(data stored in ACNUC7421 zone)

EMBL: CP001322

ID   CP001322; SV 1; circular; genomic DNA; STD; PRO; 6517073 BP.
XX
AC   CP001322; ABII01000000-ABII01000052;
XX
PR   Project:PRJNA19449;
XX
DT   29-DEC-2008 (Rel. 98, Created)
DT   23-APR-2019 (Rel. 140, Last updated, Version 6)
XX
DE   Desulfatibacillum aliphaticivorans strain AK-01, complete genome.
XX
KW   .
XX
OS   Desulfatibacillum aliphaticivorans
OC   Bacteria; Proteobacteria; Deltaproteobacteria; Desulfobacterales;
OC   Desulfobacteraceae; Desulfatibacillum.
XX
RN   [1]
RP   1-6517073
RX   PUBMED; 21651686.
RA   Callaghan A.V., Morris B.E., Pereira I.A., McInerney M.J., Austin R.N.,
RA   Groves J.T., Kukor J.J., Suflita J.M., Young L.Y., Zylstra G.J., Wawrik B.;
RT   "The genome sequence of Desulfatibacillum alkenivorans AK-01: a blueprint
RT   for anaerobic alkane oxidation";
RL   Environ. Microbiol. 14(1):101-113(2012).
XX
RN   [2]
RP   1-6517073
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Wawrik B., Richardson P.;
RT   "Complete sequence of Desulfatibacillum alkenivorans AK-01";
RL   Unpublished.
XX
RN   [3]
RP   1-6517073
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Brettin T., Detter J.C.,
RA   Han C., Larimer F., Land M., Hauser L., Kyrpides N., Ovchinnikova G.,
RA   Wawrik B., Richardson P.;
RT   ;
RL   Submitted (22-DEC-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-6517073
RA   Callaghan A.V., Wawrik B.;
RT   ;
RL   Submitted (18-APR-2011) to the INSDC.
RL   Department of Botany and Microbiology, University of Oklahoma, 770 Van
RL   Vleet Oval, Geroge Lynn Cross Hall, Norman, OK 73019, USA
XX
DR   MD5; a368ac0eb955db37bfd93c7baa7e6a07.
DR   BioSample; SAMN00000039.
DR   EnsemblGenomes-Gn; Dalk_R0001.
DR   EnsemblGenomes-Gn; Dalk_R0002.
DR   EnsemblGenomes-Gn; Dalk_R0003.
DR   EnsemblGenomes-Gn; Dalk_R0004.
DR   EnsemblGenomes-Gn; Dalk_R0005.
DR   EnsemblGenomes-Gn; Dalk_R0006.
DR   EnsemblGenomes-Gn; Dalk_R0007.
DR   EnsemblGenomes-Gn; Dalk_R0008.
DR   EnsemblGenomes-Gn; Dalk_R0009.
DR   EnsemblGenomes-Gn; Dalk_R0010.
DR   EnsemblGenomes-Gn; Dalk_R0011.
DR   EnsemblGenomes-Gn; Dalk_R0012.
DR   EnsemblGenomes-Gn; Dalk_R0013.
DR   EnsemblGenomes-Gn; Dalk_R0014.
DR   EnsemblGenomes-Gn; Dalk_R0015.
DR   EnsemblGenomes-Gn; Dalk_R0016.
DR   EnsemblGenomes-Gn; Dalk_R0017.
DR   EnsemblGenomes-Gn; Dalk_R0018.
DR   EnsemblGenomes-Gn; Dalk_R0019.
DR   EnsemblGenomes-Gn; Dalk_R0020.
DR   EnsemblGenomes-Gn; Dalk_R0021.
DR   EnsemblGenomes-Gn; Dalk_R0022.
DR   EnsemblGenomes-Gn; Dalk_R0023.
DR   EnsemblGenomes-Gn; Dalk_R0024.
DR   EnsemblGenomes-Gn; Dalk_R0025.
DR   EnsemblGenomes-Gn; Dalk_R0026.
DR   EnsemblGenomes-Gn; Dalk_R0027.
DR   EnsemblGenomes-Gn; Dalk_R0028.
DR   EnsemblGenomes-Gn; Dalk_R0029.
DR   EnsemblGenomes-Gn; Dalk_R0030.
DR   EnsemblGenomes-Gn; Dalk_R0031.
DR   EnsemblGenomes-Gn; Dalk_R0032.
DR   EnsemblGenomes-Gn; Dalk_R0033.
DR   EnsemblGenomes-Gn; Dalk_R0034.
DR   EnsemblGenomes-Gn; Dalk_R0035.
DR   EnsemblGenomes-Gn; Dalk_R0036.
DR   EnsemblGenomes-Gn; Dalk_R0037.
DR   EnsemblGenomes-Gn; Dalk_R0038.
DR   EnsemblGenomes-Gn; Dalk_R0039.
DR   EnsemblGenomes-Gn; Dalk_R0040.
DR   EnsemblGenomes-Gn; Dalk_R0041.
DR   EnsemblGenomes-Gn; Dalk_R0042.
DR   EnsemblGenomes-Gn; Dalk_R0043.
DR   EnsemblGenomes-Gn; Dalk_R0044.
DR   EnsemblGenomes-Gn; Dalk_R0045.
DR   EnsemblGenomes-Gn; Dalk_R0046.
DR   EnsemblGenomes-Gn; Dalk_R0047.
DR   EnsemblGenomes-Gn; Dalk_R0048.
DR   EnsemblGenomes-Gn; Dalk_R0049.
DR   EnsemblGenomes-Gn; Dalk_R0050.
DR   EnsemblGenomes-Gn; Dalk_R0051.
DR   EnsemblGenomes-Gn; Dalk_R0052.
DR   EnsemblGenomes-Gn; Dalk_R0053.
DR   EnsemblGenomes-Gn; Dalk_R0054.
DR   EnsemblGenomes-Gn; Dalk_R0055.
DR   EnsemblGenomes-Gn; Dalk_R0056.
DR   EnsemblGenomes-Gn; Dalk_R0057.
DR   EnsemblGenomes-Gn; Dalk_R0058.
DR   EnsemblGenomes-Gn; Dalk_R0059.
DR   EnsemblGenomes-Gn; Dalk_R0060.
DR   EnsemblGenomes-Gn; Dalk_R0061.
DR   EnsemblGenomes-Gn; Dalk_R0063.
DR   EnsemblGenomes-Gn; Dalk_R0064.
DR   EnsemblGenomes-Gn; Dalk_R0065.
DR   EnsemblGenomes-Gn; Dalk_R0066.
DR   EnsemblGenomes-Gn; EBG00001185354.
DR   EnsemblGenomes-Gn; EBG00001185355.
DR   EnsemblGenomes-Gn; EBG00001185356.
DR   EnsemblGenomes-Gn; EBG00001185357.
DR   EnsemblGenomes-Gn; EBG00001185358.
DR   EnsemblGenomes-Gn; EBG00001185359.
DR   EnsemblGenomes-Gn; EBG00001185360.
DR   EnsemblGenomes-Gn; EBG00001185361.
DR   EnsemblGenomes-Gn; EBG00001185362.
DR   EnsemblGenomes-Gn; EBG00001185363.
DR   EnsemblGenomes-Gn; EBG00001185364.
DR   EnsemblGenomes-Gn; EBG00001185365.
DR   EnsemblGenomes-Gn; EBG00001185366.
DR   EnsemblGenomes-Gn; EBG00001185367.
DR   EnsemblGenomes-Gn; EBG00001185368.
DR   EnsemblGenomes-Gn; EBG00001185369.
DR   EnsemblGenomes-Gn; EBG00001185370.
DR   EnsemblGenomes-Gn; EBG00001185371.
DR   EnsemblGenomes-Gn; EBG00001185372.
DR   EnsemblGenomes-Gn; EBG00001185373.
DR   EnsemblGenomes-Gn; EBG00001185374.
DR   EnsemblGenomes-Gn; EBG00001185375.
DR   EnsemblGenomes-Gn; EBG00001185376.
DR   EnsemblGenomes-Gn; EBG00001185377.
DR   EnsemblGenomes-Gn; EBG00001185378.
DR   EnsemblGenomes-Gn; EBG00001185379.
DR   EnsemblGenomes-Gn; EBG00001185380.
DR   EnsemblGenomes-Gn; EBG00001185381.
DR   EnsemblGenomes-Gn; EBG00001185382.
DR   EnsemblGenomes-Gn; EBG00001185383.
DR   EnsemblGenomes-Gn; EBG00001185384.
DR   EnsemblGenomes-Gn; EBG00001185385.
DR   EnsemblGenomes-Gn; EBG00001185386.
DR   EnsemblGenomes-Gn; EBG00001185387.
DR   EnsemblGenomes-Gn; EBG00001185388.
DR   EnsemblGenomes-Gn; EBG00001185389.
DR   EnsemblGenomes-Gn; EBG00001185390.
DR   EnsemblGenomes-Gn; EBG00001185391.
DR   EnsemblGenomes-Gn; EBG00001185392.
DR   EnsemblGenomes-Gn; EBG00001185393.
DR   EnsemblGenomes-Gn; EBG00001185394.
DR   EnsemblGenomes-Gn; EBG00001185395.
DR   EnsemblGenomes-Gn; EBG00001185396.
DR   EnsemblGenomes-Gn; EBG00001185397.
DR   EnsemblGenomes-Gn; EBG00001185398.
DR   EnsemblGenomes-Gn; EBG00001185399.
DR   EnsemblGenomes-Gn; EBG00001185400.
DR   EnsemblGenomes-Gn; EBG00001185401.
DR   EnsemblGenomes-Gn; EBG00001185402.
DR   EnsemblGenomes-Gn; EBG00001185403.
DR   EnsemblGenomes-Gn; EBG00001185404.
DR   EnsemblGenomes-Gn; EBG00001185405.
DR   EnsemblGenomes-Gn; EBG00001185406.
DR   EnsemblGenomes-Gn; EBG00001185407.
DR   EnsemblGenomes-Gn; EBG00001185408.
DR   EnsemblGenomes-Gn; EBG00001185409.
DR   EnsemblGenomes-Gn; EBG00001185410.
DR   EnsemblGenomes-Gn; EBG00001185411.
DR   EnsemblGenomes-Gn; EBG00001185412.
DR   EnsemblGenomes-Gn; EBG00001185413.
DR   EnsemblGenomes-Gn; EBG00001185414.
DR   EnsemblGenomes-Gn; EBG00001185415.
DR   EnsemblGenomes-Gn; EBG00001185416.
DR   EnsemblGenomes-Gn; EBG00001185417.
DR   EnsemblGenomes-Gn; EBG00001185418.
DR   EnsemblGenomes-Gn; EBG00001185419.
DR   EnsemblGenomes-Gn; EBG00001185420.
DR   EnsemblGenomes-Gn; EBG00001185421.
DR   EnsemblGenomes-Gn; EBG00001185422.
DR   EnsemblGenomes-Gn; EBG00001185423.
DR   EnsemblGenomes-Gn; EBG00001185424.
DR   EnsemblGenomes-Gn; EBG00001185425.
DR   EnsemblGenomes-Gn; EBG00001185426.
DR   EnsemblGenomes-Gn; EBG00001185427.
DR   EnsemblGenomes-Tr; Dalk_R0001-1.
DR   EnsemblGenomes-Tr; Dalk_R0002-1.
DR   EnsemblGenomes-Tr; Dalk_R0003-1.
DR   EnsemblGenomes-Tr; Dalk_R0004-1.
DR   EnsemblGenomes-Tr; Dalk_R0005-1.
DR   EnsemblGenomes-Tr; Dalk_R0006-1.
DR   EnsemblGenomes-Tr; Dalk_R0007-1.
DR   EnsemblGenomes-Tr; Dalk_R0008-1.
DR   EnsemblGenomes-Tr; Dalk_R0009-1.
DR   EnsemblGenomes-Tr; Dalk_R0010-1.
DR   EnsemblGenomes-Tr; Dalk_R0011-1.
DR   EnsemblGenomes-Tr; Dalk_R0012-1.
DR   EnsemblGenomes-Tr; Dalk_R0013-1.
DR   EnsemblGenomes-Tr; Dalk_R0014-1.
DR   EnsemblGenomes-Tr; Dalk_R0015-1.
DR   EnsemblGenomes-Tr; Dalk_R0016-1.
DR   EnsemblGenomes-Tr; Dalk_R0017-1.
DR   EnsemblGenomes-Tr; Dalk_R0018-1.
DR   EnsemblGenomes-Tr; Dalk_R0019-1.
DR   EnsemblGenomes-Tr; Dalk_R0020-1.
DR   EnsemblGenomes-Tr; Dalk_R0021-1.
DR   EnsemblGenomes-Tr; Dalk_R0022-1.
DR   EnsemblGenomes-Tr; Dalk_R0023-1.
DR   EnsemblGenomes-Tr; Dalk_R0024-1.
DR   EnsemblGenomes-Tr; Dalk_R0025-1.
DR   EnsemblGenomes-Tr; Dalk_R0026-1.
DR   EnsemblGenomes-Tr; Dalk_R0027-1.
DR   EnsemblGenomes-Tr; Dalk_R0028-1.
DR   EnsemblGenomes-Tr; Dalk_R0029-1.
DR   EnsemblGenomes-Tr; Dalk_R0030-1.
DR   EnsemblGenomes-Tr; Dalk_R0031-1.
DR   EnsemblGenomes-Tr; Dalk_R0032-1.
DR   EnsemblGenomes-Tr; Dalk_R0033-1.
DR   EnsemblGenomes-Tr; Dalk_R0034-1.
DR   EnsemblGenomes-Tr; Dalk_R0035-1.
