggatca gccgggtggg      7140
     aagctgaaca tggcgcggcg gctcggtgct gccgcgcatg cgctcaagca gcatccggac      7200
     cgccagcgga ccgatctgcg cgaccggctg cgcgacaacc gtgatctgcg gctcggtgaa      7260
     ggtcgccaga tcgaaatcgt caaaccccac cagcgagaca tcgcgcggca ccgacagacc      7320
     aagcgcgcgc aggcccaaaa gcgccccctt ggtcatcagg ctgtcgaggg tgaacagcgc      7380
     ggtgggcgga tcgggttggc ggaagagccg gatcgttgcc tcggtcgcct gcgcgacagt      7440
     ggattgcgcc accgcgatca gccgcgcatc aagcgcgatc ccgtgatcgg ccagcgcccc      7500
     cgcatagccc gccagtcggt cccgcgcggt cacgatccgc tgatcgtcgt ggatcaccgc      7560
     cacccgacga tgtccggccg cgatcaggca gccgaccgcc gcccgcgcgc cgcccgcatt      7620
     gtcgaccgag acacagtcgc aaggcagacc ctccaccgcg cggtcgatca gcaccagcgg      7680
     cacgccctcg tgcaagagcg cctccagatg cgggcgggtc ggacttgcgg cgggggcgac      7740
     gatcaccccc cgcacgttca gcgcgcggaa gctttcgatc aggtcgcgct cctgcgcgac      7800
     gctttcggcg ctgctggcga tcagcaggct ttgacggctc tggcgcagct gcgcgtcgat      7860
     gtcatgggcg atctgcgcga agaaggggtt ttgaatgtcc ccgggcacga agcccacaag      7920
     cggcaattgc ccgccccgca gcgcctgggc gacgcggttg ccgcgatagc ccagctgggc      7980
     cgcgatttcg atcacccgct cggccgtcgc ggcgccgaca tagccatagc cgttgagcgc      8040
     ccgcgccgcc gccgcccgcg acacgtttgc ggcagcggcg atatccttga gcgtcacggt      8100
     ttttctgggg gccattgccg cctcttccgg tggagcgaaa ctgccgggca gccgcgtctt      8160
     cagctaacag ggccgcggcg gaactttcaa gcgcagaggc cgacagtccc ggcgccgcga      8220
     ggaggtgctg ccgggcatgg gtgtggtcct ttcaggcaaa gaaaaacccc gccggaaggg      8280
     tggggcacag ggcggtctgg gtggggttca acctgcaatg aatgggtcag gcggcgggtt      8340
     ttgcgcctct cgggcggcgg ccagttcggc ggcgaaaagc gcgcagcgtt ccgaaaggat      8400
     cgcgatctgc tggcgcagtt cggcgatgta ggcggccgat gcggcggggg acatggaggc      8460
     tcctttcagg gtcagaagtc ggtctcgcgg gaatgcgccc tgtcagcctg cggcgcggcg      8520
     cagaaacgcg acgatccggg cgggaacttc gggggccaat gtctgcggga tgcgggcgta      8580
     attttgcgga tcgccggtcg gatctgcttg gaacaaatgg ttcagacccg ccatgacgtc      8640
     gacctgcatc ccagctgtcc gggccagatc gcgcagggcg gcggcgttct cggtcgcatc      8700
     gacctgggtg tcgctgccgc cgtaaagcgc cagaaccgga ccgtcaaacg ccccgatcag      8760
     ggccagcgga tcggggcggg cggcatcaaa cccccaaggc gtggccagaa cggcggcata      8820
     ggtcctgcgc acctcgggcg gcaacggggc cagcgcggcc gtgagccggg ggcgggccgc      8880
     ggcaaggtcg ggcgccgcgc gcagggcggc aaagctggcc gcaagcgcct catcaagcgc      8940
     cgcgatccgg tccgcggggg cgccttgcag cgcggcgatg gcgcgggtct gatggcgcag      9000
     cacctgttcc atcggcactg cgggaccggc cagaagcacc aaagccgcca ccttgcgccc      9060
     gcgcgcggca aggggcgcgg tcagcccgcc ttcggaatgg ccaaggatcg cgatgcgcgc      9120
     cgggtcgatc tcgggccttg cagcaagggc gtcgaaggcc gccccggcgt cacgggcgaa      9180
     atccgaaatc gtggcggtgg cgaaatcgcc ggcgcttccg cccaccccgc gtttgtcata      9240
     acgcaggctg gcaatccccg cccgggccag cgcatctgac agcacgagga agggccgatg      9300
     ccccgccaca tgctcgtcgc ggtcctgcgg ccccgagccc gccagcaaca gcacggcggg      9360
     aaagggaccg gggcctgcgg gcagcaccag gtcacccgcc agcacgcctg caggtccagc      9420
     gatgtgcagg ctgcgatgcg gatcggggcg gaagcgggga tcttgcggcc gcaggcaggc      9480
     catcagcggc aagacgccca gaaggacaag aaaggaacga cgggtcatga aagcctccgg      9540
     ggttttgccc ggatctctca gccttgcgcg ccctttgcga ccgggccgat ggggccggac      9600
     gcccgccagg cactgggcgt catgcccgtg cgcttgagaa acgccgcatt gaaggtggat      9660
     ttggcgttga accctgtggc atgggcgatg tcgagcacgg tgtgatcggt cgcgcgcaac      9720
     agcgcctgtg cctcgctcac ccgccagccg ttgacgtagt cgtaaaagct ttcggcccgc      9780
     ccctgattga gcgcctgact gacgtagaag ggcttcgccc gggcggcctc ggccagatcg      9840
     gccagcgaga ggcccggggc acgccacagg ctgtcgcgcc gcatcgccgc gtcgatccgg      9900
     gtcaaaagct gcgccatcgc ctcgggatca agccccgaac gggcgtagct tggcggcgcc      9960
     gcaggaacct cggtggcggc gatcaccgca tcggcccagt cgggccagtg catcttcaag     10020
     gtcagcccgt gcagcgccgt cccaaggatc agcgcgaaca ggaacaggtc cgagagcggc     10080
     ccgatcagca cccgcccgag cgacagaagg tccagaagct ggatcgcgaa cagcgcgaca     10140
     agacaggcgc ccagcagggc aacaccgctg agccggggcg tgggcggcgc ggcgatgatc     10200
     tgcgccaacg ccttggcgtg acggcgcagc gcgcgcagga tgccgatccc ggccagagcc     10260
     gttccaaggc aaagggcgag ccagtaaagc ccgaccccgg ccagagccgc cagcagccag     10320
     cccggtgcaa gcgtcggcac ctgtcccgcc tcgatcgcgg cgcgggccgc ggcgggcaac     10380
     agaaggaaag gcagacacag acctccgctt gccgccagcg cggcctcgat ccgtggccag     10440
     cgtgcaggcc ccgccaagct gcggacgtgt tgggcaagga ggatcggcaa cagcggcaga     10500
     accagcacct gccaatcctc ccaggggccg ccgtcaagcc ccagaaacac cgccagcccc     10560
     agcgcaaaaa gcgcaagaca tcccacagcc ggggtcagcc gcgcatctgc gccacgcccc     10620
     cgcaaccaga tagccagcgc agccatcgcc gccattcccg cgaaaattcc cgccatccgt     10680
     tcccccgcgc caaggcagaa tgcggggaag tcggaccggg tgcaagcgcg gcccggcgtc     10740
     cggccccttt ggatcggtcg ccctgcgcgc cggatccgcc gaagatcgcg gcacatccag     10800
     cccggaggtc ccatgacagc cctttttcgc gcccccctgc ttcacgcagc gcttcttgtg     10860
     ccgctgcttt tcgcctgtgc cccgcccggg cccgaagtca cccatgccaa aggcccgacg     10920
     gtgatcttcg aagcgggcct tggcgatact gccaccgtct gggaccgcgt cgacatgccc     10980
     cccggccttg ggcgatttgc ctggacacgg gcgggatatg ggctcggcgc cgatctggtc     11040
     gccggtcaat cctggccagg cgatgccgat ggccgccgca ccggggccga ggtgacagcc     11100
     cagctggagg cggccctgac ccgggtgcag gcaaggccgc cctatatcct tgtcggccat     11160
     tcgctcggcg cgctttacgt gcttgatttc gcccgcagcc atcccgatca ggtcaagggc     11220
     atcgtccttg tcgatccgcg cctgccgggg ttcaccgcgc gctgcaaggc cgagcagctg     11280
     cgcggctgcg aaatcccgcc gctgttgcgc ctgacgctta cgaatgtcga gcggctcgag     11340
     ttgggcgggg ttcccgagac cgagacggcg ctgcgcgacc ttggcgccct gcgcgacatt     11400
     ccgctgacga tccttttggc cgaaaaggca ggtcttggcg aggatccgcg ctggcgcggg     11460
     gtctgggccg cgcatgccga ggcttttgcc tcggatttcc gccagaccag tgtgatcccg     11520
     gttgcaagcg gccattacat ccagacctct gcccccgagc aagtcacggc cgccatcgcg     11580
     gcggttggaa gatagcatcg ccggaccgga agcgcggagt gatattcgtc cggacttcgg     11640
     ccgctgaatg gtacaggtga caggctgttt ggtgaggagc cgggcgatgg gaggcaaccg     11700
     cagtcaaagt cgaaattgaa tcccgatctg cccgcaaggc gagttataaa agcgggttct     11760
     caccatggaa aaatgactgc tttgcggaag agggcattgg caaatgcctg agctactccc     11820
     cgatccttgg acaggtttcc gggtgattta agctacaggc ccccgaaatc cgcaccacca     11880
     aaggcgcggg caccaagatc accaacttca gcctcgccac ctcgcgcccc cgcctctcgg     11940
     aaggtcgcgt cctgcgcgac gagaatggct accggatcat ggacacggaa tggcaccgca     12000
     tcacctgctt caacggtctc ggcaagacgg tcgcggagca ttgcgaaaag ggcatgaagg     12060
     tcctcgtcca cggccgcatc cactacatca agtggaccga cagcatgggg aacgaccgct     12120
     acagctgcga gatcatcgcc gagaaggtcg acttgcctca agccgcccga aagcggccga     12180
     gaacgaaaac cccgagttca tcgatcgcga cgacgagatc ccgttctgag aacggggtct     12240
     ccccctcggg cccggcgggg aaacccgccg ggttcgcggc attagttttt tagttgccaa     12300
     ttcactgctc cgggtggaag gcgacgagga catcgccatt caagagcagc tttcgtcctg     12360
     gaaaggactc gaagaaggca agcatggcct ctcgggcctg cacggtatgg tctttcgagt     12420
     gtcgtgtgaa acattcgctc ttgaagccct ctccaacacc atactcggcc atgatttcca     12480
     gatggaacgg ccccaggtcg tcacttgcgc tccaagcctc ccagacgtca ccggcactcc     12540
     tcgctgctgc gtccagtcgc tgcatgaggt caggtaggtc tagatcggaa taggcgttgt     12600
     aaaatatcgc catcgaaatc accgtatgat gccgtcccag accttggttt ttctttatcc     12660
     ggtgggaaca ccggtcaccc cttggacggt ggcacctctg cccacaccag gtattggtat     12720
     tccccgccct cgctcgacgc gcggcgcacg atgtcgcgga tattcgcggc agatcgctgt     12780
     ggatcgagaa atatctgcca ttcttcctcg tagcccgggc ccgcgtttgc caggaaatcg     12840
     tactcgaagg tgcgcccggt tcgactgccg ccctgaactc tgacgacctc cagtcgcgca     12900
     acgctgtagc cccgggatgc catatattcg ttgaactcga gcattacgct cgacggctca     12960
     acatacacga atttgccagc ttcgagttgc tccagcatct tttcaaactc gtcgcgcatg     13020
     ttcactccaa tggcctgatg atcgggtctg gttcattttc cgtttcccaa agggggcggt     13080
     tccgattgct tacagcgacg acgcgcccct ccgggctcaa aagaacccaa tacccatcct     13140
     gaccggtcaa caaggtcatc tcctggccct tgtatcgacc acgtccggcg acgattccgc     13200
     taagatcggg ccggggattg gcgatgattt catcgatttg cccggcagtg tgcccttttc     13260
     ctgtgacgta ttccagcccg tcgcccttgc cgccgtggtc gtcaatcgta ttcccgccag     13320
     gggtggtgaa cgcctcatcc cgacgtgcct cgacaatgtt cggccccgct tcatccggga     13380
     tcggcgtgga gatgatgtta ccgtcaggat cctcgacggg cagcgaaccc gtgtggttcg     13440
     gcagaccaag ggtctcggcc ggataggttt ccagccactg gtcgatgcgt tccggcgtga     13500
     agccgggaag ttcacccaac cggcgctcgc cgccagtgag ttccgggaaa accttgaccc     13560
     aaccttgggc aattgtgccg tgctgccgcc gcaaccggct ttccgcgaat gcgttgtagg     13620
     cttgctgcac gaagtctccg agggcaagtt gggcggcagg atccccttcg acgatcctcg     13680
     aggcccggga catccttggc cgatacctca gccagaaccc ggtcatcggc agctggcaag     13740
     cgctgctcga ctattgcgcg ctcacccgcc cacaccgttt cccagaccgc ccatgcgctc     13800
     gaagagctgc agctctacgg ctaccgcccc ttcgacgaac ccgatccgcg cccgatgccc     13860
     gatgcgcagc gccttgcggt tgccgtcgcc gacatcttcg acgccctcgt cgccactctc     13920
     gaggacaccc gcatggaacc cgacctcgaa gaggtgctct ggggccaggt caacctcttc     13980
     caccgcgcca ccgcccggat cgagcggtcg cttgacgaga acgagcaggc gcagcgccgc     14040
     cttcagcgcg agcaagacgg ctccgaggtg aagtcgaccg aactcgagcg cctgacggcg     14100
     gaaggcctga cccccatcga gcggcgcaac tgcatggaca tgatgcgcga tcacgccgcg     14160
     accgaattct ctcatcacac gggatcgacc tggcggcccc gccccggctc gatggtgaac     14220
     cgccggcaca tgaccgcagc gctgatcgac agccgcgatt tcctggccgc caagcgccgc     14280
     gcggaaaccg aggtgatgct gcccgtgggc cccaaggttg ccctcaccgg cgggaccgat     14340
     ttcaacgatc accacctgat ctggggcaag ctcgatcagg tccggaccaa gcatcccgac     14400
     atggtgcttc tgcacggggg cagccccgcc gcggcctgca gcgcctcttc atgcgggggg     14460
     gcggtgccaa gcccggcatt ggcgcggccg tcggtcatca cgatgaccag cggcaggaca     14520
     ttcgggtccc tgcgctgaac ctgacgcagc acattggccg cttcgccaag cccctgggtc     14580
     agcggcgtgc ggccgcccac ctcgagctcg gccagcagcc gtgccgcgcg atcgaccgag     14640
     ccggtcggcg gcagcaccac ttcggcgctg cggtgccgaa acaccaccat cgccaccttg     14700
     tcgcgctttt gatatccgca ttcggccggg ctggaacaga tcgacctgat cctgaccgat     14760
     ccctacctgc gccccgaaga cccgcgcctg ctgatcgaac gtcccttcga gatgcccgaa     14820
     acctgggtca gcctgtcgcg gatgtttgcg ccccatgaga ttgccgaacg cacgccgcag     14880
     tctcgcaagg ggcatctgac ctttggcact gcgaacaacc cctataaata cacgcccgcc     14940
     tgtctggatg cctgggctgc ggtgctgcgc actgtcctcg gatcgcgctt cgttttcctg     15000
     cgccccgaag gcggcgtcga gagtttccgc gccaatgccc gcgcggcatt cgcgcgccgc     15060
     gatgtcgacc ccgaccggct tgatttcatc ggcgtgcgtg gcgatcacat gcgccattac     15120
     aacgagatcg acattgccct tgataccctg ccgcatgtcg gtggcacgac gacctgcgag     15180
     gcgctctgga tgggggtgcc gactgtcagc ctgatcggcc cgggctttgc cgaacggctg     15240
     agctgttcga acctgtcgaa tgcggggctt ggcgatctgg ccgtgcgctc ggtcgccgat     15300
     tatgtcgcca aggcggcgga actggctgcc gatccggcgc gccgtgcggc gctgcgggcc     15360
     ggtgcgcggg cgcagatcgc ggccaatccg cttggccagc ccgcgcggtt cacgaagaac     15420
     ttctatgacc ttgcgcgaaa ggtggccagc caatgaaagc cgtgatcctt gcggggggac     15480
     gtggaacgcg gctttccgaa gaaaccgggc ggcggccgaa accgatggtg gacatcggcg     15540
     ggcagccgat cctgtggcac atcctgaaga tctatgccgc gcatggggtg aacgagttcg     15600
     tgctctgcct tggctatcgc ggctggcaga tcaaggacta cttcctgaac tccgcgcggc     15660
     tctcgtcgga tctgacggtc gatctcgcct cgggcgtcgt cgagatgctg cgcccggcgt     15720
     ccgagccgtg gaagatccat ctgatcgaca ctggcgaaga cacccagacc ggcgggcggc     15780
     tgaaacgggt ggggcatctt ctgcgtgacg acgatgcctt ttgcctgacc tatggcgacg     15840
     gtctcggcga tgtccatatc accgccgcga tcgcttttca ccgcgcccat ggcaaggctg     15900
     cgaccgtgac ggcggtagtg ccgccgggcc gcttcggcgc gctcgaccgg caaggcgacc     15960
     gggtttcggc ctttgtcgaa aagcccgcag gcgatggcgg cacgatcaac ggcggctttt     16020
     tcgtgctgtc gccgtcggta cttgaccgga tcgaaggcga tgcgacggtc tttgaacagg     16080
     agctgctcaa gggccttgcg cgcgatggcg aattgcgcgc ctttgaccat cgcggtttct     16140
     ggcaaccgat ggacacgctg cgcgaccgcg accatctgca ggcactttgg gacggggggg     16200
     cggcaccgtg gaagatctgg taaggcggcc tgatccgggg gtctgggccg ggaagcgggt     16260
     gctgttgacc ggccacaccg gcttcaaggg cgcttgggcc gcacggatgc tgaccctgct     16320
     gggtgcagag gtgacggggc tggcgctcga cccggcgccc gggccttcgg cctttgcggc     16380
     gctggcggtc gggcagtgct ggccgaactg gtcgcgcgcg gcattcccgt tcacgcgacc     16440
     gcccgttccc ccggctccgc gcaacccggc gtgatctggc acacggccga tctgcgcgag     16500
     ggcgccgagc gcgcccgcct gctggcgggg tccccggcca agcagcttct gcattgcgcc     16560
     tgggagatcg agcacggcgc gttctggacc gcgcccgcga atgatctgtg gcgcagggtg     16620
     tcctgcgatc tggcgcgcga gtttcttgcg gcgggcggag agcgggtgct cgcgctggga     16680
     acctgtgccg aatacgatcc gctcgcgccc agtgcgctgg ccgcggtccg tcttgtcgcg     16740
     ccgatcacgc cttatggtca ggcaaaagca tccttgcatg aggagcttgg ccggatctgc     16800
     gggccgaggc tgatctgggc gcggctcttt cacctttacg gtcccggcga agaccgccgc     16860
     cgcttggtcc cttcgctcat cgacgcggct cgcgaaggcc gcccggccga ggtgcgcgcc     16920
     gcgggtctga tccgcgattt cgcctccagc gcgcatgtcg cccgcgccct tgtcgggctg     16980
     atggacagcg gcgcaaccgg ggcattcgac ataggatcgg ggcagtcccg cagcctgggc     17040
     gcgctggcac ggatcatcgc cgaggcggcg ggcaggcccg acctcttgag gttgtcgcat     17100
     acgcccggcc cgcaggatcc ggcggaactc accccgcact ttgccgctct ggccgccgtg     17160
     agcggtttga aaccggagca cccgttgcaa gccctgaccg aacatgtccg ccgcgaaatc     17220
     ggcgcggctt gatcaagggc agcttagaca ccttcgaacg gcggctttca cggtttggtg     17280
     cgccgccgac tcggcaccat tacaggcgtc agcccaccgt catacctgcg cgaagccttc     17340
     cgccgcgccc cgcacgagcg gctgctcggc cccgttgccg cggttcgctc gaagggccgg     17400
     ttcgaagcat ggcggtcaat gatgcgaccg tcggctgagg gccgggacgc gcgatactgt     17460
     atcgtgtcgc agctctactg ggggacggcg ctgcccgacg cctgccagag ccgcgacgcg     17520
     atcacccggc ggggacgatg accaagctca agtggcgatt tcggccccct gtcgggcgag     17580
     tttcgcgaca tcgcggctca gcgcaagatc ccctgcctcc agcgcatgga gcgggaacca     17640
     gcgggcttcc agagcatcat ccccggccac cggctcgccg gaaacccagg aacagaggac     17700
     ggccaccagg acatgatgat ggcgcagggc tccggcctcg tcccggtcga aagcatcgag     17760
     cgcggtgaag acccgctcgg cccgcgcttc gatgccggtt tcttcgaaaa gctcgcgaag     17820
     cgctgccttt tcaaggggtt ccccaagctc caccttgccg ccgggaaagc cccatgtgcc     17880
     ggcatccggc ggatttgcgc ggcgcacgag cagcacatgg ccgtccctga aaaccgttgc     17940
     gatcgtcgcg acgatcgggc gggccgccgc ttgcgccgac gaaaggctgg tcttgtccgc     18000
     tgacatgcaa accctctggc aaagactggt ccgaacctgc cccgacggaa aagggccgct     18060
     ggcatagagg cgcaagcggt caggaatgac aaggggggca ccgcggcggt catgcccccg     18120
     cgcgctgccg cgccagggcg aggaaggccg tgaacccggc cgaagcattg cgccgcccgg     18180
     ggtaataaag gctgaagccg gggcggttcg gcgtccaatc cgccagcagc cgcaccatcc     18240
     gcccggcggc gatgtcctcg gccacatccg cttcgatgaa atagccgatg cctgcgccgt     18300
     cgagcaccgc ggcgcgggcg atggcggggt catccaccgt cagccgaccc cgggcctcga     18360
     agggcagcgc ccggccgtcc ttttcgaacg gccagcgcag cagcgcacca ttgggcagac     18420
     gcacgcgcag gcaatggtcg gggtccagat cggcgggcga gagcggggag ggatgccgcg     18480
     ccagccagcc gggcgccgcc accacggcat ggcgcgcggg ggcgcccagc ggcagcgcga     18540
     tcatgtcgcg cggcaccaga tcggcggggc ggatgcccag atcgaagccc tcggcgacga     18600
     tatcgaccag ccgcccctcg gtcaccagat cgacctgcat ctgcgggtgg ctgttcagga     18660
     actccagcac caggggcgcc acggcccgcc cgccctgcgc cgaagcattg atccgcagcc     18720
     gccccgaggg ggtgtcgcgc tgcgcccgga ccctctccat cgcggcgcgg atctcggcca     18780
     gcgcgggggc agtgcgggcg gcgaaatcgc gcccggcctc ggtcagcgac acgctgcggg     18840
     tggtgcggtt gaacagccgc acgcccagat ttgcctccag ccgcgcgatg gtctgcgaca     18900
     gcgccgtggt ggacagcccc agatccagcg ccgccgcgcg gaacgaccca cgccgcgcga     18960
     tcgcctgcac cgcctccagc gccttgagcc cggcctccat gattgtcccg attctgtcat     19020
     cagcagatgc tggattatcc cgattatcgg gcggcgcgtc gaggcttatg ctgcggtcag     19080
     acagcacagg agcccccgat gatccccctt cccgccccga tccggaccta tttcaccgcg     19140
     caggcaccgc aggaggccgc ggcctttgcg gcggcctttg cccccgaggc caccgtcgag     19200
     gacgagggcg cccgccatca cggccccgag gcgatccggc agtggtggct ggccaccaag     19260
     gcgaaatacc gccacagcgc cgaaccgctg gagatcaccg aggagggcga caagaccgtg     19320
     gtccgcgccc gtgtcagcgg cgattttccg ggcaacccgg tggtcttgcg cttccgcttc     19380
     ggcctgacgg gggagcgcat ccgcgatctg aggatcggcg gatgaccggc tttcttaacc     19440
     tgcggggcaa acgcgccctg atcaccggcg gcacccaggg cgcaggcgcg gccaccgtgg     19500
     cgctgtttcg cgatcttggc gcgcaggtgc tgaccactgc ccgcaaccga cccgagaccc     19560
     tgccggaggc gatgttcgtc gccgccgacc tgagcacggt tcagggctgc gagagggtcg     19620
     ccagggcggt gcaggaccgc atgggcgggg tggatgttct ggtccacatg ctgggcgggt     19680
     ccaccgcgcc gggcggcggc tttgccgccc tgggcgaggc cgaatggcag gccgagctga     19740
     acctgaacct gatgcccgcg gtgcggcttg accgcgcgct tctgcccggc atggtggcgc     19800
     agcgggcggg ggtggtggtg catgtcacct cgatccagcg gctgatgccg ctgcccgccg     19860
     ccaccaccgc ctatgccgcc gccaaggccg cgctgtcggt ctacagcaag agcctgtcga     19920
     aggaggtggc gcccgcgggg ctgcgcgtgc tgcgcgtggc gccgggctgg attgccaccg     19980
     cggcgtcgat ccggctggcc gggcggctgg cggaggccgc gggcaccgac cttgagggcg     20040
     gcaagcggat gatcatggac agcctcggcg gcatcccgct gggccgcccc tcgaccccgg     20100
     aggagattgc aagcctgatc gccttcctcg cctcggaccg cgccagcagc atcaccggga     20160
     cggaacatgt gatcgacggg ggcacggtgc cgacggcctg agagctggcg gccccgtgcg     20220
     acgcttcgtg tcgaagacgc cacgggcaaa ggccgcatca cgcctgacaa accgaaaggg     20280
     ggcgacgtta cgccgccaga tcatccaagc tcacgccaag cgcgtcggcc agagcgcgca     20340
     atgttgcgat cgagccctgc tttcggccgg tctcgatctc ggccacggtg acccgattca     20400
     cgcccgattt ttccgccagc gcagcttgcg tcagaccgcg cagatcgcgg tagacgcgca     20460
     aggcgctttc gccattcaga aggcggttcg catagtccgc cgggatcaac tcgtcctctc     20520
     ccgccgcaag ccgcgccttg gcgcggtcat agctttgcag gtcggccaga tcctccgcgg     20580
     cagcaagcag gcggtcatat tcttcgcgcg ggatcgtcac catctcggtc atctcaagcc     20640
     ctttccgtcg cagacgccgc cgcgcggccc gatatcgaga aggaccagaa cattgccctg     20700
     atcatccatg atcacccgcg ggtcccccac cctgagccga ataccctccc ggcctttcaa     20760
     gggcttcacg ttattggcct gcgcgcttgg gtcttgcgcg taagcttcga tcttggcgcg     20820
     gatcagcgca gcggtcgtcg agggcatccg ccgcaaggcc ttgatcgcgg ctttcgtggt     20880
     gctgatctgc ttcatgatgt agctttgggc gacatttcgg ccaaagtcaa gcataatgtc     20940
     gccctgcgcg acatgcctgg ccgacaggcg ccggccaggc aaaggtcata gatcaatccc     21000
     ttccgacagc gtcagcgcat cctccagatc gacccccaga tatcgaactg tgctgtccat     21060
     cttgggtcgt ggcccagaag cagctgcacg gcgcgaagat ttccggtctt cttggtgatc     21120
     tgcgcaactt tcgtgcgccg catcgaatgc gtgccatagg cactgggctc gagcccgatc     21180
     gaaagaaccc agtcgcgcag ggtccgggca tattggcgcg tcgagaggtg cgggctggcg     21240
     tgaacgcggc tgggccagag atagtcgttg ccgatcatct cgggatcctt gatccaccgt     21300
     tcaagagcca ggcgcgtgat ctcggtgatc tcgaagcgga cgggttttcg ggttttgctc     21360
     tgggtcaccg aggcacgttc cttgacgtga ccggcggcat agatgtcatt caccctgagg     21420
     ccgaccagat cgcagcccct gagtttgcta tcgacggtcc tgttgaacag ggcgaggtcg     21480
     cgccgattgt cggccatttc caatcgcaag cagatggacc agacgtgttt tggctgcagc     21540
     ggaagctttt ggccgacgat gcggcccttg ttccacggcg cgtgggtcgg gcgaagagcg     21600
     ggcaaggttt caatggccat gacggtactc ccctccacca cgcccgccac atcctcggct     21660
     ccgccgatcc ggaagtgtag caccgatcca tccgtcgttt cgatcgatcg agtgggcggg     21720
     gagcggcttg tgagggcgcg gcatcgtccc gcggcaatcg gcgatagcgg ccgttcgcga     21780
     ggtggctcgg ggaacggcgc actgcgcaga gaacaggcat ggcgcgcggg acggcacgct     21840
     tggcgcggct gacgtggggc gcctcaaagc tgcctttcaa ctgcgatccg gcattggccc     21900
     gcacctcagt tccgaacctc ggcgagggtc ttttccacgg ccttcccgag aatgcgtatc     21960
     agcgtcttgc agcctcccga gtctgcggct gagggtgttc gagccggttt ttccacgcga     22020
     cgggcatcgg gcggcaccgg catgggcctt gcggtcgtgc gcaacctgct gtccgcccat     22080
     cgcggcggga tcagccttgc gacctcccgc ccgacccgct ttcgcatcac ctttgacgcc     22140
     gatccgcgca tctgacccca cactgcgcag ggccgggctt ttgctccgcc ccgccccgtg     22200
     ccagactggc gcctcagaca ctcagccgag gccaagatgt tcatcgccca cctgcctgcc     22260
     ggctatcttc tgtcgcgcca gatcgccaag tcccatcctg ccaaaggcgc cttgatcgcg     22320
     accgggcttc tggcctcggt cctgcctgat accgatctct tctggttcta tctggtatcg     22380
     gaccgccaga gcgtgcatca cggctatatg ttccactggc cgctgttttg ggggcttatc     22440
     gcagcccttt cctgggggct ttcccgcgcg ctgggagcac acggcgccgg ttccttcatc     22500
     cttgtggcgc tggccaacct gttgctgcat ctggcgctgg attccgtcgc ggccggggtg     22560
     ggctggttgc gccccctttc gaccatcgag gtcaacctgg tcgaagtgcc cgcacgtcac     22620
     aactggtggg tctggaactt cgtgctgcac tggaccttcg gccttgaact tgcgatcatc     22680
     ttggcggcgg ggctgacgct gcgtcgggat ctcctccgca ggcgccccgc aaccccatga     22740
     tcgcgttctg acctgacgca gcccgacccc ggccgaggga aggatgacct cgcgaggcgg     22800
     ccgatctcgg aaacggttca gacgacagac cgatgctgct gtcgccgagg caacccgttc     22860