DR   EnsemblGenomes-Tr; Dalk_R0036-1.
DR   EnsemblGenomes-Tr; Dalk_R0037-1.
DR   EnsemblGenomes-Tr; Dalk_R0038-1.
DR   EnsemblGenomes-Tr; Dalk_R0039-1.
DR   EnsemblGenomes-Tr; Dalk_R0040-1.
DR   EnsemblGenomes-Tr; Dalk_R0041-1.
DR   EnsemblGenomes-Tr; Dalk_R0042-1.
DR   EnsemblGenomes-Tr; Dalk_R0043-1.
DR   EnsemblGenomes-Tr; Dalk_R0044-1.
DR   EnsemblGenomes-Tr; Dalk_R0045-1.
DR   EnsemblGenomes-Tr; Dalk_R0046-1.
DR   EnsemblGenomes-Tr; Dalk_R0047-1.
DR   EnsemblGenomes-Tr; Dalk_R0048-1.
DR   EnsemblGenomes-Tr; Dalk_R0049-1.
DR   EnsemblGenomes-Tr; Dalk_R0050-1.
DR   EnsemblGenomes-Tr; Dalk_R0051-1.
DR   EnsemblGenomes-Tr; Dalk_R0052-1.
DR   EnsemblGenomes-Tr; Dalk_R0053-1.
DR   EnsemblGenomes-Tr; Dalk_R0054-1.
DR   EnsemblGenomes-Tr; Dalk_R0055-1.
DR   EnsemblGenomes-Tr; Dalk_R0056-1.
DR   EnsemblGenomes-Tr; Dalk_R0057-1.
DR   EnsemblGenomes-Tr; Dalk_R0058-1.
DR   EnsemblGenomes-Tr; Dalk_R0059-1.
DR   EnsemblGenomes-Tr; Dalk_R0060-1.
DR   EnsemblGenomes-Tr; Dalk_R0061-1.
DR   EnsemblGenomes-Tr; Dalk_R0063-1.
DR   EnsemblGenomes-Tr; Dalk_R0064-1.
DR   EnsemblGenomes-Tr; Dalk_R0065-1.
DR   EnsemblGenomes-Tr; Dalk_R0066-1.
DR   EnsemblGenomes-Tr; EBT00001764008.
DR   EnsemblGenomes-Tr; EBT00001764009.
DR   EnsemblGenomes-Tr; EBT00001764010.
DR   EnsemblGenomes-Tr; EBT00001764011.
DR   EnsemblGenomes-Tr; EBT00001764012.
DR   EnsemblGenomes-Tr; EBT00001764013.
DR   EnsemblGenomes-Tr; EBT00001764014.
DR   EnsemblGenomes-Tr; EBT00001764015.
DR   EnsemblGenomes-Tr; EBT00001764016.
DR   EnsemblGenomes-Tr; EBT00001764017.
DR   EnsemblGenomes-Tr; EBT00001764018.
DR   EnsemblGenomes-Tr; EBT00001764019.
DR   EnsemblGenomes-Tr; EBT00001764020.
DR   EnsemblGenomes-Tr; EBT00001764021.
DR   EnsemblGenomes-Tr; EBT00001764022.
DR   EnsemblGenomes-Tr; EBT00001764023.
DR   EnsemblGenomes-Tr; EBT00001764024.
DR   EnsemblGenomes-Tr; EBT00001764025.
DR   EnsemblGenomes-Tr; EBT00001764026.
DR   EnsemblGenomes-Tr; EBT00001764027.
DR   EnsemblGenomes-Tr; EBT00001764028.
DR   EnsemblGenomes-Tr; EBT00001764029.
DR   EnsemblGenomes-Tr; EBT00001764030.
DR   EnsemblGenomes-Tr; EBT00001764031.
DR   EnsemblGenomes-Tr; EBT00001764032.
DR   EnsemblGenomes-Tr; EBT00001764033.
DR   EnsemblGenomes-Tr; EBT00001764034.
DR   EnsemblGenomes-Tr; EBT00001764035.
DR   EnsemblGenomes-Tr; EBT00001764036.
DR   EnsemblGenomes-Tr; EBT00001764037.
DR   EnsemblGenomes-Tr; EBT00001764038.
DR   EnsemblGenomes-Tr; EBT00001764039.
DR   EnsemblGenomes-Tr; EBT00001764040.
DR   EnsemblGenomes-Tr; EBT00001764041.
DR   EnsemblGenomes-Tr; EBT00001764042.
DR   EnsemblGenomes-Tr; EBT00001764043.
DR   EnsemblGenomes-Tr; EBT00001764044.
DR   EnsemblGenomes-Tr; EBT00001764045.
DR   EnsemblGenomes-Tr; EBT00001764046.
DR   EnsemblGenomes-Tr; EBT00001764047.
DR   EnsemblGenomes-Tr; EBT00001764048.
DR   EnsemblGenomes-Tr; EBT00001764049.
DR   EnsemblGenomes-Tr; EBT00001764050.
DR   EnsemblGenomes-Tr; EBT00001764051.
DR   EnsemblGenomes-Tr; EBT00001764052.
DR   EnsemblGenomes-Tr; EBT00001764053.
DR   EnsemblGenomes-Tr; EBT00001764054.
DR   EnsemblGenomes-Tr; EBT00001764055.
DR   EnsemblGenomes-Tr; EBT00001764056.
DR   EnsemblGenomes-Tr; EBT00001764057.
DR   EnsemblGenomes-Tr; EBT00001764058.
DR   EnsemblGenomes-Tr; EBT00001764059.
DR   EnsemblGenomes-Tr; EBT00001764060.
DR   EnsemblGenomes-Tr; EBT00001764061.
DR   EnsemblGenomes-Tr; EBT00001764062.
DR   EnsemblGenomes-Tr; EBT00001764063.
DR   EnsemblGenomes-Tr; EBT00001764064.
DR   EnsemblGenomes-Tr; EBT00001764065.
DR   EnsemblGenomes-Tr; EBT00001764066.
DR   EnsemblGenomes-Tr; EBT00001764067.
DR   EnsemblGenomes-Tr; EBT00001764068.
DR   EnsemblGenomes-Tr; EBT00001764069.
DR   EnsemblGenomes-Tr; EBT00001764070.
DR   EnsemblGenomes-Tr; EBT00001764071.
DR   EnsemblGenomes-Tr; EBT00001764072.
DR   EnsemblGenomes-Tr; EBT00001764073.
DR   EnsemblGenomes-Tr; EBT00001764074.
DR   EnsemblGenomes-Tr; EBT00001764075.
DR   EnsemblGenomes-Tr; EBT00001764076.
DR   EnsemblGenomes-Tr; EBT00001764077.
DR   EnsemblGenomes-Tr; EBT00001764078.
DR   EnsemblGenomes-Tr; EBT00001764079.
DR   EnsemblGenomes-Tr; EBT00001764080.
DR   EnsemblGenomes-Tr; EBT00001764081.
DR   EuropePMC; PMC3526173; 22955231.
DR   EuropePMC; PMC3548836; 23349695.
DR   EuropePMC; PMC5109826; 27846794.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00002; 5_8S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF01051; c-di-GMP-I.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01852; tRNA-Sec.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF01989; SECIS_3.
DR   SILVA-LSU; CP001322.
DR   SILVA-SSU; CP001322.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003083
CC   Source DNA and bacteria available from Boris Wawrik
CC   (bwawrik@yahoo.com)
CC   Contacts: Boris Wawrik (bwawrik@yahoo.com)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
CC   The organism was changed from 'Desulfatibacillum alkenivorans
CC   AK-01' to 'Desulfatibacillum aliphaticivorans' in April 2019.
CC   ##Taxonomic-Update-Statistics-START##
CC   This Genome (query) :: GCA_000021905.1
CC   Current Name        :: Desulfatibacillum aliphaticivorans
CC   Previous Name       :: Desulfatibacillum alkenivorans AK-01
CC   Date Updated        :: 2019-04-22
CC   Analysis Type       :: Average Nucleotide Identity (ANI)
CC   Analysis 1 (A1)     :: Query vs. TYPE genome for current name
CC   A1 Genome (subject) :: GCA_000429905.1
CC   A1 Name             :: Desulfatibacillum aliphaticivorans
CC   A1 ANI              :: 97.50372%
CC   A1 Query Coverage   :: 86.42%
CC   A1 Subject Coverage :: 87.09%
CC   Analysis 2 (A2)     :: Query vs. TYPE genome for previous name
CC   A2 Genome (subject) :: GCA_900142135.1
CC   A2 Name             :: Desulfatibacillum alkenivorans AK-01
CC   A2 ANI              :: 92.85495%
CC   A2 Query Coverage   :: 81.84%
CC   A2 Subject Coverage :: 82.5%
CC   ##Taxonomic-Update-Statistics-END##
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..6517073
FT                   /organism="Desulfatibacillum aliphaticivorans"
FT                   /strain="AK-01"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:218208"
FT   gene            39..221
FT                   /locus_tag="Dalk_0001"
FT   CDS_pept        39..221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0001"
FT                   /product="hypothetical protein Dalk_0001"
FT                   /note="IMG reference gene:2503005696"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01711"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFL7"
FT                   /protein_id="ACL01711.1"
FT                   /translation="MFEMLLRRKSLLSDLTSKGLCAYNAINAWVTSARFKKTAKKYLKT
FT                   FPIGPAQMFSCVHAR"
FT   gene            423..1787
FT                   /locus_tag="Dalk_0002"
FT   CDS_pept        423..1787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0002"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; PFAM: Chromosomal replication initiator DnaA domain;
FT                   Chromosomal replication initiator DnaA; KEGG: dol:Dole_0001
FT                   chromosomal replication initiator protein DnaA; IMG
FT                   reference gene:2503005697; PFAM: domain; Bacterial dnaA
FT                   protein; TIGRFAM: chromosomal replication initiator protein
FT                   DnaA; InterPro:Chromosomal replication control, initiator
FT                   (DnaA)/regulator (Hda); InterPro:Chromosomal replication
FT                   control, initiator DnaA; InterPro:Chromosomal replication
FT                   control, initiator DnaA-like; InterPro:Chromosomal
FT                   replication initiator, DnaA C-terminal; InterPro:Trp
FT                   repressor/replication initiator"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01712"
FT                   /db_xref="GOA:B8FFL8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FFL8"
FT                   /protein_id="ACL01712.1"
FT                   /translation="MMTDSMRLVWEKAKEAIRSQVPDQGYLMWIDPLRVVKAAADSVVL
FT                   GCPNPLAKKWLMDHYRGLLESAMQQAAQRPLKVLLEVAECVAEAPETPEEAPQQLCLPA
FT                   FADIPRPSSGRLLNRDFTFDSFVVGDCNDFAYSAALSVASKRSKLHAPLYLLAQTGLGK
FT                   SHLSQAVGRQVMQESPEERVFYITAEDFTNEMIGALNTGTISSFKEKYRRNCDTLILED
FT                   VHFLSGKNRTQDELAFTLDSLMETNKRLVFTSAYLPSEIPKMHDSMRSRLNAGVISSLE
FT                   APDFRMRMRILQRKANSAKIALPMDVAEFMASELTGDIRHLESGIKGLAARNSIMGRGI
FT                   DLKMAREVVGNIVRNRKALTLGVITKMVCKYYRVTEEDLRSRSRKQAIARPRQVAMYLG
FT                   RRYTDQSLQAIGRTFNRYHATALHAVGVVERHIRENGDMREPVLFLCGKIEAGEF"
FT   gene            1874..3262
FT                   /locus_tag="Dalk_0003"
FT   CDS_pept        1874..3262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0003"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   dol:Dole_0002 FAD linked oxidase domain-containing protein;
FT                   IMG reference gene:2503005698; PFAM: FAD binding domain;
FT                   FAD linked oxidases, C-terminal domain; TIGRFAM: glycolate
FT                   oxidase, subunit GlcD; InterPro:FAD linked oxidase,
FT                   N-terminal; InterPro:FAD-binding, type 2;
FT                   InterPro:FAD-binding, type 2, subdomain 1;
FT                   InterPro:FAD-linked oxidase, C-terminal;
FT                   InterPro:FAD-linked oxidase, FAD-binding, subdomain 2;
FT                   InterPro:FAD-linked oxidase-like, C-terminal;
FT                   InterPro:Vanillyl-alcohol oxidase, C-terminal subdomain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01713"
FT                   /db_xref="GOA:B8FFL9"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFL9"
FT                   /protein_id="ACL01713.1"
FT                   /translation="MPIDAAIIKILKKIVGPKHVHDSWHQRAAYAYDASNRDFTPDAVV
FT                   FPATTAHVAEIINLANLNNFYVIPRGAGTGMTGGSLAVEGGVVMPLTRMDQVLGVDPAN
FT                   LTADVEPGVVTGDFQKLVEAQGLFYPPDPSSSAYCTMGGNVAECAGGPKAVKYGVTRDY
FT                   VLGLEAVTGAGEVVATGVRTAKGVVGYDLTRLITGSEGTLAVITRITVRLLPLPESVRT
FT                   ITAVYDKIDDAAKTVAAVFSAGIICRSIEYLDQAAIGCAESHLEIGLPTDAEAILLLEV
FT                   DGDPQQAERAAERVAKVCRDQNARTVSGVDDAEAAANLWKARKGLSPALFKYGPHKINE
FT                   DIVVPRTKIPDVVRRINELRAKTGLTMVSFGHAGDGNIHFNIMLDKEDPVALEKAESAV
FT                   VELFDYVLKLGGTISGEHGVGISKAPYFDMEIPPAQMEIMRQIKDVFDPNHILNPGKMF
FT                   PPET"
FT   gene            complement(3402..6254)
FT                   /locus_tag="Dalk_0004"
FT   CDS_pept        complement(3402..6254)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0004"
FT                   /product="peptidase C25 gingipain"
FT                   /note="PFAM: peptidase C25 gingipain; SMART: LamG domain
FT                   protein jellyroll fold domain protein; KEGG: dol:Dole_2014
FT                   peptidase C25 gingipain; IMG reference gene:2503005699;
FT                   PFAM: Peptidase family C25; InterPro:Concanavalin A-like
FT                   lectin/glucanase; InterPro:Concanavalin A-like
FT                   lectin/glucanase, subgroup; InterPro:Peptidase C25,
FT                   gingipain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01714"
FT                   /db_xref="GOA:B8FFM0"
FT                   /db_xref="InterPro:IPR001769"
FT                   /db_xref="InterPro:IPR006558"
FT                   /db_xref="InterPro:IPR012600"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="InterPro:IPR029031"
FT                   /db_xref="InterPro:IPR038490"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM0"
FT                   /protein_id="ACL01714.1"
FT                   /translation="MEKRKWISASGKTDIGKEADKSIVKTDYSKVRSLGVDDQGGGATI
FT                   VTYELTGAWMDELEYRGNVYDLIDIPSAGVHTQPGHPAVPQEGLFVAIPPNAKVTAVKL
FT                   LKETDRELDGKYNLIPVAEPSIEGHAEVYKPDPGIYGKDAFAPDQPFEFVGEKRVSGRL
FT                   VAHILVFPAKYNPQTGKVVLVESLELEVTYDTKPGMDCAPMKRGQASNAILDSLILDAD
FT                   TALKMEDKLGMDADAKAAEPKKLKDPGNHGDFVIVTTGDLKDAFKNFIDIRNLDHTVKL
FT                   ALLNDIKKEFPATGDDVSIKDFLTYAYNNWALRPKWVILGGDVDKIPTHHTACATWNDP
FT                   GDEPHHGLMASDHFYADISGDILPELLVGRFPASDSDTMKKICARALAFGRHGSQWRDV
FT                   IMLTTYQRNDYEQCKDAIAVAIDGEKRRDYNAALKYYGSDPAATKAKIIERLNERDNHH
FT                   VAKNGGVDIVNYRGHGSQTAWQASNGLNINDVTNLKTGSKTPLVLSICCLNNFIDWTGP
FT                   CFGETWISKLKSAGFWGASRPSYTAVNHKFDKFLWEGIINERYTSIGDIAQYGTAKLWQ
FT                   NDTSDLAKQNIKMYLLLGDPTADAKKVKNYSVSFKGNDGSYASVPNSPEIATAKEITVE
FT                   VMMRAESFNGGNWQDAVVSKHGPESGWELRVGEAIPRMMVTIGKTHYYAQPDDPAKSPK
FT                   LQAKRWYHLAGTFDGKTIKMYVDGELWFSKSVKGNITQYSGNLVFAKNANPEWDKRWFK
FT                   GDIANVALWNKARSQKEIQGDIFDNILADEIDRHNGLLGYWAMNEGGEEGEIVSDKFNV
FT                   LYDQVQTSINILSANNSGRIHKASWEKQHLNFYFTGKYTCGVKFGGATGTWHDASNLEI
FT                   KPDGAITYAGKTIVTPLIEANRIAWCIEDGNDSEGAIELMLGSDSRYFWPEGDQTSKLF
FT                   QGWIRDKGPSGPLDFRGKTS"
FT   gene            6875..7423
FT                   /locus_tag="Dalk_0005"
FT   CDS_pept        6875..7423
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0005"
FT                   /product="hypothetical protein Dalk_0005"
FT                   /note="KEGG: gsu:GSU1876 hypothetical protein; IMG
FT                   reference gene:2503005700"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01715"
FT                   /db_xref="InterPro:IPR004010"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM1"
FT                   /protein_id="ACL01715.1"
FT                   /translation="MKCTGPVLMVMILLVLGFAPASTAQDNEPIQDIAAKTKGIVDAAY
FT                   DYVRQHSGDMLAVQHALQTNPDFFDRENNLYVFMHSYNIEKKEAVCCGQGSRPELVGKN
FT                   MWNLRTPSGRLLFFEIARMIEKDGEGWIEYDWLNPYTKTLMSKYSYVRGITLQDGQKAW
FT                   VGCGFWKNKNKDFQHDDKK"
FT   sig_peptide     6875..6946
FT                   /locus_tag="Dalk_0005"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005700_SP"
FT   gene            7407..10805
FT                   /locus_tag="Dalk_0006"
FT   CDS_pept        7407..10805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0006"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="KEGG: dde:Dde_0558 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   HAMP region domain protein; histidine kinase A domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; IMG reference gene:2503005701;
FT                   PFAM: HAMP domain; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; His Kinase A (phosphoacceptor) domain;
FT                   PAS fold; TIGRFAM: PAS domain S-box; InterPro:ATPase-like,
FT                   ATP-binding domain; InterPro:HAMP linker domain;
FT                   InterPro:PAC motif; InterPro:PAS; InterPro:PAS fold;
FT                   InterPro:PAS fold-4; InterPro:PAS-associated, C-terminal;
FT                   InterPro:Signal transduction histidine kinase, core;
FT                   InterPro:Signal transduction histidine kinase, homodimeric;
FT                   InterPro:Signal transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01716"
FT                   /db_xref="GOA:B8FFM2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM2"
FT                   /protein_id="ACL01716.1"
FT                   /translation="MTIKSKIFAAGAVFFIVFVLLAFMSIWTQHEVLANRNIRDSVDKK
FT                   LADIQEFEEWKTSLIRSVSDIAAQEHVPPLAREQFLLPAGQQMPGYDILSESGLRLVDL
FT                   IASKEKASADIDEAFDDIRIEINSLYYQLDDRISTVLAILQLERVMGGDASEKGALAPY
FT                   VLKSLNQLTLVALNSLISRNFSNEHKSVVMKNQRFVSSQLELIDSDGSLLALFSELFAQ
FT                   IESLERLIGESDATLLRYQTQIAEAREAFDSAAKSTEMNAVVAKAKSDLDAANVKLENA
FT                   SRSTLTAVFVFLFLVPLLVIIFGIFGLNTIILRPISQLMHAMKRVEDGAFDVAVPIRAK
FT                   DEIGKLAWAFNAMAAEITSKVAEMSRLNQGLRESESKYKTLVNNIPQRIFLKDKNFKYV
FT                   SCNRNYAQDVNMTEAQIEGKNDFDLFPMEIAEKYRSDDERILSAGESEEIEESYIKDGE
FT                   TMVVQTVKIPIRDDAGEVSGVLGIFWDITERRKMEESLRITRFSFENAPLGIYLIGEGR
FT                   RILDVNEAAARMLGYTREELASMGTWEVDPFQAKLDDEAAWNIAKAQKEGECFESVHLR
FT                   QDGSEVPVEVSSSLFEYEGLRYAVAFIQDITQRKQAEEELRKSRRLLSNILESMDESVA
FT                   TIDQEFVYQLVNRRHEECFDQPRRDVVGRTVWDLFPGVKETPAWRYMNRAMQGEMVGGV
FT                   EIKVPKLDGTELWMRGSYSPLKDSDGKVIGVVGVGVDVTQQKKDEEELRRLRNYLSNII
FT                   DSMPSVLVGVDSKGRVTQWNKRAEQVTGIRSENARFQPLAKVFSGLSIEMERIQASIRD
FT                   RQVLHNSKAPSRSQEETRYEDITIYPLVANGVEGAVIRVDDVTEQVRLEELMIQNEKML
FT                   SVGGLAAGMAHEINNPLAGIIQTANVMRSRLEQLELPANIRAAEEAGASMDVIMAYMEK
FT                   RSIFRMLDAIDESGKRVAEIVKNMLSFARKSNETFSLHHPVHLMDKILELASTDYDLKK
FT                   QQDFKTIKIIKEYEENLPEISCEGTKIQQVLLNILRNGAHAMQSLDASGGYTPCFVLRL
FT                   AREENMLRMEIQDNGPGMDKATVSRIFEPFFTTKPVGEGTGLGLSVSYFIITQNHGGTM
FT                   DVVSSPGNGANFIIRLPLAHVNDNA"
FT   sig_peptide     7407..7472
FT                   /locus_tag="Dalk_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005701_SP"
FT   gene            complement(11229..12863)
FT                   /locus_tag="Dalk_0007"
FT   CDS_pept        complement(11229..12863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0007"
FT                   /product="Putative AMP-dependent Co-A ligase/synthetase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   hmo:HM1_0898 acetyl-coenzyme a synthetase family protein,
FT                   putative; IMG reference gene:2503005702; PFAM: AMP-binding
FT                   enzyme; InterPro:AMP-dependent synthetase/ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01717"
FT                   /db_xref="GOA:B8FFM3"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM3"
FT                   /protein_id="ACL01717.1"
FT                   /translation="MMGKTPNMTDYQKEYDEFKWEVPEYFNFAGDVIDKWAQDPEKLAM
FT                   LWVDDDGNEVRKTFAQLSAASKKLANLLTSLGVGQGDVVMVVLPRNIEWWEVFTACIRM
FT                   GALLAPGTTQLTSKDLQFRANKAEASCIITNPELAEKFDKVAEECPTVKSKIIITEPRE
FT                   DWTFYTEAVEAASDQFETAKTKSSDNCLVYFTSGTVGFPKMALHTHASYPIGHQVTGKY
FT                   WLDLKPEDMHWNVSDTGWAKAAWSSYFGPWNMGAAQFIHHTDRFDPIKTLELLAQYPIT
FT                   TMCGAPTIYRMLVLQDLGQFKFPTLRHCVGAGEPLNPEIIEVWKKATGCVIRDGYGQTE
FT                   TVLLAGSFPCIEPRFGSMGRPTPGIELKVIDEDCNELPPNTEGDIAIKVKPNRPVGLFK
FT                   EYWKEPDRTASVYRGDYYLTGDRAYVDEDGYFWFVGRADDVILTSGYRIGPFEVESALI
FT                   EHPAVAESAVVSSPDETRGEVVKAFVILAGGFTASDELAKELQEHVKNVTAPYKYPRKI
FT                   EFVDVLPKTVSGKIRRVQLRNQEWGKE"
FT   gene            complement(13114..13863)
FT                   /locus_tag="Dalk_0008"
FT   CDS_pept        complement(13114..13863)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0008"
FT                   /product="conserved hypothetical protein-like protein"
FT                   /note="KEGG: glo:Glov_1528 hypothetical protein; IMG
FT                   reference gene:2503005703"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01718"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM4"
FT                   /protein_id="ACL01718.1"
FT                   /translation="MKSRAVAILGMHRCGTSMAARVVNLLGAYLGQEEDLMGPASDNEA
FT                   GFWERWDLMEFHDKVLQSMGRTWDDPSPTPDWGALPQARSLERELAAKIKDVFSGQALW
FT                   AFKDPRACLLLPLWKNALSALNIGLQTLIIVRNPMEAIGSLARRNGYSREKCCALWDLH
FT                   YRQVLDHLGETPHVIVLLEELCKAPAVQIEKLASALEIGVDEKTIENAARSIRPDLIHN
FT                   HSKGKYRLPAQMEETYGRLRKKALSLK"
FT   sig_peptide     complement(13807..13863)
FT                   /locus_tag="Dalk_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005703_SP"
FT   gene            complement(13860..15197)
FT                   /locus_tag="Dalk_0009"
FT   CDS_pept        complement(13860..15197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0009"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: hch:HCH_02231 ABC-type polysaccharide/polyol
FT                   phosphate transport system, ATPase component; IMG reference
FT                   gene:2503005704; PFAM: ABC transporter; InterPro:ABC
FT                   transporter-like; InterPro:ATPase, AAA+ type, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01719"
FT                   /db_xref="GOA:B8FFM5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029439"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM5"
FT                   /protein_id="ACL01719.1"
FT                   /translation="MPDNASKNTAPAVSVQGISKDFRVSSSEKPGFLRRFVPAPLRPAE
FT                   KFRSLDNVSFGVSIGETLGIVGRNGSGKTTLLKIICGIMTPTQGEVRVRGRVSTLLDLG
FT                   AGFAPEFTGLENAYTNGAFMGFSREKMDEKMPAILDFADIGEFIHRPVKTYSSGMYVRL
FT                   AFAVAIHADPDVLVVDETLAVGDESFRRKCFARINQIRRNGGTVILVSHSLQNIVELCH
FT                   TALWMERGKIILKGAPSFVVGEYERFANSSFENQKIILDRIADCAEPQVPAQGDRLVEE
FT                   LAGFHQPRVYETNGACILNPRIIGRDGRPVGNLIMGRDYFYTYDVRFDQDAKNVRFGMM
FT                   VKTQSGLEAGGAVSHGAGDALEFVEKGALLRLRFAFKCQLTPNVYFINAGVQSVGDENS
FT                   VYLHRIVDAVMFRVTPLPGLLATGIMDFGAHLKDGERVSVERVQKP"
FT   gene            complement(15187..16224)
FT                   /locus_tag="Dalk_0010"
FT   CDS_pept        complement(15187..16224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0010"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   cyt:cce_4557 glycosyl transferase, group 1; IMG reference
FT                   gene:2503005705; PFAM: Glycosyl transferases group 1;
FT                   InterPro:Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01720"
FT                   /db_xref="GOA:B8FFM6"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM6"
FT                   /protein_id="ACL01720.1"
FT                   /translation="MVYIGERIQHHAGRSGYDQLARRVRSRPLSPAIHHALTSILERTP
FT                   SSAVKARLDSPPYSWYWRPEQLAQELHAMGSMALAGGVYHWLYGENDFRWAGRFPRRKG
FT                   ARIVVSMHQPPRIFERVFPDPKALGRADAVLACCRSQADYLKDFAGEDKVHVIPHGVDA
FT                   DFFTPAPKPAEEKFIVLAVGSWLRDFSLLAEVIREAGRRRSGLCFHLVLPRDRIKDFDG
FT                   APNTKIFHGVPDAHLHSLYQSANVLFMPVTDFTASNTLLEGMACGLPAVASDVGGMRDY
FT                   MDSSCGVLVPPSDPEQALTALLNLKKNQNLAPAMAESARKKALKFDWKRIAQSVMKVYK
FT                   GLYAR"
FT   gene            complement(16254..17984)
FT                   /locus_tag="Dalk_0011"
FT   CDS_pept        complement(16254..17984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0011"
FT                   /product="hypothetical protein Dalk_0011"
FT                   /note="KEGG: cyt:cce_2294 hypothetical protein; IMG
FT                   reference gene:2503005706"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01721"
FT                   /db_xref="GOA:B8FFM7"
FT                   /db_xref="UniProtKB/TrEMBL:B8FFM7"
FT                   /protein_id="ACL01721.1"
FT                   /translation="MRLRIPDKRTLVIVFALAITAWVAHFLWVRDFLLFEDDYSHVGRS
FT                   LDGEWSQIYYLLKWAWEAWPQGRPLHFSLMPVFTGLGMHMGGLPWVYFFGFLFIAGNAA
FT                   LFYVTALKVAPPGPALAGACAFCLFPADTTHAMLTHNMALQASLMFLLAAVHAYLSDKK
FT                   LLSYLLIAGTLICYETAIVPFIAAPLLKSPWNRKTIKELATTTAVVALLMTGHALLRAA
FT                   MNEHRMMELVSDNPWRLAGHVPASMVIGPLTVLKAFFLRPGYALSHANALTAFSGLVFA