     cggcaagcgg cgacatggag aaactggccc acgcgctcga ccggttgggg gtcgcctatt     22920
     cctggcacaa ggtcgtgccc ttcgttggcg atctgatccc cgagcctgag gtgcgcaacc     22980
     cgggctacgc gcccgcctat gtcatggata tctgcagcac cgagaccggc ttgaaacttc     23040
     tggaaacgaa ttgcatcaat gccgccgggt tctatgcggc cgatgtgatg aagctggcgg     23100
     cggcgatcga cgcgcttggc tgagcggtcc gggaggggcg agatgggttt tgtcttgcgg     23160
     catctgctgt tgttcttcct gccgatcgtg ctggcggttg ggcttgatgt tgccaccgca     23220
     ccgttgcggc ggcagcttta tcagcaatcg ggcgtgtttc tgcgcgatct gttctccaac     23280
     gacccggagc gtgttcggac aacgcttgag agcctaggcc agggcggcat cagcctgtcg     23340
     gagagtcttg actggggcct gcgcgctgct gtcgtgatcg ggtttcttgc cttttcactg     23400
     ctgatcccga aatcggcctc gtcacaaagc gccgtcaatt ttctgaccac gctttgcgtc     23460
     ggcttcggct ttgcgaaact caatggcggc tttgccgggc tggactgggt tgagctgggc     23520
     ctttgtctga tcatcgggct gtgtctcgcc gttgtggcgc tgacccgaag gctgacatct     23580
     ctggccagac ccgcccgctg agcgcgtgga tcttacaact ggatgtggat gtgatcgtcg     23640
     tgccgggcgg cggcgcagcc ctgaaagcgg atcttggacg cgcccgcccc gaatttcgcc     23700
     gccagatgcg gttccaggaa gatctttccg atccggggat cgcgcgacaa aagccgcaat     23760
     gcaaggcgca tccgctcggg ctcgggggcg taatcgggcc agagcggttg cagccagtca     23820
     agatcccagc gcagggtcgg aaagcgcggc gggcaggttc tgggccccgg ctcgaacgcg     23880
     aaatagccca agggtgaccg ggtctgcccg ggcaggtagc ggccgtgatc ggcgtaataa     23940
     aacgccaggt cgagtttgcg gccatccttg tgcgacagat gcggcagaag cggaaagccg     24000
     ttcaaaaacg ggaagttgcc atcaagggca agggtcacgg tgccgggatg ggtccgggcc     24060
     atttcggtcg ccatgtccgt ggcggcggcc ttgagctcgg gggcgacgta attgcggttc     24120
     gcaaggcaaa agacccagga gcgcatcccc agcggcccct cgccatggca ggtgatcggc     24180
     acccgcctga agtgcggtgc gatcatcagc gcccccagcc aaagcgcggc gtacagcagc     24240
     gcaaaggcaa gaagcttgcg ccgaaacaga cggctgatca gccacgccag cccgcccaac     24300
     tgcgtcagca ccgtcagcac ggcagccagc gccagatgcc gggcggcgcg tccgatcctc     24360
     atgcgtccct cagcccgttc ggcaccagcg ccgcctgcat ccaatgcgtt tcgctttgca     24420
     catggcccgc gcggacatat ttgcccatcc ggcgcggcat ctcggcctcc gaaaaggccg     24480
     ttgccacccg cgcgacaaag ccctcctgcc gcaccggatc aagccccgcc gcgatggttt     24540
     caaaaagccc cggacgccaa ggtccgcgcc agagcaccgg caccggggtg atgcccagct     24600
     cctcgaaccg catcagggtc agatcccagg gttgcacctc gtcgccccgg atccaggcaa     24660
     agcccagaaa ccacgcgggc agcgtgtcgt agcccaccga atggcgggca taaaggttct     24720
     cgccgacgat ccgctcgccc tcggccagct gcggcgcgat acccgcggca aaggccttga     24780
     gccaatcgcg cgaggggtgg ttgcggctgt cggggctgcg cgcatggcac ccgccgcggt     24840
     gcagcgtggt gttctcgccg tccatctttt cggtgatcac cagatcgtcg cagatcagcc     24900
     cctcgagcga gttcatgatc ttgtcgtcgc tgctggcgcc gggcgagatc ggcaaatgaa     24960
     aggtgcgggg atatttcttc gtcatgcggc cagagtatcc ggatgccacg agggcggaaa     25020
     gaggcctcag aacggcgcga gcgtggcaag gaaactcggt tcgggcgtgc attcgcttcc     25080
     cgcgcgctcg gtcagccagt cgggatgggg cagcggggtg aaccccatcg cgccaaagga     25140
     ccagttccag accgaccaat cggcatcggc ctcgacgatc agcacggcgt gcagatacca     25200
     gtgcgaggtg ctcttgaagc cggtccgggt ggtgtaaagc gacaggccgc gcagctcggc     25260
     ccagctgtcg atgggatgag tatccccgtg gcgcgcgatg caatagggat ggcccgccgc     25320
     aattttcagc gccgaaaccg cggcggcagg gaccgtcgcg agcgaccaaa gggccaagag     25380
     cgtcggcaag gccatcaaca gggccgcgag ttcgcccgcc tcggtggcgc ggcccagcat     25440
     ctgcaggcca cccacgacgg caagggtcag catcagcccc tcgaggaagg caagggccga     25500
     tccgccatcc atcatcgcgg caagagtgag caagaccccc agcaccgcgc agcagaccgt     25560
     caatggcacg agcacgaggc ccggcagtcg cagccgcgcg taacgcgcca gaagcgcaga     25620
     gaccagcggc aggacgggcg cggcgacgat cgcggccaca gccgcggcga tgtctcccgg     25680
     gacgcgcggt ctgtgcagca aagacagcgg cgccagatcg gcatagcccg cggcgatcag     25740
     ccccgccatg gcaaggggga tccatcccgt tcggtgctgc gcgggagcgg tcacagcacc     25800
     cgccgcccgg aaacaagcgt ggcgtcgccc ggggtccaaa gatcaaaggc aagcatcggg     25860
     gaaagggtga aaatcggcca atccggcacg aagcggggcg tggcgccccc ggcggcgatg     25920
     aggcggcgga tgcgtccgcc gcaccagagc ccgaccgccc cgggaaggat gagacggatc     25980
     ggctgcttga acaccacgaa ggccgccatc gccgggaaga tcaggaagag atgcgggatc     26040
     aggcgccgga gatccgcttc gggcagcttg ccaaaaggcc ggtaaagggg cggaaatccg     26100
     cccagcagct ggagggagag gatcaggacc atcatcccga acatcagggc cgttccgaac     26160
     atcgcacgcc ttttcaatcc gttacagtcc ttgaaacctc ccatgccccg cgccaaagtg     26220
     caatgcggct gatgcgatcg cggattggct tgcggcccga ccctgcggaa tgtcgctccg     26280
     ccggggcgtt tcacgggcca ttgtgcaaag gaaccgcgcg atgacacctt acgccggctg     26340
     tctgctctcg acgtttttcg acccctacgg ctgggggtct gtcctgatcg ggctggcctt     26400
     tgctgtcggc ttggcccgac gcggcagagg gacgctttcg ctgatctcgg tgcttctcgg     26460
     ggtcgtcgcc ggggcgttgc ttgcagcatt tcattacaat ctcaactgcg tggaactgta     26520
     tcccggttag gggcaaaccc ggcttcggtc gcttcgcctc gcccgttcgc gcggccgcag     26580
     accgcgccgg tttggaaaag gcttgtcgcg caggcaggat cgggtcatcc tcggtccctc     26640
     agaacgtcct gtgcggaatt gatttcaaaa ggtcttttgc aatgtccccc gcgcccctgt     26700
     tctggatcac cgtcctcggc ctgctggcgg gcctgctcgg cctgtcggta gcgggctggc     26760
     gccatgcaaa gccggtgcaa cagatcgtgc ttgggctcgc cgggcttttg ggcatcatgc     26820
     tgacgctgtc gttcctgttt gcgccgcttg gcctgccggt ggcagcctgt gcgctggtca     26880
     cctatgtcgc ctgccgcctc gtcgcggggc tggccagccg cgcggcgcgg cttgtggcgg     26940
     cgcctcttgc gtttggtttg attgcggccc ccttcgccga acggatcagc ttcgagatcc     27000
     gcacggcaag cgcgcgggga gcctatgcgc ggggctgggc ggaccttgcg cggaagccgc     27060
     ttgcggtgca gttcggcacg ttacggctgc agctgccctt ttccccccag atccacgtgg     27120
     caacaccctg cccgcccggc gcagcggccg cgcccggggt ctgcgtcatc acggcgctcg     27180
     acgcccggcc gcaggcccat gatctgctgc agggcggtcc gccccccgcc gcgccgggcc     27240
     aaccggcgcg gctcgaccgg atcacgctcg atgccacgga cccggcgggg cggttcgggg     27300
     ttgtcccggt ttcgtcgctc gagacagctc cgcctgaaag ccgggcgcaa tcgtgcgcgc     27360
     gccaccccga ggccttggtg agcccctggt gcgccgcgcc cctttcgcgc agcgtgaccc     27420
     tgcgcccggc gccccgcgaa ccagacattg aagagatctt gctgcgcgac catctccccc     27480
     tcgaggggat cacgctgccg cccgatgcca ccggcacccc ggcacggttc acctgttccg     27540
     ccacgcgcga tgcggcacgg cgcaacgacc cgacgcggat ccgtttccgt ctgtgccgac     27600
     tgagctacca gcccctcgcg gggcttgagg ctgtcgtgga atttgacggc atcgcggatg     27660
     cggagttgca tgaagcggcg ccgaggctga taggagagtt tgggcgtggt tgaatgccgc     27720
     cctcggggac cggggatgat ccccgcaagc ggaacagatt tttggtcgca ctacctgtac     27780
     gcacgaccgc gccacacatg gtcaggggtg gctttgtgtt ctccacccat attcctgcat     27840
     tcatcgcgcc gcagagggtg cctctacctc cggcttgcgg gcaagcagga tgaaacgcgt     27900
     gtataccctc gtcctcaggc ggttgcgcag gccattggag cggcgttgag cctttgcgat     27960
     cggctcatgc gggatctgca tcagatcgac gaaccccgcc gaacgcagca tcggctcaag     28020
     cgcctcaagc gtcagcccgg cgccaaaggg cagacggcgc atgatcccgg cgtgccgatc     28080
     gccaagtgcg ccgtggtagg tcggatcggg cgacagccgc tcccacagcg ccaggagccc     28140
     ggccgcccaa tacccgcgcg gatcgggttg cgcccagttg ccgtcgtaga tcagcaaccg     28200
     cccgcccggg cgcaaaacgc gaaaccagtc cgcaaaagcc tccgccgggc gcgtcagtgt     28260
     ccagacgagg tgacggcaca ggatcgcatc ctggctttgc gcaggttcca tcgtggcgtg     28320
     agcatcggcg agacggaacc gcaaccgcgg tttgcccgcg tgcttggccc gtgcgacggc     28380
     gagcatcggc tcgcagaagt cgagcgcggt gacctcgtgg ccaagatcgt gcaaaagccg     28440
     cgtcacctcg cccgtgccgc aggcaagctc cagcacccgt tgcggcgcgt cgccaagccg     28500
     gtgcatcggg acagcccagg cctcggcctc ggcgccgggg gcgatccggt ggccgaaagc     28560
     caggtcgaag gtcgcggcgc gcagccccca ataggcgcgg atctcctcgg acagatcaaa     28620
     gttgctcatt gcggatgcgt cgcgaggatc gcctcgaaac ggctgcgcgc ccgcgcgggc     28680
     agatcggcgg gcagcaccgg cgcgggggcg tcgcccacct tgatcagcat gaccatgccc     28740
     atggcgaaat gcgggctgca tcggatgcca tagcttccgg gaacggtcag ggtgacgctg     28800
     aaggtttcgt tgatcttcga tttgaacggg atggcgcctt cggggatcat cccctcgatc     28860
     gtggcggcgt tgtgaccggg ctgggccgga agaaatcgca ccgtatcgcc cggggcaatg     28920
     tgcaggaagg cgggctcata ggccatcgcc ccgctctcgg cgcggttgta catcttcacg     28980
     tcatgtgttt cggccagcag cggggcggcg aacagaagca gcgcaacggc cgggatggcg     29040
     gcaagtttca tcgatcagtc ctcaagacaa tggaaacgga acaggtttgt gttatcggcg     29100
     ggatcggtca gcacggtggc gccgacccgg aagatccgcg ccagccgctc gggcgtcagc     29160
     acctgccgcg gcgggccgca ggcgatcatc cgacccccgg ccatcacccc cagacggtcg     29220
     cagccgatcg cctgattgag gtcatgaagc gccacgatca ccgtgaccgg caggcgggtc     29280
     atcagccgca gcagcgacaa ttggtggtgg atgtcgagat ggttcgtcgg ctcgtcgagc     29340
     aagagcagcc gcggctcctg cgccagtgcg cgggcgatat gcaccctctg acgttcgccc     29400
     cccgacaggg tggaccagag cgccgcgccc atctgcgcca tgccgaccgc ggtcagggcc     29460
     cgatcgacga tcgcaccatc ccgggggccg aacggatgca acgctgacag ccagggggtg     29520
     cggcccagct cgaccgcatc gcgcacggtc agcgccgcat cggtctcggc ctgctgctcg     29580
     acaaaggcga gcttgcgggc cacctcgcgc cgtgactgcc gggccagcgg cacgtcatca     29640
     agccgcacct cgcccctcgg atgcggcaag agcccggcga tcagccgcag cagggtggac     29700
     ttgccggagc cgttcggacc gaccagcccg aaggtctcgc ccggacggat atccagcgtg     29760
     acgccctcga caatcgggcg cccggcgctg gcccagccca gatccgtcgt ggaaaccttc     29820
     atctgcgccc cccgttgcgg atcaggataa gggcgaagcc cggggcgccg acgagcgcgg     29880
     tcacgacccc gatggcgacg acctgcccgg ggatcaacat gcgcgaggtg atgtcggccg     29940
     cgatcaggaa caccgcgccc gccagcgccg cccccggcac cagcgccccg tgccgcgccc     30000
     ccacggcaaa gcgcaccgca tgcgggatca ccagaccgac gaagccgatc gagccgacaa     30060
     ggctgaccat cgtcgcggtc atcagcgtcg tcgcgccgat cagcaccagc tgcacccgac     30120
     gcaccgcaat gccaagcgcc gccgccgatt gcgcgccgaa tacaaaggca tccatcgccc     30180
     ggacatgcca gagacagacc agaaacccca aggccgccgc aggcgcggcc agcgccacat     30240
     ccggccagcg caccccggag agattgccaa gaagccagaa catgatcccc cgcgcctgtt     30300
     cggcattggc cgatttcgcg atgaagaaac tcgtcagggc gttgaagagc tgcgatcccg     30360
     cgatcccggc cagcaccagt tgcgcgggcc cccctccggc ggcccgggcc agcgccgcga     30420
     ccagcccgaa ggccagaacc gcgccgacga aggcgccccc ggacaggcca agcgcgcctc     30480
     cgcccacgcc aaggatggtc accgccaccg ccccggtcga cgcgccggcc gacacgccca     30540
     gcaggtaggg atcggccagc gcattgcgga tcagcgcttg cagcacgacg cccgaaagcg     30600
     ccagcccggc gccgcagccc gccgccacca gcgtgcgggg catccggtag ttccagatga     30660
     tcgccgcatc gatcggatcg acgggatggc ccgcgttcca aagctcattg gccagaaccg     30720
     ccgccaccgt cgaaaccggc agcggcgttt cgccgatgac gacccccgca aggatcgcca     30780
     tcgtcagcac ggcagcccca agcatccctc gccacaggag agaccgggca cgccagccgg     30840
     aagctgccgc cgccatcatt tcagaccgaa tgccggcagg gcttcaacca gcgtctcgag     30900
     cgcggtgacg ttgcggatcg agggatccat cgcatgggca tccagaatga cgatccggtt     30960
     gttcttcacc gcatccatct ggcgcgtcac cggatcggat ttcaggaagg cgagtttctt     31020
     ttcgtaatca tccgcctcga agcggcgccg gtccatgcgg gcgatgacga tcaccgaggg     31080
     attcgcccgc gcgatggttt cccagcttac ggtcggccat tcctcgtcgc tctccacgac     31140
     attcttcagc cccagtttct ccatcatgta gccgggcggc cctttgcggc ccgcaacata     31200
     ggggtcgaca tccatctcgg ccgaggaaaa ccagaacacc gccgacgcgt catgcagatc     31260
     gagcgcccgg gccttttcga tcgccacggc ctcgcgcgcc ttcagatcgg cgacaagcgc     31320
     atcggcccgg tccgaaacgt cgaagatctg ccccaactgg gtcacgcccg catggatcga     31380
     ggccatctcg aacatcgcgc tgcgggtgcc gtcggagccg gtgctgttgt cctttttcca     31440
     gcaatcggcg ggcaagacat aggtggggat gccgacatcg gcgaactgtt cccgcgtggc     31500
     gacgatgcct tgcggcccca catgccattc gtattgcacg gcgaccagtc ccggcttttt     31560
     cgccacgacc gattcaaagc tcgggtcatt gtcggccagc cgcgcgacgc gggcattcgt     31620
     ctcgcggaac tccggaagga cctcggtgaa ccagaccgag gtgccggtca ccttgtcgcc     31680
     aaggccaagc gcatagagga tctcggtcgc ggcctgcccc acggtcacga cgctgtcggg     31740
     cgccttctga aaagtcagat cgacaccgca gttcttcagc tgcaggggat aggtggtttc     31800
     ggccatgacg ggcgacgcga agccggtcgc gcaggcaagc gcgacagtca gggaacggac     31860
     aaacatgaaa agtctccgga tgtcagggca gccggggaca gatcaggaaa ggtcggccat     31920
     ggcgtgttcc tgcggcaccc ctgcgggccg cgcacgaact ggctggaggg tgcgcaaacg     31980
     cacccaaggg caaaagtcat tcgacacctc cccggacacc ccgcccgggc cgcattgcgt     32040
     ttcgacgtgt cggcaggtct cctgactggc gggtcatcga ggtttcgcgg ccttcccatg     32100
     gcatgcgcca cagtgacttt gggtgcgaaa cccctcgccg cctacagttg cgggggcagt     32160
     tccggttcgt cagacgcttc tgacaacgga ttccctttca attcctttcg gaaaccgacg     32220
     ccgctggtta ccccgaacgt ggcggaacgg caagcgcgag aagcgaaaaa ccgttgtttc     32280
     tgctgcaaat tatatctcgg acagatcgaa cctcgcgctt cggcgggtcc atcccccgag     32340
     acggcgggcg ggcagagcgg ccccgatgat cgagcggttt cgtgatcaga ggccctgcgc     32400
     gcgatccctg gtgacgaccg tcggcttgcg ccctgcgggc gtcgcgatca tggcgccgcc     32460
     aaggatcagc gggccggcga tcaggaaggc cgtgccgggg cgttcggcga agaaaagcat     32520
     gcccgcgacg gccgcccaga ggatcgagag atattcgtac ggggccagcg ccgcggcttc     32580
     ggcatggcgg aacgacagcg tcatgaggat atgcgcgacg cccccggcaa ggcctgcccc     32640
     aagaagcagg gcgaactcgg ccgggtgcgg ccacacccag cccgcgggca cggtcgcaag     32700
     cccggccgcg gccgagacca cggcgaacca gaaggcgatc gcccccgcct tttcccccgc     32760
     caaggtcagc cggcgcacct gaagcagcgc tccggctgtc agcatcgcgg tggcaaggcc     32820
     cagcgtcccc cccaaagccg cgcccggcgg aagcccgccc gagaaggcgg gcaggcagaa     32880
     ggccgccgcc cccgccagcc ccagcccgac gccgcccagc cgccttggac caagcctttc     32940
     gcccagcatc ccccacccga gcagcgccag cacgaccggc gcgagatagg acagcaaggt     33000
     cgcctcggcc agcggcagat agcgcagcgt ggcgaaagag gtgaacatcg ccgcggcccc     33060
     catcaggcag cgggcgatgt ggccgaaggg gcggcgcgtg gcaagccccc gggggaagtc     33120
     gcccgtccac cacagaaaga gcaccagagg cagcagcgcc accgccgagc ggaagaacac     33180
     cacctggccc agcggaacgg cgtcacccag cgccttgatg caggcggtca tcgcggcgaa     33240
     ggcgagggtg gagccgatgc gcagcgcgat gccgagcggc tcgccgctca gccgcggccg     33300
     aggggtcgtc agactgccca tgcggatcgg tccctttcgc tttcaggcgc ggaaacggat     33360
     atgcggcggc ccggccgttg tcgaggtggc gatctctgcc tccacccgga acacggcgcg     33420
     cagcagctcg gcggtcaaca cggcctcggg cgtgccgcag gccacgacac ggcccgcctc     33480
     cagcacgacg atccggtcgc agaacatcgc ggcgaggttc atgtcatgca gcgcgatgat     33540
     gcttgtcaga tcaagctcgc gcaccatgcg caggatcgcg atctgatgat ggatgtcgag     33600
     atggttggtc ggctcgtcaa gaaacaggat gcgcggcgcc tgggccaatg cccgggcgat     33660
     gtggacccgc tgcttctcgc cgcccgagag ggtctgccag ggctgcgcgc ggcgcccctc     33720
     catgtcgacg cgggccagcg ccgaggtgac cgccgcctcg tcctccgccg accagcccga     33780
     gagggcggag cggtgcggcg tccgccccag ccgcaccacg tcgcggaccg agacattgct     33840
     gtcggtcgcg gcgctttgcc ggacgaaggc cagctgccgc gccagcgccc ggcgcgggag     33900
     gcgcgcgata tcctgcccct cgatctcgac gaaaccggcc tgcgggcgct tcaacccggc     33960
     aagcagccgc agcagcgagg acttgcccga gccgttcggc ccgatcaggc ccagcgtctc     34020
     gccccgcgcc acatcaagcg agacatccgc gacgatggtc cgcttgcgga tgccccaggt     34080
     cagattgcgg gcggcgatgg tcatgattgc ggccgggaac gatagaggat gatggcgaag     34140
     aagggcacgc cgaccagggc ggtgacgacg ccgatgggaa tggtctgctg cgcgacgatc     34200
     acgcgcgcgg cgatgtcggc cagcacgagg aagattgccc ccgcagccgc gcaggccggg     34260
     atcagccgca gatgcatcgg cccgacgatg aagcgtgccg catggggcac gacaagcccg     34320
     acgaagccga tggcgccaac catgctgacg atggtcgcgg tcatcatcgc cgtcacgccg     34380
     aacaggatca ggcggatgcg cgccaccggc acgccaagcg ccgcggcatc ctcgtcgccg     34440
     aaggtgaagg cgtcaagcga acgtgccatc aacaggcaga tcgcaaggcc cgtcatcacg     34500
     acgaggatca gaagctggaa atccggccag cgcacgccgc cgaagctgcc cagcaaccag     34560
     aacatcacgt cgcgcgcctg ctgggcattg cccgaggtgg tgacgatata ggaggtcagc     34620
     gcgttgaaaa gctgcgaggc ggcgaccccc gcgaggatcg tgtggttcgg cccgctggtc     34680
     gcgccgttcg acaaaagcgc caccagcgcg aaggcagcga aggcgcccgc gaaagccccc     34740
     atgggacagc gacagcccgc ccggccgatg cccagcacga tgaccgccac cgcgccggtc     34800
     gaggcccccg ccgagacgcc cagcacgaag ggttcggcca gcgggttgcg cagcagcgcc     34860
     tgcaggatcg cgccgcagat ggccagcccc gcgcccgcca gcgccgcgac cagcgcacgg     34920
     ctcagccgca ggtcccagac cacgctctgc tcgatgcgcg ggatctcggc ggtcgtgagg     34980
     cccagcccgt tgcccaccgc cagcacgacc gtgccaagcg caatggcata atcgccgacg     35040
     gtcatcgcca ccgcgacggc aagacacaga accagaaggg acaccgtcag aagcaagagg     35100
     aatttccccg ccccgcttcc ggtctcgtca cgaatgctca cggcaggtcg aaggaacgga     35160
     gctggtctgc cagttgctcg gcgccgtaaa gcgtgcggat cgaggggttc atcgccgccc     35220
     cgctcatcac cgcgatgcgc cccgccttga ccgcctccat ctggctgacc gccggatcgg     35280
     aggtcagcca ggcgatcttg gtgtcggccc ggtcaaggtc ccagcggttg cggtccacct     35340
     gcgcggcgac gaagacggtg ggattggcgg ccatgatgcc ttcccagccc agggtcggcc     35400
     attccgcctc ggtcctgatc gcgttggagc cgccaagcag atcggcgatg tagcccgaag     35460
     gcccatggcc gccgcccaga taggcatcgt cggcaggcga ggggctggag aaccagaaca     35520
     ggaaggtcag atcctcgcgc ggcgcgaatt cggcgcgcag ggcggcctcg cgggccttga     35580
     aatcggcgat caccgccgcg ccgcgctcgg ccacgtcgaa gatgcgcgcc atgtcctcga     35640
     tctccttgta gaggaggtcc atggaccaca gatccttgcg gacaccatag gcagagctcg     35700
     ccgcgctgcc gttcgcgctc tgcgtgtcgg cctcggtggt gcaggcactg ggcgagaggt     35760
     aggtcgggat gccgagcgct tccagatctt cacgcttggt gaccttgctg tcgggcccca     35820
     tcagcgtcac cagcatggca ggcacgaaat cgggctgctg cgccagcacc gcttcaagcg     35880
     tcgggaattc gaccgtcagc acctccacct tgtcatgcgc cgcggccagc tccggcagga     35940
     cgctgttcgg ccagaaggcg gtggcggcca tgcgatcctc gagccccagc aggagcagga     36000
     tctcggcgct gttctgcccc agcgccacgg tgcgctcggg tgctttcgcg aaggtcacct     36060
     tttgctcgca attctcgatg gtgaggggat agctcgtccg ctcggcaagc gcggcggagc     36120
     aaaggcagga gagggcgacg ccacccagaa tggcggtctt gaggggcaac atgggggagg     36180
     gtccggtttc cgagtgaaag agtcgatttt cactatcccc gcaacccgcg gaactcaaga     36240
     gtgtttcact caggaactgc gggcgaaaca ggggctttgt tgcacaacgc cgacgtgcgg     36300
     cggtgtggca ccttttgccc ccgactggag ggtgaccggc ggcctgcgct atcagcgcga     36360
     cgacgtggag cggcgcggca ccaccagctt cacgcccgag gtgctggatt acgaccggag     36420
     cttcgatgcc tggctgccga agcttgcgct gacccatgac ctgaacgaca ccaccagcat     36480
     cggcgcgatg gtcagcaagg gctacaaccc gggcggggtg acgcttggct tcgtgtcaag     36540
     gcaatatgtg accttcgagc cggaaacggt ctggaactac gagcttttcg gccgcacgaa     36600
     gctgtttgac gagcggctcg acctgaccgg gaacctgttt tacagccgga tgaagaatgc     36660
     gcagcgctat gtgacctcgg tgatcgaggg cggctatacc gatgcggtga ccgtcaatgc     36720
     cgacaaggcg gaatcctacg ggatggagct gggcttcagc ttcgcggcgc gcgacgacct     36780
     gaccctgcgc ggcaatcttg gccttttgca caccgaaatc gtcagcttcg agaatgcgct     36840
     ggccgattac gaggggcatg aattcggccg cgcgcccagc cgcacgctca gccttggtgc     36900
     ggattgggcg atccgtcccg atgtgacgct ggcgggcacg gtgcgttaca ccgacgccta     36960
     tttctcggat gacaccaatg cgacggcgct tctgatcgac gcgcataccg tggccgatgc     37020
     ccgcgtgacc tggaccccgc gcgaggatct gtcgcttttc gcctatgtga acaacatctt     37080
     cgacgatcgt tcggtgacca acctgcggtc gctgcaggga tcgctgcagg gcaccgtggt     37140
     cgatccgcgc tcggccggcg tcggcctgaa aatgaccttc tgaccgacag cccggccccg     37200
     ggacgctctt cggggccggg cgaaggcggg catccgccgg atcagggcag cagcgcgccg     37260
     ttcagccggt tctgggcgtg gatctggatg aagacctcga acatatgcgc atcaaggggc     37320
     gcggtaccac ccgacagcgc cgcctcgacc agatctatcg ggatttcgct gtgcggcatc     37380
     gaggcggtga tctggtcgcg caccgcggtg atcagcgcgc gcggggtcgc atcgccgggg     37440
     gcgcgcaggc aatgcgcggt gacggtggtg aaatagccga tcgtgtcgaa ccaggccgga     37500
     tcggtgcggc ccgcggccga ggtgccgatg gtcagcgcct caagcccggc cagccgctgc     37560
     agcgccacag agatcgccgc atagacggtg ttgaacagcg aggccgagca ggtctttgcc     37620
     aaggcatgca acccggcgca gaccgcgggc ggcacggcga tttcgcacca gccgcccgcc     37680
     gtcgcatcct ccggggccgc atcctcgggg gtcgcgggcc gggacgctgc gcccggggca     37740
     cggatcggct gcggcggcgg cgcgtcgcgc agagccgtga cccaatgttc cagcgaccgg     37800
     gcgtcgatgc cggcactggc ccgggcgcga gcaaaagcgt gaaacggtgc gaccggtccg     37860
     gcccagtcgg gggcccgttc cgccgcccgg gcggcatagg cgcaggccag ctcggccatc     37920
     atcaggttga gcctgacctc gcccctcagg ccttcgcggc gcttcccgct gaatcgtcgg     37980
     tcttggctac aacgccgagg ggcaactgat ccggccgtta catcgaggag gcggaccgga     38040
     tcgaccgtca ggaaaccggc gcggcgcggg ccgagcgggc ggcccatctg aaggggcgat     38100
     accatggcat tcgtcagcag atcgaacgtt tgctggcgat ggaaaaggcg ctggacgatg     38160
     cgccggacgg gcaaatttcg ctgaccgacc cagatgcccg ggcgatggca acgcgcgcgc     38220
     agcacagacg ctattggcgc ggcgggtgtt caagctgcga aatcaaacgc cgttgcacga     38280
     cgatccatga aggacggggg gctctgaacg acgggtttcg cggtgggaac acgagcatct     38340
     ggtcgaggca tcggatgcgc gccgacgcag cgccggcgcg ccgatgcggg tgcgaagatc     38400
     aaccgtcgag cacccgttcg gcacgatcaa ggcctggacc gggtcctgcc atttcctgac     38460
     caagcggttt caaggggtgg gcacggaaat ggcgttgaac gtgcaggcct acaacatcaa     38520
     gagaatgatc tccttggtgg gcatgccgag gttggtggct gcaatccaaa ggtgatcgcg     38580