FT                   TGMGWALWRLPLPLELKCLSFSALSEKYGLKMHGSLKIPQGLAPGGRLLIAGALALCLA
FT                   YVLTFTRWPPTSLGGRDTCVHLAATFGASIIITGLAWMILETAGMFRLKLAAAGAVAVY
FT                   LAFLLGFSMAVQKDFVNGSEFQRQFWREVLQLCPDLEDGTTIFVKENIRTTSDFVIPNA
FT                   WSVRLVLEQMLLFPKDWTSPPALFILNEKVIAGVTPDPGGESWTLLIPGEGRETRTVKQ
FT                   GKVIALELNANGLVRLESAEHRPGWEPLEGLHVKPEGKSSIQSLEKKALYRIMIERGLR
FT                   "
FT   sig_peptide     complement(17898..17984)
FT                   /locus_tag="Dalk_0011"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005706_SP"
FT   gene            complement(18058..19260)
FT                   /locus_tag="Dalk_0012"
FT   CDS_pept        complement(18058..19260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0012"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG: mac:MA1179
FT                   glycosyltransferase; IMG reference gene:2503005707; PFAM:
FT                   Glycosyl transferases group 1; InterPro:Glycosyl
FT                   transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01722"
FT                   /db_xref="GOA:B8FKA7"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKA7"
FT                   /protein_id="ACL01722.1"
FT                   /translation="MIRKKILISDTAPLYPPMWGGPKRIWGLFSNLTHKYDIIYVGVDT
FT                   GQYELVKGIEASEDFFEKRFSMPESYYKYWLPIYERLFKNLNFDPYTYFFIDNAKHYVD
FT                   ALESQPADAIVCSHPWSWNTLKYRTDSPVIYDAHNCEYTLMRSLAEGNLFKPILTHKTK
FT                   VLEGDLCRRAKVILACSEEDKQAFVDVYKLDPGKISIVENGTDIPPLPSLKERVAAREE
FT                   LGYARQPVVLFVGAYYKPNIQAVDFIVNRLAPKLPACQFVIVGTVTNAFSDSQAPENVS
FT                   FAGILTDDYLEHYWRAADLAVNPMSKGSGVNIKMLDYMAAGIPTVSTPFGCRGLDVENE
FT                   KHVVISELDNFATAIWDTLKNPELRGLMRKKGYDYVSTKFDWKILSKKVEHILDQLLFD
FT                   R"
FT   gene            complement(19273..20379)
FT                   /locus_tag="Dalk_0013"
FT   CDS_pept        complement(19273..20379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0013"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   swi:Swit_3862 radical SAM domain-containing protein; IMG
FT                   reference gene:2503005708; PFAM: Radical SAM superfamily;
FT                   InterPro:Elongator protein 3/MiaB/NifB; InterPro:Radical
FT                   SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01723"
FT                   /db_xref="GOA:B8FKA8"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKA8"
FT                   /protein_id="ACL01723.1"
FT                   /translation="MTGPGSEKNRVRCIRPFTSMELQPGGEVSFCCVEWAKVPYIGNVQ
FT                   NQSLMEIWNSDTAQYIRRKMLAGEWEDVCRPDVCPTLVSEGWKELTTDGAGKKLFVLTE
FT                   QHIKDIQAGRTRMSVSPTYVLMSNLEACNLKCPMCGPFRNIYAENRNNAPFDCAVEKQR
FT                   EIMEGENMAVLERISRDVVNGLPDLKVLGLCGAGDPLFRPDTRKILFSKDKRVRPEIAL
FT                   FSNGLLFNSKMWKKIKHNAFRYVNVSVDAAARDTYEKVRPPGKWDDIVANLEFLSDLRA
FT                   QGKIPQLFINFTVMRSNLEEMTDFVRLGERLKVDSVYFQKIRGIIRNRENFFDGPDKDQ
FT                   ELLDRLEIIKPQAKKAAGGETAVAFGNL"
FT   gene            complement(20376..22550)
FT                   /locus_tag="Dalk_0014"
FT   CDS_pept        complement(20376..22550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0014"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; Radical SAM
FT                   domain protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   pph:Ppha_1002 radical SAM domain protein; IMG reference
FT                   gene:2503005709; PFAM: Radical SAM superfamily; Glycosyl
FT                   transferase family 2; InterPro:Aldolase-type TIM barrel;
FT                   InterPro:Elongator protein 3/MiaB/NifB; InterPro:Glycosyl
FT                   transferase, family 2; InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01724"
FT                   /db_xref="GOA:B8FKA9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKA9"
FT                   /protein_id="ACL01724.1"
FT                   /translation="MKNNTPKISIIVVNYNGLKFLEDCFTSLTQTDWPKEALEVICVDN
FT                   GSTDGSQEYLKKNFPDVAVLDHQPNNYAAANNAGIKRASGDYVILLNNDVKMDPGWLRP
FT                   LAAAMELNPRLGGVQPKLLYFDGMIQSLGHIKSPDFYWTDRGMGEPDLGQYGDALMEAD
FT                   SLCGACAMYRRECLDQAGRLDEDFNMFVEDVDFGVRCLDHGWPLACQPQSRVHHLFHGS
FT                   IAGESRARLLIESNRLLLIAKHWPDKLAENLTGRGFFLQPDPEKQRAFIPAASKACGKL
FT                   LTEHPPEKARRILDDVFIKLAQALDPQKDALVRKAMLHQKEAARELEVQKERARLDLRD
FT                   VESRLYAEIDRLRDLVIQREEELRLLRESLSYRYVLKPVQKAADRVKGALPRTQNAPPP
FT                   SPALPRIVSMKFTNNCQLKCRMCGIWSQEKEAELPGEQWRKAIDKVFHWLGPYRLDIAG
FT                   GEPLLRPDNDELTAYASALGVETVLLSNGALITKARARKLLDSGLDSIHISLDSLNPEV
FT                   HDRMRGKAGTFAKATKALKHLQELRRYRSKDFSIGVAAIVMAPNVEELPALAEFVYRGG
FT                   ADFISFQALDQNFHDKYDPQWFASNPYWIKDLDALNRSMDKLRAMKLRGAPIDNSLAQL
FT                   QAVKRYFADPQNFCRRFQCLSGEKNFIIKNNGDVLLCWNLPPVGNILHDAPERIWQSSE
FT                   AKKRREQIAACTRTCRILSCHVTEEALQNA"
FT   gene            complement(22775..23797)
FT                   /locus_tag="Dalk_0015"
FT   CDS_pept        complement(22775..23797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mtp:Mthe_1240 hypothetical protein; IMG reference
FT                   gene:2503005710; PFAM: Domain of unknown function (DUF389);
FT                   TIGRFAM: uncharacterized hydrophobic domain; TIGR00341
FT                   family protein; InterPro:Conserved hypothetical protein
FT                   CHP00341; InterPro:Protein of unknown function DUF389"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01725"
FT                   /db_xref="GOA:B8FKB0"
FT                   /db_xref="InterPro:IPR005240"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB0"
FT                   /protein_id="ACL01725.1"
FT                   /translation="MALRLIRIVIPEQEEQAAKNLLEDQGVKRFWLENAPDGLFVANVL
FT                   VSSESTESLLDVMEKRFASYTRFQMVILPVEAAFPREIKKPGGATGNGNGEEDGKATAA
FT                   KKNRGRVHRQELYTDARDVSSLTWNYLIMVLLSSFVAAIGLLRDNVAVVIGAMVIAPLL
FT                   GPNVSLALAATLGDPDLAKRAIKTLMAGVALAFVLSIGLGLSLHVDAAGREIASRTTVD
FT                   FIDLVLALAAGVAGALSFNQGTSSALIGVMVAVALLPPLAVCGMLLGSGHTPQALGAFL
FT                   LFGANTICVNLAGVITFAAQGVRPNTFWEADLAKKYSRYAVEFWILLLCVLAFFLVQSR
FT                   "
FT   gene            24123..25523
FT                   /locus_tag="Dalk_0016"
FT   CDS_pept        24123..25523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0016"
FT                   /product="Amidophosphoribosyltransferase"
FT                   /EC_number="2.4.2.14"
FT                   /note="KEGG: sfu:Sfum_0268 amidophosphoribosyltransferase;
FT                   IMG reference gene:2503005711; PFAM: Phosphoribosyl
FT                   transferase domain; TIGRFAM:
FT                   amidophosphoribosyltransferase;
FT                   InterPro:Amidophosphoribosyl transferase;
FT                   InterPro:Glutamine amidotransferase, type II;
FT                   InterPro:Phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01726"
FT                   /db_xref="GOA:B8FKB1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005854"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB1"
FT                   /protein_id="ACL01726.1"
FT                   /translation="MGGLFGCCSKDECVSEVFYGTDYHSHLGTRRGGMAFMDGADVHRS
FT                   IHNIESDYFRSKFEPNLDKFSGNKGIGVISDNDPQPLVVNSHLGPFAIATVGRIVNMEQ
FT                   LIEQAFASRNFFTESKIGGASPTELVAMLICQEDSFEAGIRNVQASVQGSCSILLLTPQ
FT                   GLWAARDKLGRTPLVIGKKAGAYAVASESSSFPNLGFELDYFIGPGEAVFIDPEGWEQK
FT                   LPPGDKMQVCSFLWVYYGYPASSYENINVEAVRYKCGAALAKNDDVRPDYAAGIPDSGI
FT                   GHALGYANEKRIPYQRPFVKYTPTWPRSFMPQNQKVRDLVAQMKLIPVAELIEGKAPLF
FT                   CDDSVVRGTQLKGTIQGIFKAGAREVHMRLACPCLIFPCDFLNFSTSQSSMDLIGRRAV
FT                   MAMDGGLDKVHDYAVSGRGKKQALNEWIGGEIGLNSLKYQRLEDLVEAIGLPKSRLCTH
FT                   CWDGSSYF"
FT   gene            25576..28776
FT                   /locus_tag="Dalk_0017"
FT   CDS_pept        25576..28776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0017"
FT                   /product="Carbamoyl phosphate synthetase, large subunit"
FT                   /note="four CarB-CarA dimers form the carbamoyl phosphate
FT                   synthetase holoenzyme that catalyzes the production of
FT                   carbamoyl phosphate; CarB is responsible for the
FT                   amidotransferase activity; IMG reference gene:2503005712;
FT                   PFAM: Carbamoyl-phosphate synthase L chain, ATP binding
FT                   domain; MGS-like domain; Carbamoyl-phosphate synthetase
FT                   large chain, oligomerisation domain; Carbamoyl-phosphate
FT                   synthase L chain, N-terminal domain; TIGRFAM:
FT                   carbamoyl-phosphate synthase, large subunit;
FT                   InterPro:ATP-grasp fold; InterPro:ATP-grasp fold, subdomain
FT                   1; InterPro:ATP-grasp fold, subdomain 2;
FT                   InterPro:Carbamoyl-phosphate synthase, large subunit;
FT                   InterPro:Carbamoyl-phosphate synthase, large subunit,
FT                   CPS-domain; InterPro:Carbamoyl-phosphate synthase, large
FT                   subunit, N-terminal; InterPro:Carbamoyl-phosphate
FT                   synthetase, large subunit, ATP-binding;
FT                   InterPro:Carbamoyl-phosphate synthetase, large subunit,
FT                   oligomerisation; InterPro:Methylglyoxal synthase-like
FT                   domain; InterPro:Pre-ATP-grasp fold;
FT                   InterPro:PreATP-grasp-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01727"
FT                   /db_xref="GOA:B8FKB2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005480"
FT                   /db_xref="InterPro:IPR005483"
FT                   /db_xref="InterPro:IPR006275"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR033937"
FT                   /db_xref="InterPro:IPR036897"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB2"
FT                   /protein_id="ACL01727.1"
FT                   /translation="MPKRDDVNKVLIIGSGPIIIGQACEFDYSGTQACKALRQVGYEIV
FT                   LVNSNPATIMTDPGMADATYIEPLNVESLTRIIEKERPDALLPNLGGQSGLNLSSELAQ
FT                   QGVLKKYGVKIIGVQESAIKRGEDRDEFKATMNKLGIEMPKNTVVTTVEDAQKAAAELG
FT                   FPVVVRPAYTMGGTGGGMVFNREELDVIASRGLSASRVGQVLIEESVLGWEELELEVVR
FT                   DAKNQRITVCFIENVDAMGVHTGDSYCTAPMLTISQELQDRLQKYSYDIVEAIEVIGGT
FT                   NVQFAHDPETGRVVVIEINPRTSRSSALASKATGFPIAYVSSLLAAGLTLDEIPYWRDG
FT                   TLEKYTPSGDYVVVKFARWGFEKFPDALDQLGTQMRAVGEVMSIGKNYKEALLKAIRSL
FT                   ETGRYGLGFAKDFNGASLEKLMDMLAQPTSERQFIMYEALRKGASVEDLHKKTFIKAWF
FT                   IEQMKELVDLEEEILKYKGQSLPDELFLQAKKDGFADKYLAQLLGLDEAAIREKRLGLG
FT                   LAEAWEPVPVSGVEDAAYYFSTYNAPDKVDSAPGRKIMVLGGGPNRIGQGIEFDYCCVH
FT                   AAFALRDEGLSSIMVNCNPETVSTDYDTADRLYFEPLTLEDVLSIYEKEKPEGLIVQFG
FT                   GQTPLNIAGELAKAGVPILGTQPESIDLAEDRDRFASMMAELNIPMPEAGMASNLDDAL
FT                   QVAAKIGYPLMVRPSYVLGGRGMEVVHDEEMLKHYVGKAVGVTPERPILIDKFLPHAIE
FT                   AEADALSDGVDVFVPAVMEHIELAGIHSGDSACVIPPISIPAKHLETIKEYTKKIAKAL
FT                   NVVGLMNIQYAICEDRVYVLEANPRASRTVPIVSKVCNVSMARLATRLMLGQKISDLNL
FT                   TEKTVPHFGVKESVFPFNMFPEVDPVLGPEMRSTGEVLGIADSFGRAFYKAQESTGTAL
FT                   PTSGNVLLTVTDDNKSEALEAAKRLKSMGFGIWATKGTCSYFQENGLEAKLINKMHEGR
FT                   PNIADAIKNGEIQLVINTPSNRLSQYDDSYIRKTAIKFKTPYITTTAAAIAAVRGIAAH
FT                   IEDQAEVKPLQQYHQDIS"
FT   gene            complement(28844..29866)
FT                   /locus_tag="Dalk_0018"
FT   CDS_pept        complement(28844..29866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0018"
FT                   /product="hypothetical protein Dalk_0018"
FT                   /note="KEGG: pph:Ppha_0360 putative PAS/PAC sensor protein;
FT                   IMG reference gene:2503005713"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01728"
FT                   /db_xref="GOA:B8FKB3"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB3"
FT                   /protein_id="ACL01728.1"
FT                   /translation="MGNEVLILIAEAMAVYFLVLWAHSLRHRFGPVHFYAIIGGITAIM
FT                   SWVTDAGLSVQVGGVTFVIGSTVFYTSLLLGVFVVYVFDGPRATRIAISTVAGVSILVP
FT                   MIAVALHIQMALIGKPNLAYIPLPSLRINTASVITTLIDLIFLGIAWEYLGRPGLGLKL
FT                   WLRAYATLLAVMWLDVILFSTGAFAGTPHYRGILEGTLISRFIISLFALPFLYGYLYWQ
FT                   NQKKGLAIENRPVLAILKQVAEIEVELGAAQQEIERRKIAEAERDKLIAELQQALSEVK
FT                   TLRGFLPICSHCKSIRDDQGYWNRLEAYLLEHSDIELSHGVCPECAKKFYPNVKMYEDE
FT                   "
FT   gene            30115..30450
FT                   /locus_tag="Dalk_0019"
FT   CDS_pept        30115..30450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0019"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_0319 hypothetical protein; IMG
FT                   reference gene:2503005714"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01729"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB4"
FT                   /protein_id="ACL01729.1"
FT                   /translation="MKNELQEVIKSIGKEYESAISQDSTYLLEVDLASKAEKLGYGAIR
FT                   DKYRGATAFAPLKDSAPGMKVMFDGRGFSRHAQFDSGMIVPEHIAKEAGLPHKAYIPHE
FT                   SMIRIIG"
FT   gene            complement(31296..31946)
FT                   /locus_tag="Dalk_0020"
FT   CDS_pept        complement(31296..31946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0020"
FT                   /product="cobalamin B12-binding domain protein"
FT                   /note="PFAM: Methionine synthase B12-binding module cap
FT                   domain protein; cobalamin B12-binding domain protein; KEGG:
FT                   afu:AF0006 corrinoid methyltransferase protein (MtaC-1);
FT                   IMG reference gene:2503005715; PFAM: B12 binding domain;
FT                   InterPro:Cobalamin (vitamin B12)-binding;
FT                   InterPro:Methionine synthase, cobalamin (vitamin
FT                   B12)-binding module, cap"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01730"
FT                   /db_xref="GOA:B8FKB5"
FT                   /db_xref="InterPro:IPR003759"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR036594"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB5"
FT                   /protein_id="ACL01730.1"
FT                   /translation="MPNNIFSQPLPELVTALKEKEVHDQVLARLERGDDPMEILNECQR
FT                   GMEGVGLLYEKKEYFISGLIIAAEILKDVVNLTAPHIREIHSGKSAVTVLIGTAQGDIH
FT                   DLGKDLFITLLQCYGFHIIDLGVDVSPQTFLESFIEHKPQIVGISALLTSVIDAMKETI
FT                   ALIRSEVPQGASVPLFIIGGGIADQIFADMVGADFWTQDAMAGVRFCQDAVKA"
FT   gene            complement(32021..32785)
FT                   /locus_tag="Dalk_0021"
FT   CDS_pept        complement(32021..32785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0021"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; UbiC
FT                   transcription regulator-associated domain protein; KEGG:
FT                   mta:Moth_1312 GntR family transcriptional regulator; IMG
FT                   reference gene:2503005716; PFAM: Bacterial regulatory
FT                   proteins, gntR family; UTRA domain; InterPro:HTH
FT                   transcriptional regulator, GntR; InterPro:UbiC
FT                   transcription regulator-associated; InterPro:Winged
FT                   helix-turn-helix transcription repressor DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01731"
FT                   /db_xref="GOA:B8FKB6"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB6"
FT                   /protein_id="ACL01731.1"
FT                   /translation="MPRNQRKEAFDLKGSIDRNSYEPAYVQLMNLLKSQIASGQFPPGS
FT                   RLPSEAQLCKKYNISPMTVRRSINLLIDQGMVDTTQGKGTFVKPIALSSVNFSLTEFVD
FT                   ILKEDGASVRLLELNAVKASPEAAAHLAIDPGDRIIYIRRLIYLDKDPVLYHQEQLVCD
FT                   PKRPIVEDEMEVTSLKGLFTGLNQSGLKKGQVAINATQLSDQEAGWFRLPMGSPAIRLE
FT                   HLFFDFADQPVSWGWFVCHSERVLFRAAVGPW"
FT   gene            complement(33047..34072)
FT                   /locus_tag="Dalk_0022"
FT   CDS_pept        complement(33047..34072)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0022"
FT                   /product="Putative TRAP-type C4-dicarboxylate transport
FT                   system, DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: dol:Dole_3157 TRAP dicarboxylate transporter-DctP
FT                   subunit; IMG reference gene:2503005717; PFAM: Bacterial
FT                   extracellular solute-binding protein, family 7;
FT                   InterPro:Extracellular solute-binding protein, family 7,
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01732"
FT                   /db_xref="GOA:B8FKB7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB7"
FT                   /protein_id="ACL01732.1"
FT                   /translation="MLKKAVLLCVFSALIAAAFVPGANAEEQQTYWKFATLAPDGVGWA
FT                   KQIKIHVLPAVEEVTDGSIKIKIYWGGVMGDDEDIIKKLRIGQLDGVGLSGQGVTLACK
FT                   PMSVVELPFLFRSWEEVDYIKAKMRAQFDQLLADDGYMALAWNDQDFDQMYSTKSPLAN
FT                   LDDFRAAKFITWYGPVEEALLTNLGAHPVKVNVPEAATSVRQGIVDAAIAPAAFVVGSQ
FT                   LYAKIPYVNPIKVRYSPSLILLSMDVWEDLPDEYKEEFFKRRPDVEKKYCEAVRKDNEK
FT                   SLAALIKYGLKETKMTEEDFAIVRERATAIWDELAGEEYPEEVLEEVKGHLADYRKAHS
FT                   G"
FT   sig_peptide     complement(33998..34072)
FT                   /locus_tag="Dalk_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005717_SP"
FT   gene            34402..34677
FT                   /locus_tag="Dalk_0023"
FT   CDS_pept        34402..34677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0023"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: dol:Dole_3207 histone family protein DNA-binding
FT                   protein; IMG reference gene:2503005718; PFAM: Bacterial
FT                   DNA-binding protein; InterPro:Histone-like bacterial
FT                   DNA-binding protein; InterPro:IHF-like DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01733"
FT                   /db_xref="GOA:B8FKB8"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB8"
FT                   /protein_id="ACL01733.1"
FT                   /translation="MNKLELVSTLKNRAGISKTDAAKIVQIFFDSMADALAEGERVEIR
FT                   GLCSFFVKEYKSYTGRNPKTGEPVKISPKKLPFFKCGKELKERVDY"
FT   gene            34706..35698
FT                   /locus_tag="Dalk_0024"
FT   CDS_pept        34706..35698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0024"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: dol:Dole_3206 DNA polymerase III, delta prime
FT                   subunit; IMG reference gene:2503005719; PFAM: DNA
FT                   polymerase III, delta subunit, C terminal; TIGRFAM: DNA
FT                   polymerase III, delta' subunit; InterPro:DNA polymerase
FT                   III, delta subunit, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01734"
FT                   /db_xref="GOA:B8FKB9"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKB9"
FT                   /protein_id="ACL01734.1"
FT                   /translation="MDPVRHQKRALGFLSGILAKNNVAHALVFTGDAGLGKRQAAVHFA
FT                   MARNCEGTPDPESAMFGSQGPCGVCGSCRKILSGNHPDVLFVEKRGASIKIEQIRDLLS
FT                   VLAMRPSEGKTRVVLISGAGDMTASSSNALLKALEEPSDTTCFVLLAGQKSELLPTVVS
FT                   RCQEIRFSPLPVSFLIESLENDGVDPDLAHACAFIASGSLDKARALASDQGLARRNWLV
FT                   NQLCALEDQGMGQALLLAEFLAKDKNAAQEDLNWIRTWLRDLLVSRYAPQRVINRDLMG
FT                   LVNSRSAKTAPEVLLEKLQAVADCENDLTRNVNTRLSMENLCMRLSSGG"
FT   sig_peptide     34706..34783
FT                   /locus_tag="Dalk_0024"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005719_SP"
FT   gene            35699..36835
FT                   /locus_tag="Dalk_0025"
FT   CDS_pept        35699..36835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0025"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: dol:Dole_3205 PSP1
FT                   domain-containing protein; IMG reference gene:2503005720;
FT                   PFAM: PSP1 C-terminal conserved region; InterPro:PSP1,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01735"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC0"
FT                   /protein_id="ACL01735.1"
FT                   /translation="MGKVVGIRFKPQGKTYDFDPGVYVLAKGDKVVVETEQGLGFGTVA
FT                   TTARQVSEEMLKLPLKKIHRIATQEDLDQYESVLLLEKDAFDYCEKAIGELKLEMNLFS
FT                   VDASFDSSKLTFFFTADGRVDFRELVKTLVRHFRVRIELRQIGVRHQAKMCGGLGRCGR
FT                   ETCCTSFMSGFVPVSVKMAKVQNLSLNPTKISGLCGRLMCCLTFEHEIYKELKDGFPKL
FT                   GKRVNTPSGKGKVIRHNLLKGLVSVRLEEGAEIELPADHCAPPDEPAPKIAAPAPEEND
FT                   QRPSMAEEAQADQRPDRPEKKRRPRRKKKPRQTKGNQDQDQSKEDKPKQKQGNPNQKQG
FT                   KGKPRRPRNKKRNRQNPDKKNTANADQPAPKNNTGGDS"
FT   gene            36880..38811
FT                   /locus_tag="Dalk_0026"
FT   CDS_pept        36880..38811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0026"
FT                   /product="Methionyl-tRNA synthetase"
FT                   /note="methionine--tRNA ligase; MetRS; adds methionine to
FT                   tRNA(Met) with cleavage of ATP to AMP and diphosphate; some
FT                   MetRS enzymes form dimers depending on a C-terminal domain
FT                   that is also found in other proteins such as Trbp111 in
FT                   Aquifex aeolicus and the cold-shock protein CsaA from
FT                   Bacillus subtilis while others do not; four subfamilies
FT                   exist based on sequence motifs and zinc content; IMG
FT                   reference gene:2503005721; PFAM: Anticodon-binding domain;
FT                   tRNA synthetases class I (M); Putative tRNA binding domain;
FT                   TIGRFAM: methionyl-tRNA synthetase C-terminal region/beta
FT                   chain; methionyl-tRNA synthetase; InterPro:Aminoacyl-tRNA
FT                   synthetase, class 1a, anticodon-binding;
FT                   InterPro:Aminoacyl-tRNA synthetase, class I (M);
FT                   InterPro:Methionyl-tRNA synthetase, class Ia;
FT                   InterPro:Methionyl-tRNA synthetase, class Ia, beta subunit,
FT                   C-terminal; InterPro:Nucleic acid-binding, OB-fold;
FT                   InterPro:Nucleic acid-binding, OB-fold-like;
FT                   InterPro:Rossmann-like alpha/beta/alpha sandwich fold;
FT                   InterPro:tRNA-binding domain;
FT                   InterPro:Valyl/Leucyl/Isoleucyl-tRNA synthetase, class I,
FT                   anticodon-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01736"
FT                   /db_xref="GOA:B8FKC1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR004495"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="InterPro:IPR023457"
FT                   /db_xref="InterPro:IPR033911"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC1"