     ggaaaatcgg cgatctcaag cccgagaatg gcgccttttg agcccgaaaa ggccctcaaa     38640
     acaggggttc ggagaaattg gttctgaaaa ccgccggaac ggggcagagc gcctacgatt     38700
     tgaaaccaaa atctgagttt tcacacagcc tcggccggtc gcttcctgtc tgagcgctgc     38760
     ggtgcagctt cacgagaccg gccattcgtc catcgtgcag catttcggaa ggtgaaggtt     38820
     ggctgcgcgg gcgaagctgc cgttgccggc tcatgaaacg cagcctattg gtatccttgg     38880
     tttacgcgag gatttcatgc gcctgcttac cctacttctg ctatctcttc ctgcattggc     38940
     aatggccgaa ccggttcaca ttcccggacc gcagggtcag cttgaggcgg aaatggtcgc     39000
     cgtcgatagg gctggtcatg tgatcatcat cattcctggg tcgggtccga cggaccggga     39060
     cggaaattcg ccgcagatgg gcctctcgac tgacacctac aagttactgg ccgaggcatt     39120
     tgccgaacaa ggcatcgcct cattgcgtat cgacaagagg gggttttatg gcagcgccgg     39180
     ggctatttcc gatcccaaca atgtcactat tcgtgcgtat gccgaagatg tgcgcgattg     39240
     ggcagcatac gcctcaagtg tcgcaccttg tgtatggctt gccgggcatt ccgaaggtgg     39300
     actggtggcc cttgtggccg cccaagacgc gccggaaaat ctctgcggct tgatccttct     39360
     ggcaacgccg gggcgcccga tagggcagct catggtcgaa cagttcaagg ccaatccggc     39420
     aaacgctcct ttgatgcctg agatcggcgc catcgtagct gatcttgaag cgggcgaggc     39480
     ccgcgatcca gattccatgt ccgcggtgct gcgtccgcta ttctcttcgg gacttcagcg     39540
     ctacatgatc gacctcttct cttatgaccc cgtagagatt gccaaagaat ggaacggccc     39600
     cgtgctgatc gtccaaggaa gcgaagacac gcaagtccga cctcgcgatg ccgatcttct     39660
     ggccagtgcg ctgcgtcagt cccaacggat caatcttgtc cggggaacgc atatgctgaa     39720
     gacagcggtc gccgggaaac cctttgccac atatactgac ccatctctcc ctctctatga     39780
     aaatctcgtg cccggcatcg ccagctttat ggacgaatct gcgcgtcccg actgacaact     39840
     tggggctcgg agctgacctc tgtctcgccg cagcatgccc cgaatcgcgg acatctcgcg     39900
     acgtcgagat cggccctaag ccgccggtcg aggccatgtc ttcgccgcaa cgcagctggc     39960
     tcgaagcgga cggtcaacat tcgatacagc aaaatcttga gcgaacgtcg ctgaggcgat     40020
     ctggatacgg aacaggctca gggggccagc ttcaggcaag gggcatccgg cgcgaagaac     40080
     cgggtcgcat catggctggt ctcgatcagg gcaaatcccg tttccgcccg gcttcgctcc     40140
     agaaaatccc tgctgcgcgc gaggctctcg gggtcgagcc ccgagacagc ctcgtccagg     40200
     atcacaagat ccggccggat cgccaaggcg cgcagcaagg ccacccgttg cgcttgcccc     40260
     ttcgacaaga gcggcgcagg cagcgcggca caggcgccaa gacccagctg atccagcgcc     40320
     tcttgcagcc agaccgtctg cggccggggc agcggcaggg cgacgttgcc ccgcgccgaa     40380
     aggccgggga tcaaccttgg ctcggcaaag gcgaagccga tgcgaagccc gggcttgcgg     40440
     atgacctcgc cgcgaaccgg gctgggcaga cccgcaagat ggcgcaacag agccgtcttg     40500
     cccgcgccgc tggcgccgtt caggcgcagg ctttccccgg ggccgagcgt cagcgccagc     40560
     ggaccgaaaa gcgcgcgctg atgccccggg gggcacaggc cgagcgcggt tgcacggatc     40620
     agcatggtca tttgcgccgc gccctgcggt ccgccagggc cagcagcgcc tctgctccgg     40680
     cgatcatcag caggaccacg aaggtcaggg caagaagccg gtccgtcatc aaccatgtct     40740
     gcgccgactg gatcgcgcgg ccaagtccct gaccgccgcc cagaagctcg accagcaggg     40800
     tgatgcgcag cccgttggcc acggcgacac gcagcgcggg catcagcgcg gttgcaagcg     40860
     caggccacag gacatggcgc aaccgccgca ggcgggggac gtggaacagc cgtgccatct     40920
     cgtcaagttg cgggtcgatg gcgccaaggc ccgcagtcgt cgcgatctgg aacaccggca     40980
     caagcaacgc ggacacggcc gccaccacca tcgtcccgcc gccctcgagc cagaggatca     41040
     gcagaatcgc cagcacggcc gcgggcagac ccatcaggac cagccgcaag ggcgccagag     41100
     ctgcgccgat cagcggccag cgaaaggaca tccatccaag cacgagacca aagaacagcg     41160
     ccaacagcac gccggcaagc gctgcggcga ggctgggcgc aaggctcccg gtccagaatg     41220
     tccgctcccc cagaagtgca atcagcgcgc gtccgaccgc cagcggcccg ggcaggattg     41280
     cgggcagtgt ctgccgtgcg atcacctccc aaagcagcag gagcagccct gctccggcca     41340
     gaccggcccc aagacgcgcc gccttggcgg gaggagacgg gctcactttc ggatcccgga     41400
     ggcatagaac tccggtcccg gcagcgtgcc gccgattgcc tgcggggcga ggtcgaagat     41460
     ctcgccgtaa aaggccctca ggggggcagc atcggcgggc atgaccagaa ggctggcggt     41520
     gatgcccgca aaggccgatg ccccgggccc ggtcgagagt tccggaaaaa agcccgccag     41580
     aagagcatgt gcctgccccg gagtggccgc gaggtccgaa tgagccgttt ccaatgccgt     41640
     gacgatcttt ccgcgcgcag gcaaatcggg gcttgcaagc agtgcgccgc cgggcgggca     41700
     ggccgtcgcg ccggtggctt tttgccagag cggacacaga tcggaacgcc gccgcaatgt     41760
     cgggtccgcc gcgagcgccg cactggccat cggttcggcc agaagcgcga gatccgcctt     41820
     gccggccagc agcatctgca tcgaagccgg ataggcgccg gtgtaaagcg gttgccaggc     41880
     cgttgtgcca agaattcggc gcagcatcag atcgggcaga ttgccctcga agggcacggt     41940
     gatcttcaga ccgctcagcg cttccggccc atccagatcg gagccgcgcc cgatcagcca     42000
     cagattgccc ccggtcacgc tggccgcaag aagatcgcct ttcatcccgc gcgcctgcaa     42060
     caggggcgcc atgagcaccg gcgccatcgc caccaccggc cgcccggaag cgagctcctt     42120
     gcgcagcgtt tcaggattgg tccagggccg gaaggtgaag gtgatcccgt cggctgccag     42180
     cggttgttgc gcggcaagcg cgatcagcgg ggccgagtcc cagatcggcg ggccggtcag     42240
     gatcacttcc tcggctcgca ggggggcggg caggccaaga agcagcgcgg cgaacagagg     42300
     gagcaagttc atctgggggg cgccttgggg tcagaagggg aaagggattt gcggcccatg     42360
     tcgacgcgga accggccgaa gggcgttccg atccatttcg aactgacggc aaggcctgcc     42420
     tgtgccatcg catcggcgat ctcgccatcg tcaaaggaaa cgtcgcgctg ccacagcgcg     42480
     ggcatcagac ggccgatcac atgttcctcg ggggcgcagc gtccctcggt cagcgtggca     42540
     tgcagcgaga cgaacacccc ccgaggcgac agccgctcgg cgatccgccc aatcaaggcg     42600
     ctgatccccc gatcatggaa atagagcgtc atcgaggcga agatcatgtc gaaggcccct     42660
     tcgggcagcg gatcgttgta gctgcccgga tgcacccgca ccgacagttc cgccagttct     42720
     gccgcgatgc gctcggcgac cggcggcagg tccagaaggg tgatccgcag atcgtgtcgc     42780
     agggcagaca aggcgcgggc aagcgttccc gagccggggc cgatctcgag caagctttgc     42840
     gcgctttccc attccggcag accggtcaga cacggaagca tcacctctgc cgccgcgccg     42900
     cgatgaaacg aggcaaggct ttcatgcgcg cggttccaat aagccgcgtc aaacagcggc     42960
     cgctccggag agggccgctc cggcgccaga agctcggcga tccggtccag ccccgcatgc     43020
     ctgagccgcg ccagcgcctg caggctgggg atcaggctgg tcgggcttcg cgccgacagc     43080
     agcggcaaca gatcgggcgg cgtctggaac gtttcgcccg cccggtccag aaatccgcaa     43140
     gccacaaggg cgcgcaggac cagcgtcagt cgatccggat ccagaccctg cgccagcgcc     43200
     agatcggacg ccccgactgg cgccgcgcaa agatcgaaga gtcccgtttg catcgcatgg     43260
     tcgagcaggg caaagcggat cggcccctcg atcgtctcga acagcacatg cgccccctga     43320
     tcgcggcggg gagccgtctc cggagtcacc attgcgtcgt ccagttcagc ccgaagctgc     43380
     gcggctggcc atcctcgacc aacgtgccgt agaacgagcg cagcgacagc gcggcatatt     43440
     cctcgtcaaa aaggttgtgc gcccagagcg tcagcactcc gttacccaga tcgcggctga     43500
     tcgaagcgtc gacgatccgg tagccatcct gttccagagt gttggccgcg tcgaaatagg     43560
     acgacccgta gccgttgact gcagcgcgcg cacgccagcc atcgccgcct tcccaggtca     43620
     caccaagacc gtaactcagg tttggagcca tcggcagctg gttgccggaa taatccaccg     43680
     gcccagcacc cgtgcgggtc atgaaggagg ttgcccgcgc atgctgccat ccgagcgatc     43740
     catcaatctg ccagccatga ccaagggggg cggacagcgc cgcctccagc ccatagcttt     43800
     cggcctcggc ggcgttcgag attttctgaa ccgcgcccac caccgtttcg gtgatctgct     43860
     tgtccttcac cgtggtgtga aacccggtca ggctgaggct cgcgtcattg agaaagatgg     43920
     ttttcagacc gatttccgcg ttccagctgt attcgggcgc gtagatcagg ctcgcggcat     43980
     tgcccgcaaa ggcatagttg taaccagcgg gcatgtagcc gcgcgcatag gaggcgtgca     44040
     gcgtcgtgcg gtcggagata tcccacgcca aagtggcttt cggcagcggc gtcgtcgtcg     44100
     catccgaggc ggcatagctg cccgccagcg agaaggtctg gctggcagag ctggcgatat     44160
     ggtcgatccg cagcccgccg ccaagacgga gccggtcagt cagcgcaacc tcgccaaggc     44220
     cgtaaagtgc gacaccgttt tgcgtgatgc tggtcacccg gcgcgcgccc attccgcgca     44280
     ggtcgaaatc cacgtcggtt gcctgatgat aagcgtgaag gcccaaagac catttgaacc     44340
     gttcggcgcc ctcgagcgaa ctcagccgga tctcctgaga gatcatgcgg tccttcagat     44400
     cgaaagccgt cacggcgacc ccggggattg gcgggagcgg gctggaatcg gtatcgagca     44460
     ggaaatcgcg atcaaaggtg gtgaagccgg tgatggtggt cagatcgaac ccgtccaggg     44520
     tctgggcata gtccagcgaa gtgacgctcg aacggcggtt ttcccgggat ggatcgctgt     44580
     agcgactttc gtagcggccg gtcgcctgcg gcccgtcgat gtagcgatac tgctccttgc     44640
     cgagggtctc gtcttcgcca aggaagctga cccgcagcgt gccaccgttt tcgaaagccc     44700
     aggccgcccc cgccaagagg ctggttcggc cttcgcgtcc gccatcgtca tcgccgcccg     44760
     ggcgcgggtc cgagatcacc ccgtccgttt tcgaccgctc caggccgaac agcagtgccg     44820
     gagccccctc cttcgccgcg ccccaaagca ccgaggcggt atagcccggc ggctgcgccc     44880
     cggcatccga gccggaaacg ccaaagccca acttgacccc ggtgaaatcg cccgggcgca     44940
     gcgtgtcgta gatcagcaga ccggcttcgc tattgcgccc gaaggccgtt ccctgcggcc     45000
     ctttcagcag tgtcacctgt tcggcggcga aaaaatgcgg cagttgcagc gtcccgagcg     45060
     gcagggcgac gccattcacc tggtaaccga ccgggtcgct caacgcgttg tcaaaggcgg     45120
     aaaggccgcg aaccaccaga cgctcaccgg aattcgcgcg ctgaaacaga acattgcccg     45180
     cccgtgccgt caccgcctca agatccgggg cgttgcgctc ggccagatcc gcgccgtcaa     45240
     tcacggttgc atcgctggcg gagcgcagcg cggtctcact ccaatgactg ggtgagatct     45300
     cgatggtgcc aaggttggtc gcctcctgcg cgcaaaggcc gacaggggtg gcgccaagcg     45360
     caagggcggc aaccgaaatc aggaccccgc gatggcgcgg gccgggcagt ggcggcaaga     45420
     aaagaggggc agggcacatg tcacggtcct cgctgcggat gggcgcctgc gggttaacac     45480
     gggcctgccg ccccgacttt catccgggca aataaatctt ccattcggcg aaaccatcag     45540
     ttgcgctggc tgccatggcg gcgccagctg cgcgcggtca tgccgaagcg cttgcgaaag     45600
     gcggtgctca gatggctggg gctggaaaag ccgcagtcat aagcgatttc tgtcaacgag     45660
     cggccttgat ggccgatcag ttctgccgct cgctccagcc ggagttctcg caagcgctcg     45720
     aagacggtcg tgccggtttc gcgacggaag cagcggttga gcgtgacatg gctcaggccc     45780
     agatcctgcg ccagatcgtc aagactgaag gtctcggcca gccggtcgcg cagcagcgcc     45840
     tctgtgcgcg ccaccagcag cattgcctcg ggcatggccc ccgcacggcc ctgctgcgcc     45900
     agttcctcga agacattgcc gacgagggcg aggcaatctc cctccttgcg cagcagcgcc     45960
     gccggggtgt cggcgccatc aaaaaagcgt tccggcagcc cgcgcgccgg acgcgacagc     46020
     cgaaacctgc gcaccatccc cgggtcgggc aattcctgcg cgatcacccg gcacagccgt     46080
     tccgtgaccg cttcggcctc gatcacgatg accagattgg aacagccctg cccgggatgc     46140
     aacacacgcg tcagggcttc ggagttggtg cgcagcaccc atccctcgcc gttgcagatg     46200
     tcgtgatcac gccccgcggc gtcccggatc gtcatgatcc ccaagaggtt gaaggcgatc     46260
     agcaaccgac cggcgggcca aaggatgaca tcctctcgtc cccggccggg ggcgaattgg     46320
     ctcagcgcga ccgagatccc cggcccgagc cgcagcagat cgatccgcgt tgcagcgccg     46380
     accccgggca gggtgatccg tgtggtctcg ccctctcccg gaagcgagcg ggccggttcg     46440
     atccggccgg aaacagccgc gcccggtccc cggcgatgat ccggacaggg ggccgatgcg     46500
     ggtttggcga catccgcaaa atcagaaacc cggctgcggg cagccgatga caagccagac     46560
     tccataattc ctccgatccg tcacacccga cggctgagcc agactgcaag gtcggtctcc     46620
     tgacttgcgg gtcgctgcct tcccgccctt cccatgtccg gcgtcagtcc gggccacagt     46680
     ggattttcgg gtcggctcgc cgctcacagt cgcgggggcg gtcggatttg gctcttgccc     46740
     tcctgcaagc cgcaggcggg atggctgtcc tgttccctgc catcggatct gcgatggcac     46800
     catgcacgga cgaaggctgc cagttcggga caggaaggtc aagctgtccg gaacgcccgg     46860
     ccgcctcgcc ctcgcgccgc ggtgccgcgc tccgccgtct ctcgacggcc tgccggaaag     46920
     tcttgcctgg ccgtcgaagc tggacctgac gcggatcatc ccttacggtc gggagggtct     46980
     gcttgctcgc agcggcatct accccaccga cgtcctggag gatctaccta tgaaattcgt     47040
     ttctttcaaa tcccttgcgg gagccgcgct tgcggtcggc ctgatggcgc agggcgttgt     47100
     ggcgcaagac ctgcagtttt tcaggatcgg aaccggaggc acggccggga cctactatcc     47160
     gatcggcggc ctgatcgcga acgcgatttc caatccgccg ggatcgcgcg cctgcgcgga     47220
     tggcgggtct tgcggcgtgc ccgggctgat cgccactgcc gtggcctcga acgggtcggt     47280
     cggcaacgtg aattcgatca acggcggcac gcttgaggca ggcttcagcc agtccgacgt     47340
     cgccttctgg gcgcagaccg gaaccggcat ctgggaaggt cagccgccgg tcgaaaagct     47400
     gcggctgatc gcgacccttt accccgaaag catccatctt gtcgccacca aggcgtcggg     47460
     catcacctct gttgccgatc tcaagggcaa gcgggtgtcg cttgacgagc cgggatcggg     47520
     cacgctggtc gatgccaaga tcattctggg cgccttcggc ctgaccgaag ccgacatcac     47580
     gccggaatat ctgaaacccg atcaggcctc ggaccggatg cgcgacgggg cgatggacgc     47640
     gttcttcttc gtgggcggtt atccggccgg tgcgatcgcc gaactgtcca gccagcatga     47700
     ggtggtgatg gttccgatca ccggccccga ggtcgatgcg ctgcgcgccg aatacaagtt     47760
     cttcgccaat gacgtggttc cggcgggcac ctacaagggc caggacgccg aagtgcccac     47820
     cctgtcggtg ggcgcgcagc tggtgacctc ggccgatctc tccgaagagc tggtctacgg     47880
     catcaccaag gcgatgttca acgagaccac ccagaagctg tttgccaacg gacattccaa     47940
     gggcaagttc atcacgctgg aaaatgcggt gcagggcgcg ggtatcccgt tccatccggg     48000
     cgccgaaaag ttctataggg aagtcggcgc gatcaagtga tcggcctgtt ctgaaccgac     48060
     cgggaacgcg atcgcgaccg ccgatcgcgt tcctttatct acacgagcct tgaggatacc     48120
     ccgatgagtg acggcaaacg cgcgatgacc gcagcggagc ttgcagcgat cgaagaacag     48180
     ttcgatcccg aagcgcgctt tcgcaccgtc acgcggcccg tggccactct ggcgggggtg     48240
     atcctcttcg cgctggcctg ctatcactac tatacctccg gtttcggcat tccgcgcgcc     48300
     accacccatc gcggcatcca catgggggtg tcgctgctgc tgatcttcct cagctttgcc     48360
     gcgctgtcct ctcggcgcca caggacgcat ggttttgccg tgcttggcct gccggtcacg     48420
     gactggcttt tcggcatcgg ggcactggtc agcgcgcttt atgtgccgtg gatctatgat     48480
     cagcttgcct tccgcatcgg caatccgctg cagatcgacg tggcgatggg gacgatcctt     48540
     ctggtgaccc tgcttgaggc cgtgcgccgg tcgatgggct ggcccttgcc cctcatcgcg     48600
     ctgatgttca tcggatatgc ctatttcggc cagtcgatgc cggggatctt cgtgcatccc     48660
     ggagcggact ggtcggggat cgtcaaccac ctttacctgt cgtcgcaggg tgtctacggc     48720
     accgcgctgg gtgtcatcgc gacctatgtg ttccatttcg tgctgttcgg ggcgatggcg     48780
     cagcgtatcg ggctgggtca gttgttcatt gacctggcga cggcgctgac cgggcgcttt     48840
     tccggcggtc cggcgaaagt gtcggtcgtg tcctcggcgc ttctgggctc gatctcgggc     48900
     tcgtccatcg ccaatacggt gaccaccggc gcgctgacca ttcccgcgat gatcaagatc     48960
     ggcttccggc gtcatttcgc ggcggcggtc gaggcggccg cctccaccgg cggtcagatc     49020
     accccgccgg tgatgggggc ggtggcgttc ctgatggtcg aatatctggg catcccgctg     49080
     cgcaccatcc tgattgcggc catcgtgccc gccttcatgc actttttcgg ggtgctggtg     49140
     caggtgcatc tggaggcccg gcgactgggc atccgcggcc tgcgcaagga agaattgccc     49200
     aatgcgatgc gggtgctgcg cgagggctgg ctgtcgattc tgccgctgat cctgctggtt     49260
     tacatgctga tgtcggggcg cacgccgttt ctggccgcct tctgggcgat caccgcctgt     49320
     atcgtgatct atgccattca gcgggtgatg gcggcggggc tggccaaggg catccgcgag     49380
     ttcgccgcgg gcatctacga gagcttcatc tcgggcgcca agggcgcgct tgccgtgacg     49440
     gcggctgcgg cgctggtggg ggttgtcatc ggggttgtca cgctgacggg catcggcttc     49500
     aagatcgcgt tcatgctgac cagcgtggcc cagggttggg cggaaagcac ccatgctttc     49560
     ctcgccttcc tgccgatcga actgttcagc atgtccacgc tcgcactctt gttcacgctg     49620
     atgatgacgg cggtggtgtg catcttgatg ggctgcggga ttccgacgac ggcaaactac     49680
     atcatcatgg tcgccgtggc ggccccggtc ctgtcgatga tgaatgtcga gccgctcgtg     49740
     gcgcatttct tcgtgttcta ctttggcgtg ctggcggatg tgacgccccc ggtggcgatg     49800
     gccgcctatg ccgccgcggg gatcgccggg gccaatgcgt tcaaggccgg caacaccgcg     49860
     ttccgccttt cgatgggcaa ggcgctggtg ccgttcatgt tcgtgttctc gccgtccttg     49920
     ctgctggtga cggcagattt cagctgggga tcgttcgcgc tggcgttcag cggggccgtg     49980
     cttggcatca tcgcgctgtc ggcggccatc accaactggc tgctgcgccc gctgctgctg     50040
     atcgaacggg tggctctgcc gattgcggcg ctgctgatga tcgcgcccga gatcatctcc     50100
     accgtgatcg gggcggccat cctggcggcg gtgaccctgc gtcaatggct tgcggaccgc     50160
     ccccgatcgc ccgccgtccc ctgacagaaa gtccccaaag cgccgtgatt gccggaaggc     50220
     cggcctttcc cgatgacgga atgacagctc tcttgctgcg ccatgcgtca tccgcgaaaa     50280
     gccgctttcc gccgagatcg tgtcaaaact tgccgactct gcgacccgga cagtccagcg     50340
     cgagatggcg gccttcagag accgtggctg gctgatcaag aaacgccccg cggcgcgatg     50400
     gacccgctgc cgaggtggag gatcgcaagg tgatcccctc ccgcagatcg ccttagctga     50460
     cggtgttgaa cgggccactt gacgaaatgc ggcggcagtc ctagctatat gtctagccag     50520
     ctagccagat gggtgcgttg atgtggaccg ttcaggatgc caagaacaag ttcagcgcgg     50580
     tggtcgaagc tgcgcttgcg ggtcagccgc aagaggtgag ccgtagaggc aagcccgcgg     50640
     tggtggttgt ttccgtagag gagtatcgac gacttctggc cggggcggtg aaagcgcgcg     50700
     aaagctttgc ggatcatctg atggcgtttc ccgggggcga tgtgccccgg gccactgttg     50760
     ccccgcgcaa tgtggacttc tgatgtacat ccttgatacg aatgtcattt ctgctgtgcg     50820
     tcgtcccgac cgcgcgccga aggtggccgc ctggctgcgc ggaaaagcgg agcaggatct     50880
     ctttttgagc gtcatcacgc tgggcgagat cgaacgcggc attcgtttgc aggacccgcg     50940
     tgatcccgac tttgcgcgcg accttcgcgt ttggctggat cgcaccgttc tgatgttttc     51000
     ggaccgcctg cttcctttcg aggcggagga tgcgcggatt tggggccagc tgtccgccgc     51060
     catcggacat aatggcgcgg atctcatgat cgccgcctcc gcgctgcgcc acggcgcaac     51120
     ggtcgtgacc gggaatgtca gcgatttcgc cccgaccgga gcgatgttgg agaacccatt     51180
     ttaagggcct tgtgcggaat tcgcgccgag acatgagagc caggcacggt atccgtggcc     51240
     ccggcagcgg tcccgaaccc ggcgctcagc cggtcagcgc cgcctccgcc atcgttccga     51300
     tcattcgagg ggccgaaaat cggggtttat cgggccgatg caccgcttgc attcaggaat     51360
     gcgggcgcgg acccagcagc aggggcgcaa gcgcgatcag gatcagcatg aaggccagcg     51420
     cccaaagcgt cgccgcaagg atcgtgccgg gagtgtaaag cgccagcggc ccgacggcgg     51480
     cggcccagcg aagcagcgcg gccagcggga tcagcgcata ggccagcgcg acggggaagg     51540
     gggcgaccag cgggcggccg gtatggccga gcgtggcgcg gctcatcacc gcgctgacca     51600
     tcgtgccgat gccgccgatg gcggaaaaat gcagcgcgcc gatctgagat ccgatgccga     51660
     aggcggccag cccctgcaag agcgcgccga agcccaccag cgccatcgcc gcatgcagga     51720
     cggccaggat cggctccccc cgcaccgccc agccctgcca gcgcgcgatg cggatcagct     51780
     gggccgcgcc aagggtcagt tccgccgtgc cgatcaccgg atccggcagg ccaagggtga     51840
     tcgccagcgc ggcggcgatc gcggcaccga cggccagcct gtcggccggt gcgaagctga     51900
     ccggcaggcc cggggcccgg ggcttgccca gatccggggc cgcgcccgcc agcatcgccc     51960
     ggcgcgccag cgcgttgcgg gtgaaggccg gggtgatccg cccgccgatg atgacgatca     52020
     gcgcgatcag cgttgccagc gccccgtgca gccccgcgac ggcatcgccc atcggccagc     52080
     cgagcagatc cagcagcacc cgcagctgcg ccccccagat cagcgccacg acgcccagca     52140
     ccagcagatt ggccggtttc ggcgccgccc gcagcatcag ccagatccgc ccggtcagga     52200
     ccggcaggaa agccagcgca agcccggcgg ccagcggcgc gggcagcgcc ccccaaagcc     52260
     acatcccgac ccgtccggcc agccacagcc ccccggccag gatcaggaac cgcggcccgg     52320
     ccggggcggc gccggtccag ttcggcaccg ccgtcagcag gaaccccgcc gtcgccgccg     52380
     cgccgaaacc gaagatcatc tcgtggccat gccaccattg cggcaccata tcggcgggca     52440
     gctccatcat gccgccaaac gcgtgcaccg caagccacag cccccagacc agcatcgcca     52500
     ccgtgcccca gacggcagag agcaggaaaa acagacggaa gccttcggaa aaaaggcgtt     52560
     tgagggcggt catggcaggt cctttcgcga tctgtgcgca gcttggcgca aagcgccttg     52620
     atccccttga tgaaagtcaa ggaaggcccg cgagcggcgg gggatcacgg aaacgggaaa     52680
     ggcatggagg ccttgatgac gacatcgtcc cgcaccaccc ccccggcagc gatccccggg     52740
     cgcctgccgc gcctgtcccg cctggggctg ctgctttatc cctttgtcac cgcggcggtg     52800
     gcggtcaacc tgttcatgct gggactgatg gggcaggcgc tcggctttgc cgcgctgtcg     52860
     ccgacggcgg cgctgctttg ggcgctgccc tttggcctgc atgccagcgt gctggcggcg     52920
     cgctgggtcc gaagcctgat tgccgaggct ggcgggatct gacgccgccc cggacaaccg     52980
     gggcggcaag ggggctcagg acaggacccg tttcagcgcc ggaacgtggc gcagcagcag     53040
     cgcatcgagc gccagcaccg caaggatcgc cgccccgccc agcggaaagg ccagcccgac     53100
     cagcaccgcg acgacaagcc cgccagtcca gagccgcgcc tgcggcccgc gcggcggcgc     53160
     ggccagacgc ccggccgcaa ccggacgacg cttccaccac agcaccacgc ccgcgacgca     53220
     ggacagcacc agaccggcgc agatcagcag gttcagcgcg acgctccacc agcccagctg     53280
     cccctcgtgc agggcgatcc ccaccgccat catcttgccc atcagcgggt aatcggcaaa     53340
     gcggacatcg gccagcacct tgccggtata ctggtcaaga tgcacggtgc ggtcgctggt     53400
     cggggtcggg ctgtcatagc tttgcgaatc gcgcgacagc gtccagaccc cggtcgcatc     53460
     ggcgggcgcc gaaacctgca cccgcgcgtc aaagccaagc gcccgggccc ccgccatcac     53520
     cgtctcgaag gtgacgggcg tccccggcgg cagcagttgc acccccgcct gcgagcccga     53580
     ggcgggcagc tgcaccagtt ccagcaccca gggcacctct tcctgcgcgg tatggttcat     53640
     cgcggcatgg gttgcgtccg aaagcggcac cgcatcccat ttcgcggccg gaaagctgga     53700
     ccagggctgc acgatcctgc cgccccagac gccggtccag ctcatgccgg tgagcaggaa     53760
     aaacgcaagg aacagcgcga cccagacccc ggtcgtcaca tgcagcgact tccagaagct     53820
     gcgcccccgc gcggccagat cgggcaccag caccgcgcgc cagcctttgc cctgccgcgg     53880
     ccaggccaga taaagcccgc tggccagcat catcaccgca aggctggcgg cgatttccac     53940
     cagcgtatcc cccggcccgc cattgccgcc ccagagcagc tcgccatgca ggttggtcag     54000
     ccagtcgttc caggtgcccg cctcgggacg atcggaaacg accgcgcccg aatagggatc     54060
     gacggccagc atccgcgccg tctcgccgtc ctctacccgc acgatcgccg gggtccggtc     54120
     gtcgcgcggg gagatgtatt tgtcggcccg gctgcccgga tgcgcagcct cggcggcggc     54180
     gatctgcgcg ccgacgccca aggcctgcgc cgcgggggcg atggcgatgc ggtcgccata     54240
     ttccgaatcg atggcggtga accacaccat cagcgccccg gtgacggcca gcatcagcag     54300
     gaagggaacg acgtaaagcc cggcgtagaa atgccagcgc caggcggtga agtaaaagct     54360