FT                   /protein_id="ACL01736.1"
FT                   /translation="MASPFYITTPIYYVNARPHLGHAYTTIVADTAKRYHQLRGQDAYF
FT                   LTGTDEHGDKVVEAAEKENKEVRDYVDMISGLFRNLWPELLISNDQFIRTTDADHIKVV
FT                   QEVLQKIYDNGDIYFSEYEGLYCFGCERFYLERELVDGKCPDHEVEPKKIKESNYFFRM
FT                   SKYQDWLIDHIKKNPGFIRPQRYANEVLSFLKEPLEDLCISRPKTRLTWGIDLPFDENY
FT                   VTYVWFDALLNYASALGYPEGEKFQKYWPGVQHVVAKDILKPHGIYWPTMMKAAGIPVY
FT                   NHLNVHGYWNVADSKMSKSLGNVVEPLELSKKYGIEQFRYFLMREMTFGLDSSFSEEAL
FT                   VGRINSDLANDLGNLFSRVISMAHKFCKGTVPENHPDLAFDSDWKLSDAAMEAVEAYDL
FT                   AMDEFQFHKGLAAVWEFISRMNKYVDFTSPWVLAKDKAAAAQLEAVMYNLLEGLRLVAG
FT                   MVWPVLPNAAEKMVGHLGLDKDAFLKDSAALGEWGVLKPGTQLQKAVTLFPRIDVKKME
FT                   EKAPEKKQKAPKTPELKPEIDIEDFGKVDLRVGTVIEAQAVPKANKLLQLTVDLGEPEP
FT                   RTVVAGIAKAFEPGDLVGQQVIVVANLKPAKLMGITSQGMVVAAVNKKGVIGLSTVNTP
FT                   VPPGTTLR"
FT   gene            38814..40130
FT                   /locus_tag="Dalk_0027"
FT   CDS_pept        38814..40130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0027"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: pca:Pcar_1370 FtsI-like cell division protein; IMG
FT                   reference gene:2503005722; PFAM: Penicillin binding protein
FT                   transpeptidase domain; InterPro:Beta-lactamase-type
FT                   transpeptidase fold; InterPro:Penicillin-binding protein,
FT                   transpeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01737"
FT                   /db_xref="GOA:B8FKC2"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC2"
FT                   /protein_id="ACL01737.1"
FT                   /translation="MAVEKPEIEAKGMSWREYQETLKRKREARKRSWFVFKWASMFVLA
FT                   LVLAIGIAFGVTEFYPRFVTEKKEQAPAIEMLSKAQIRDLMHGQRLWDVAEEPPQVALE
FT                   GKTYELTSTLDLEFQRHMLAELKPEYARAIAFVAMEPQTGKVLTMVGYHKDPKAGNPCT
FT                   QVLFPAASVYKMVTAAAAMDDKNFTPQTPVRYNGKKHTLYKSQLKDVDNKYTRHIDLEE
FT                   AFSDSINPVFGKIGVLLGPEALTAKSKAMGFEQDLGVECDFNPSQLGKPEDKYRTAEIA
FT                   SGFNRETLISAMHGAAMASAVLNNGVMPQPYIIASAENQENQVVYEGGLTPMGQAMSET
FT                   SSLGLQKMMVDAACHGTGRGCFSRRQRGKALREIVVGGKTGSINNDTDYDIRYDWFVGF
FT                   AHDKENKKQLAFAAIVAHEDYIGKKAGDYCKDAIEYYFD"
FT   gene            40450..40818
FT                   /locus_tag="Dalk_0028"
FT   CDS_pept        40450..40818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0028"
FT                   /product="hypothetical protein Dalk_0028"
FT                   /note="KEGG: sfu:Sfum_1901 transposase-like; IMG reference
FT                   gene:2503005723"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01738"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC3"
FT                   /protein_id="ACL01738.1"
FT                   /translation="MQTRSFEALSTPHILEKELDAIELVDRYTVENQFRASKSSSHVRV
FT                   NPIFHWTDSKIRCHLLTCLLALTCRRFLLTSPEACICLWQFGRQAGNKLTWCVICISFV
FT                   RVYNVCIANACLRGSFFT"
FT   gene            40937..42040
FT                   /locus_tag="Dalk_0029"
FT   CDS_pept        40937..42040
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0029"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: lbf:LBF_0732 transcriptional regulator;
FT                   IMG reference gene:2503005724; PFAM: Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family;
FT                   InterPro:Helix-turn-helix, AraC; InterPro:Helix-turn-helix,
FT                   AraC type, DNA binding domain; InterPro:Helix-turn-helix,
FT                   AraC type, subdomain 2; InterPro:Homeodomain-like;
FT                   InterPro:Homeodomain-related; InterPro:HTH transcriptional
FT                   regulator, AraC"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01739"
FT                   /db_xref="GOA:B8FKC4"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC4"
FT                   /protein_id="ACL01739.1"
FT                   /translation="MVWSIQAITLPIFFASGLALLLALEQVLRKKPNTANLLFSSIFVC
FT                   CAIILWGAGAVANSLPPKMPLTIYLFFTAICCVGPLYYFYFTLLLHPEKRFSPRSLIHF
FT                   IPAFGAFCAETGFQMLPLEFKTAWLNEMFVQPPRNALMVLVVIGAVHAAAYISYLLKMD
FT                   LGLVWNVKQVKNELRGMLVIDVLAILCVVALYIGFTFKILWLFHYGGLLLTVLTVSVFL
FT                   GYNRYPGFLQLLQEEFEKKRYEKSSLTHVDVSAINESLHKLIAEEKIYTDCELNLAGLA
FT                   DMLSLSPHQLSEFLNERVQTDFRSFINSFRVEEAKKLLVQEPDKNVLTICYDVGFGSKS
FT                   TFNNVFKKETGQTPTQYRESALSPQTA"
FT   gene            42983..45679
FT                   /locus_tag="Dalk_0030"
FT   CDS_pept        42983..45679
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0030"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; Radical SAM domain
FT                   protein; SMART: Elongator protein 3/MiaB/NifB; KEGG:
FT                   dol:Dole_1480 radical SAM domain-containing protein; IMG
FT                   reference gene:2503005725; PFAM: Radical SAM superfamily;
FT                   alpha/beta hydrolase fold; InterPro:Alpha/beta hydrolase
FT                   fold-1; InterPro:Elongator protein 3/MiaB/NifB;
FT                   InterPro:Epoxide hydrolase-like; InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01740"
FT                   /db_xref="GOA:B8FKC5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC5"
FT                   /protein_id="ACL01740.1"
FT                   /translation="MKRILLANSIGPYETGWGEDVNDLFSARLTRAQGPFTAKSIFPAF
FT                   ALHLLAENLNADVTIMEWPTEELFHKELKKDYDYLGIQVKSVHLSQIAGMVKIARAVAP
FT                   DTKIILGGYGVMHIFHPYPNDPLNDAQYLKDNADHFCFEEGVTFFRKIIGQNPDDPISQ
FT                   VRQPMFEVTVQGGDHLARFPLSSTLVSLGCPNACEFCNTSHFFKFKKINVCSPEEAFAS
FT                   LKAASQRMAGQPSLFNMIWDEDFLLDRNYVLRLGELLQKDGLIGKVNLFCFASIKSISQ
FT                   YTVEELVRCGVGVLWIGVESKFEADILANHNFQKRVGRDVREVFEELHNHGILIIGSNI
FT                   LGLDFHNHKNILEDIDYFVSLKPDLYQVSPLRPCPGTTLYDRLMEDGRIEEEFRHQDTM
FT                   LWSDIGLKHPNFKRGEIQKYFHLEHKRLLETNGPTILSVMDVMFKGYKTMVHSPDPFLQ
FT                   AKAERCYFFGKKLAAGFLPVIPEMIPTPAVRERASQIHEQYRRYVGDFGVKEKVAQRVI
FT                   GRLMRKRAAMKPPESYTPDYLVTRVKGPDAEPKVVKRQRPVLHVLSQASIKGLRKVLGL
FT                   REHNAFPIKLKDIDDFPVEFKTMEIEGNRMNYVDEGKGETLLMLHGNPTWSYLYRHFIK
FT                   DLKKDYRCIALDHLGYGLSDKPHYEDYSMEAHIRRLGAFIEKLGLKDITLICQDWGGII
FT                   GLSYAARNKDLFSRLIPMNTTGFLPGSPKEFIQCLGAWAFPYLWSYKVPIAGKKMAMDW
FT                   NVFLKAGMHLGIVNSKRQLHKRAMDGYLYPFQMVRDRTAIMKSVRQVPMGPLDKTWRLL
FT                   HDTGRRLAGWNVRTQVIWGMKDPVFVPWFMEKFEEMLPNHAPSVKIATAGHFLQDDEPE
FT                   IIIREIRRFLKEKQLKRKKGGGKKRAA"
FT   gene            45698..46360
FT                   /locus_tag="Dalk_0031"
FT   CDS_pept        45698..46360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0031"
FT                   /product="Mg-chelatase subunit ChlI-like protein"
FT                   /note="KEGG: dau:Daud_1209 magnesium chelatase; IMG
FT                   reference gene:2503005726; InterPro:von Willebrand factor,
FT                   type A"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01741"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC6"
FT                   /protein_id="ACL01741.1"
FT                   /translation="MTYTYPFTAFIGQDLMRLGLLLNAVNSKIGGMLIRGEKGTGKSTV
FT                   VRALAAILPEIDVVEACPFQCNFHAADLMCPYCRKAEVLLPPTKSINLAERKLRTMPTG
FT                   GTTPLCAGMALGLKIAKKALQRKRVPWPRIVLITDGRANIGLEKIKDGTPLPLHEEVLS
FT                   MAKSIGKENHIRSLVLDTEEKQPAALGMAREIARRMNARRVPIHGLQPKSIVEALLE"
FT   gene            46489..46743
FT                   /locus_tag="Dalk_0032"
FT   CDS_pept        46489..46743
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0032"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: protein of unknown function UPF0150; KEGG:
FT                   npu:Npun_R4601 hypothetical protein; IMG reference
FT                   gene:2503005727; PFAM: Uncharacterised protein family
FT                   (UPF0150); InterPro:Uncharacterised protein family UPF0150"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01742"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC7"
FT                   /protein_id="ACL01742.1"
FT                   /translation="MEHYTARYVKTNSGYMGQLMEWPEVVTEGKDIEECRDMLRDALHQ
FT                   MILAYKELSKEMPKGNALFEQLAIEVDNVCETAGSRQAS"
FT   gene            46706..46894
FT                   /locus_tag="Dalk_0033"
FT   CDS_pept        46706..46894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0033"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: npu:Npun_R4600 YcfA
FT                   family protein; IMG reference gene:2503005728; PFAM:
FT                   YcfA-like protein; InterPro:Ribonucleotide reductase,
FT                   stirrup; InterPro:Uncharacterised protein family UPF0395"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01743"
FT                   /db_xref="GOA:B8FKC8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC8"
FT                   /protein_id="ACL01743.1"
FT                   /translation="MSVKRRDLVKHLEANGFYLLREGANHSIYTNGEQVVPVKRHRFVD
FT                   RITANEICKQAKIQPKF"
FT   gene            complement(47036..51172)
FT                   /locus_tag="Dalk_0034"
FT   CDS_pept        complement(47036..51172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0034"
FT                   /product="hypothetical protein Dalk_0034"
FT                   /note="KEGG: Os01g0180300; hypothetical protein; IMG
FT                   reference gene:2503005729"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01744"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKC9"
FT                   /protein_id="ACL01744.1"
FT                   /translation="MMRGDLMQNISKKIIGLSLFAALAASLYSCAVMRIDVDAYKGPLA
FT                   NHEQVQIEQMAVMAIGAKPLLISLRDKLEWGDVQDASSAFDDKGASKWERDWYKPDFVP
FT                   FPGRAGVAEKKWFQDDRAIRVNGVLGLYKDQGPEGLFSVIGDVQRFRLDFQSSDQVIKR
FT                   NKGKLGEFWKEKQKAFYGENLEEHPVVKYLNDNKPEASAGVSSDKDVTAFKNAYRILKT
FT                   DYMQIQNEVDASQENEGNGYNQSKPVKRIAHAHNVLLSIANKYKDCSELNKFQTASKMN
FT                   EIVSSRAFFELQKGDGALIGLHFDILLKDKDNKKEIVNYIKEFSFNFVEFRAAAGKLLD
FT                   AMLRSLTQVDRLQQSGEHLPPLLPLSLSKAVGTLLSVESLTKNKDRYMQKAKDNMQRED
FT                   IKSIFDSAIARRNELVNNDDLKAAGALIGLHRRYMKNFEQEFGGGVPEGMPKFGIAPFV
FT                   HDSSDFNPLANMLESVTETCSGSGFDRGRKREGLDSLLETYLEKVEAFDCANLTDSKNW
FT                   QKAACEKNKAENDLVGALVRFAQKVLFVANNDSLLSGGKEKYIPENFKSDPALINAKEI
FT                   TEETLKSYILVLQAVGNSLLVQADDFEKRKDHENRLKKRAPLEAAAYQRAYYKSAQGHL
FT                   SDLISSLEAKQEGYASQLEKRRILEEKIAGNETKETEAKASKKKAEQQLDQVTDIQERF
FT                   KELPTLLDADGKIRSSVDVLLKTYNKLPDSEKSGSKLSIDNTKSMRDAANSLKEAFSAM
FT                   EDKLSSYSVNPAYQKQAENAIAGCNGEFNSSDAGDNAVFKCQSLNIIAQTAGHLVEGGK
FT                   NSSGSYWNELDKAKSAAESISGLAVNGVISGTENLGKLSAAVSSVENWSNSGSVTTAYE
FT                   NIASVKSLFDNLKEAGDKLKKSIADTENELKTLAGELKECKSELTKAPAQATLDANNRE
FT                   LTTAIGVLNHDSVKAWPPSMDSPYFSRQEFAGALNQKLASLKGGASTPDISDTDVTTTQ
FT                   SVIRKSGFATGSAYVVPSDAKDPKDVLDSLIAGMQYEYLNEVKENGAESDNALHAAQAI
FT                   KAAYAYRSGMAYLRPSIAYLRSSSPATTLQGDTFPSGANENLLVGGFWRSTPIIANILK
FT                   YRDNLKRQVPEEIDKQFWHNINKVKVSGSGSTNYVIAKDDIGNWYVKNYSSDATAITNS
FT                   AFNLAKFGFGPSMGLQLPVGGDSEGAENQQGSAQPTVGSKLFDKYTKEYQDQTKAQYKK