     gttcaggcgc ggctgcgcct cggggggcgt ggcccccggc ggtagatcgg tcatgatgtc     54420
     tcctgtgaaa gtcgtgagct ctggtcaggt cacggcagtc acgggggggc cggtggcggg     54480
     cggcaggccg gtcacatggc cgtcgcgcag gatcgtcggg ggcggtttga tccgggtggc     54540
     ccgcgccatc cgcaccggca gcggcaagcc cgcgggcagc gcggcaaccg gcgccgccag     54600
     atggcagcag gcccagctgc aatgccggtc atcggaggcg ggcagccgat caagcggctt     54660
     tccgctgtca agatcaagga tcaccgacac cgggccatgg cccgaacaca gcaccatctc     54720
     gagcgtgccc gaagccgcgc gcagcggccg caccgcgggc ggcagcagcg ccgccagaac     54780
     cagcccgaga acgagcgtcc agacggcaag ccggtcaagc tttctgaagg ccggtgcttt     54840
     catgtctctc gcagtaatca cgccgccgtc atgcgtcaat atggcgcaga ccgggtcagg     54900
     ccagatgttc tacacgcgcc cccggaaacc gggtcacggc ctgcaggatc gtctcggccc     54960
     gcggcatcag acaggccgcg gtcgagagcg catcggccag accggcctcg ggcgcggtga     55020
     tcgtcaccag cttccagacc gcgggcgccg ggcggccggt ccccggatgc aggatgtgac     55080
     cgacccgccc ggcgctgtcg aaggtcgttc caagcgccga ggaactggcc agcgcgcgat     55140
     cctgcaaggc gacctgaccg cctgcggcca aggtgatcgg ccagggcgtg ccatcggtct     55200
     gcgggccaag cgcgcgcatc tcgccggtgt cgatcaggat gcgctccagc ccgcggccgc     55260
     gcaaaagcgc cgccaccttg tcggcgatga aaccctgcgc aatgccgttc agcgtcagcg     55320
     tctgtccggg ggccagccgg atcccgccgc tgtcgaaccg caccgaaccc cagtcaaccc     55380
     ggtgcaaagc cgccgcgatt tccgcctcat ccggggcaag accggcgccg aaccgggtcg     55440
     catacagcgt ccagagcggc tgcaccgtcg gatcgaagag ccccgccgtc gcagcatgga     55500
     ccgttcccgc cagcgccagg cattcgagca gctcgaaggg cggatcttcc agccgaccgg     55560
     ccgcattcag ccggctcagc gcgctgtcgg cccgggtcag cgaaaacacc gcctccagtc     55620
     gcgcgatctc ggcggcggct tcggcggtga tcgccgccgc ctcggggtgg tcgatcacga     55680
     tccgggcgcg ggcgccaagg gcgatcccct cccagacccg gctggcggcg gcgagcgggc     55740
     tggcggcaag ggcggcgatc ccggcggaaa tgctcagaaa ccggcggcgg ctgaaatcgg     55800
     tcatcacatc cccccctgca tcttcgcatg gtcgtgtttt tgcatccgcg cccggtaatc     55860
     ggcctcttct gccgcctgca cctcgggcgg gacgggggcc agaacggtct cggggatttc     55920
     ggaaagccgc atcagctgcc caccatattg ggcgatgaag gcccgggcat cctcggtccg     55980
     ggcgaagggc acggtttcgg gctgatccat cccgcccagc cgcgagctgc cgaccacata     56040
     aaccgccgta tcggcggcga tccagggcag gctgccgggc tttgtccaat cgcccgcgcc     56100
     catgtcggtg acatagctgg cctgcaccgc gccatccttt tcgggcatcc gcagataggt     56160
     gacgacatcg cgcacctgac tgaagaacaa gggttttccg gggtgggcat ccagatgcac     56220
     ctgcgccttc gggccaccgt gatcgagaat gttcatctgg cagaaatagc ccaccgcctc     56280
     gggggtcagc gacaccggct gcgggatcgc ggcctcctcg cggcaggcgg ccagcaggca     56340
     gaaggcaagg aggaagcgtt tcatggcacg acctttttga acgagagaag ggcaagcccg     56400
     cccgagacga ggggccacag aaggacggag gccgccgatt gccagaccgg caccgcctgc     56460
     gcggcggcag cgaccccggc ggcgaccgcc gtcgcctgcg aggcggccag gttgtaaagc     56520
     cggaacgcat cggccggatt ggccagcagc gtcagcggaa agacctgtct ggtgaaaaag     56580
     ccgccattgt ctgccaccac cgcggccaga agcgccagat cataaagcac gacgaccaga     56640
     agccagagcc cgatcgccag gcccgccgcc cccgagggcc gcctggcccg cgccgagatc     56700
     gcatagccca gcccaaggaa agtggcgcca agcgcgaccg aggtccagat tagccgcaac     56760
     agcgcgccaa gccccgcgac cgaggccgga tcgagcagca cggccgccac ccccgccgcg     56820
     ccatagcccg ccaccagcgc cagcatcagg atcgccagat gcgccgccgc cttgcccgcc     56880
     aggatccgcc cgcgcccgac cggataggtc aggatgagcg agagcgtgcc gcgttcggcc     56940
     tcgcccgcca ccgcgtcgaa ggacagcaac agcgcgatca gcggcaccag atagaccgag     57000
     aggctggtca ggctggccac cgtcaccgac agccggtcca cgcccagact gccggtgggg     57060
     ccagagcccg ccgcggtcag gatcagcgcg aagatcacca tcagcacggc ggcaatcgcc     57120
     agccagcggt tgcgcgcggc gatgcggaat tcggctttcg ccagcgcaag gatcgccgtc     57180
     attgcccgtc cctccggctg aaatggctgt agatgtcttc aagcgagggc gggatcaggt     57240
     cgagatcggt caccgccgcg cccagagccg caatccggcc cagccaggcc agcttctgcc     57300
     cctgcgccac gttcagatga aactgcgcgc cggaaagcac cgcctcgggc agggcaaggg     57360
     cgacggtttc gacctgcccg aacgccgggg tgatctgcag cgtcaccggc agatcggccg     57420
     cggcgcgcag accggccagc gtgcccgtcg ccaccagatg cccgcccgac aggatcacga     57480
     tccggtcggt ccgcgcctcc acctcggtca gcgcatgcga cgagagcagg atcgccgcgc     57540
     cctcggccgc cagttcgtcc aaaagcgcat agaaatcccg ccgcgacacc ggatcgaggc     57600
     cagaggtcgg ttcatcaagg atcagcagtt tcggacgccc caccagcgcc tgcgccagcc     57660
     cgacgcgctg ccgcatcccc ttggaatagg tgccgatccg ccgccgcgcc gcgccatgca     57720
     gtccgacccg atcgagcagg ctgcgcgcct gcccgggatc ctcgccgcgc agcgacagaa     57780
     aaagtcggat ctgttcctcg ccggtcaggg cggggtgaaa ggcgacgttt tcgggcagat     57840
     aggccacgcc cgcccgcgcc tgcgccgatc ccggcgccgc ccccagaacc gagacctgcc     57900
     cgccgtcgaa cgggatcagg ccgaggacga tcttcatcag cgtggatttg cccgcgccgt     57960
     tatggcccaa aagcgccacc ctttcgccgg gggcgacctg gaagctgacg gcactgagcg     58020
     ccgcaacctc ctgatagtgc ttagtgagcg aggtcagttt cagcatcttc ttcggtgtct     58080
     ttcgtccagc ggtcgcccag ttccgccgca gccgcggcca gttcgggggc aagggggatt     58140
     tcaaggggcg ccatcagcgg atggctgtcg acgatgccgc cgggcagcgt cgcggggaaa     58200
     ctttgctggc tccagcggat cagctgcacc gcgggcgcgc cgatcagaag cccggccgcg     58260
     ggttgcgacc acaggatatg gtccatcagg tcattcggcc ggaacgcctg atcggcaaag     58320
     ccgtcgccgt tcagatcgaa ggcggcaagg tcggaccaga aattgccgcg cccgtccagg     58380
     ctccattcca gatcgcgggt gccgacatat ttcacctgat tgcggttgcc cacaaaggca     58440
     ttgccggtca ccgcattccg tgccgatccg gcggtatagt gaatgccgat gtcgcagccc     58500
     tgaaagcggt tttccgcgat caggttcttg ttcgcatcgt aaagaaaggt gcatttcgcc     58560
     gcgccgatga ccagattgcc gatcacgtcg gcatcgttcg tggaattcag catcaccccg     58620
     tggtcacgat ccatcagcga gatattgccc gtcacctgca cccggcgcga atacatcatc     58680
     gcaaagccaa ggtggttgcc gatcgagata ttgtcttcga ccacgctgtc attcgtatac     58740
     atgtagtgga tggcaaagcg cagatcgcga aaggtgttgc gccggtagat gtcctttttc     58800
     gaggcattgg aaaagatgcc gtcgcggccc cagcgcacct cgttgtcctc gatcagcacg     58860
     ccgggcgcgt tccagacgta aaagccgttg ccccgcgcga tcatgtgcgc atcctgccgc     58920
     ccaaggatgg tgttgcgccg cgccgtgccg tcgatggcgc cgtgaaagtc gatcccgtgc     58980
     aggttgtcgc gcagaaggtt gccctcgatc agcgtgcggg ccacgccctt gaccaccttg     59040
     atcccggcgt cgatctcctc gttgcggcgg cccgagttct gcacggtcag cccgcgcagg     59100
     gtgacgtcat cggcggtcac ggtcagcacc gtgccgcggc cgttgccgtc gatcaccgcg     59160
     ccgccctgcc cgtcaagcgt aagggatttg tcgatgacgg cggggccata ggaccccgcc     59220
     gccagtttga gcacgtcgcc cgggcgggcc gtggcgatcg cgccttgcag ggctgccttg     59280
     cccgggaaca ccatgaccgt ttctgcctgc aaggggcagg cgagcaggat caggaggaga     59340
     gagagacagg gcagccgcat cggttacgcc ttcggacgca cgaacatgcg gccgcgcatt     59400
     tccatgtgca gcgcgtggca gaaccactgg cagtaatacc agtagacgcc cggattggcg     59460
     gcgacgaagg tgaccgacga ggtcgcctgc ggtccgatct ccatcgccac gccgtggccg     59520
     cccatggtga agccatgcgt caggtcgtcg atgtcatcga ggttggtgat gaccatcgtc     59580
     acctcgtcgc cctcgttcac ctcgaagctt tccatcgcat agttcggcgc cacggccgac     59640
     atgtagacgc ggaccttggt cggatcggcc ttgtcgcgga tgacaaaggc ctgttcgtcg     59700
     tccagatcga cgccatcggc ctcggcctgt ttgcgcgtct cggcccagaa cgggtcgttg     59760
     cggtcccaga tcgatttgat gcccgtcatc ttcgaggcat gcacggcaat cgcatcatgc     59820
     ggttccgcga agttcggccc gtcgtgcacg accttcatct tgtcgcccga gatgtcgatc     59880
     agctggtcgt tttcgggctt cagcggcccg acgttcagga accggtcctt ggagaatttg     59940
     cacaggcaaa ccagccactt gccatcggcc tcgagggtct cgcccatcga ggtcttgagg     60000
     tggcccggct gatattgcac gtcgcatttg tcgaggatcg gatcgacctt ttcgcccgcg     60060
     taaagccgct tggccagatc gatgttccat ttcaccacct ggctgtcgag gaagagcgag     60120
     gtatagacat tgcccttgcc gtcaaaggcg ttgtgcagcg ggcccagccc cagttccggt     60180
     tccgccacca cgaccgaacg cggatcgaca tccgaggcaa acagcgtgtc cagcttcgtg     60240
     acgtcgatca ccgtgacggt gggcgagagc ttgccgccga tgcacaggtg caccttgtcg     60300
     ggggccatgt tgcagccatg cgggttgttc gcgacgggga tgtagcgggt gtagttcttg     60360
     ttcgagccct tgcggccgtc gatcaccttg acgccgttga gcgtttgata gtcgcccgct     60420
     ttgatgccct tttcgatctc ggcgatgttg aagacgacga catggtccat gtccgaggcg     60480
     gtcatctggg cggtgttcat gcccatttcg ctgttgtagc tggtcgagaa cgcccatttg     60540
     ccttcgtaat cggcgtcgca attgtcgagg ttgccggaca cgatcacctg ccacgccaca     60600
     tcccacttgt cggcatcgac cgcggtgaag atgttcacgt aagtgcccac gtcgtccatc     60660
     gtcgcgccgt cattggccag cggcgtttca tcctcgccgt tgcagaagac gtaattcgag     60720
     cgcggccatt tctgcggccg cagcccgtgg atggcgtgcg cattcgggat ttcgaggatc     60780
     gcatcgcatt tcatcacgtc gcagcgcacc cgggcgacgc gggtattcga cttgtcattc     60840
     atgaacagga agcggccgtc atacttgccc tcggtgaagg acatgtggac gtggtgcaga     60900
     tcgccctgat cgtggatctt cttgccgttg gccgcgagga atttcttcgt gtgttcggtc     60960
     atcgcgcgct gatgcacgcg cagcgactca ttcgtctgcc cccagccggt ggccgagcag     61020
     cggttgaaca ccggaacccg catcagctcg cgcatcgagg gcacgccgag aatgcgcatc     61080
     tcgcccgact ggcccgagga ccagaagccg taatattcgt ccagctggcc cggggcgacc     61140
     tcgaagccgc ccgtggcgcc ttcggcctgc gccgcggtgg ccagcgtcgc cgcgccgatc     61200
     ccggtgccaa gcgccagacg gccggcaagc ccgcccgcca gcgccgcgcc gcccgcggtg     61260
     gcgcccagaa gcatcctgcg gctgatgccg gatctggttt cctcggtcat ggtcgaactc     61320
     cttttcgttc agtgaggggt atggggatgg ttgcgcagat cgcgcggcac cgacgccgat     61380
     gtcggcgcca cggcggcgcg gcgtttgtcc tgccggatca ccaccgggca gcgcgcgtgg     61440
     ctttggtaaa gcacctggca atgcaggcag gtgacgcatt cgttcgggtt gatctcgccc     61500
     gtggggtgga tcgcctgcac cgggcagtca tgcgcgcaga cctgacaggg gttgccgcaa     61560
     tcgtggtagc gcttgagcca gtcgaacatc cgcagccgcg ccggaatggc gagtgccgcg     61620
     cccagcgggc agagatagcg gcaatagaac cgctcgacaa aaagcccggc cagcagcagc     61680
     gcggcggcat aggcgacaaa gggccaggcg cgcacgaatt tcaggatgat cgcggtcttg     61740
     aagggctcga tttccgccag atgttcggcc tgttcgatcg agcccagcga gaccccgaac     61800
     agcccaagga agatcatgta tttgatcggc caaagccgtt cattgaggcc ccagggcagg     61860
     gtccattgcg gaatgtgcag ggcgcgggcg atgcggttgg tgatttcctg caaggcgcca     61920
     aaggggcaaa gccagccgca ataggcgccg cggccccaga acagcagcgc ggcggcgacg     61980
     gcaaaccaca ggatgaaggt caagggatca agcaggaagg cctgccagct gaaggaggtg     62040
     gtcagcgcgc cgaaaagcgc catcagattg accaccgaaa gctgcgcatt ggcgtaaaag     62100
     cccaggaaca ccagcgtcac cgtcaggaag ctcatgcgga accagaagaa ggcccgggca     62160
     ttgcgcgtca tcgcgttctg gaaaaagaag accagcgtca gaacggtcag catcgccccg     62220
     gtgacggcga tctcaaggcg cttgcccgcc cagatcgacc gccacagatc ggcctgcgcc     62280
     gcggtttcct cgaccggggc gggcgccgcc acggccacgg gtttcagata gcccgcaggc     62340
     agctgatagc ccagatcgaa ggtggtgaag accttatccg tcgccgccac cgggcgttgc     62400
     accagaagct gcagccggaa cggtttcgca gggtcaaagc ccagatcggc cgggatccgg     62460
     aacaggtcgg tttcggtgaa gccgggggcg cccttggcct caagcgagac cagacggcgg     62520
     tgatcgcggt catggaaccg caccgtcacg tcatcttgca ccagcacgat gcggtcaaag     62580
     atgccgccgc ggacatagcc cgagcccttg aaggaataaa gcccgttcgc cgccacggcc     62640
     acggcggctt cgccgggctt gagccaggcc tgcaggtttg ccgcctcggc cgggcccaga     62700
     accgccttgc cgatgccggg caccgagacc agcgccagat tcaggtcgat gaagcttgtc     62760
     tgcggcggct cgcgcagcgc ccgggcggcg gcgcgcggat cgggcagggc cgcgaaagcc     62820
     tcgttcacct gaccgacatc gagcgacagc cgccgcaccg tgccgtcgcc cagcatcgac     62880
     agccagcctt cgggggcagg ggcctccggg ttgatctcgg ccttcgggcc actcgccacc     62940
     tcggcgctca tgccacccag gccaagcgcc cgggcgacct tgatccccga tcgcagcatc     63000
     gaatcgtcga tcaccatcac cgtgaccgtg gcgcccgaaa tgatctgcag atcatgcgcc     63060
     gtggccttgt cggcggcggc tttcggcaga tcgacgccga tataggagcc gaccagcgcc     63120
     ttgaccttgg cctcggggat gccgaccaga acgatcggct cggaatgctt gaccaactgc     63180
     gcgccgatca ccttgcccgc ggggtccagc gccatcatca catggatggg cttgcccgaa     63240
     tagccggtgg tgccgacgaa atcggaggtc acatagaccc agccgagttg ggtctgcccc     63300
     tgcagcaccg gggcaaccgc cagatcctcg cgcagggggc cgaaaccgtc ggcgcccggg     63360
     acaagatctg cggccgcgat ctgcggcagg tatttttcca gcacggtttc cgcggcccgc     63420
     gcgggccccg acagcaccgc caaaagcccg aacaccagcc cgcagcaaag ggaaaggaaa     63480
     aaggtcggtc tgcgcatcag gaaatcatcc ggacaggggc cgcgcacggg gggccgcggg     63540
     cagcgggaac aggatcgggc cgcgcgggca tctcggcgcg ggcggtcatc cagagggggt     63600
     cgaaacgggt gtcggcgacc tttgtcagcc gggccggagg cggcaccagc gccccggcgg     63660
     cggcggcaag acaatcgggg caggcggcgc aatcggcggc gccgggcgcc ggggcggcat     63720
     ggccctcggc atcaagccag atcacgtcgc gcgcgcccgc atccgagcag atttccatcg     63780
     gttgcagccc cgcctgcgcc gcgcaggccg ccgcccccca ggcgcccgcc agcaccagag     63840
     ccagacagag gctcaggcga agggccaggg cggccagcgg cgtcagacgc cgcgcaaggg     63900
     gcgcggtgaa ggtcatgatc tctccctaag gagggatcct gccatcggcc ttgatttaag     63960
     tcatgtggaa tatccttttt atcggatctc gacccggccg cgatttcgcg tcaagatatg     64020
     tgcatccgtt cagaggtggc ccttgcgcct gacgaccttc accgattacg ccctgcgcct     64080
     gctgatctat accgccggca agcccgagag ccgggtgacc atcgacgagg tggcggagtg     64140
     gttcgcaatc tcgcgggcgc atgtgaagaa ggtggttctg accctgtcgc gcggcggatt     64200
     tctgctgtcg agcaaggggc ggaacggcgg tttcaccctg gcgcggccgc ccggagagat     64260
     caatctgtca gaggtgattc tggcgaccga gccggatttc ggcctgttcg aatgctatct     64320
     gaccggcaat gaatgccgga tctcccgtcc ctgtcggttg cccaatgtcg ccaacgaggc     64380
     gctagcggcc tttctggcag tgctgggcaa atacaccctg gccgatgcga tgctgcggcc     64440
     tgcctatttc ctgctgcccg ccgcgggccc gcaaccgctg cgcggcccga aaagacccgc     64500
     aacacaggac gggcccggct tgagcccggg caaagtgtca taagcaatgt tatgtaaagc     64560
     ttcgaacgtc ctccgcgccg gaaccttgat cccggcctga ccgccgcggc gctgccgcgg     64620
     gatcggcgtc ttcggtgcag cattctcgcg gccgccagac caccgaaacg cgggtttcgc     64680
     aaacagcgtc cagccgcctg cctcttgcgg cgcactcttt catcgcctat cgtcgattga     64740
     cgaaaaaggg gctatagatg gttaccgacg acacacttgc ggaactggcg aaatcgctgg     64800
     cgcatccggc ccggctgcgc atcctgcggg tgctgcttgc cacgccgggc tgcatcggcg     64860
     gcgagatcgt ggaggcggtc gggctggcgc aatctacggt gtcggaacat ctgcgcatcc     64920
     tgaaggcggc cgggatcata accggcgaaa tcgacgggcc gcgcatctgc tacgcactca     64980
     gcccccccgc ccttgcacct ctgggcgcgt tcattgccag cctgacgccc ccgcccgagg     65040
     gggcgtgctg cctgcccgcc ggaaaggaca ttccatgagc ctctttgaac gctatctgac     65100
     gctttgggtt gcattgtgca tcggtgcggg gatcgcgctg gggcagatgt tccccgccat     65160
     ctttcgcgtg atcggcgcga cggagatcgc ccgcgtcaac ctgcccgtcg cggtgctgat     65220
     ctggctgatg atcattccga tgctgctcaa gatcgacttc gccgcgctgg gtcaggtgac     65280
     ccgccactgg cgcggcgtcg gggtgacgct gttcatcaac tgggcggtga agccgttttc     65340
     catggcggcg ctggggtggc tgttcctgtc ggtcctgttc cgccccttcc tgcctgcgga     65400
     tcagatcgaa agctacatcg cggggctgat cctgctcgcc gccgccccct gcacggcgat     65460
     ggtcttcgtc tggtcgaacc tctcgaacgg cgagccgcat ttcacgctga gccaggtggc     65520
     gctgaacgat gcgatcatgg tcgtggcttt cgcgccgatc gtggcgtttc tgctgggtct     65580
     ttcggcgatc accgtgccct gggcgacgct ggtgctgtcg gtggtgcttt acatccttgt     65640
     gccggtggcg gtggcgcaat ggatccgccg ccgcaagctg gccgaaggcg gcgaagcgct     65700
     gccacggctg ctctcgcgcc ttggtccggt gtcgatcctt gcgctgctca ccacgctggt     65760
     cttgctcttc ggctttcagg gcgaacagat tctggcccag cccctggtga tcgcgcttct     65820
     cgcggtgccg atcctcattc aggtctattt caacgcggcg cttgcctatt ggctcaaccg     65880
     cgtgaccggc gaggcgcatt gcgttgccgc cccctcggcg ctgatcgggg cgtcgaattt     65940
     cttcgaactc gcggtggcgg cggcaatcag cctgttcggc ttcacctcgg gggccgcttt     66000
     ggccacggtg gtcggcgtgc tgatcgaggt gccggtgatg ctctcggtgg tgcggatcgt     66060
     ggcccgcacc aagccctggt atgaaagcgg ccccgccgtg cgggcgcggg ccgggcattg     66120
     atctcagcag cacgtcccgg agccgcagcc gcaaccaccc gcgctgacgg ctgtggcgct     66180
     gccggtgacg ggaaagcccc gggcgaccca gcgggccagc ccgtgcttca tgttcgtcac     66240
     cttcgcatag ccctgataca tcaggaaata ggtggccttg aggctgcgat caccagtggc     66300
     acaggcgagg atcacctcgc ggtcgcgcgg gatttcggca aagcgggcct cgaactggct     66360
     cagcggaatc gtcatcaccg cgcagcccgc aaagccgcag gcggcaacct cgtccgcctc     66420
     gcgcacatcg acgagcagcg ccccctcggc cagccgcttt tgcgccgtgg tcgggcaggc     66480
     gtcgcgcgcc tcgggcagat cgacctgggt catctcacgc ctcctcttgc agccagacca     66540
     gcacctgatc gcggctcggc accgcgccct tgtgaacgac cttttccccc accaccacgg     66600
     caggcgtcgt catcacgcca tagccgacga tctggcgcat ctcctcgatc ttgacgatct     66660
     cgaccggctt gcccgcctcg gccgccacct gcgcgatcag atcggcggtg gccttgcact     66720
     tggcgcagcc cgtgcccagc accttgattt ccatgattta ccctttcaga acagaaagtt     66780
     gaacagatag cccacggcca ggatgccgct gcccaccacc cccacgaaga cgccgatcaa     66840
     ccgcaggctg aggacctgtt tcaggatgat catctcgggc agcgaaagcg cgatcaccga     66900
     catcatgaag gcgagagcgg tgcccaaggc cgcgcccttg cccaaaagcg cctcgatgat     66960
     cgggatcacg ccggcggcat tggtatacat cggaatgccg attgccacgg cggcgggcac     67020
     cgaccaccag gcctccgccc ccatgatccg cgccatcaga tcctcgggca catagccgtg     67080
     gatcagcgcc cccatgccga tcccggcaag gatccagatc cagacccgac cgacgatctc     67140
     gcgcagcgcc gcaaggccca ggcggtagcg gtccaccatg gtcagccggt cgccctcgaa     67200
     ggccgcgggg gcgctggcgc cggaatgaat gtcgcgcacc caatcctgca accagctctc     67260
     cagatgcagc cgcccgatca cccagcccga gacgatggcg acggcgagcc cgaagaagaa     67320
     atagaccgcc gccacctgcc agccgacgag accgaagagc agcaccagcg ccacctcatt     67380
     caccatcggc gccgagatca ggaaggaaaa agtgaccccc aaaggcaccc ccgccgagac     67440
     aagcccgatg aagagcggca ccgccgagca ggagcaaaac ggtgtcacca cgcccagggc     67500
     cgcggccatg acattgccca ccccctcgcg ccgcccggcc agcagggcgc gggtgcgctc     67560
     gggcgagaac cagctgcgca gcaagcccat caagaacacg atgagcgaaa gcagcatcag     67620
     caccttgggc agatcgtaaa ggaaaaacgc gatggcctcg ccggtgcggc tgtgacgatc     67680
     aatgggcaag agcgcggtca gcgcctcggc ggcgggggag agttggcggt agaccagcgc     67740
     ccagaagatc aacgccagcg caaggccaag gtgccaggcc caggcagggg cggggcgtgt     67800
     cgaaagcgtt tgatcgctca tgcggcgctc ctttccgcgg tggcggcggc ggcgagaacg     67860
     gcggtcagca cggcgcggat ctcgggcggc atctccgggt tcagccgata gcgcacccat     67920
     tgcgcgtcgc gccggtccac caccagcccc gcctgtttca gcgcctgcat gtgccgtgac     67980
     atccggcttt gcgtggcatc aagcgccgcc atcaactcgc agacgcaatg ctcgcgcccg     68040
     tccgcaagac ggatcatcgc cgccaaccgg gtcggctcgg ccaaggccgt cagaacggaa     68100
     agaatcatcg gacacctctt gcgctttcgc gcatattcgc cctggcgcat gccatgcgtc     68160
     aaggcgcata tggatgcgcc tcagtcctgc gccagcctgc gggcggccca ccagctggtt     68220
     gcggccatgg cgcctgcggt ggcaaggcac agcgccagcc cgccgaactg gcagctgagc     68280
     cccgacaaaa gcgtgccgat cagccgcccg gccgcattgg ccatgtagta aaaaccgaca     68340
     tcgcgggtga tccgccgcgc atcgccaaag gcgaggatca gataggaatg gaccgaggaa     68400
     ttgaccgcga agacgaagcc gaaggcgagc agtccgatga gcagcgttgc ggtcagccag     68460
     ggcgcggggg cgggggcgat cagcaccgcg gctgccagcc cgaaggggat cggcaccaga     68520
     tagcccgccc aggtgatcgc cttcgtcacg atcgcggcct cgggctggga tttcgcgccc     68580
     aagatgcggg gggcaaaggc ctgcaccgcg ccgtaggcga tgatccagag cgccatgaaa     68640
     ccgccggtca gaaagaacgc ctcgcggcgg ccctcggccg tgccgtcgga gagaaccgcc     68700
     tggaaataga ccggaagccc gacgacgaac cagacatcgc gggcgccaaa aaggaacatc     68760
     cgcgccagcg aaagccggtt cacctgcggg tcctgcgacc gccagccgcc ccaggcctcg     68820
     tcggatttca tcttcccggg caggcccttg ggcaggaagg ccacgaccgc gatcaggatc     68880
     gccgccagaa gccccgccat gccccagatc gccggcttga agccgacaag cgccagaagc     68940
     gccgcgccaa ggaagaagcc gagccccttc accgcgttct ttgacccggt cagcgccgcc     69000
     acccagcgaa acagcccgcc ctcgccgctg ggggcgagca gtttcaccgc cgatttcgac     69060
     gacatcttgg ccagatcctt ggcaacgccc gagacaccct gcaccgccat cacgaaagcg     69120
     accgaggcgg ggatcgacca gcccgggtcc agctgcgtca gcgcgaccag cgccgcgacc     69180
     tgcaggccaa gcccgccgta aagcgtggcg gccaggccga accgcgccgc cagccagccc     69240
     gcgccaagat tggtggcaat gcccgcgact tcgtaaagca gaaacagcca ggccagcgcg     69300
     accgggctga agcccagccc gttgaactgc aacagcacca gcatccgcag cgcgccatcg     69360
     gtgagcatga aggcccaata ggcggcggtg acggcagcgt aggcgcggat cggattggcg     69420
     ctcacaacga ccccgccacc attcgggcga tatcggccat ccggcagaca tagccccatt     69480
     cgttgtcata ccaggcgtaa agcttgagct gcgtgccatt gaccaccatc gtcgaggggc     69540
     cgtcgatcac cgccgagcgc gggtcgttgg tgaaatccga cgacaccagc ggccgcgtct     69600
     cgaaaccgag gatgccgttc agccctccct cggcggcggt ctgcagaagg ctgttcacct     69660
     ctgcgaccgt ggtcgggcgg tcaagttcga agacgcaatc ggtcagcgag gcattcaaaa     69720
     gcggcacccg gacggcatgg ccattgagcc gccctttcag ctcgggatag atcagcgtga     69780
     tcgccgtggc cgagccggtg gtggtgggaa tgaggttcat cagcgccgac cgcgcccggc     69840
     gcaggtcttt cgcggggcgg tcgacgatcg tttgcgtgtt cgtcacgtca tgcagtgtgg     69900
     tgatggatcc gtgtttgatt ccaagcgctt cgtggatcac cttcacgatg ggggccaggc     69960
     agttggtggt gcaggacgcc gccgtgatca gccgctggct gccatcgtaa agcacgtggt     70020
     tcacgccata gacgaggttc agcgcgcccg tatccttgac cggggccgaa acgacgacct     70080
     tgcgcacgcc tgcatcgaaa tagggctgga ccttggccgc ggtcttgaac tgcccggtgc     70140
     aatcgagcac cagatcgacc ccgatctcgg ccaggggcag ggcttcaagg gtcttttccc     70200
     gcgtcagccg gatgcgctgc cccgcgatct gaagcccggt ttcggtggcg gcaaccgggg     70260
     tcggccagcg gccatgcacc gtgtcgaact cgagcagcag cgcatgggtt tcggcgtcgc     70320
     ccatggcgtc gttcaaaagc acgatctcgg gcccgcgccc cagatcgatg agccgccgca     70380
     agagcagttt tcccatccgg cccaagccgt tgatcgcaag tctcgccatg gctcaggcct     70440
     tttcgggcag ggcgccgatc gcatcgacgc gggtttgcag cgccagccgg tcgagcgtgg     70500
     caaagggcag gtcgacaaag gcggcaatgc ggcggcgcag cgccccgtag gtctgggcga     70560
     aaaccagcgc gcgttcggcc tcggtgccgg tggccttgac cggatcgggc aggccccaat     70620
     ggccggtgat cggctgaccg ggccagggcg ggcagtcctc ggccgccgcc gtatcgcaga     70680
     cggtgaagac gaactccatc tgcggcgcgg cggggccctg gaactccgac agatgcttgg     70740
     cgcgcaggcc cccggtgtca tggccgttgc ggctcagcac ctcgagcgcg aaagggttga     70800
     tcgcggtccc gggccgcgtt ccggcggaat gggcggtgaa cttgcccgcg cccagatcgc     70860
     gcaggagcgc ctcggcaaag atcgagcggg cggaattgcc cgagcagatg aaaagcacgt     70920
     tgaagggcgt gtcgggcatg ggatttgcct tttcatgaag agctttgggc atcaggtcgg     70980
     gccgggcccg gcccagatcg agggcgagat agccgatcag ggattcggtt ttgtgaagat     71040
     cgacggcgta gaaaagcgac cgcccctgcc gggtgactgt gaccagcccg caagcagtca     71100
     gatccgccag atgatgcgag agggtgtttg gcttcagccc cagcgccgcg gcgatttcgg     71160
     tgggccgcac gccctgcggc gcaaagcgca tgagcatccg gaacaccgac aggcgaccgg     71220
     gatggccaag acaggcaaag gccgcggcgg cctcgggggt ggggcaagtg ttttccatgc     71280
     ttcctgaata caggaagcaa tccccccgtc cagtgaagct ttcatgacaa tccggcgaca     71340
     ggcgtcacgt ctcgcagatg acgcggccga tgtcgcgcag atcgtacccc ccgatggcgc     71400
     cgaattcggc cttgaaggcc tgcgagcgca gcaccgacag gagcgcctgc acctcggggc     71460
     ggggcagatg ttcggtcttc accacaaggt cgtagcgttc gcgctgcatc ggcagaaagg     71520
     cgaccccatc cacctgccgc gcgatctttt ccgtgcccac cgcgatatcg gcctcgcccc     71580
     gtcccacggc gcttgccagc gccagatgcg aggcgctttc ctgcccgtag ccggcaatcc     71640
     ggctaccgga aatcccgagc cgtcgcaggt gttcatccag cagcacccgc gaccccgccc     71700
     ccttttcgcg gttgatcatg cggatgtcgt cgcggccgaa atccgcccag ccggtgatcc     71760
     gcttcgggtt cccttcggcc acataaagcc cctgcatccg ccaggtgaca ttgacgatcg     71820
     tgcaggcaat gcccggcagc agcgcccgca catgcgcaat gttgtagctg tcgctggcgc     71880
     cgtcccacag atgcgccgtc gcgacgccga cccggtcatg atacagcgac acaaggctgt     71940
     cgtagctgcc gatataggcc cgaagcgcca tcaccccgcg ctgccgcagc aggttcgaaa     72000
     gcacgtcaag gatcagatcc tgcccgcaga tcacgaagcc cgcactgccc ggccgctgcg     72060
     cgccaaggtc gaaatgacgg ccctcctaca gcaccaccgg cccggggcgg gcggcggggc     72120
     aagccgttcc ctcgacatag gcgcgcagct gcgccgcgct gaagcggatc ttgcggccga     72180
     ccttgtaatg gccgatcgcc cccgccttga tcagcgcata gaccccgctt ttcgagatct     72240
     tgagccgcag cgcgacctct tcggcggtca tggcatctgt cggggcatcg cttgcagcat     72300
     cggacatggc acgggccttt ctgcgatttc gtgatggttc gccctattcc gcgcattcac     72360
     gatcttccat cggcccgagt caattcgttt tcgctttact tcgcgccgat atctggcttg     72420
     atccggcgag cagacagcaa aacgggtgca aaagctgcat tttcgccccg tttcgcctcg     72480
     gttcacgcat cgaaaggtcc gccatgccgc agcccttcgc acccctgccg cctttctctc     72540
     gggcggggtc attggcaccc tgggcgggtt gatcggcctt ggcggtgccg atggccgatc     72600
     tggcggcgca atggccggtg atcgtgaatc tgctggcggg cagtctggcc ggggcgtggt     72660
     ttggcgcagg ctgggcgacg cgtttgcgct ctgacatcct gttcaaggtg atcgcggcgc     72720
     tgatggcggg aattgccgtg gtgcttctga ccggccacgg cgtggcgtcg ggcgcggccc     72780
     tcgtcaccgg cggcgcgcag atcggtctgg gcgtggtcgc gggctttgcg atcggcatcg     72840
     tcgcggcgct gatgggggtg gcggggggcg aattgctgat cccgacgctg gtgatcctgt     72900
     tcggggccga catcaagctg gcggggtcgc tctcgcttgc ggtcagcctg ccgacgatgc     72960
     tggtgggttt tgcccgctac agccgcgatc aggcctttgc cacgctgggc cgcaaccgga     73020
     ttttcgtcgc ggtgatggcg gcaggctcga tcgcaggcag ctttctgggc gggcatctgc     73080
     tgggccttgt gcccgaggcg gtcctgctgc ccggcctcgc gctcattctg gtgatttccg     73140
     ccttcaaggt ctggcggcac aagtaggcgg gtggtgactt ttgccgcaat gacctgaccc     73200
     gcccgccttc gcgatttcct gaggatcgat cacgtggcgg cgtcgacggg gagcggccct     73260
     tcgtgtcgcg acctggcgtc acgctgcggc ccgctcgggc gaccgcttcg gaggttgcgg     73320
     ccgggcggat cgaccgacgg caaagggccg ggtccgtcga tcaactcgtc gccttcgcaa     73380
     cgggcgggaa gctgtccgat gcaagtgcgg cattccagtt gcgtcaagtc ggcaagacgg     73440
     acgctcacaa aaccgcagct agctttctta gtaaatgatg agcatatact caggggtgaa     73500
     tagcgcaaaa gaaagcgcat tgaagttgtt tgtgcagacc aagagattta aacgtaagtg     73560
     gtgagcattt tctcggcgcc catatcgtga ggaattcgta caaatgcgga tttcgcgagt     73620
     aagaatagcc aactttgcaa atttctccga tctcgacgtc gagacgggcg agagcatcgt     73680
     catcgtcggt gaaaacaagg tcggcaagag caacttcatc cgcgccctgc aactgatcct     73740
     cgaccccggg ctctcggaac gagaccgcca actcggactc gaacatttct gggatggctt     73800
     aggagaggac aagcttggcg aggcgatcga aatctcaatc gatctgacgg atttcaccaa     73860
     cgatccgcgt ctgatggcgc atctcaacga ctgcgtggtg gacccgggcc cgccaatggt     73920
     cgcgcgcctt acgtaccgct tccagccaaa ggcaaatctc ggccgtgatc ccgaaagtct     73980
     ggctgactac gagtacgtca ttttcggcgg cgacgatccc gatatggcga tcgggtcatc     74040
     attgcgccgg atgctcccgc tcgacgttca ggtggcgcta cgtgacgcag agaaagacct     74100
     gtcgatctgg cgaaattcgc cgctaaggcc gttgatcgaa cagttggcaa cttcgctgga     74160
     cgaagacgct cgcgacgaaa tccaggaaca agtaaacgag gctcaagccg agcttgccgg     74220
     tcatgccgag gtggttgcta ccgcgcagcg gatcagcgac cgcctgatcg ctattgcggg     74280
     tgagcagcat gccgttccgc tcacgctagg cctagctccg acgcgggtcg atgcgctact     74340
     gcgtagcctg cgcctgctga tcgacaatgg tgcgcgcagt attggcgatg ccagcctcgg     74400
     caccgccaac ctgatctttc tggcgttgaa gagcctcgag ttggatcgtt tggtgactga     74460
     cggcgagcgt gaccacacct tcttcgtggt cgaagagccc gaggcgcatc ttcatccgca     74520
     tgtccagcgg ctggtctatc ggtatttcct cggcggcgct gcagatgacc aagaagatgc     74580
     tccgcctctt acgaccatcc tcacgacgca ctcgccgcat atcgccagcg tcacaccgat     74640
     ccgctcgatc gtcctgctcc gctacgacgc cggcgaggat gcgacgaccg ccgtctcgac     74700
     agcgacggct ccgctgacgg agcgcgatga ggccgacctc cagcgttaca tcgatgtcag     74760
     ccgcggcgag atcttctttg cgcgaggcgt catcctcgtt gagggcgatg ccgagcggtt     74820
     tctcattccc gcattcgctg aggcgctgga catcccgctc gacatgctgg gcatcacggt     74880
     ctgctcggtg agcggcacca atttcacgcc ctatgtgaag ctgctgggtc cgcagggcct     74940
     gaacattccg cacgtcatcc tgacagatcg cgatccgaac ggcacgaggc cgccgctggt     75000
     acgccgccgc ctcatcgagg tgctgaatct ggtcgagaac ggggtggact acacgccgct     75060
     cgacgccgat gccgtgatcg cccgcgcgga gccactcggc tatttcgtga atggcaacac     75120
     actagagccg gaactgttct gtggcggcct cgcggacgcg atgcaggaga tcatagaaga     75180
     ggaactgcca atcaatcagg cgacccgcga cctgctgcaa ggctgggtcg acgacaccga     75240
     cacgctcgat gaggagaggc tgatcaaact catcgaacgg atcggcaagg gacgcttcgc     75300
     gcaggcgctg gcgccgtacg tcgaggagga tacgtgcccg gactatatcc gcaaggcgct     75360
     ggagtacatt cgcgatgccc ttgcgtagtg tcagcgccgc ctatctcgcg caagcagcgg     75420
     acttggccag taacccgggc cagcaagccg cctatgactc gaccggccat tgtgtcgtgc     75480
     tcgccggccc cggcagcggc aagaccaaga cgctggtgct caagcttgcc cggatcatgg     75540
     ctgaagacgt acgcgcgcca cgcggcgcgg catgcatcac ctacagccag gagtgcgcgc     75600
     gcgagctgac gcgccgactg gagcggctgg gcctgagaga ggcgccgaac ctcttcatcg     75660
     gcacggtcca tggtttttgt ctgaggcatc tgttgatgcc ctatggccgt cttgccaatc     75720
     tgccggtgcc gttcccgctt gcggtcgcca cgcaacgaca gagcgaccag gcgatgaatc     75780
     gggtcgggga caggctcttc ggcgtaggtc atccgaacaa gccgatggat ctggggcgtc     75840
     atcggcgatc gatattggac aggacgtcgg aagcctggac agatgaggag gagcttgcgg     75900
     catgggccga gggctacgaa gccgagctgc ggcgaacagg tctcgtcgat ttcgatgacc     75960
     tcgtgatttt cggccagcgt ctggtgtcgg aacacgactg ggtgcttccg ctgctccaag     76020
     cgaaattccc agtcctagcg gtcgatgaat atcaggatct cggcgttgcg ctgcaccgca     76080
     tagtcaagcg cgtcgccttc gacgggggtg tccgcctctt tgcggtcgga gatccggatc     76140
     agtcgatcta cggcttcacg ggtgcggacg gagctttgct ggaggagcta gcggagcgcg     76200
     acgatgtcga gcgcgttcag cttcaactca attatcgctc ggccacgcgg attgtcagtg     76260
     cctccgaaat ggcgctcggc gaggatcgcg gctaccgatc gaacgacccg gatcgccagg     76320
     cggtgatcgc cttccttgaa tgcgacgatg gcctggtagg ccaggccgcg cacgcggtcg     76380
     ccgagatcat cccagcggcg cttgccgcca aaccgggacg tgcgctcggc gacatcgcca     76440
     tcctctaccg ggactatcgt gccggcgacg tggtggcgga agcggtcgcg tccgccggtc     76500
     tcgactttgt gcgggtcgac acggccgcgc cttatcgcaa ggtcgcactc acgagctgga     76560
     tcgaggactg cgccgcctgg tgctcggggg gctggcgcaa agcacagccg caattgcgtg     76620
     gcttgttgga ccgctggatc ggtttccatc gcgcacggat ctcggacgcg caagccagcg     76680
     cggaattgca aagcctcacc cggcttctct ggtcgctccg ggttgaagag gggctggccc     76740
     gaaacttcgt agcggcgctg cgagcaggaa tgctcgacgc gctgatggtg gacgagccga     76800
     gccttgccga tcagcgcgaa caggtcgagc ggatgtcagc ggcagtggcc gtgggtgggc     76860
     cgcttgcgga ccttgacctc gcaagtcttg ctgggcgtga tggctcacca cttcacctca     76920
     atttgttgac gctgcactct gcaaaggggt gcgagtacga tgtggtcatc atggtggggc     76980
     tcgatcttgg cagcctgcca tggcgtaacg aagcacctgc ggcccagcgt gagagtcgac     77040
     gtctgttcta tgtggggcta acgcgggccc gcgatgaaat ccacatgcta tattctggtt     77100
     tcgtcgatac ccgcttcggg aggaagtatt ggggacgctc tccgttcctg aacgagcttg     77160
     aggcgcgaat gcgggaagcc gaaggcgact aggtgaaaag tggcgcaatt cgcaacaatg     77220
     gcgcataatc ggccggtgaa agcaacgagc gactgcttcg ggaaagccgc gctgcggcgt     77280
     ggacacgctt tagaccgtcg gctttgggcc gggtacgtcg atcaactcgt cgctttcgca     77340
     acgggcgggg agcggcctgt gagtttgcgg catcgcaccc gcggcaattc gtgatagctg     77400
     ccggtcgccg agagcttcgg gaatattgca tgcaacgcgc aggttgctga cgcggaactc     77460
     aatcggtcgc ccattgggcg accgcttcat ctcgctcatc agcggacagt cgttcaagtt     77520
     ttatgggggc aacagaatcc gtaactcatg tcagttgaac gcgatgaggt gacgggctgc     77580
     agcgatgggt tgcccggaat aatttccgcg aagccctctg gcttgcctct ctgctgccaa     77640
     ccgttcttgc gggaccctct gcgctgctga gctctcacgc aaggctcgcc gtttgcggcc     77700
     catggaagaa gttcgcggtc gcccctccgt cgatcaggaa atcgctgccg gtgatgaagc     77760
     ccccctccgg ccccatgata tgcgcggcaa gggatgccac ctcgtcgggg gtgcccgcgc     77820
     gaccggcggg catctgtttc agcatcgcct gataaaactc tgcgcgctca ccgtgcaact     77880
     catcttgcgc aagcggagtg acgatgatgc cggggctgat cgcgttgatc cgtgcgtcgc     77940
     gcttcgccca gttgacggcc tcgccgcgca ctcgaagcga gttgcaccgc ttcgacatct     78000
     gataggcgtg cagcgtgtcc gtcacgccct tcacgaagtc cagcgccagc aggtcatcgg     78060
     ccggggccgt ggccagaagc gcatcctgct ccgccgacag ggctggcatg cgatacccgg     78120
     actgcgacga gatcaccaag cccgaaccgc ccggcgcgat cacgcggccg aattcttcaa     78180
     gcacgacggc tgtgccgtaa agatcaacct tcaggatcgc cgcgatgggc gcttgcgacg     78240
     gggaaacgcc cgccgcctgc accacggcct tgatcgcccc gagcgtcccg gcccgagcgg     78300
     caacagcctg aaccgccgcg cggtcagaga tatcggcctg catggctgtc acctcgaacc     78360
     cggcgcgtgc aagcccctcg gccgccgcat cggccgaggc ctgggtccga ttggccacca     78420
     cgatcaggcg gccaatgctg atccgacggg cgatggcctg gccaatcccc ccggcgccga     78480
     agacgacggt tacctccatg tcaatcctcc acctgcagca tggtcttgat ggcgcggcgt     78540
     tcgtccatgg ccttgtagcc ctcggccacc tgcgcaatcg gcagcaccag atcgaagacc     78600
     tttccgggct ggatcctgcc ttgcaggacg cgctccatca gatcgggcag gaagcggcgg     78660
     acgggcgcgg gaccacccag catccgctgc tgcttgaaga acatctgttg cccgtcgaaa     78720
     ctgaccccat gcggcacgcc gacatagccg atcgacccgc cggggcggca cacgcccgtg     78780
     gcctgcgcca tcgagccgac ggtgcccacc gcctcgatca ccgaggcggc gccgatgccc     78840
     ttggtcaact ccatcacccg ggcaatcccc tcggccccgc gttcggacac gatgtcggtg     78900
     gcgccaaatt cccgcgccag cgccgagcgg ctttcatgtc cgctcatcgc gatgatccgc     78960
     tcggccccca tctgatgcgc cgccatcaca cccatcagcc cgaccgcgcc gtcacccacc     79020
     acaacgactg tgccgccctc gcgcacatcg gccgcccatg ccccatacca gccggttccc     79080
     agcacatccg acaccgccag aagatgcggg atcatcgccg catcgggcat ttccttggtg     79140
     gcaaccagcg tgccatcggc caagggcacc cgcgcatagg gggcctgcgc ccctgacatg     79200
     aattcgcgtt gcgcgcacga cgattgaaag ccgaactggc aatgcgggca ggtgttgtcc     79260
     gacagacaaa agctgcccac gacgaactga ccgggtttca cggtgcggac ctcggcgccc     79320
     acctcgacca cgacgccgca gtattcgtgg cccatgtgca tcggcgcggt gatcgggttt     79380
     gcgccgcgat agggccaaag gtccgagccg cagatgcagg tggccgacag cttgatgatc     79440
     gcatcggtgg gtttgaggat tttcggatcc tcgacgcgct catagcgaac gtcgccgggg     79500
     ccgtgcagaa cagttgcata catgatcgtg cctccttacg cgccgtagtc ggcgtcggta     79560
     acgtgctcca tccaggtgac gacctggccg tctttcacct cctgaagcgc gatatggctc     79620
     attgcggtgt cgggggcggc gccgtgccaa tgccgttcct cgggggcgaa gcagacgaca     79680
     tcgccgggat ggatttcctc gatcggtccg ccttcgcgct gcacccttcc gcgcccgaag     79740
     gtgacgatca gcgtttgccc cagcggatgg gtatgccatg ccgtgcgggc accgggttca     79800
     aaggtgacat gcgcgccctg cacccgttcg ggcgcggcgg ggttgaagag cggatcgacc     79860
     cggacggttc cggtgaacca tgccgaggga ccgacaaacg aggcacgcga acccgcgcga     79920
     tgaatttcca tgacatgtcc tttcggggcg ggccgttctt ggccgcggca tcgccgcaag     79980
     ctacgggttt tgcgtttcgg cgataatgcg ctagaccggt attgggtcta tcatctgggg     80040
     atatgaatgc ggcgcgatga aatgggcgat ctgatcgcct ttctggcggt ggcagaggag     80100
     cgcagcttta cccgggcggc ggcgcggctg ggcacgtcgc aaagcgcggt cagcgcggtg     80160
     gtgcgccgac ttgaggagcg gctcgacgtg cggttgttga cccgtaccac ccggtcggtt     80220
     tcggtgaccg aggcggggca gcggctggtg gatgcgctgc gcccggcctt tgacgggatc     80280
     gaggcggagc tggcggcgct tgatgatatc cgcgcccggc cgcaaggcat gatccggctg     80340
     acggcaagcc gccatgccgc cgagcggatc gtgatgccgg tggcgaaccg gctgatggcg     80400
     gattaccccg aggtgcgggt ggaaatcctg ctggatcaac gctttgtcga tatcgcgaaa     80460
     gagggcttcg acgccggcat caggcttggc gaaagcgttg atcgcgacat gatcggggtg     80520
     cgcatctcgg gggatctgca gatggtcgtg gctggatcgc ccgcctattt cgcccgccat     80580
     cctgcgccgc aaaccccgca agacctgacg gcgcacaact gcatcaacct gcgcctgccg     80640
     accttgggcg ggctttacgc ctgggaattc gaaaaggacg gccgcccgct gacagtccgg     80700
     gtcgaggggc agttcaccac caacgacccc gagcttgcgg tggctgcggc gctcgaggac     80760
     cgggggctgg tttgcctgat gaccgattac cttgccccgc atctcgcctc ggggcggctc     80820
     gttcgggtgc tggccgactg gtgcccgccg ttttcgggct atcaccttta ctaccccagc     80880
     cgccgccaga tcaccccggc gttccggctt ttgatcgacg ctttgcgctg gcgggggtag     80940
     cccctccgcc acgggcccgg gcgtcagcgg taggacaggg caaggatcgc ctcgggcaac     81000
     cttgcgcctt gcccgcggcg atcagatcgc gcaccgcgcc cgcgacatcc tccatcggca     81060
     catcgggatc gacccggtgc tgatagaaaa gatcgatcac ctcgacgccc aaccgcttca     81120
     gactggcctc ggccacctga cggatgcgct cggggcggct gttcagcccc cagtcgcgcg     81180
     ccccggtgac ctgatcgatg ttccagccga atttcgtggc aatcgtcacc ttgtcgcgga     81240
     tcggggccag ggccttgccc agcaagacct cgttcgtcca gggcccatag acttcggcgg     81300
     tgtcgaaatg cgtcaccccc agatcgtaag cgccgcgaat gaccgaaatc gcctcggcct     81360
     cgccgggcgc cgcgccatag gtggcggcga aactcatcgt gccaaagccg atttccgaga     81420
     cctcaagcgg gccaagtttg cgggttttca tgggtttatc ctttcagatg agggttcagg     81480
     ccttgtgaac gccaaggctg acattcccga gggcgggttg acctgcgagg gtcacgatca     81540
     gatcggcgac gctcttgcgc gagacagcgg caccggaatt gcggaaagtt tcgcccttga     81600
     gcgtggtgcc ataggcgatc tcgtcgcgat cgttcagcca ggcggggcga atgacggcat     81660
     agtctagacc cgaggtttcg atgacgcgcg ccgaggcacg atagggatcg aggatcgcgc     81720
     cgggcgctct ccgggcacct cgtcgtagat ccccatcgag gagatgaaga tgacgcggcc     81780
     gacacccgcc gcctgcatcg ccgcgacgat ggctttggcc tgcgcctcca tcgcgcccca     81840
     gaggttggca tagacgagat cctgacctgt catcgcgctg gccagcgtcg ccgtgtccag     81900
     aacgtcgccc gtgaggatgc gggtgcgatc ggtctcgggg ccaagccttc gggcggcatt     81960
     gcgcgcgtaa agggtaagtg tcgcatcggt tcgggcgagc agttcctgcg tcgcaacccg     82020
     cgcaatctgt cccgccgcgc caaggataag gatcttcatt gcggtccccc gtcaggccgc     82080
     gatgaaagga tggacgtcgc gccagatgaa gcgcgcgacg cgtttggcaa tcagccattc     82140
     tccgttcacc cgcaaatagc tgtcactgta gatgacgccg ttcgagtttc gggtcttggc     82200
     cccctcgggc tcgccgatca gctcgacggt gcagtcatgc gtggcggtgg cagtatcgcc     82260
     gtcgatctcg gcggtgaact ggccattcac atgatagacg gtgtcgaagg tcgcgaggaa     82320
     cggcgtccag ctgtcctcga tcgccttgcg gccgcgcaga gggggcagcg ccgtctcgcc     82380
     aaaccaggtt tcgacgaccc cgtcttcggt gaagaggaag gtttgttcct gcacctgtct     82440
     ggcgtcagca aggttggaga aagtgtccac aagggcttcc tgaccggggc gatgaccaag     82500
     gataccgcgc tggccgagtc cgacttccgc aagaccctgc cgcgtttcac gcctgaggcg     82560
     atggagaaga accaggcgct ggtcgacctg ctcaggcaaa ttgcggcaga gaaggaagcg     82620
     acaccggcgc agatcgcgct ggcctggctc ttggcgcaag cgccccggat cgtgcccatc     82680
     cccggaacca gcaaggccta tcggctcgaa gagaacctgg gtgccgccga gattgtcctt     82740
     gcgtcggagg atctcgcgcg gatcaaggcc gcaacagcga atattcatat cgagggcgag     82800
     cggcacaccg aggctggcct gaagaccgtt ggtctctcat atggcgacct gaaaatgagc     82860
     gtccacgttg atcctcgctg cgcccgaact tttcggtttc gggcgcgctg gcgtcattct     82920
     tcgtagacgt catcgattga cccgcttggg cgtcgcgtcg tcattcgtca gcttgcgacc     82980
     cgatcatggg gtctaagccc ctcccccgcc ttcagcgtgt tgataggggc cgcgatatcc     83040
     tcgcgctcgt ccatgaactt ggcgtcggac tggatcaggc ccatgatgtc gtcgcaatcg     83100
     atcaggcgat gcaggcgaca ctcgccaaga tcgtgaccgg gacaaaacgg ttggcgccgc     83160
     caagccgggt ttcgggggcc gatgtaacgt gcaaggattg gcttgacgtg cggaacgcaa     83220
     gacaggaagc aagcgcggag aacgccgccg ggatcaatcg agagagcgac aacgacgaac     83280
     acttcggggc tgaagaagat cgcagcactc ctggcttccc ctgaaacgcc caacagccat     83340
     aagaggatag cgcgtccggc gtcattgatg cacccggccc ggaaccgccg ggcgccgtcg     83400
     cggcttggcg cgccaaagct gactgtcgat cgcgccgcag cgagaatttc ggcaggcccc     83460
     gggcaatgat gctttcatcc gagctttggc aagtcgcaca tggacgatcc tgcaggcccc     83520
     cttccgcccg gctcgagaca caatgcgtgg cccgtacaag ccgtgccgaa agggcacttc     83580
     aagcaggggt tgcgcgaaaa cgcctcgcga gccagggaaa tacccgcaca aaggttgcaa     83640
     tgtcgcaatc agtcgtttac gacatgcgcg tcggtttcgg ccgtctttgt gccttgcgca     83700
     ctgtccatcg accgcccttg cggttggcat gacctggccc tgtgtctccg tgacgctttc     83760
     gatttgggcc ttcgcaatca aacgggtttc cggttgctgc ggcgcgccgg tcatcgtcac     83820
     gaacgcgccg cacacaggag gacgccgatg aagaagccgt ttgcttctgt ctggctcacc     83880
     gcatcttttg ccgctttggc cgccccggtc atggccgcag aggactgcgg aagggtcagc     83940
     attgcggaaa tgaactgggc ctcggccggt gtggccgccc atgtcgacaa gatcattctg     84000
     gaaagcggct atggctgcga ggtcgaactg gtcaccggcg acacgatgcc cagcttcacc     84060
     tcgatgaacg aaaagggcga acccgacatg gcgcccgaat tgtgggtgaa tgcggtgaag     84120
     gtcgcgctgg ataccgccgt ggccgagggc cgcctgatcc tggcggcgcc gctgctggcc     84180
     gagggcgggg aggagggctg gtgggtgccc aaatacatcg tcgacgccca tccggagatc     84240
     accaccgttt cggcagccct tgcccgaccc gatctgttcc ccgcgcccga agatcccggc     84300
     cgcggtgcgg tgcacaactg cccctcgggg tggaattgcc agatcaccac cgaaaacctt     84360
     taccgggcgc tggaggccga gaccaagggc ttcgatctgg tcgataccgg gtctgcggcg     84420
     gggctcgacg gttcgatcgc caatgcccat gaacgcaagc tgggatggct gggctattat     84480
     tgggcaccga ccgcaatcct tggcaaatac gagatggtca agctcgattt cggcgtgccg     84540
     ctggacaagg cgcatttcga cgcctgcacc tcgcagcccg attgccccga cccgaaggtg     84600
     accgcctatc cggtttcgga ggtggtcacc gtggtcacca gggcctttgc cgaaaaggcc     84660
     ggcgtggcga tggattatgt gcagacccgc aaatggtcga atgccaccgt caatcaggtt     84720
     ctggcctgga tggaggcgaa ccagggcacc aacgaggacg gggcccggca tttccttgaa     84780
     acctgtcccg agctttggcg ggactgggtt ccggccgatg tggcgcaaaa ggtgaaagcc     84840
     gcgctttgag cccggcctgc cctctggcgt gcggcggcct gccgcgcgtc ccccgttatc     84900
     acaaccgtca ggaccttgca tggcatccga ctgctggagc ttgcccgaaa ccctgtgccg     84960
     ctttcccgcg atggaggcaa aaaccctgcg cctgatgcgc aaaagcatcg acgacggctt     85020
     tcgcgacatc gtgcgaagct gggcggacac gatcgacgcg gccacggttc cgcttcagat     85080
     gtttctcaac acgctcgaac acgccttcac cgacaccccc tgggttctgg tgctggtggt     85140
     gttgctcgcc gcggtctggg gcaccgcacg caattggaaa atcgttctgg gcacggcggt     85200
     tgcgctatgt ctgatcggct gggtcgggct gtggcaggat acgatggtga ccttggcgat     85260
     ggtgtcgttt tgcacccttg tggcggtcgt catcggcctg cccatcggca ttgccgccgc     85320
     ccgctccgac aggctgcaac gccttgtcag cccggttctg gacgtgatgc agacgctgcc     85380
     cagtttcgtc tatctgatcc cggtggtggt gatcttcggc atcggcaagg ttccgggcat     85440
     gattgccgtg gtgatctatg ccgtgccgcc gatgatccgg ctgaccaccc ttggcatccg     85500
     gctggtggac cgcgaagtga ccgaggccgc cgaggccttc ggatcctcgg cgcgacaaaa     85560
     gctgtggaac gtgcaattgc ccctggcgct gcccacgatc atgacggggg tgaaccagac     85620
     catcatgatg tcgctgtcga tggtggtcgt ggcctcgatg gtgggggtcg ggggcctggg     85680
     caagaacgtg ctgcaggcga tcaacaacca gttcttcacc gtgggcttcc tgaacgggtt     85740
     tgcgctggtg gccattgcca tcgtctttga ccgcagcagt caggctttcg gcctgcggct     85800
     gcaaaaacac cgcgaggcag gccatgactg aggcacctcc catcttgccc ggcgatgacg     85860