FT                   ALALLTEDKGLHATVKNAWTTAGFDDKDQKQLEDMLDGAAKELEAAHTGVKDKKDLSEQ
FT                   AAGVVTALRAGLRFKRSLDIGIDGLAFESAKANAKDAKDAKEIETQSKPLREKARKAAD
FT                   EAIMPILKSLSSQRAQTIDDYEQAIKFIGEAVSKN"
FT   sig_peptide     complement(51080..51172)
FT                   /locus_tag="Dalk_0034"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005729_SP"
FT   gene            complement(51169..51825)
FT                   /locus_tag="Dalk_0035"
FT   CDS_pept        complement(51169..51825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0035"
FT                   /product="hypothetical protein Dalk_0035"
FT                   /note="IMG reference gene:2503005730"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01745"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKD0"
FT                   /protein_id="ACL01745.1"
FT                   /translation="MLDFGFLKRICLLVVLTGGLAFGGGCATPEQTALLGFGGGVLYGA
FT                   QAPSSEIQQTYYLGVFDPQDQVPPEVYRVRVRGQASFLSNMKFASGWVRAELIDSLGAD
FT                   ISRNWDTGQMTLTKEQELMASLQTGKRHVLFGPEGCREAPKDHRLVLVMGASPDKFFES
FT                   LDKALGEVSQAQKNAADEGLNRKLFEALAETSGQSRQLIEYAKDLEAEAKSDNKS"
FT   sig_peptide     complement(51745..51825)
FT                   /locus_tag="Dalk_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005730_SP"
FT   gene            52249..53403
FT                   /locus_tag="Dalk_0036"
FT   CDS_pept        52249..53403
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0036"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; aminotransferase class I and II;
FT                   KEGG: plt:Plut_1353 aspartate aminotransferase; IMG
FT                   reference gene:2503005731; PFAM: Aminotransferase class I
FT                   and II; InterPro:1-aminocyclopropane-1-carboxylate
FT                   synthase; InterPro:Aminotransferase, class I/classII;
FT                   InterPro:Aminotransferases, class-I,
FT                   pyridoxal-phosphate-binding site; InterPro:Pyridoxal
FT                   phosphate-dependent transferase, major domain;
FT                   InterPro:Pyridoxal phosphate-dependent transferase, major
FT                   region, subdomain 1; InterPro:Pyridoxal phosphate-dependent
FT                   transferase, major region, subdomain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01746"
FT                   /db_xref="GOA:B8FKD1"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKD1"
FT                   /protein_id="ACL01746.1"
FT                   /translation="MRISARGQNIRQSDIRTMTTACREAGGINLAQGVCDIKVPDEVIA
FT                   AAKKAMDEGYNVYTPNHGLPELRQAIADKTAAFYGYRPDPETEIVASLGATGVFYCAAM
FT                   ALLNPGDEVILFEPYYGYHASTLEAVGAIPVFVPTKPGTWEIEPDALAKAVTPRTKGIV
FT                   LCTPGNPSGHVMTAGEIDLIAEAAQKHDLVIFSDEIYEHFLYDGRTHLCPGLHPGLEGR
FT                   TVTMSGASKTYAITGWRLGYCICPADVTEAVTHLNDLVYVCAPAPLQMGVAAGMNMLGR
FT                   DYYEGLARDHQKKRDLFCDTIEKAGMKPYRPEGAYYVLADVSGVPGHDSFTRAMHILEK
FT                   TGVSSVPGRAFFHDDSGDALVRFCFAKEFPVLEEACDRIASWKG"
FT   gene            complement(53423..54643)
FT                   /locus_tag="Dalk_0037"
FT   CDS_pept        complement(53423..54643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0037"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: cyt:cce_1138 two-component hybrid sensor and
FT                   regulator; IMG reference gene:2503005732; PFAM: Bacterial
FT                   extracellular solute-binding proteins, family 3;
FT                   InterPro:Extracellular solute-binding protein, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01747"
FT                   /db_xref="GOA:B8FKD2"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKD2"
FT                   /protein_id="ACL01747.1"
FT                   /translation="MLKSNCFVIVAVLIYTFLSAGFSHSSSAQAFQPSQPLTVKAAVLK
FT                   NFPPHYTTDANGKPSGFAVDVLERVTQIANIQVEYIVKEDWQDVFEALKSGEADLIPDQ
FT                   GITERRKQWFDYSLSTEACPIGIFVLSETEGVESLDDLIGKKTAVVALNVGEAIIAKRS
FT                   AIKPIVFDNVEAALLSLLSGNVDALIFPEPVIMMFAREARVDRRIKRAGSPLRTVKRGI
FT                   AVRKGNITLLNRLNPAIEQFLQSKEYSRIYTKWHGEPTPFWNTFRVILAMLGFLSLTAV
FT                   IMGYWRYRSMAVLNIELKKQIRLREAAEQDLKASYDTLEQKVEERTRKLKAALSEVKAL
FT                   SGLLPICSHCKKIRDDQGYWKQIESYIQEHSEAEFSHSICRDCAAKHYPELKIYEIMDA
FT                   EDNESSD"
FT   sig_peptide     complement(54554..54643)
FT                   /locus_tag="Dalk_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005732_SP"
FT   gene            complement(54650..54814)
FT                   /locus_tag="Dalk_0038"
FT   CDS_pept        complement(54650..54814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0038"
FT                   /product="hypothetical protein Dalk_0038"
FT                   /note="IMG reference gene:2503005733"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01748"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKD3"
FT                   /protein_id="ACL01748.1"
FT                   /translation="MELDIKSSDIYLKRVMNLGGCIYLKYTSKTRMHCFLNEKNTHILT
FT                   EAKPLSPEE"
FT   gene            55023..55415
FT                   /locus_tag="Dalk_0039"
FT   CDS_pept        55023..55415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0039"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   gsu:GSU0402 hemerythrin family protein; IMG reference
FT                   gene:2503005734; PFAM: Hemerythrin HHE cation binding
FT                   domain; TIGRFAM: hemerythrin-like metal-binding domain;
FT                   InterPro:Haemerythrin, iron-binding site;
FT                   InterPro:Haemerythrin-like, metal-binding;
FT                   InterPro:Haemerythrin/HHE cation-binding motif"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01749"
FT                   /db_xref="GOA:B8FKD4"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR016131"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKD4"
FT                   /protein_id="ACL01749.1"
FT                   /translation="MAFFNWEEKYSVGVPRFDNEHKKLIDLTNRFYEAMKVGKARDAMQ
FT                   ATCNELVAYTKTHFNNEEMALKQSTYPNLASHQEEHRFFTKQVMELKAKLDAGEPVMAS
FT                   TLGNFLKNWLVNHIMGIDKTYQKYLR"
FT   gene            complement(55491..57386)
FT                   /locus_tag="Dalk_0040"
FT   CDS_pept        complement(55491..57386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0040"
FT                   /product="DNA ligase (NAD(+))"
FT                   /EC_number="6.5.1.2"
FT                   /note="KEGG: dps:DP1006 NAD-dependent DNA ligase; PFAM:
FT                   BRCT domain protein; NAD-dependent DNA ligase OB-fold;
FT                   NAD-dependent DNA ligase adenylation; SMART: NAD-dependent
FT                   DNA ligase; IMG reference gene:2503005735; PFAM:
FT                   NAD-dependent DNA ligase OB-fold domain; NAD-dependent DNA
FT                   ligase adenylation domain; BRCA1 C Terminus (BRCT) domain;
FT                   InterPro:BRCT; InterPro:NAD-dependent DNA ligase;
FT                   InterPro:NAD-dependent DNA ligase, adenylation;
FT                   InterPro:NAD-dependent DNA ligase, N-terminal;
FT                   InterPro:NAD-dependent DNA ligase, OB-fold;
FT                   InterPro:Nucleic acid-binding, OB-fold; InterPro:Nucleic
FT                   acid-binding, OB-fold-like; InterPro:RuvA domain 2-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01750"
FT                   /db_xref="GOA:B8FKD5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FKD5"
FT                   /protein_id="ACL01750.1"
FT                   /translation="MQDLPSSIADISDPELLGQWLEKYNEAYRAGKPMISDAHYDLLVE
FT                   RLREIAPDHGFLSAVEAETFADKREVRHPAPMLSTEKAYDKQSLERFVERVYKEAAQIG
FT                   VTDVLFQVTPKLDGLAARDDGQILATRGNGYAGYDITNALEKGVIPQGGRGLGLGEIVA
FT                   VQSYFQENLADRFEHPRNMVVGIISSDVLNISAKQALEDKQVHFVPYATLNKWEGSGKE
FT                   LLENSEKITQDLIQATDYPMDGMVASVMNQDVRDHMGATSHHYRWQIAIKAKGETGVTT
FT                   VNAITWQVGRTGNVTPVLEVEPLKLSGATIRRVTAHNAGRIREKGAGVGASIEVIRSGE
FT                   VIPKLENVLTPSDDTLIPENCPVCETPLEWNNDFLKCPNLNCKARVEQRIRHWFRILGN
FT                   ADWFGIKTVERLVAGGFDSLEKIYAMTEEDFLSLEFGPVQSKNLAEAINLSKSRPVEDW
FT                   RFLAAFGISDLGEGDSRKILSFFPLEELLDKTRDDIVALHGFGDVTSISIEKGLKALGP
FT                   TIRHMLDLGFNLQPTPLKSEMDVSSPISGKGVVFTGSMETGSRKDMEENARSLGANVQK
FT                   AVTGKTDYLICGAKVGAKKTQKAQDLGVTVLTEQEYLQLVEGGESQSSPEQMSLF"
FT   gene            complement(57362..58114)
FT                   /locus_tag="Dalk_0041"
FT   CDS_pept        complement(57362..58114)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0041"
FT                   /product="purine or other phosphorylase family 1"
FT                   /note="PFAM: purine or other phosphorylase family 1; KEGG:
FT                   dol:Dole_1714 purine phosphorylase family 1; IMG reference
FT                   gene:2503005736; PFAM: Phosphorylase superfamily;
FT                   InterPro:Nucleoside phosphorylase; InterPro:Nucleoside
FT                   phosphorylase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01751"
FT                   /db_xref="GOA:B8FKD6"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKD6"
FT                   /protein_id="ACL01751.1"
FT                   /translation="MTIMDEKTSRDALINPRAIKGVPNLDSIALMCAVRPDVDDLVKCL
FT                   GLKRSHQLPMNKIYFNKDGKGGSVAGPMMGAPYAAYVLEQLIASGAKKILFVGWCGAVS
FT                   PDLEIGDVIVPSSAFVDEGTSVHYSHREIGTIVRSFPNEDLVDWLSDALEREEIEHARK
FT                   AVWTTDGIYRETPEQIEYFSWQGAAAVEMELSALQSVANFREVALCGVLIVSDELHSGK
FT                   WKPGFSDPKFQETRKKVIEALCRICRAA"
FT   gene            complement(58114..58365)
FT                   /locus_tag="Dalk_0042"
FT   CDS_pept        complement(58114..58365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0042"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1713 hypothetical protein; IMG
FT                   reference gene:2503005737"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01752"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKD7"
FT                   /protein_id="ACL01752.1"
FT                   /translation="MPYDAELDKVLKSWESEETGLVISINQYAESEPKLQIGPRMFTRK
FT                   DGTKRQGKAGRLTIEDVLWLYDMIDEIKDEMVELAPPE"
FT   gene            complement(58729..60801)
FT                   /locus_tag="Dalk_0043"
FT   CDS_pept        complement(58729..60801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0043"
FT                   /product="Glycyl-tRNA synthetase, beta subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="KEGG: dol:Dole_1712 glycyl-tRNA synthetase, beta
FT                   subunit; TIGRFAM: glycyl-tRNA synthetase, beta subunit; IMG
FT                   reference gene:2503005738; PFAM: Glycyl-tRNA synthetase
FT                   beta subunit; DALR anticodon binding domain; TIGRFAM:
FT                   glycyl-tRNA synthetase, tetrameric type, beta subunit;
FT                   InterPro:DALR anticodon binding; InterPro:Glycyl-tRNA
FT                   synthetase, class II, heterodimeric; InterPro:Glycyl-tRNA
FT                   synthetase, class IIc, beta subunit; InterPro:Glycyl-tRNA
FT                   synthetase, class IIc, beta subunit, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01753"
FT                   /db_xref="GOA:B8FKD8"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR015944"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FKD8"