     acgaagaccc cgtcaccggc cgcagcggca tcgagattcg caatctttac aagattttcg     85920
     gcccggaacc cgaacgccac attgccgccg tgaaagccgg gctgagcaag gccgagctga     85980
     accgcaagca cggccatgtg ttgggcctga ccgacatttc cctgtcgatc ccgcccggca     86040
     agatcacggt catcatgggg ctgtcggggt cgggcaagtc gacgctgatc cggcatatca     86100
     acggcctgat cgcgcccacc acgggcgagg tgatccatga cggcgccgat gtctgccgga     86160
     tgagcccgaa agatctgcgc gcgttccgcc gccacaagac ggcgatggtg tttcagaaat     86220
     tcgccctgct gccgcatcgc accgttttgg gcaatacctg ctacgggctg gatattcagg     86280
     gcgtgccccg atccgaaagc gagcccgtgg cccggcgctg gatcgcgcgc gtcgggctga     86340
     agggctacga gggggcctac cccgcgcagc tttcgggcgg catgcagcag cgcgtcggcc     86400
     ttgcgcgggc gctgagcacc gatgccgaca tccttttgat ggacgaggcc ttctcggcgc     86460
     tggatccgct gatccgcctc gacatgcagg cgatcttgct ggaattgcaa agcgaactgc     86520
     gcaagaccat cgtcttcatc acccacgacc tcgacgaggc cctgcggctg ggcgagcgca     86580
     tcgccatttt gcgcgacggg cggctggaac aggtcggcac cggacaggac atcgtgctgc     86640
     gcccggccaa cgactacatt gccgccttcg tgcgcgaggt gaaccgggcc cgggtgatcc     86700
     gcgcggcaac cgtggcccgc ccggtggttg cgggggcaaa gctgcccgaa tttgccgttc     86760
     cgggcccgga ggttctggaa accgttgccc ggcagatgac ggcggcgggc gtcagccacg     86820
     cccgcgttct ggggcggcgg ggacaggtgc ggggcaccat cgccatctcc gacgttctga     86880
     ccgcaatggt gacccccgct gccgcgccgg aacacgacct tacgaaagga tagatcatgg     86940
     atgcggaaaa tcccgaaaac tggttcagcg aggccgtcgc cacattgggg gatcggctga     87000
     cggccgcgcg tgaaaatgcc gggctctcct gcgccgaagc cgcaagctgc ctcggcattt     87060
     ctgtcgagac atataccagc tgggaacagg actccgcttt cccaagggca agtctttgtc     87120
     acatgatcgc ggggctcttc ggcgtctctc tggcgtggtt gctgaccggc gaaagtcttg     87180
     gcgtcgagcc accgcaaaac gacctgcccg cgcagggtcc ctgcctgccg tccaccgatg     87240
     ccgatctgcg ctgcatgcgc gaagacatgg ccgaaacccg tcttcgggtg cagcagattg     87300
     acgaacggct ccaaaggatt ctgctgcacc tggaatgatc gcgcgacagg ccgccgttct     87360
     gcctcccgta ggcattgttg cagacctctg accgtggagg attcacagtg cgaatccatg     87420
     cgctggaatt cacgccaggc agcgacagtg acagccccgt gctgccagat gtgctcggcc     87480
     ggagcgtcgc gatcctgctt gatgtcgcgc gctcgaccga aagcgcggtt tcgggccggg     87540
     cggtttcgcg gtgatccccc atgcaggcca tctgaccgcc gccctgcccg agatctggcg     87600
     ccatctgggg ggcgcctaac gcgcccagga ctggcccgga tcttcctcga catagtcgcg     87660
     cagcagcgcc acatcctcga tttccgccac cgactggcgc acctgcacgc ccttttcgcg     87720
     cagccgggca aaggcgcggc tcaggctttc gggcttcatc cccagacgcc cggcgatcag     87780
     caccttgtca tagggcagca cgaccgcaca ggggccgcgc tcctcgctca catgttcaag     87840
     caggaattcc gccacgcgct gcgcccccga ccgcgccttc agctgctcga tctgcccgac     87900
     cagccggtgc agatgcgcga aggtcgccgc cagcagcgac accgccagcc cgggctggcg     87960
     ttcgatcagc cgcaggattt ccgccgtctc gatccgcacc agcacgacat cggtcgccgc     88020
     ctcggccgag accggataga cgccgccggt aaaggccacc gcctcgccga aactgtcgcc     88080
     gcgggtaaag acgctgacca ccgcctccga gccgttcggc gcgacgcggt aaagcttcac     88140
     ccagccgtcg atcaccatat agaccgccgt ggcgggatcg ccctgcagga agatcgtcgc     88200
     gccgcgatca aggctgcgtt catgcgcgcc ggtcaggatc agatcctgcg ccggtttcgg     88260
     cacggcccgc agcagcaggg atttccgggc aatccggtcg gcatcgggtt tcatcggcgg     88320
     cggtctcctt caccgggtta tcgcatgacc gcagcgccgg cgaaagccgc cgcgacaggt     88380
     ccgcggggcg ttctgcgtca ccccgccagc cgcgcataaa gcccgccccg cgccagcagc     88440
     gccgcatgcg atccgatctc ctgcacgcgg ccgtcttcca tcaccacgat gcgatccgcc     88500
     gcccggatcg tgcccagccg atgcgcgatc accagcgtcg tgcggccccg cgacagcgcc     88560
     tcgagcgcgg cctgaatctc gcgttcggtc tcgctgtcaa gcgccgaggt cgcctcgtcc     88620
     aggatcagga tcggcggatt ccgcaggaag gcccgggcga tggcgacgcg ctgtttctgc     88680
     ccgcccgaga gcatcacgcc gcgttcgccc accagcgtct ccagcccctc gggcagcgcc     88740
     gcgatcagcg cggaaagctg cgccttttcg gcggcggccc gaatctcggc ctcggtggcg     88800
     tccagccgcc cataggcgat gttttcgcgc aagctggtgc cgaacaggaa cacgtcctga     88860
     ctgacgatgc cgatctggtt gcgcaagctt tcaagcgtca tcgcatgaag cggcaggccg     88920
     tcgatgcgga tggtgccgct gtcggggtcg taaaaccgcg gcagcagcgc cagaagcgtg     88980
     gtttttcccg cgcccgaggg gccgacaaag gccaccgtct cgcccgcggc gatgctcagc     89040
     gacacgtctt gcagcaccgg gcgggcagcg tcatagccga agcgcacgcg gtcgaaggtg     89100
     atggccccgc gcagggctgt caccgggcgg gcatcggggg cgtcggcgat ctctgtttcg     89160
     gtttccagaa gttccagata gcggcgaaac cccgcgatgc ccttcggata ggtctcgatc     89220
     accgcggcga tcttttccag cgggcggaag aacaccccca ccagcaaaag aaatccgacg     89280
     aagccgccgg tgctcaggct gcccgccagc acgaagcccg cgcccgccac catcaccacc     89340
     acctgcacga agcgcagccc catgtaatgg atcgcgctcg agaccgccat cagccggtag     89400
     gcctgcagtt tcgtggcgcg ataggcgcgg ttgtcgcggt cgaacagccg ttcctcgtgg     89460
     cgctcgttgg caaaggcctg caccagacgg atgccgccca cggcttcctc cagccggacg     89520
     ttgaactgcc cgacgcggcc atagatctct tgccaggtcc gggtcatccg cccgccatag     89580
     accgcgacca gccagaccgt cagcggcacg atcgcggcgg tgatcagcgc cagcacggga     89640
     tgcagcgccg ccatcagcgc aaaggcgccg acaaaggtca tgatcgcgat gaacagatcc     89700
     tcggggccgt gatgggccag ctcgccgata tcctccagat cgcgggtgac gcgggcgacc     89760
     agcttgccgg tgcgggcgcg gtcataccag cgccacgaca gccgcgtcag atgcgcaaag     89820
     gcctggcggc gcatctcggt ctcgatctcg atgcccagca tgtggcccca gtagatcacg     89880
     atccccatca gcacggtgtt gagcgcatag accgccagca gcgcagcggc ggcggcgatc     89940
     gtcagcgacc agtcccccag cggcaaaagc cggtcgatga aaaaggtgat cgccagcgga     90000
     aaggccagtt ccagcagccc cgaggcgacg gcagagccga aatcgagcca gaacaggcgc     90060
     cggtgcgggc ggtaatgggc gatgaacttg cgcagcatct tttgtctttc gctcaggcag     90120
     gcagggcgac gggatggccg cccagcgtcg tcacggtcat cggcaggcca tagacccggg     90180
     ccagcgcctc gggggtcagc agatcgccga gggggccgtt cagcaccagc cgcccgccct     90240
     ccagcgccac cacccggtcg caaaaccgcg ccgccatgtt cacgtcatgc agcacgatca     90300
     ccgccgaaag cccgctgtcg cggcacatcg cctgcacaag gcccagcacc tcgacctgat     90360
     gcgccacatc caaggccgaa atcggctcgt ccagcagcag cgtccgcgcg ccctgcgcca     90420
     gcatcatcgc gatccagccg cgctgccgct cgcccccgga aagcgtgtcg accagccgct     90480
     cttccagccc ggtcaggccg cagcggcgga tcgccccggc gacggcggcg tgatcctcgg     90540
     ggcgaaagcg gccaagcgcg ccgcgccagg gataccgccc cagcgccacc agctcggcca     90600
     gccgcatccc ctcggccggg ggggtgacct gcggcagaca ggccagcgcc cgggccagat     90660
     cgcggcgcgg ccattgcgaa agcggccgcc ccagatgcgt gatctgcccc gccgtgggcc     90720
     ggacctgccc cgagatcagc ttcagcagcg tcgatttccc cgatccgttg cgcccgatca     90780
     gcgcggtgac gcagcccggg tgcagcgtca gatcaagccc gtcgatcagc cgccgcccgg     90840
     gcacgtcgaa gcacaggtcc cgcagggtga aaagcgtcat gcgcgcccct ttcgcagcag     90900
     aaggacgaaa agccagggcc cgccgatcag cgttgcgcaa aggcccagcg gcaggtcata     90960
     ggggctggcc agggtgcggg cggcaaaggc ggcaagcagc atcagaagcg cgccgatcag     91020
     ccagcttgcg gtgacaaagg gcaccggccg caccaggcca aggctgcgcg ccagatgcgg     91080
     cgccatcagg cccacgaagc tgaccggccc gacaaggatc gtcgccgcgc cggtggccag     91140
     ccccgccagc aggatcagcc ccggccgcag cggcgtcagg ggcaggccaa gcgcgcggca     91200
     gagggccggg ccaagcggca ggatctcgag ccagcgggcg gccagcagca gcgccgccag     91260
     cagcgccgcg gccgccgcgg ccagggccag cgccgccgcg ggcgtcaccg ccgcggcact     91320
     gcccgccagc cagcccagga tcgcccaggc gcgcggatcg ccggtggcga tgatcgccgc     91380
     cagcacggcc gaggcaaagg cgccgatcgc gaggcccgcc agcaaaagcc gggccggggc     91440
     gatgtcgcgg ccaaaggcga gggcagagag gcccgccagc gtgacggcac cgccaagccc     91500
     ggcgccaagg gcgagcgccc ccggacccgg cgcggtctgc aggaacagcg tcgccgcata     91560
     gccaagcgcg gcgccgccgg tgacgcccag cacctcgggc gcggccatcg gattggcggt     91620
     caaccgctgc aggatcgccc ccgccccggc cagaagcgcg cccgccgaag ccgccgccag     91680
     aagcgccgtt gcccgcagcg gcaggaagct ggcgcaaagc ccgggcgcga tcacgcccca     91740
     gcccgccggg ccgcggccga ggaccagcgt cagcgccgcc gccgccagca gcagcccggc     91800
     gagcagcgcc agcccccgcg cgggatggcg ggcacgacgg ggcggagccg ccccggtctc     91860
     gagggggggc ggcacatggg tcggcatccg cggcagaagc cacagcagaa gcggcccgcc     91920
     gatcaggccg gtcagcgcgc cggtgggcag gtcgggaccg ccaagcgccg cgacggccag     91980
     cagcaggctg tcggccagcg acagcaggac cgcccccgcc agcggggcca gaagcagccg     92040
     gtgccgcagc gttctggcgc caaggccgcg ggcgatggcg ggggcggcca ggccgacgaa     92100
     gccgatcagg ccaagctcgg ccgagaccag cgccgacagc ccgaccgcca gcgccagcgt     92160
     gatcaggcgc agcggcgccg ccgcaaggcc cagcccccgg gcgcccgccg ccccaagcga     92220
     cagcaccaga agcggacggg ccagagctgc ggcgccgagg atcgcgaccg ccagcgccag     92280
     cgccagatgc gcggcggggg tccagtcgtc ctgggtcagc gcgccgccgt tccagatcag     92340
     cagcgacagc aggtaatgcc cctgcgccag cgtcagcgcg gtggccagcg cactggcggt     92400
     cagcccgacc agcatcccgg ccagggtggt ggcgagcggg gcaaagccgc gccctgccgc     92460
     cagcgccatc cccagcgccg tcgcggcccc tgccccggcc agcgccaccg gcagattgcc     92520
     gcccgccaga agctgcggcg ccagaaccgt ggcggcgacg atcgccagct gcgcccccgc     92580
     ggcggtgccg agcacggtcg gatcggccag cggattgcgc agcaccgcct gcatcagcgc     92640
     ccccgacagg cccagagccg ccccggcgag cagcgcgacg accgcgcgcg gcatcagccc     92700
     ctgggtcagc aggatctgcg gcagcgccat ctgaccgatc tgccagggca gcgcgggcca     92760
     atcggcgaca ggcaaggcca tccgggcggc cagcagccac agccccacgg acagaagcgc     92820
     cgccacaggc agggcaagcc gtctcatgcg gcctccagcg ctttggtcag ggcgcgggca     92880
     aagcgcagcg ccgaaggcag gccgccgaaa ccgttgatcg cgcccagagc gctgacccgg     92940
     cccgcgcgcc gggcgggcag cgcgttccaa agctccgagc gggcaaggcc gcgggcggtc     93000
     tgaaccggga tctcgccggt gaggacgatc cgcgcggtcg gaaaatcggc cagccgttcc     93060
     agcggcaccg gcgcggcaaa ggcgaagcgg ctttcgccgt cccaggcatt ggtcagcccg     93120
     agcgccgtca gcgcgccgtg aaacaggctg tcggtgccga acaggcggac atgccgggcg     93180
     tcgccgatct cgaccagaag acagggcgcg gcggcggttt gcgggatgcg ccgggcaagg     93240
     gcggcaaatt cggcgcggct gcgggagagc acggcgctgg cggccgcggg ggtgccaagc     93300
     cgcgttgcca gatcctgtgt cgcggcgatc agccggggca gcggcggcac ccccggcacg     93360
     aagagcgggc gcgaaaacac cggcgcgatg ccggccagcc gcgcctcggc gaagctgtaa     93420
     tagcttgagg acaggatcag atcgggcgcc gcaagggcca gcgtttccag gctgggcccg     93480
     ccgcgcaggc caaggtcgat ggtgtcggcc gaaagcggca tcggtgcggt gcggcgaaag     93540
     gcggccagct cggccagcgc ctgcggcgga tggccaagcg cggcggcggt ttccgccatc     93600
     gcccagtcga tcgccgccag ccgcagcggc cggaccgccg ctgccccctc ccctgccccg     93660
     gcccgtcccg ccaccacggc cgaggccgcg gcaaccagga cggcgcggcg ggtcaccccg     93720
     ccccctcgcc cgctgacatg tggcccgctt accatgtgac gccaaggctg gccgagacgg     93780
     tgcgctcgtc gcccggatag ctggcgaagg acccgacccc ggccacatag gccttgtcgg     93840
     tcaggttcga gacgttgatc cgcccggtca cgccgttctg ccaggtatag gaggcgccaa     93900
     ggtcgagcag cgtcaccgcc cccagccgcg cggtgttggc gtcatcggcg tagcggctgc     93960
     cgatatggcg caggcccccg cccagcgtca gcccctgcat cttgcccgcg aagtcatgcg     94020
     acagccacag gctggccgca tgttcgggca cgttcttcag cgcggttccg gcctgttcgc     94080
     ccgccagcac cttgctgtcg gtccgggtat aggcggcctt gagggtccag ccctgcgcca     94140
     gctctgccac gccttccagc tccagcccgc ggatccgggc ctcgccgatc tgccgcagtc     94200
     cggtccgcgc gccctcggtc acggtggtgt tgcggtcggt ctcgcgcaga tcgaagagcg     94260
     cggcgctgaa caggccctcg aaggcggcgg gctcgtattt caccccaagc tcccattgct     94320
     tgccgcgggt gggatccagc gcccggccgt cgatatcggc gcccggctgc ggcagatagg     94380
     aggtggcata ggacaggtag ctggccaggc cattgtcggc gacatagccc agcgagacct     94440
     gcccggtcgt cgccgcatcc ttgcgggtca gatcggtgct gccgtaattg gtgacattct     94500
     gcccgtcctg atcggaccat tcccggcgca gacccagcgt cgcgcggaat ttgccgaagc     94560
     tcatctcatc gacgccataa aggccgagct gcgtcacctc gatgtccttt tgcgcggtat     94620
     accacggcgc cccgaagctg ccgccatagg ccggggcggt gatgtcgatc gcggcaaggc     94680
     tggaaaagcc ggtcgtggcg ctttcgcgca gccgcatcgc atcaaggccg aaggtcagct     94740
     tgtggctgac gcctccggtc gcggcctcgc cgctcagccg cagatcggtg ccgaggctct     94800
     cgaagctttc gcgctgcgcg atcacgccgc gcgtcgcggt gctggcggtg ccgcccgaga     94860
     catagacgct gtcgtaatcc cagtcgtgac gggtatagcg cagcgtgttg ttcagcttcc     94920
     agccattgcc gaaatcatgc gtcaggccaa aggacagcgt gcgcatctgc cggtcgcttt     94980
     gattgatcgc gggatcgccg aaatcgaagc tgcgcagccg gtcccaatcg accaccccca     95040
     gcatcgccgc gggcacgccg gtcggtgatt gcggcgcgtc gtcatgcatc gaggccatga     95100
     tttcaagctc ggtcgtgtcg gtcagcagat agctggccga gagcgccaga tagtcgcggc     95160
     ggttgtcgat ctgtttcacc gcggtgttgg tgtcgcttga tttcgcggtc agacgatagg     95220
     cgaagcggtc gttcaccacc cggttcgcat cgccgaaaac ctgccacgaa ccttggctgt     95280
     cgaaaccgaa ccccagttcg gtggtgtcgc ccgaggcctg cgcgcgcttc tggatcatgt     95340
     tgatcacgcc cgcgggcgtg cccgcgccat aaagcaccga ggccgggcct ttcagcacct     95400
     cgacccgttc caggccgtaa agctcgaaac tgggcgcgct ggtcggatat tgcgtcgagc     95460
     gcatcagccg caacccgtcc agaagcttgt cgttttccag gttgaagccg cgcaggtaaa     95520
     ggctgtcaaa gcgcggatcg gcgccgaaat tctcggtcac gacaccggcg gtatagccca     95580
     ccgcctcggc gaggctggtg gcgccctgcg ccgcgatctg cgcgcgcggg atcaccgaga     95640
     cggcggccgg ggtttccagg atcggcgttc cggtcttggt cgaggcgctg gttttcgcca     95700
     ccgatccggc cagcggcgcg gtcgggttgg cgccgccctg caccgaaatc gtgccaagga     95760
     aggtttcgcg gctgtcgtcc tcctcggcca gcgcagcgcc ggccgcaagg gccgccaagc     95820
     tggccccgag aagaagacgg gaagaaaggg tcttgcgcat gggcatttcc tgagagggcg     95880
     gatgaattcc cgagcgttta acacgggtat tttcggtctg tcttgaacag ggctgcgggg     95940
     atttgttcaa aacccgggat ttgtgccgcg ccgccagacc gagggcggca ggccatgcgc     96000
     ggcgcgaaac agccgggaca gatgcgcctg atcggcaaag ccggtggcat gggcgatttc     96060
     ggccagcgac agcgccggat cggccatcat cgcccgggcc gcttccagcc gcagccgcga     96120
     ttgccagcgc tgcggcgttt cgccgaactg ctgcttgaac cgatgcgcaa accagctttc     96180
     cgacaggccc gccacctcgg ccagttccgc caccgtcacc tgtcgcgaca gatgcgcccg     96240
     cagatggccc tcgaccgccg cgcgctgccg cggcgtcaga ccgcccccgg gcggcggtgc     96300
     ggccccctgc cccggcccct gcaccggctt gtcccccggc ccctgccccg gttcggtccg     96360
     gtcgaaaatc tcgcccagaa gcgccgagag caggccatcg agcaccatct cgccgcggcg     96420
     cggcacccgc acctcttcgg cggccatctg cgccagcgcc cgcagccggg gattgtcgcc     96480
     gatcatctgc ggctgcgcca gatcggggcg caccgcggcc cgtcccagcc gctgcgccag     96540
     cgcggcgccc tgcaggtgga aatcgatatg cgccagatcc tgcccgcgct ccagcctgct     96600
     ccagagcggc acgccggggg gcatgtaaaa cgcctgcatg ccgcgcagct ccggcccggc     96660
     ttcggccgcg cgcagggtca tcgcggtctc ggtcaggaaa acgacgatgc gcggatcggg     96720
     ggcaaggtaa aagccgccgc cgccggtttc gccgcgcacc gaccagacat cggcgatggc     96780
     gccttccaga cggcgaaagg ccagcggcgc cagcgtgcgc agcgcctgtg tccgcgtctg     96840
     catccgcggg gtgaacgtct gtctgagctg acccaaatcg accctgtccg tgaggagcct     96900
     cggcaaaggg cgtatctgac agaaacaatc aactttggca atgcgcttgc gcagcgcccg     96960
     gtcctggtcg caatcccggc gcccgaagcg attcgatccg ctcgggtttg cgagggatgg     97020
     tggcttgagg ggccaccgcc accagatctc gcgtcgggtg gcgcgcaggg gcgaaaagca     97080
     attttaatca gggacttgtc tgatctgagg gcgcaagcgg accggccttg tcagggcgat     97140
     ggcccccgac tttgcaaaaa actgttgtct gggggaaagt tgcgtgcaat gtctgatctt     97200
     gtcgcaaaaa ggcgcaaaca acgcgttttc gcgacgaaac caagacggcc caccaagagg     97260
     ccaagagggc agaatgagca tatcgtcaaa accggccgtc tctggctctg ttgcagcctc     97320
     catcgccgcg aatgccgtca ggctgtcgga ggcgctggac aatcatatgc gcaacagctt     97380
     tcagccggaa agccggaaaa cgctgcggaa attccagcct gccgaagttt cggaactgac     97440
     gggaatcagc atgtcgaacc tgcgaacccg gcatcaggac ggcgatttcc ccgaggtgga     97500
     gaccgattcg cgcgggcggc ggctgtattc cgcggccgag atcgaccaga tccgccacat     97560
     catggcaaag accggccgca atggcgacgc ctatctgccc ggtcgccgcg gcaccgatgc     97620
     gctgcaggtg atctcgatcg tgaatttcaa gggcgggtcc agcaagacca cctcggcgat     97680
     ccatcttgca cagcgctatg cgctgcgcgg ctatcgcgtt ctggcgatcg acatggaccc     97740
     gcaggccagc ctgacgacga tgttcggcta tcggcccgag atcgaattcg ccgagggcgg     97800
     cacgatctat gacgcgctga aatacgaaga gccggtgccg atcagccagg tcatccgcaa     97860
     gacctatttc cacaatctgg atctggcccc ggccgggctg atgctgtcgg aatacgagac     97920
     cgaaaccgcc tatgcgctgc agcacaagat cgacccgccc tttacccagc ggctggcgat     97980
     cgcgctggac gaggtggagg caaactacga tctggtgatc atcgactgcc cgccgcagct     98040
     tggctttacc acgatgacgg cgcttctggc ctccaccggg cttttgatca ccgtcgtgcc     98100
     cagcatgctg gatgtggcct cgatggcgca attccttgaa atggcgggcg aaaccgtgcg     98160
     tgcgctggaa gaggcggccg ggccgatcca ctggaatttc ctgaaattcc tgatcgcgcg     98220
     ctatgagccg accgacgtgc cgcaatcgca gatggcgggt tttttgcgct cgatcctgct     98280
     cgatcaggtg ctgacgacgc cgatgctgaa atcgacggcg atttccgatg cgggcatgac     98340
     gcagcagacg atctatgaaa tcgagccgtc gcaggtgctg aaaaagaccc tcgaccgaat     98400
     tttggaaagc gtgaacggcg tcgccaatga attcgaaacg gtgatccaga acgcctgggg     98460
     gcgggagact gactgatggc acgtcgcaac ctgttccagc cccctgcccc gcccgccgaa     98520
     aagcctgccg aaaaacccgc gccggaaagc aagtcccgct ttccgaacac cggcgcgatg     98580
     agcggggtga aatcgacgct gaaggatctg tccagcaatg ccgtgcgcga gatcccgccc     98640
     gagctgatcg aggaaggcgg ccccaaggac cggctggcct tcagcgatgc cgatgtcgcg     98700
     cagctggccg aaagcatccg gctgcacggg cagcaggtgc cggtgatggt gcggccgatc     98760
     gccgaccggc cgggcagcta ccgcatcgtt tacgggcgcc gccggctgcg ggcgctgcgc     98820
     ctgctgggtc tgcccgcgaa ggcgcttgtg cgggcgctgt ccgacgacga ggcgattctg     98880
     gcgcaggggc aggaaaacgc gcaaaggctg gatccgagct tcatcgagaa atcgctgttt     98940
     gcggcggaac tggcggcaag cggctacgag acggcggtga tcctcgacgc gctggcgatc     99000
     gacaagccga tgctgtcgcg gatgcagaag gtcgcgcgca gcattcccga ggcggtggcg     99060
     cggcggatcg gtccggcgca tggcatcggt cgacggcgct gggaagagct ggccgatctg     99120
     gtcaacgccc atggccttga tctggaggcg ctggcggaaa cggtgctggc gccgggtgcc     99180
     gacagctcgg acgggcggtt tgcgcagctg gcgacggcgg ccgcggcggc cctgcgccgg     99240
     gcagagccgg aaacggcgcc cgccgcccct gccctgccgg tggtggcgga cgacgggatc     99300
     cggctggcgc agatcagcga aacggcgcgg gcggtgacgg taaaactgtc gaagaccgag     99360
     gccccggaat tcgcccgctg gtggcgcgaa catgcagagg ccgaattgcg gcgtctttac     99420
     acggaatggc ggtcaggccc ccgggccgac tgacggaaac ggacccccgc agcagaaagg     99480
     agcacgaaag caacccgaaa agaaagagcc ccccaaggtc atccccggag agcccccatc     99540
     tgttctttgc accttcagat gtatcagctt ctccgccgca gtcaacagca accgattcgg     99600
     ttgtcgggtt ctttttgcct tgcgcaaggg atgatggcca aagggctctt gcagcccggt     99660
     ttgccgtgaa aaacgcatgg ctttcattca agcgaccgca gccttcggct tgcgggcccg     99720
     ggatctgttg tccgcggaca atgccccggc ggcccgggcc cttccggaac gtcaccttct     99780
     tgttgaaacc ctgcggcagg cggcgccgct gctggggctg aagccgaccg tgctggccac     99840
     gctcgaggcg atgctgtcct gcctggcgcc gaagcggaac catcacatgg ttttcgcctc     99900
     gaatctgacg ctcagctctc gccgcaacgg ggtttcggac cgcaccttgc ggcgtcatgc     99960
     ggcggtgctg caagaggccg gtctgttgca gcgcaaggac agtgcgaatg gcaagcgctt    100020
     cacccgctac gatcccgacg cgaggcaggc gctgcacttc ggctttgatc tcagccccct    100080
     cttcgacagg cttgcagaga tcaccgcgct ggcgctgcgg gcgcggcaga tgtcggagca    100140
     gatcgcctat ctgaaatcga agatccgggc gcagcttcgg gtgctgctgc aggcagaccc    100200
     gactgatgcg cggggccttg aactgctgcg ccgtctgcgc ggcaagctga cggtcgaggc    100260
     cctgtcggac ctgtcccagg cgctgccgca ggcggtgcat gaagcggcgg aggaccgccc    100320
     cgaaccccct gccccgacac aggccccgac acaggcattg tccgccagcg acggccaaaa    100380
     tgtccgccac catcagaagt caaaaaaaga aattactgaa gaagaaacga cggcgcggga    100440
     aaacaccggc gcggaagagg cgctgaccct tgcggaactg gtgacggcct gcccggaggc    100500
     agcgtctttt tcgctgcgac gcatcgaaag ctttgccgat gtggtctctc atgcgcagag    100560
     gctggcgccg atgatcggca tcgatcaggc cacctatggt caggccgtgc gcagcatcgg    100620
     cgccgtgcca agcgcgctga ccgtctgggc gatggtccag tgccacacgc agatcagaaa    100680
     catcggcgcc tatttccggg cgatcaccag cggcgccagg cggcaggatt tcgacgcggt    100740
     cagacttgtc agacggcttg ggcgcagggt cgcggcgtga aattgtccgc ggacaacgga    100800
     tcggcgggaa gggcaggggg ccgcccggcc ggatcacctg gcgaaaagcc gcggggcttt    100860
     ggaaacttaa cagcttgttc aactatcgcg cgcattctga ccccctgcat cgaggagtgg    100920
     cagatgagga aataccccgc ctttccgcgc gatctggccg ccgccgccga ggcggatccg    100980
     ctttcctttg cggtggccgg tcgcgaccgg gaaacgcttg cgatggtgcg ccgcgcgatc    101040
     gaccggggcg atgtgctgct ggccttccag ccgatcatgc aaaccgcccg gccggagttt    101100
     ccggcgtttt acgaaggcct catccgggtg ctggacgata ccggccgggt gattccctcg    101160
     catgatttct tcgccgccgc cgaaaccacc gacctgggcc gcaggcttga ctgtctggcg    101220
     ctggatctgg gtttgcagac gctggccgaa aacccgaagc tgcggctctc ggtgaacatg    101280
     tcggcgcgtt cgatcggctg gccggaatgg acccgcatcc tgacccgcgg ccttgcccgc    101340
     gacccgaccg cgggcgagcg gctgattctg gaaatcaccg aagcctcggc catgacgatg    101400
     cccgaactgg tctcggtctt catgcatgaa atgcacatga aggggatctg cttcgcgatc    101460
     gacgatttcg gcgcgggcta tacctcgctg cgctacctga gagagttcta tttcgacatc    101520
     ctgaagattt ccggccagtt catttccggc atcgcggaca atcccgacag tcaggttctc    101580
     acccgggcgc tgatgtcgat cgcagggcat ttcgagatgt tcacggtggc cgaaggggtg    101640
     gaaaccgccg aagatgccgc ctggctggca gggcaggggg tcgattgcat gcagggctat    101700
     tacttcggcg cccccaccct gaccccgccc tggagcctgg ccgcggcccg gcaggcagag    101760
     cgctgagcgg cccggatcgg gcccctagcc gcggcctctt tgcgccagga acgcgcagac    101820
     cagaagctgg ctcatgtgat aaagcatcgc gggcaggacg attgcgccga cctgatcggc    101880
     aggaaacagc gctgcggcaa tcggcaggcc ggtggcaatg cttttggtgg cgccgcaata    101940
     gaacagcgcc gcgcggtcgg ccgtcggcaa ccggcaggcc cgcccggcca tgaccatcgc    102000
     cgccatgcca agcgccagga acagcgcgat caccccggcc agcaggatca gccgcagcgc    102060
     cgggatcgcc tgccacagcc ccgcgatcgt gcccgcgctg aaggccgcat agacgatcag    102120
     caggatcgag ccgcggtcca ccgccatcgt caggcgcttg tgccgggcca ccaggccgcc    102180
     gatccgcggc cgcaggatct gccccagcgc gaagggcaaa aggatctgcg ttccgatgcc    102240
     cgccaccgcc ccgaggctgg ttccgccccc ggcgcgatgc atcagcagcg tgaccagaag    102300
     cggcgtcagc gccacgccga tcaggttcga caccgaggcc gcgcagatcg cccccggaac    102360
     attgcccccc gccagcgcgg tgaaggcgat cgaggattgc acggtcgaag gcagcaccga    102420
     caggaacagc agccccagtg tcacatccgg ccccagcacc ggggcgaaga ccgcggcaaa    102480
     gccgatcccg agcagcggaa acagcagata ggttgcgcca aaggtcagcc cctgcagccg    102540
     ccagttcagc agctccgccc gcaccgtgcg cgggtccagt ttcgcgccgt acagaaagaa    102600
     cagcagccac accgcccccc aggtgacctg tttcagcccc gccgccagcg cgcccccggc    102660
     gggcaggaaa acccctgcca gcaccatcgc cagcaaaaga agcatgtagg tgtcgatgcc    102720
     gaagcgtttg agcgggttca tctttcgtcc tttcacgcaa gagccgggcc cctccttgcg    102780
     gcgggcccgg cgggggaggg ggcagggcgg tcctcaggcc gcggtggcgc cgcgggcgcg    102840
     gaggatcggc caggcccgct tgaccgacag cgcgaccgcg gcggtgatcc ccgccttgac    102900
     cagatcgccc gggatgaagg gggcggatcc cagcgcggcc gccttgagcg acagccccgc    102960
     ctgtaccgcc agcaccggaa cgccgaggcc atagagcacg acgatgccgc cgatcgtggc    103020
     aaagacgaac gagcggagcg cggtcaggcg tttccagccc agctcgtgca gcaggccggt    103080
     cacataggcg gccgggatcc agcccagcag gaagccgacc gtcggcccgg caaagacgcc    103140
     cagcccgccg cgcccgcccg acaggatcgg cagccccaaa gcgaccagca cgacgacaag    103200
     ccccatcgcc agcgcgccgc gacgggcacc gatgaccgcg cccgcgagca tcggccccat    103260
     cgattgcgcg gtgatcggaa cgccgatcag cggcagggtg atcggcggaa acagcgccaa    103320
     agcggccgtc agcgccgcga aaagcgcgat caggacgatg tcgcgggtgg aaagggaagt    103380
     catcgcaggg gtccttcgga gggggttatc gggaaatggc ggcgccgtcg tgatgaccgg    103440
     accgggcctc gatcgcctcg gcgacctcgt cggcggtctt gagaacgcgc aggatcagcg    103500
     gcaggatcag cgccagagga tgggtgccaa gaccgcgcgc cgcctgggct tcgcgcaccc    103560
     gcagcgcctc gtcgcggatc accggcagga agcgcagcgc cagcgccagc gccagaccga    103620
     ccttggccgg gttgacgccg agcggcgcca gcggggccag cagccgttcc agcgtcgcga    103680
     tcagatcttc ggtgcgggtg gtcagggtga ccagcgcggc gagcaggatc agcgtcagga    103740
     tccgcagcac gaccagcgcg gccaggctcc agcccgccag ccagccctgc accggaaaga    103800
     ggatcgccag catccacagc agcggcgcga cctgcgcccg gatctgcgcg cggccgaagc    103860
     ccgccagccg gaagcccgcc agcgtcagcg ccagcgcggc cagcatgatc gcgggcgctt    103920
     cgaccagcat cagcccggtt ccggccaagg ccagcgcggc cagtttcggt cccggcgggc    103980
     agcggtgcag ggggctcatg tcatccgctc cacataggac cgcagcgccg ggccgggttc    104040
     atcatcggcg acgatccggc cctgatcaaa gaccagcacg cggtcgaaac cggccagcag    104100
     cggcaggtca tgggtgacga cgatcgccgt ctgtgccaga tcggcgatca cctgcccgat    104160
     ccggcgggca ttgcgcagat ccagcagcgt cgtcggctcg tcgaagacga tgcaatcggg    104220
     cgcggtgatc agcacgcccg caatcgccag cagctgtttt tgcccgcccg acagccgatg    104280
     cgccggggcc tggcgcagat cggccaggcc gaaacggtca aggatcgcgg tgactttcgc    104340
     ggcgcgctcc gccgcgccgg acttctggcc cttgagtccg aaggcgatgt cttcctcgac    104400
     cgtgggcagg acgatctggg tatcggggtt ctgaaacacg aagccgacct tgcgccgtac    104460
     cgccctggcc tcgcgggcgg tctccagccc gtcgatgcgc accgtgccgc ggtcgggcag    104520
     catcagcccg ttcagcaatc gcgcaaacgt gcttttgccc gacccgttcg cgccgacgat    104580
     gccaatgcgc cgctcggtca gggtcacgga gatcccgcgc agcacgtcgc gcccgtcaaa    104640
     gctttgaaaa acatcggaaa tttgtatggt ggtgggtgcc gcaggcaggg aaggaagggc    104700
     actgcctgcg gcgccttgca accgcaagct gctggcgaca atacttgaaa ccatcatcgg    104760
     tttgccccat ttcacttgtg gttgcatggt tctggtcact cggttggacg ttccgccaag    104820
     aaaatcaacc gaagagagcg gcgagggtca tgtaaccgac cgagggcacc atcaggcagc    104880
     cgaagccggt gtagaaggtc gccgtcagcg cgccataggg caccagtttc ggatcggtcg    104940
     cggcaaggcc cgcgctgaca ccgctcgtcg tgcccatcag accgccgtaa accgccgccg    105000
     ccgcaggcgt cgtcagcccc gcgggtttcg ccagaagcgg cgtcaggatc atcaccgcga    105060
     tggatttcac cacaccggcc gccaccgaaa gcgcgatcac ctccgacgag gcgccaagcg    105120
     cagccccggt caccggaccg acgatgaagg tcgtcgcccc gccgccgatc gtcgccatgt    105180
     cgaccacgct cgtatagccg aaggcatagg ccaccgccgc gccgatcgcg gtcgagatga    105240
     tgaccgaaat caccagcgcg atgccgcccg ccagaccggc tttcttcacc tcttccagtt    105300
     tcaccccgaa ggcggtcgag acgatggcga aatcgcgcag catcgcgccg cccatcagcc    105360
     cgaagcccgc gaacagcgag acatccgaaa tgcccttgct gccgccggtg accttgccgc    105420
     cgatataggc cagcaccagc cccgcgacga tggcgatggc cgaaccgtgg atgcggttgt    105480
     tgaccagttt gccgatcgca taggaaatcc acatgatcac gccgacgatg gcgaaggcgg    105540
     tgatcagcgg cagtttttcc agcgtcccaa caatgatgtc gagcatgtca ttttgctcct    105600
     tgcgcagcgc gtttggccgc gtcttcggtt tcggcggtgc caccaagcgc cgccagcgga    105660
     cggatcagca ggaagccggc aacaaccggc aggaaaccgg cgatgaaggc catggtgccc    105720
     gcatcgaagg ccgcaacgac gttctggctg gccgccatgg cgacgacgat cggaatatac    105780
     atcgccgacc agaatttgat gccgtcctgc gccagttccg acatccgctc gcggtcgatg    105840
     aaccagcgcg agatgacgac caaaagcagc atcgcgatgc cgacgccgcc cacgtcggca    105900
     tcgatgccga ccatgtgccc gatcaacttg ccgatgatca cgcctgcgat caggcagccg    105960
     ctcatcagcg agaccccgta aatcaacatg tcttctgtcc tccttgatcg gcggagaaga    106020
     gcgcctgccc cgtgcaggcg cccgtccgcc tgtccttatt cgatgatcat gatcaccgca    106080
     ccgggtttca gacggtcgcc cgggttgacg gcgatcgact tcaccgtgcc gtcgatcggc    106140
     gcgggggtgt cgttcttcat cttcatcgcc tcgacgacgg cgacgcattg ccccttggtg    106200
     acggtggcgc ccaccgcgac ctcgatcgag acgatcaccg agggcatctt cactttcaca    106260
     tccattgcct tttcctttct ggctgtttga ttgggtgttg cgggtcgggc cgcgccgggg    106320
     gcggggcctc gaaaagggag atcaggtggg ggcgctcgat cagctcgacg ccggtgatgg    106380
     tcttgcccag caccgagcgc gcccccgaca gaagttcggt cagcttgacg ccgatgccgc    106440
     cgggcagggc gacttcggca tcgaccgcca ggccgcgccg tttcgccagc gtggccagca    106500
     tcgttgccag ttgttccagc gcgcgcaggc tctcggcgcg gaccaccaga tcaagatcgg    106560
     agtccgggcg cagatagggc aggccggtca ccgtctgcag cgcggccgag ccgatcaggc    106620
     cgatctcgac cccggagagg gcgcctgcgc gggcgatctc gggcagggcg ggatgcaggt    106680
     tcgggccgag gatcagggcg cggtccatca cctcccaggg ggtgaaaaag gccgaaacct    106740
     ggccgcgccg caccggcacc gcggcgcgca cccgttcggc gccgtggcgg aacgggaagg    106800
     agaacccgag ctggccgccg ccatcggggc aggggccggt gggacggcag acgatgccgg    106860
     ggatatgcgc cttgctcatc gcgtcgcgca ccagcttgcg ggtgccgggg tcgcgcatct    106920
     gctcgggcag cgcgtcaaga accgcggcca ggatgcccgg gcgcgaggcg ggcgagacat    106980
     gggcaaggct gtgacggatg cggaacatct cagcgcctct tgatccaggc ggggtcggtc    107040
     ttggcgcttt gcgccatgtc gcgctgcgcg gtgaccagcg tgtcgaaaag caccgtcgcc    107100
     tccgggcctt cgatcacgat cggcgcggcc cggccaagcg cgggcaccag ttccagccgc    107160
     gtcgccccgg cccccaccgt cagaccctgc gccaccttca ccacccggct cttgatgcgc    107220
     aggatggtgc gggcggtctt ttcgatcacc tcggcggcgg tggcgggggt atgggtgacg    107280
     atcacctcgt attccggata ggtgcgggcg cggcgatagg tgatgatccg ccccgcgcgg    107340
     tcgcagacat gcccggcgtc ggacacgacg aaactgtcgc ccatcggcag accgcccacg    107400
     accagttccc gccagggatc gcccagaggc gaggggacca gcgaaatatc ggcgcgcagc    107460
     gggcggccat ccagcaccag ccagccgaat tcctgacagc cgtaaagatc gtgcacggca    107520
     tagccaaagg cctcggccac cggcaaaagc tcggcatcca gcggcgttcc ggcacacaga    107580
     agcacgcagc cctgcggcat ccgcggcttc agatccagcc gcagggcctg ttccagcgtc    107640
     gcgcgcagga acgaggattc gccaaggatc agccgcggct gctcgcggca ggcggccagc    107700
     aacagcgcat cgcggctgga gcgttccaga tgcgaccaga ccaggccgca gccctcaagc    107760
     gcctgttttg aaaacacatt caccagcggc ggataggtga caagcatccg ttcgcccgcc    107820
     gggatctgca gccgcccgaa aatctcccgg gcgactgcat tgcggttttc cagctcggca    107880
     tgggtcacgc cgacgatggt ctgaaaggcc gacgatccgg tggtgaaggt cagataggcc    107940
     agattgaagg gggtgtggac ctcctcgatc acatgcgccg cggtggggcc cgcgatgccc    108000
     ttgtgcgcca gcgtgcggcg gggcatttcc gccaaagtcg gcaccgcgcc ttgcaggctc    108060
     agcgcgtctt cgagggcttt gagatcgtct gacatcttcg tcttcctttg gccgtcggtc    108120
     tttcggggct cagcggctgg gcgcgtagcg atccgccacg gcggcgaaat cgcggctcat    108180
     catctcgatg acgcggggac gctcgatccg gccgccgcgg gcttcgccca gcttgccgcg    108240
     gccccagggg ccaagatcgt cctgccgtcc ctccagcttc gcggcccgga cctcggcgat    108300
     ccgcgcgacg atggcggggc gcatgccatc gagcgtctcg accagcgcct cgacgccgcc    108360
     aagcgagtgg aagaagcgcg gaccggcggc aaagacggcg ctttgcttcg acaggacttc    108420
     cagcgtttcc agatccttgc ggatgatccg cgagaccgag gtcaagggca tcacatggat    108480
     catcgtgccg aattgcgcat cgagcgacag gatcgcatcg gcctgcagcc cgtggcacag    108540
     gaacgccccc gagatcgccc ggccgatcac catggcgatg atcggatggc ccttcagccg    108600
     cgcctcggcc agcgccagct gataggcggc ggtcgatttg ttcatgccga agatttcctc    108660
     gaccttgccc gggccgttgc cgggggtgtc gacgatcagc accagcggcc gtttttccgc    108720
     cagcggcttt tcggcatcct cgatgatcga ggcatagacc gcctcggcca tcttgtagcc    108780
     ttcctccagc ccgatgatcc cggcgtagac caccgggaat ttctcgttca tcgcgccgcc    108840
     atccgaggcg atgatcgtgc agaccgtgcc ttgcagcgtc gcggtgccga cgaccgcgcc    108900
     cggcccgaat tcgggatcgt cgaagctttt cgcccccacg gtgccctcgg cgaagctgcc    108960
     cgcatcgacg atcatctcga tcgcgtcgcg gccccgcccc atcatgcttt cctgcatgtc    109020
     catgattttt ctccttttcg ggtcagacgg cgagacggcg cacagtggcc agaaactcgg    109080
     acaggggcag gtcgatcagc ccgtgggcgt cagtgttgcc cgcccgcgtc cagacatcgg    109140
     tcgcatcaga gggttgcatc tcggccgcca gcgccacggc gcgcagctgc gccttgacct    109200
     tggcgggcga accgatgcgg cgcatctcct cgaaggcctc gatcgaaagc ccggccagcg    109260
     ccgagacctg ctcgcggaag gccgcgacgg tgttttcgac caggaaattc gcatcgccca    109320
     tgatgaactt gtgccgcccg ccggtggtgc ggtagacaag cgcgcggtca gaggcgtcga    109380
     attcctcctt gcccatttcc tgctcgatca cctcggggcc ggtcaggcca aggcggccga    109440
     attccgacat gatgatcacg tcggtggcgg cggcgacgaa gcccatcccg ccaaaggcgc    109500
     cgaccttgga gccgatcagc gcgatcaccg gcaccttgcc gcgggccttt tgcagctggt    109560
     ccatcacctc ggcatgggcc agaagcccgg cgttggcctc gtgcagccgc acgccgccgg    109620
     tctcgaagga aatcaccacg aggggctttt cctcttcgtc gaggtcgtcg aattgcgcca    109680
     caagatcgtc atggaagtcg atcgccagct tgatcgtgtt gaccattttc gcgccgccga    109740
     tctcgccgac cgagccgccg atgaagcggc cttcctgcga gatcacgaaa acgggggtgc    109800
     ggccgatctt gccgacgccg gtgacgatgc cgtcgtcaaa ggccacggca tcgccgagca    109860
     gggccaggtg cgggctggtc acccggtcga aggggccggc cagttcggtg aagctgccct    109920
     cgtccaccag accgatggca cggtcgcggg ccgaggcttc aaggaagctg cggggttgca    109980
     ggtctgtcca gttggtcatc tcgtctctcc gcctcaggcc gcggccagcg cctgttgcag    110040
     gcgcaacagc acgacggcgg gggtggcgtt gttgtcgttg atctcgatgc gggcgtcgca    110100
     aagcccggac tcgtcgagga atttctgcaa gacgcgggtc cagagcgcgt caaagccggt    110160
     gacgggggtg accacggtca ccgcgacgcg gcccgaaagg tcttcgggat gcatcatgat    110220
     ttccagatcg ctggatccgg tgacgcccac atgcaggcgg gcttggatct tcgtcttcgg    110280
     cgcggcggcg gccagatcca gggtgagagt gtgcaaggcc atgattttgc ctgtctttac    110340
     cagttgcgga agcgggcggg cgggttgtaa aggccgccgg accaggtcac gagatcgcgc    110400
     atgcttttcg cggccagcag gtcgcggttg gcacgggcgg ggttgatgcc cagatcggag    110460
     acggtcttga cgatgcccgc ctcgcgcagg gcgcgggttt cttcgggttt cgcggcaagg    110520
     ccgatgtcgg tgaagcccgc gacggcgcgg atggcggcca tgcgggcctc catgtccttg    110580
     cagcggttca ggtaggcgat gccttcctcg gtgacgatat gggtcaggtc gtcgccgtag    110640
     atcatcaccg gcgggatcgg cagatcggca tcccgcgcca gtttccaggc gtcaagttcg    110700
     tcgacaaaga ccggggcacg gccctcgccg aaggtttcaa ccccttgcac cacaaggcgt    110760
     ttgccgcgcg gcagattgcc gatgtcacgc tcgagcgagg gcagttcctg gccgcatttc    110820
     agccaggcgt cggtcgggtg gcgccgcccc ttggcatcgc agcccatgtt cggcgcgccg    110880
     ccgaagccgg ccacccggcc cgccgtcgcg gtcgaggagt tgccgtattt gtcgatctgc    110940
     agcgtgccgc cgatgaacat gtcgatggcg taatgccccg ccgtctgggc aaaggcccgg    111000
     ttcgagcgca gcgagccgtc cggccccacg aagaacacgt ccggccgcga ggcgacgtaa    111060
     tcttccatgc ccaactcacc gccgaagcaa tggatcgtgt cgacccagcc ttcctcgatc    111120
     gccgggatca tggtcggatg cgggttcaag atcatatgcg tgcagcattt gcccttgagc    111180
     cccagttcca gaccataggt cggcaggatc agttcaatgg ccgaggtcaa aaagccgatg    111240
     ccgtggttca tcgagctgac gccatattcg gcatagatcc ccttcaggca catcatcgcc    111300
     aaaaggatct ggctgtcggt caccagcgcc ggatcgcggg tgaaaagcgg ctcgatgaag    111360
     aacggcttcg gcgattggat caccgcatcc acccagtcgc ccggaatatc gacgcgcggc    111420
     agttcgtcaa cgatttcatt gacctgcgcg atgacgatgc cttcgcggaa ctttgtcgcc    111480
     tcgacgatgg cgggggtgtc ttcggtgttg aagccggtgt aaaggttgcc cttgcggtca    111540
     gccttgtagg cgcagacgag cgagacccgc ggcgtcaggt ccaggaagta gcggccgaaa    111600
     agttccagat aggtgtggat cgcgcccagc tcgatcttgc cattggcgat gaatttcgcc    111660
     acccgcccgg cttgcggccc gccaaaggcg aagtcgagtt tcttggcgat gccgttttca    111720
     aagagatcca gatgcgcggg cagcggcacc gccgattgca ccatgtgcag gtcatggatc    111780
     ttgccgcggt caaccttgtt caggcattcg gccaggaagt cggcctgttt ctggttgttg    111840
     ccttcgatgt tgatgatgtc gaaggggcgg atcaccgctt ccagaagcgc caccgtatcc    111900
     ttggcgagca cttccttgcc cttgacatag aggggcgctg ccgcctcctt gcgcgcggcg    111960
     gtatcttccg cccgcttgcg ccagctgttg cgcttgtctt gctgcgtcat ttgctttcgt    112020
     cttcctcctt cagagggttt tcaaagggtt gcctgcgtcg cggcgagggg gatctcgccg    112080
     aagatgacgc tgtgaagggt gccgtcggcg gtgcgcagac agagcgcgcc atccgggcca    112140
     agcgcctcgg cgatgccctg acggggggct tgcggggcgg aaagggtgac gggctggccc    112200
     agcgtgcagg agcgcaccga ccaggcatgc cgggcgggct cgaagccgag gcgttcccat    112260
     tcggtcagcc ggtggtcgag ccgttcgacc agcgccgcga aaagatcgaa gcggtcgacc    112320
     ttgcggccgg tttcggcgct gatcgaggtg gcgatggctt gcagctccgg cgggaaatcc    112380
     gtgcggttct gggcgatgtt gatgccgatg cccgcgatga tgtgatccag atcgccttcg    112440
     ggggtcagca ccagttcgca caggatgccc gaaagcttgc ggcccgcgac catcaggtcg    112500
     ttcggccatt tgatttgcgg cgcaaggccc gtgctgcggg tgatggcctc ggccgcggcg    112560
     acggcgatga caagcgtcac ctgcgccaga tcggccagag ggcgggaggg acgcagaagc    112620
     accgaggcga gcaggctttc cccgggacgc gaaacccagg gtcggtcgta tttgccccgt    112680
     ccggccgtct gatgatcggc cagaacgatg gtgcccgtgg gcgcgcccct ccgcgccaga    112740
     ccggccagga agctgtttgt ggaggacaga acgggccggt ggtggaccgc gcagccgatc    112800
     ccggtccgac gccggacggg aagggcaagc gtcgggaggt tcgggagaag atcgggatgg    112860
     tgcgcggtca tgggtttgct cctgtgagcg ggtcagggac ggtcggtcag ttgaccagac    112920
     cgatggtcga ggcgaagaca ccgacggcga tggccgagac gatgaccccg cagatcgagg    112980
     cgcccatggc gagcggcatg atcatggcgt gggggttggc ttcgaaggct tccttctggg    113040
     cgatcttcgc ggtcgagggc atgcaggaga cgccggcgat accgatgacg gggttgtaat    113100
     tgcccttcga cagtttccag accagatagc cgccgccgat gccgccaagc gccgagacgg    113160
     ccagcgcggt gatgccaagg atcagcagca gcgcgacttg cggatcaagc agggttccgg    113220
     cttcgcacag cgtccccagc accaggccca gaagcagggt cgaggcgtaa gtgacggtgt    113280
     tttcaaggaa cttctggtag ggctcgattt ccgcttcctt gatcgcgacg ccgaggaaga    113340
     acgacaggat cagcggcgtg gcgacgggca gcagcaggca cagcagaccg gcggcaacca    113400
     cggtgaagat gaatttcgcc tgcggcgtga catcggggaa gtcgtaatcg acttcgatgg    113460
     cgcggtgctc ttccttgatc agccagcgca ccagataggg gtagcccgca taggtcagcg    113520
     acagataaag ataggcgatg atcgagatcg gcacgaagag gttcttcgcc atcatcagcg    113580
     agccaaagag caccatcgga ccatcggcgc cgccgatcgt gcccacggcc gcggcttcac    113640
     cgggcgtcag gccgcaatag taaccgatca ccagcgtcac gaaggtgccc agttccgcgc    113700
     agaccgcgac cgcgatcgag gcccagggcc gggcgaggat gaaggaaatg tccgccatcg    113760
     tgccgatgcc catgaagagc atgcaggcca ccagcgagtt gacgaaggtg aagttgtaga    113820
     tcggctgcag gaagttgatc tgcatgatgt ccatgagcgc attcgtctcg gataccaggg    113880
     gcgagatcac cagcgtgccg acctggccgc cttccaggat catcacgccg gcgttgaccg    113940
     ccatcatgcc aaggcccatc ggcaccatga tcagcggttc cagcgtgcgc ttgaagccca    114000
     gataggccag caggaaacca agcccgatga acgccagacg ggcgaaggaa atcagcgggt    114060
     cctggatgaa gagtgtcccg ataccgggaa agatgttgaa cagggtctca agcatttgag    114120
     cgcctcagga tgcgttggga gaggagagga gtttcgagat gccgacgatc acgccgatca    114180
     ccgcaaagga gatcgcggcg gtgatcaggt agctgaaggc ggcataggtg atgatgttca    114240
     tggatgcctc aggggttgca gggggcgaag ggcagggcct ccgcggggaa gatcgggggc    114300
     agctcgcccc cggaaagcgc atcgacgcca agggtcacgg ccagaagatc ggccgcgccg    114360
     ccggggctga tgtgtcgttc gatgaaccgc gcatcgagcg cgtggatcgc cgccagcccg    114420
     tcgccggtca gcgcgccgcc aagggcgagg atcttgcggg cctcggtccg catgaagctc    114480
     agcgccgcgg gaccgccgcg ccacagcacg gtggtgtcct cggtctcggc catcagcgcg    114540
     atcagcgtgt ggcacaggct ggtggccagc gtcgcgccgc tggcgcgggc ggcgcgcagg    114600
     gcgggcaggc cgtggttgcg cacggtcgga tagcccgcct cggcctcgcc gcggatgcca    114660
     aggacaccgt attgacgaaa cagtttctcg cccgcggttt cggcctcgcg gtgcaatccg    114720
     gcgcgcaatt cgcggtcgca gatcccggcg accatcgccg cggcggtgtc gaacagcgcc    114780
     gcctcggtca ggtcgtccct gcgggcggcc agccccgccg ccgccgccag cacgcccgcc    114840
     gaaaacagca gcccgcgctg ggtgttgacg ccgcgcgtcg cggccagaag ccgggcctcg    114900
     tagatctcgc cgatggcgcg cacccggggc agcagcgtca gggccgggcc ggcatggtca    114960
     agcccggcct ccgcgcattg gtaaagacag ggcgcaatca ccgccgaaga gaccatgaag    115020
     gtctgcaggt tcatgtcccg atgcgcgccg ttcgagcgcg gcgtcaccag accgggtttg    115080
     ggatgggtgg agatttccag cagcgccccg gtcaggaaag ccgatccgat cgaccaggcg    115140
     ctggtttgcg gtgacaaggc aatgtcgctg aaccagtcca gcggcctgcg caacgcgtat    115200
     ttcatgggtt tcgtcccgcg caactgacgg cagcgcggcg cttcgtgaac gccaggcgtt    115260
     ccacggccaa tgcagggatt acctctggtc ggggaaaccg tcagacatgc gccacaccga    115320
     tgtcacttgc tcacgcggcg ctttgggttc gtcagccgtc gcagccccac gcgggcagac    115380
     ggctcatcac gggatcacgg ccctgtcggg cagcttcgcc tcacgtcctt gtgatcgttc    115440
     gtgatccgaa gcatggcagc atcgttacgc ctgtcgcccg ggcttgtcca gaaatcgttt    115500
     tcagggcgca agaggctgcg tcaaagcgcc gcagttttgc agctattcat ggcaaaatca    115560
     atgacttggc aaaaatggag ccagctttgc aacagcggcg cgcgggaatt ggcccgcggc    115620
     ttgcggctcg cgttttcgtc aacggcgaca ggcgattgcg gcgcggcggc aggccgggcg    115680
     gcaatcgcca tgcagccatg gaagtctaga tatgcatcac cccgaagccg atgcgttcgt    115740
     ggttcgtcgt gggatgaaag gccgattcgc catgcgcggc gacggcgacc cagtgcccgt    115800
     ccgagaccag cgccaccttg agcttgaggt tcgattccgc caccaccgtc gccgagaccc    115860
     cctgcaggca ttccagcccg gcgtgaatca ccccgtgcac ggcgcccggg cggttgtgga    115920
     tcaccccgcc gttcagcgca caggcgacga tcgacttgac gaagcccttt tcgatttcgg    115980
     accgccgccc ggtgacatag gtgatcccca ccttccaggt cggatgggcc aggatctgct    116040
     ccttgatcag gtcttcctct tcgcggctgc tgatggcggc catgatggcg gccttgccga    116100
     ttctgtctgc tgtgacttgc atgttcgttc cgatccgacc cgtttcaccg cgttcatagc    116160
     ggcgcgacag gggcggctca atcgcgatga tcgcggcccg cgcggcggcg cggtgaaagc    116220
     cgccccgtca gccgtcggga tccgccttca cgaagcggct catggcgctg ccgatgtctt    116280
     cggacagccg caggatggtc tccagccggg ccttgatctc ggcgtgaaac agatcgagct    116340
     gatcgatcgt cgagaccaga ccggcgccgt tttcgcgcaa ccggccgcat tcgacgcgcc    116400
     ccatcacccg gatcgtgtcc agacccagca tcagccgccg gatctccgcg ctggatcggg    116460
     ccagctcctc ggcatggccg accgcagtcg tcagcgcggc atggctgtcg cgccgggtgg    116520
     cgccgcgtgc ctcggccagt ttcgcggcct cggtctgcca gtccagcccg ggaaccggct    116580
     cggcctgccg gaaggtcgcg atcatttccg ccatcacccg attggccccc agcaggaaaa    116640
     gcgcccgcgc cacctcgcgc gagacgcggt cgcacagatt ctcccggccg ctgacgaaac    116700
     tgcgcagccg gtccgagatc accaggctcg aggcgcggta attctcggag atcgccgaaa    116760
     ccggcccgcc cgagggttcc agccgcgagg cgacaaggcg catgttgttc gggatcgact    116820
     gcagcgattc gaaactgcgc aacagcttct tctgttcctg cgtcacccgt tcgagggcct    116880
     cgttcatctc gatcagccgc cgggtgcgcg ggtcttccgg gcggccaagc cgatggtcgc    116940
     gcgcggccag ttcctgcccc aaagcgctgg ccatgaaggt ggtgtagctg gtgaatcccg    117000
     cctcggtgat gatcgtccag agcctgcgcg cgctgtcgcc gggatccagt cgctcggcgc    117060
     gttcgcgggc cgcaagctcg gcatagacct tgcggatctg cgcgaaaagc ggcgtcgagg    117120
     gcttgagacg gaccgacagg aacccgccct cggtgggcag gatcaccgcg aagacccagt    117180
     agaaatcgcc attgcgggcg cggttcttga catagccgcc catcggaaag ccgttgccaa    117240
     gcgcatccca caggatgcga aacaccgcac ggggggtgtc ggggtggcgg atgatcttgt    117300
     gcggcgcgcc cagaagctct gaccaggcga agccggagac attctggaag acatcgttgc    117360
     ctgccagaat gaccccgcgc ggatcggtcc gcgaaaagaa aagatcgtcg agtcgaaaat    117420
     tgacctcgcc ctcgggctgg ccggagagat cgcgctgatg agtcatgagc tttctcgctg    117480
     aaattttcgc aagcttatcg tcagcggtct taacggctga tttacggcgg ctgaaaaaat    117540
     cgctttgccg gggtaggggg gcgatcaggc gatcccggcc agatgcgcca gaacgccaag    117600
     accggccgac ccggccagca ccgccgccat gccccagccg cgccggaaca gcgcccagac    117660
     cgcgacggcg gcaattccgg ttgcgggcag atcaagcgtg gccatctgcg gcagatcaag    117720
     gctgaccggc ccaaggctga tccgcgtgac cccgcgccag agcagatgca gcgcaaacca    117780
     cagcgccaga ttggcgatca cccccaccac cgccgcggtg accgccgaaa gcgccgcgcc    117840
     aagggcacgg ttggcgcgca gccgctcgat gaaaggcgcc ccaaggaaaa tccaggcaaa    117900
     acagggggca aaggtgaccc agctggccag aagcccgccc agactgcccg ccagcagcgg    117960
     cgcctcccag cccgcggcgc gaaaggccgc catgaagccg acgaattgca gcaccatgat    118020
     cagcggcccg ggcgtcgttt ccgccatgcc cagcccgtcc agcatctcgg tcggccgcag    118080
     ccagccgaaa tcggtcaccg ccgcctgcgc cacccaggcc agcaccgcat aggcgccgcc    118140
     aaaggtcagc acggcaagtt tcgaaaagaa aagcgcgatc gcggtgaaga cactctcggg    118200
     tgcaagcagc caaagcgccg ccaccggcag cagccacagc atcagcgcca cggcgcccgc    118260
     cctcagcgcg gcgcggcgct cggctccggt cgggtcgccg tgctcctcgc ccagaagcgt    118320
     ttcggcatcg ggggtcgcag ggccgcccgc cgcgccatgc ccgccgggcg caaaggccgc    118380
     gggcgcgatc aggccgccaa gcacgccgat cagcgccgcc gccgccacga tcagcgggaa    118440
     cggcagggcc aatgcgaaaa gcccgacaaa ggccgccacc gccagcgccc gttgcgcccg    118500
     ggttttcagc gcgcgtttcg ccagccgcag caccgcctgc gcgacgatcg ccagcacccc    118560
     ggccttgagc ccgaagaaaa ggcccgcgac cagcccgccc ccgccccaaa gcgcatagat    118620
     ccagctgagc gtcatcagcg cggccacacc gggcgcgagg aacaaaagcc ccgccagaac    118680
     cgcgccgcgc accccatgca gcagccagcc gacataggtg gccagctgca tcgcctcggg    118740
     accgggcaag agcatgcaga agttcagcgc atgcaggaaa cgggcgtcgc cgagccagcg    118800
     tttttcctcg acaaggatgc ggtgcatcac cgcgatctgc cccgccggtc cgccaaagga    118860
     caggcccgcg atccgcgccc agacgcgcgc ggcttcgccc agaccgggcc tttcgatgct    118920
     gccgctcatg gtgtcgcccc gcctggccgg tcccggttgc cccgtcgcgg ggctttcggc    118980
     gcaccatgcc ccggcccctc cggcctgtca aacccggccc cgcccgagag acagccgcca    119040
     cgggggcgct ttcgtcgggc ggtctgtcgt ggcaggatgc cgcaaggacc gcggctttgc    119100
     cggaccagcg gggcaggggc cctgcgtctt tgaaagggca gaagaaaatg gctgacatgg    119160
     cccgaaagga cttcaccgcg gcgaaccggg cggcctggaa cgcctcggcc cccttgcatg    119220
     cacagggcga cccctgggcg cagcttctgg cccgcgcggg ggagccgggc ttttccgtac    119280
     tcgacccctg tctgaccgcc gttctgcacc ggctcgggct ggcggggaaa tccgccgcgc    119340
     agatcggctg caacaatgcc cgggagctgc tgtcgctggc ctcgctgggc atccgcccgg    119400
     ccttggggat cgatcaggcg ggggcgttcc tggcccaggc ccggcagctt gccgaggccg    119460
     ccggtctggc gccgcggctg gtcgaggcgg atatctacga cctgccgccg gatcttggcc    119520
     aggtcgatct tgcgctgatc accatcggcg ttctcaactg gatgcccgac ctgcccgcgt    119580
     tcttccgcgt cacctccggg ttgctggcgc ccgggggcgt tctggtgatc tatgaaacgc    119640
     atccgtttct cgagcagttc gacccggccg ccgccacccc ctttgaaccg gcgttcagct    119700
     atttcgagcg ccgcccgcag ctggtgaccg aggcgatcag ctatgacggc aaggaccacg    119760
     gcaagggcga aaccggctat tggttcctgc atccgctggg cgagatcgtg accgcctgcg    119820
     tgcgatcggg gcttgcgatc gaggagctga cggaattcgg gcacagcatc cgggaaccgg    119880
     aatatgacct ttacgaaggc cgggccgcgc agatcccgat gagctactgc ctgatcgccc    119940
     gcaagccgcc cgcgtgactt tcagcgcgcg gcccgcagct tcacccgcac gaccttgccc    120000
     agccgcacgc agacgaaatc aagccgaatg tggggggcac cgcgttcgaa ttcgtgaacg    120060
     acgatgcttg gcgcgtcctg aaagtccgca agacgaatgt tgccttgcgc aagccgtctt    120120
     ttgccgacca gaacccgcac ccgggagccg gtcatctggt tgcgcagcac gagcaggtgg    120180
     ttgcgccccc ggtcctcgat gtcgtcgagg tcatagatct tgagcagcgc cccggatcgg    120240
     tcgcgaaaca cgcgcgcgcg gccggacggg acacgcttga cccggaccga ctgctgataa    120300
     tcgtccgtgc acgcgtgctt cggccagggc cagccgacat cgtcgaacaa gacccgcccc    120360
     ccgtgtcggc tttggtaaaa atacacccgc gcgccgcaga ccgggcagga ggcgttcgga    120420
     tcaaggtaac agtcctgcgt ccagccctca cgggggaccg gctcggtgac acgttccaag    120480
     ccgtcacaaa gcccgccgcc gatgtgaagc ggcctgagca cgccatcgac atagcgaaac    120540
     gcgatctcgc cgccgcattt gtcacagatt gccacctcgg gcgccttcct ctgctcgcag    120600
     catcccctca cagatccgag acataaccct ccccggccgc gttgacgaca taggtgctgc    120660
     ggacaggaaa gacgacccgc aaggaacatc cgcccggcaa ggcaccgacc gcttcgggtg    120720
     aatgcgccgc tttcgaagga ctttcccgac cgaactcttg atttgtacgt ccatttggcg    120780
     tacatgatgg ctgcgacaca ggaggcggcc atgcttggtt tccacgacag cacgcgcgcg    120840
     atcgatgagc ggaacgaggc ccggatgaat ttccggacga agccgcgcat caaggccgcg    120900
     atccagcagg cggcggcgct ttctggcgtc gacgattccg tcttcacgat gaatgccgcc    120960
     tatcaggccg cgctggcaac gattgccgcg catgaacgca caatgctgca gccggtcgat    121020
     catgacgcgt ttttcgcggc actcgatgct ccggccgcgc cgacagacac cctgcgcgcg    121080
     gccttccgtc ggcatggcaa aacggtcgtg tcgcagtaga tggcggcatc gcaaccggcc    121140
     ttctgccgca ttgagccgtt cgatccggaa agacatgatc gggcggcttt ttcttgcggc    121200
     gtcaaacagg tcgacaccta ctttcagaag acggccaaca agcttgccaa ggcggacaat    121260
     gttcgtctct atgtgatggt cgatccgggc ggcacggtca tcggctttta tgctctcaat    121320
     gcgcatgccg ttcactttgc ggatttacct gcaaaattcg cgcggacacg tccgtcgcac    121380
     ggcaacatcc cggcggcata tatctcgatg atcgggcgcg atcagagggt ccgcgggggc    121440
     ggctatggcg gcgatttgct tgtcgatgcg ctgcgccgga ttgcggttgc cgcagaggcc    121500
     atcggcgtcg cggtcgtcat gcttgatgtg ctcgattgtg gcgatcccgc ccgcgtggcc    121560
     cgccgcaagg cgctctatga aagctacggc tttctgccgc tcgcctcgaa cccgctgagg    121620
     atgttcctgc ccgtcagcgt cgttcgaacc cttgtcgcgg aagagccatc cggccgatga    121680
     agaacgcggc cgggcagcgg ttgttctttc gcgcggatcg acggtgcccg atgtcgatct    121740
     gaaggcgtgg ggccgctttt gacggcggtc gggccgggat cgacgctttc gtcgcgagct    121800
     ctacaagatc ggggtcaatg tgaaccagat tgcgtcggcg gcgaaccggg gcagggtgtc    121860
     gatggtcaag gagcagtggg ccggactcga cgcgttgcgc cagaggttgc cggtgctgcg    121920
     cgcgaccctg tcgcaggtga tcaacgagcg gcgtcggagg ggcgtgacgc tttaccggaa    121980
     gtttgtggca gagcatcagg ggcgccaaat tggctaccca tgctcttcat ctgagctcct    122040
     ccccgaaaat gggaccgtga cggaagctac gatctgaagt cagctggtct ccaagcccgg    122100
     atctcccgtg ttttcgcgtc gatgccgatg tggatcttgc gccaaacccg gcgtttggtg    122160
     cccccgtgct tgcgggcgtt ccattcccct tcgccctcga ccttgatccc ggtgctgtcc    122220
     accagcaggg gccgcggacc ctccgagccg cggttttgga tgttgacctt cagggtcttc    122280
     tgccgaagcg tcatcccgaa ccggggctcc gcccgatcag ggctgaaaac ggtccacagg    122340
     accgttttcc gggcgccctt cacccttcat cgtcaggcag gtccggctgg cggcgtcgct    122400
     gtcgtcgggt tgccgcccgc gcttgccggt cggcacggcg tccctggtca ggatttgtgc    122460
     aaccgagccg cgccacccga cacgacagca gggcatccct ttgcgcgcga atggctggtt    122520
     caatggcgcg aagacgtcta aaagcgggct ctggctggat ctgattgctg cgaggctgct    122580
     tgacccgaac tcccttgacc ctgaccggca gcgcgcttgc cgtcctgcga gcccttgtcg    122640
     aacgggggcc atcgacccgg ccacagctgg ggcaggatct tggcctgtcg cgccccacca    122700
     tgtcggctgc catcgccgag ttgatccagg cgggcctggt cgagccgatc ggcgcggttc    122760
     agggcggcat gggccgtcgg gcggtggaat atcgcgtcgc cacccatgcc gggcatgtga    122820
     tcgcggtcga tgcgggatcg acgcatatcc ggctgcggct ctcgactctg gaccggcggc    122880
     ttctgcattc cagcctgcac ccgttgccgc aaagccaata tgcgctgacg ccgcagatca    122940
     gcgccgtcgt ggccgccgcc gtggccgagg ctttggcgcg gaccgaggcc gactggggcc    123000
     ccttgcaggc gatggtcatc gccgttccga cccgcgtcgt cgggcccgag ggcgataccg    123060
     ccgcgaccga tcaggaggtg atctacagca atttcacccc gccgccgcag gtggaatgca    123120
     cactggtgaa caacgtcaac tgcgcggccg tggcagaata tcactatggc gcggcgcagg    123180
     gacggcagac cttcgccttt ctgcaggtcg gggtgaagat cggtctgggg ctgatgctga    123240
     acgggcagat cctgcgcggc gtcaatggcg cggcggggga aatcggtcat atctcctttc    123300
     ctttcgcgcc gggcctgaca ccgcaacgcg gcgaggcaga gcgctatctg ggcaccgagg    123360
     ctttcatggc ccgggtccgc gccggctggc ccgccgatgc cggcccgccg ccccgggaca    123420
     cctatgagct tctggcccgg gcggggacgg gcgatgccac cgcgctggcc catgtcgagg    123480
     aacatgccgc ccagatcggc gcggtgatcg cgatctgcgt cagcgtgatc gaccccgggc    123540
     tggtggtgct ggggggcggc tatggcgcct cgccgctgct gcgccccaag gtcgaagagg    123600
     tggtccgccg cctcgccttc ccggccgaaa tcaccacgag cacgctcgcc gccgaggcga    123660
     cggttctggg cgccgaacgt ctggccgtcg agcgcgccgt ctcggccctg ctcggcctgc    123720
     cctgctgaaa ctttcatccc gcgcgcacaa taaaaagctt gctcggtcga ctttgtttgt    123780
     taagctgcct aactatgtag tcgaccaccc gaaggagtcg acacggtcac gacgggagag    123840
     aaagatgaag aaccgacaca ccgcagccag cctgctggtt ctggcgctgg ccgccgcggg    123900
     caccgctgct ggcgcgcaga gccttgaata ctgggtttat tccgatttcg cgcagggcga    123960
     ggctctggcg ctgcaacagg aattcatcaa ggaattccag caaagccatc ccggcgtgtc    124020
     ggtgaacatc gtcggcaagg gcgatgacga tctgaccgcg ggccagatcg cgggcgcggc    124080
     cagcggcaac ctgcccgaca tcttcatgaa cggcatcggc gtcggcgctc agctggccga    124140
     tgtgggcgcg ctggccaata tccatgacaa atggatggcc ctgcccgagg aggtccgggc    124200
     gcagtacaac gccgccgccg tcgccaattg cgccccccgc cccggcgaga tgtattgcct    124260
     cccctatacc ggctacggct cgttgctgtt tcgcaacctg accgtgctgc aagaggccgg    124320
     gatcgacacc gccaccccgc cgaaggactg ggccgagtgg ctggcgcaga tggaaaaggt    124380
     caaggccgcg ggcaagttcg ccattcccga tcaggcgctg gtgttcaact cgatcgcgga    124440
     aatctatgcc gtgaccgggg atgtctcgac ctggggcatc gactgggaca agaagaccac    124500
     ccggatcgac cctgccgtga tgaccgcagt gatgcagaaa ttcgtcgcca tgaagccgct    124560
     gacctcgggc accagccgca acgatcaggc caccaaggac ctgttcgtga ccaaccaact    124620
     cgccttccac accgtcggcc cctgggtgaa cccgacctat caggaggcca gcgccaattc    124680
     cgggctgaag tatgatttcg tgctgatgcc gggcgagacc gcgggcaagc agggcggcat    124740
     caagaacttc gagatcatcg gcgtggcccc gggcaagaat gccgatctgg ccttcgaatt    124800
     cgtcgcctac atcaccgcca aggagcagat ggcgcgctgg gccaagctgc tgtcgcgcta    124860
     caattccaac gatgccgcga tggccgatcc cgaggtggcg gcgctgccgc tgatcgcgca    124920
     atcggccgcc gctgtggccg gggcgatgga cgtgaacccg ccctatctga tccatccggt    124980
     gccggcctgc tatcaatcga cggtggtcga ttacgtctcg gccaccgccg atggcgagtt    125040
     cacgcccgaa gaaggcgcga ccgagatgat cgccgagctg aacgcatgcc tcgctgactg    125100
     accttcgaca cgaccctctc ccgccgcgcc cgcggcggga gacccggcct tctcgaccgc    125160
     cccttgccgg gcgccttcac cctcatgggg gaacgatgcg acacacgcgc caccacctgc    125220
     cccacttcct gatgatcctg ccgtttctgc tgctgttcgg cgcgttcttc ctctatccga    125280
     tcctcagcgg cttttattac agtttccatg actggaacgg cgtccgcgag cccgtctacg    125340
     tcggtcttga gaactacacc aagcttctgg gatcgcgcga cttttcccgc gcgatgtgga    125400
     acctcttcca atacatcgcg atcaccgtgc cgcttggcct gagcgtcgcc ttcggtctgg    125460
     cgctgctcgt ggacagcttc acgggacgct gggcgaactt ctttcgcaac gcctatttcc    125520
     tgccggtggt gctgcctgcc tttctggccg ccacgatctg gcgctggatc tatgcgtcca    125580
     atttcggcct gctcaacatg atgctgggct ggatcggcgc cgaacccgtc agctttctca    125640
     atgacacggg caccatgctt tatgcgctga tcgcggtgga tgtctgggtc tcggccgggt    125700
     tcaacatggt catcatcctg gccggactga agaacatccc cgcagacctt tacgaggcgg    125760
     cgcggctcga tggcgccagc aagctgcagc aggtgatcca catcaccctg ccgatgctcg    125820
     cgccggtgat gttcttcgtg ctgacctatt ccgtcatctc ggcgatgcag gtctttgaca    125880
     agccctggct gctgacgggc tcttccttct cggaatatgg cgggcgccgc ggcgcgctgc    125940
     tgttcccggt gatggacatg atgggccggg ccttcggcgg cgtgcagttc ggcctcgcct    126000
     cggcttacgg cttcctgctc acgctggcca tcatccttgt caccgccctc ctctacgcgc    126060
     ttcgcagctg gagcaaccgc cgatgatctc tcctctttcc ctcgccccgc ggctgtcggt    126120
     ctggaccgtc ctgaaatggg tcatcgccct gctgatcgcg gtcatcacga tctttccgat    126180
     ctggtggatg gtcaatgtcg tcttctcgct gcccggcgag ccggtctcga tcaacccccg    126240
     gctctggccg acctcgctgt cggccgggtt cgacaagatc gggatgatct tcacccagac    126300
     cggctatctg cgcgcctatg gcatttcgct cgcctatgcg ctgctgacga tcctgggcgt    126360
     gctgttcatc ggctcgctcg cggcctttga attcgcgctg ttcgactttc cggccaagcg    126420
     gctgatcttc ggcatcgtga tgctgtcgct gatggtgccc accgccgtga ccatcatccc    126480
     cacctatctg ctgacttcgc agctgggctg gctgaactcg atgcaggggc tggtcgtgcc    126540
     cggtctcgcc tcggccttcg ggctgttcat gctggtgcag ttcatgcgcg ccattccgca    126600
     agacatgatc gaggccgcgc ggctcgatgg cgcggggcat ttccagatct actggcatgt    126660
     cgccctgccg ctgtgccgca acgcgctgat cacgctggcg atcctgacct tcatgcagac    126720
     ctggggcaac tacatgtggc cgctgatcat caccacctcg cccgagatgt acaccgtcgg    126780
     gcaagtcgtg ggcctgttca acgcgcccct ctcgcatcag acggtcgatg tcgtcatgac    126840
     cgccaacctt ctcgccgccg tgccgccgct gctgttcttc ctgatcttcc aacgcaagat    126900
     cgtcgaaggc atcgcgatgt cgggcaccaa gggctgaacc ggagcacacg aaaccatggc    126960
     ctttcttgaa atcaaatccc tgtgcaaaag cttcgaggcc tatccggtct tgcaagatat    127020
     cgacctgtcg atcgaaaaag gcgaattcgt cgtctttgtc ggcccctcgg gctgcgggaa    127080
     atccacgctc ttgcggatga tcaccgggct tgagacgccc acttcgggca cgatcgcgat    127140
     cgaggatacg gtgatcaacg acgtcgatcc ggccaaacgc ggcacggcga tggtgtttca    127200
     atcctacgcg ctttacccgc acatgacggt gttcgagaac atctccttcg ggctgcgcat    127260
     ggcgcatcag cccaaggcgc tgatccgtga acgggtcgaa aaggccgccg ccatcctgcg    127320
     gctggaaaag cttctggacc gcaagccggg gcagctttcg ggcgggcaga agcagcgcgt    127380
     cgccatcggc cgcgccatcg tgcgcgaacc gcgggtgttc ctgttcgacg agccgctgtc    127440
     gaaccttgac gcggagctgc gcgtgcagat gcgcgccgag ctgctggagc tgcacgagcg    127500
     gctcggcacc acgatgatct atgtcaccca tgatcaggtc gaggcgatga cgctggccga    127560
     caagatggtg gtgatgatgg gcggcaaggt ccagcaatat ggccgcccgc tcgatcttta    127620
     tgacgatccc gacaacaagt tcgtcgcggg ctttgtcggt tcgccgaaga tgaacttcct    127680
     gtcggccagg gtcgtcaccg ccgggcccgc gggcctgcgg gtcgatctgg cggcgggtgg    127740
     cgcggccttg gtgccgctgg cggtgacgct ggcgccgggc gcgcgggtcg ctcttggcct    127800
     gcgccccgag cagatttccg tcgtcgccgc ggggcagtcg cttcccgccg atgcggtgat    127860
     ggtgaccggc cgtgtcgcgc tgatcgagga tctgggcgcc gaatcctatc tgcatctgca    127920
     ccttgccgac gacagccgca tcggggtgcg gacggtccgc catgccgcgc atctgggcga    127980
     cgaggtccgc gttgccgcgc ccgcctctgc cgtgctggtc tttgacgatg ccggaacgcg    128040
     tctgcggggc cgggcatgat cttgcagacc gcgtccgggg ccgctgcccc ggtggtgggc    128100
     gtcgacatcg gcggcaccaa gaccgagatc tgcctggcac gcctggacgg agcccggctg    128160
     atcaagctgc gcgagacggt cctgcccagc cgcagctggc gcggcgccga tgcggccgcc    128220
     gatgccgcca gtcttctggc gcaggtgcgg cttctggtcg gcgacagccc cgtcgcggcg    128280
     ctgggcgtgg gcgcgcatgg ctgcgacgat gacgccgaat gcgagacgct ggccgcggcc    128340
     ttgcgggccc gcagcgccct gcccctgcgg gtggtgaacg atgccgagct gatgccgctc    128400
     gccatgggcc gggtggggca gatcgggctg gttgcgggca cgggctcgat tgccgtgtgc    128460
     cgcaccgccg aggggcggat gatctcggcc gggggctggg gctggctgat cggcgacgat    128520
     ggcagcgccg ccggtctggt gcgcgaggcg gcgcgggcgg tgtcgcttgc gctcgatggc    128580
     ggcgccacga ccgaagaccc gctgatcggg cttctctatc attcgctggg ccagccggaa    128640
     ctgccgcggc tgggcagcac gctggcaggc cttggcacgg cggcggcgat cggcgcccat    128700
     gcgcccgcgg tgtttgccgc ctgcgacgcg ggctcgccgc tcgccgcttc ggtcatccgc    128760
     gccggggccg aggcgctggc ggggcttgtg gtgaacctgc gcgcccgcgg cagcaccgcc    128820
     tcgcatgtgg tggccggcgg cagcgtgatc gtggcgcagc cgccgctgtg gcaggccttc    128880
     gccaccgccg tcgcgcggcg cagcggcggc gccgtcaccg cgcatctttt ccagggtcat    128940
     ccggtcgagg gcgcctgccg ccttgccgcc gatctggtga cgcccgccct ttcctgacct    129000
     atcgacagca gaaggacctc gaccatgagt tacagatcca ccatcgcccg ccagcccgag    129060
     gcgctggccg atacgcacgc ggcgctgcgc agccagcttg acgccgccga tctttcggac    129120
     ctgttcgggc cggtgatcgg cgtcaccggc atcggcgcca gctttgccgc cgccgtcgtc    129180
     ggcgcggccg agctgcaggc ccggggacgg cgcggcatcg cgctgcgcgc ttgcgatctg    129240
     gccgcgggcc atgatctggc cgacacgctg gtcggccttt cggcgggcgg gcgcagcatc    129300
     gaaaccgttc tgggcttcga aaagctgccc tcggcgcggc gcatcggcat cagcaaggac    129360
     ggcgccggtc cgctggccgc ggtttccgac ctgcatcttg aaatccggca gggcgcggat    129420
     gcgacgccgt caagcgtcgg ctacacggcc acgcttctgg gcatggggat gctgttcgag    129480
     cggctttcgg gcgcgcagga cgacagcttt gccgatctgc ccggcgtggt gaccggggtg    129540
     ctggcacagg cggcggcaaa gatggagcgc atcggcacgc tctttgccgc gcgccgggcg    129600
     atcgactgcg tcggcgccgg ggcggcgctg ggcacggccg atggcgcctc gctgcttctg    129660
     cgcgaggccg cccgtctgcc cgccgcggcg catgacaccc ggcattacct gcacgggccg    129720
     ctcgaggcga tggatgccac gaccggcgtt ctgatcatcg gcgacgggcg cgaggtggag    129780
     ctggcgcatc aggtcgagcg gatcggctgc ccggtggttc tgatcaccac cgatgcgacg    129840
     gtgacggatg gcgagcggct gaccgtgatc acggtgccgc gccgcgacaa cctgatcgcg    129900
     cagggcatcc ttgacattct ggcgccgcag ctgatcgccg ccacgctctc cgatgcggcg    129960
     ggcctgaccg atgtgaagtt ccgctaccgg atgcaggaca ccaagatcgc cgcgccgacg    130020
     gcggcctgac ccgctccggt ggcggccgga ccgccgccgc cggacccacc cgcatggccc    130080
     cccgcgcctt gtgtgatcgc tgcggacgag ggcgttcaca gcgatcagca ggccgcggat    130140
     ggggcgcaaa actctcgggc cgacccgcgg caatgcggcg tcggcccttt cttcacgcgg    130200
     cttcgatcaa gatcccgccc ccgtcgccgg gcaggctgcg cgccccgtct tgcggcggga    130260
     cacgcgatgc aagaaaggcc cgggccggat gcgaccggcc ggcgtgcctc aataggcgac    130320
     gcgcttgtaa tagcgccggg tcaccagcgg atggtttcgc atcacctcca gatgggcgct    130380
     cagccgctcc atcaacgtcg ccatcaccgc aggcgagagc agcgcgcgca gctcgggcga    130440
     gagctcgcgc ggcaggtaat ccgccgtcga gatcaccgtc agcttgtcgg tatattgccg    130500
     ggcgaattgc gcgacgcgct cggccagcgg gtcgcagtca tcctcgccgc ggaacaggat    130560
     caggctgaca cccggttcga tcagttcaag cgggccatgg aagaaatccg aggcatgcgt    130620
     cgggcgggtg cggatccact gcatttcctc aaggatgcag gtcgcgtagt aaagcgcctc    130680
     gggccacatg ttcccggcgc cggtgaacat gtgataatcc gacccggcga tgatcgcggc    130740
     gaaatccttg gccttgggtt caaaggcctt tttcgccgca accagcgcgg cgggcacgct    130800
     ggccagttcg cgcagcagcg cgtcgtaatt ggcgatctcg ccgcgcgcct tcatcaccga    130860
     aagcgccacc agcagcgact ggatgtagaa ggattccgag gaggtgtcat cctcggcaaa    130920
     gttgaccaga gccgggttgc cgccctgacc cagcggggtt tcggcatggc ccaccagcgt    130980
     gatcaccgtc gcgccgatct cttgcagctt cgccatcatc gcgacgcttt ccttggtcgt    131040
     gcccgaaagc gagggcatga ccacgatcga acgcgccgtc agattggccg agcccgtgat    131100
     caccagctcg gccggatagt ccttgaacac cggaaagccc gagcgacgtt gcagcagctg    131160
     gaccgccggt tccatcagat aggcgacgcc gccggtgccg aggaaataca ggttggtcgc    131220
     accggcaccg atcgccgcgc cgatcgccgc gtcgatgcgc ggggccagat cgaccgcgcc    131280
     ttgctggatg cgcaagaagc gggtttcgtc aaaattgaac atggcatgtc cttcgcagtt    131340
     gtgcccgttt gcgggcatga ggggattggg gccgcacgcg gaacgtgcgg cagagggttt    131400
     gcggggagga aacgggaaag ggcggcggat cagtcgatca gggcggccac ccgggtggaa    131460
     agggctctgg cggcaccgcc cagatgcccg atgcgggccg cgcgcgcagt ctcgtcggca    131520
     tcaagccggc cctgcatctc ctgcagcatc gcctcgaccg cttcgggggc ggtgccgccc    131580
     ggaaccttgc gggccgaaac cgcctgcacc gggtccatcc agcggcgcag cttgtcctcg    131640
     gccagatcga agctgcgccc gatctcttcc tcggcggcgg cattgagcac ctgcaccgtg    131700
     agctggcgcg catcgccacc cgcggcgatc accatctgca ccgcccgccc gacgacatga    131760
     tgggcatcgc ggaacgagac gccgaagtcg cgcaccagac catcggcaag gtcggtcgcg    131820
     gtcgagaaat tcgcggaaca ccgcgccagc aggcgttcgg catcgggggt tgcggtctcg    131880
     aagatcagcc gcaaaagcgg cagcgtggcg cggaaccgct cgaaagtcgg ccaggcgtcg    131940
     gtgacgccct cgcgcacgct gtcgaggccg atcgaatagt tcgacccttt caccgccgaa    132000
     agcgcccccg ccagcgcccc gatgctgcgc ccggcctcgg cacggaaata ttcaagcggc    132060
     agcatgttct tcttttgcgg catgatcgag gaagtgcccg ccacccggtc gggaaagccg    132120
     agcgcgccga attcccaggt ggtgaagacg tagaaatcct gtgccacgcg cgaaaacagc    132180
     acctgcgcgc tggtcaccgc ccaaagcatc tcggtgacga aatcgcgcga ggccacggca    132240
     tcgagccccg gcgtcgccag ccccgaaaag ccgagcatct gcgccacccg cggccgatcg    132300
     atcgcaaacg aggtccccgc cagcgccgcc atgcccaacg cgcaggcatc ggcccggtca    132360
     tagaccgcag ccagccggtc gtagtcccgt tccatgccgc gcgcgacatt ggccagataa    132420
     tagccgaagg tgatcggctg cgccggttgc agatgggtgt agcccggcat caccgtcatc    132480
     ttgtggcgcg ccgccgccgc aagacaggcg cggcgggttg cggccatttc cgccagcagc    132540
     ccaagacaga cctcgcgcgc ggccatccgg tcaagcgtcg cgccgatgtc gttgcggctg    132600
     cgcccgatat gcagccagcc cgccgtcgcc ttgccgatca cctgccccag ccggttttcg    132660
     aaggcgaaat agctgtcttc gaactgcgga tcgaggtcga tcgcccccgg tccctcggcg    132720
     cggatcgtgg cgatgccgcg caacaacgtg cgcgcgatct cggccgggat caggccgcat    132780
     tcggccagca tcacggcatg cgcctcgttg agcgcgcaca tccgttccag cgcggcggcg    132840
     tcgaagccct gcatcggcgg cgcatagatc gtgcgcgcca cctcggccgc ggtgcgttcc    132900
     gtcaggcggg agcttacgga gttcttcatg tcatctgtcc tgttgcgcaa ggggccggga    132960
     aa                                                                   132962
//

If you have problems or comments...

PBIL Back to PBIL home page