FT                   /protein_id="ACL01753.1"
FT                   /translation="MQPLLLEIGSEEIPAGYIVPALEALAQALDAKLESARIAHSKPKV
FT                   YGTPRRLAVILDEVAEKQESVTTEMVGPPKSVAFDGEGKPKVPAVKFAEKAGVAVEELT
FT                   FQETEKGVYLCAKIQDEGKETLGILQEMLPEIISHIPFPKSMRWAALPGTFARPVFSIL
FT                   ALLGDQVIPFEWNGVTTGRQTRGHYFMAPEAIDIQTPSEYVNALEKAKVIADIPTRRKM
FT                   VKEGVDAIAKELGGDAIEDEELVDIVANLVEFPAPVGGKFETGFLEVPDKVLITAMREH
FT                   QKYFAIQDKDGKLMPCFVAVNNTQCKDPQLVATGHERVLRARLSDAKFFWDVDKKQSME
FT                   DWVKRLDRVLFQKKLGSVGEKVARVEEMAKFLAAAPEINGDPDKAQKAAHFCKADLVSG
FT                   LVIEFTKLQGVMGKAYASLAGMDAETASALEEHYLPAYSGGPLPRTKTGDAVAMADKMD
FT                   SLCGCFAVGLIPSGNRDPYALRRQGIGVIRILQEKGYSLSLSAIVDKGLTLVKDKADQN
FT                   LAETRDKIISFLADRMAHMLAEQGFSKDVIQAAVAISCDDIPYLWKRVAAVEKLKTLPD
FT                   YEALAQTFKRVANIIKQAAEKGTLSDQEVNPALFEKDCEKDLLEAFTAMEAKVSGLGVD
FT                   EALLEVAKLRPAVDAFFDDVMVMAEDMKVRENRLALLAGIAGLFGRFADFSRISA"
FT   gene            complement(60837..61703)
FT                   /locus_tag="Dalk_0044"
FT   CDS_pept        complement(60837..61703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0044"
FT                   /product="Glycyl-tRNAsynthetase, alpha subunit"
FT                   /EC_number="6.1.1.14"
FT                   /note="glycine--tRNA ligase alpha chain; GlyRS; class II
FT                   aminoacyl tRNA synthetase; tetramer of alpha(2)beta(2);
FT                   catalyzes a two-step reaction; first charging a glycine
FT                   molecule by linking its carboxyl group to the
FT                   alpha-phosphate of ATP; second by transfer of the
FT                   aminoacyl-adenylate to its tRNA; IMG reference
FT                   gene:2503005739; PFAM: Glycyl-tRNA synthetase alpha
FT                   subunit; TIGRFAM: glycyl-tRNA synthetase, tetrameric type,
FT                   alpha subunit; InterPro:Glycyl-tRNA synthetase, class II,
FT                   heterodimeric; InterPro:Glycyl-tRNA synthetase, class IIc,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01754"
FT                   /db_xref="GOA:B8FKD9"
FT                   /db_xref="InterPro:IPR002310"
FT                   /db_xref="InterPro:IPR006194"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FKD9"
FT                   /protein_id="ACL01754.1"
FT                   /translation="MTFQDIILTLQKYWAEKGCVLVQPYDMEVGAGTFHPETLLRSLGP
FT                   EPWKTAYVQPSRRPTDGRYGENPNRLQHYYQFQVIIKPSPDDVQGLYLDSLKAIGIDPL
FT                   AHDIRFVEDDWESPTLGAAGLGWEVWLDGMEITQFTYFQLAGSIELSPVTVELTYGLER
FT                   IAMYLQEIDNVYELDWNGVVKYGDLHHMNEVEQSTYNFEVANVDMLLGFFDSYEAEAKA
FT                   CLEKELVLPAYEYCLKCSHTFNLLDARGAISVTERTGYIARIRNMARGCAEKYLEQRES
FT                   MGFPLAK"
FT   gene            complement(61721..62782)
FT                   /locus_tag="Dalk_0045"
FT   CDS_pept        complement(61721..62782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0045"
FT                   /product="GHMP kinase"
FT                   /note="PFAM: GHMP kinase; GHMP kinase domain protein; KEGG:
FT                   dol:Dole_1710 GHMP kinase; IMG reference gene:2503005740;
FT                   PFAM: GHMP kinases C terminal; GHMP kinases N terminal
FT                   domain; InterPro:GHMP kinase; InterPro:GHMP kinase,
FT                   C-terminal; InterPro:Mevalonate/galactokinase;
FT                   InterPro:Ribosomal protein S5 domain 2-type fold;
FT                   InterPro:Ribosomal protein S5 domain 2-type fold, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01755"
FT                   /db_xref="GOA:B8FKE0"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE0"
FT                   /protein_id="ACL01755.1"
FT                   /translation="MSNRLKELLQDCSVEASAPCRIDMGGTLDIPVFYYALHHLSPCTF
FT                   NAALALRTKVTLCANDSDAVKVSSRGFESAEFELDSAPFDHPLGIIFAIAVYYRAHGIH
FT                   ITVESDSPPKSALGGSSAAALAVIAAFDRAYQELGERALPVRRSVALAHDIESAVLGIP
FT                   CGLQDQLAAAYGGVNAWYWTVSPDGPRFEKQSLMGKKEAREFEKRILVAYCGIPHVSAD
FT                   VNTTWMKQFVSGSTRDKWVQIAGLTADFVDAVDKKDFPKAIEAMNKEVDLRLEMTPDVL
FT                   NPIMHRLVQAAKENAAGARFTGAGAGGCVWALGEEDKMEAIKDLWSKILADEEGAHLLD
FT                   AGVDPDGVLVSQR"
FT   gene            complement(62799..63575)
FT                   /locus_tag="Dalk_0046"
FT   CDS_pept        complement(62799..63575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0046"
FT                   /product="DNA repair protein RecO"
FT                   /note="TIGRFAM: DNA repair protein RecO; PFAM:
FT                   Recombination protein O RecO; KEGG: dol:Dole_1709 DNA
FT                   repair protein RecO; IMG reference gene:2503005741; PFAM:
FT                   Recombination protein O C terminal; Recombination protein O
FT                   N terminal; TIGRFAM: DNA repair protein RecO; InterPro:Arf
FT                   GTPase activating protein; InterPro:DNA
FT                   replication/recombination mediator RecO, N-terminal;
FT                   InterPro:Nucleic acid-binding, OB-fold-like;
FT                   InterPro:Recombination protein O, RecO"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01756"
FT                   /db_xref="GOA:B8FKE1"
FT                   /db_xref="InterPro:IPR003717"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022572"
FT                   /db_xref="InterPro:IPR037278"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FKE1"
FT                   /protein_id="ACL01756.1"
FT                   /translation="MPPVTTSAVILRSIEYGDFDLIVTFFTQAQGKRAALAKNARKSFK
FT                   RFGGALELFSKVSIVYAHGKKKGGLPLLSESNLEQHFSNIRMDIHKTALASLWAETIYS
FT                   WAEEEHAQEEIFQLLIRSLENLDNEKVDRDKVNILFLLRFLALAGLSPSLDQCVLCCRS
FT                   LEDWGQGGICFDHARGGIVCPKCGVCLAPGPVLSVGAVKQLLWLNKGDLAAAGRMKLSR
FT                   EAMDRGRDLLESFLAYHLGKEPKSLRFLKDLRRRHF"
FT   gene            complement(63582..64934)
FT                   /locus_tag="Dalk_0047"
FT   CDS_pept        complement(63582..64934)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0047"
FT                   /product="magnesium transporter"
FT                   /note="TIGRFAM: magnesium transporter; PFAM: CBS domain
FT                   containing protein; MgtE integral membrane region; MgtE
FT                   intracellular region; KEGG: pca:Pcar_0596 magnesium
FT                   transporter; IMG reference gene:2503005742; PFAM: MgtE
FT                   intracellular N domain; CBS domain; Divalent cation
FT                   transporter; TIGRFAM: Mg2+ transporter (mgtE);
FT                   InterPro:Aldolase-type TIM barrel; InterPro:Cystathionine
FT                   beta-synthase, core; InterPro:Divalent cation transporter;
FT                   InterPro:Magnesium transporter, MgtE intracellular domain;
FT                   InterPro:MgtE magnesium transporter, integral membrane"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01757"
FT                   /db_xref="GOA:B8FKE2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR006667"
FT                   /db_xref="InterPro:IPR006668"
FT                   /db_xref="InterPro:IPR006669"
FT                   /db_xref="InterPro:IPR036739"
FT                   /db_xref="InterPro:IPR038048"
FT                   /db_xref="InterPro:IPR038076"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE2"
FT                   /protein_id="ACL01757.1"
FT                   /translation="MLGDRTKTTIEPIRRLLRRGAFAQVRKIVNKTHAADLSVAFRTIS
FT                   PYDQKKLFSMIQDLEQKGLVFSELDEDIFLRIVEDLRVDEIVDILDTMASDDVADLMER
FT                   FPADLAKEILRKMEKEGSEEVEGLLRYDTDTAGGIMVPDFVTVREETTAEKAIASLQKE
FT                   YIDVEMPFYLYVTDDYDRLVGVSSLRQLVVVPPETPVRDFMTRDVYRVSTDMDQEEVAK
FT                   IVARYDILAVPVVDEENKLVGIITVDDVIDIIRREATEDMFKMAGVGEEFVETQSIVKS
FT                   TRIRLPWLFASCLGGVLAYFIIGRFEASLKQMAYLAAFIPVIMGMGGNIGTQSSTIVVR
FT                   GIATGRINIRDLWRVVGKELSVGLILGVFYGLVVGAVARITHDQWSLSFAVTLAVMSSM
FT                   SIAALVGSMFPLIFARLHIDPAVATGPFVTTSIDILSVFFYFQIATVLLNL"
FT   sig_peptide     complement(64866..64934)
FT                   /locus_tag="Dalk_0047"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005742_SP"
FT   gene            complement(64997..65989)
FT                   /locus_tag="Dalk_0048"
FT   CDS_pept        complement(64997..65989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0048"
FT                   /product="SurA domain protein"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   SurA domain; KEGG: dol:Dole_1707 PpiC-type peptidyl-prolyl
FT                   cis-trans isomerase; IMG reference gene:2503005743; PFAM:
FT                   SurA N-terminal domain; PPIC-type PPIASE domain;
FT                   InterPro:Peptidyl-prolyl cis-trans isomerase, PpiC-type;
FT                   InterPro:SurA N-terminal; InterPro:Trigger factor,
FT                   C-terminal, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01758"
FT                   /db_xref="GOA:B8FKE3"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR015391"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE3"
FT                   /protein_id="ACL01758.1"
FT                   /translation="MMSCMKKNCLTALFSTLLTLMTVVPSFAETELVDRIVAIVNTDVI
FT                   MLSELNEKMAPILAKIDAAGLPDEQREKTIYKYREDILNTMVSSLLVEQESEKLGVKVM
FT                   EGEVDSYLERFKQSSHLTDEALRAQLEADGISMDLFRNQIHDTILFQKLKTTEVDSKIV
FT                   ITDKEVQDYYNEHIDQYEGKKSYHLRYILLPYPENATEEQKAAVEKTMGEIIAMFKAGE
FT                   SFPALIENVSNEKIGGSGGDLGFFKAGDLTKDLSEKVKIMKPGDITEPMTVDLGLQIFW
FT                   LEETEMGEGASLEDVRQEIQDLLYNEEVKHKYEKWVSELEDNSYVKIIR"
FT   sig_peptide     complement(65906..65989)
FT                   /locus_tag="Dalk_0048"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005743_SP"
FT   gene            complement(66020..66862)
FT                   /locus_tag="Dalk_0049"
FT   CDS_pept        complement(66020..66862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0049"
FT                   /product="hypothetical protein Dalk_0049"
FT                   /note="KEGG: dol:Dole_1706 SurA domain-containing protein;
FT                   IMG reference gene:2503005744; InterPro:Trigger factor,
FT                   C-terminal, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01759"
FT                   /db_xref="GOA:B8FKE4"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE4"
FT                   /protein_id="ACL01759.1"
FT                   /translation="MAKNRVKNSRVASVILTGALAVLLVGVFLFSGCGEREQVRDDALA
FT                   RVGETVLKLPEFNELFELAEAGFSGYGLGYTANRKETRRQFLNQLVEEMFVLEYARVNG
FT                   LVLTPEALQKAEQEIWRDYTFVNPDDPILGKIKAGEEQEQAEPQELSEPPEAFTSVLRD
FT                   QALTFQLWEKGLARRLLLEQAISRELDGRVQVSEEEIEAYLAENPVIPQMRPEEDTAYE
FT                   KGEAPEGEDAAEPKGPSLEEQKRIARKVLEAQKAQDEYAEWLLELKERFPVSVRPDLL"
FT   sig_peptide     complement(66761..66862)
FT                   /locus_tag="Dalk_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005744_SP"
FT   gene            complement(66932..70471)
FT                   /locus_tag="Dalk_0050"
FT   CDS_pept        complement(66932..70471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0050"
FT                   /product="transcription-repair coupling factor"
FT                   /note="KEGG: dol:Dole_1705 transcription-repair coupling
FT                   factor; TIGRFAM: transcription-repair coupling factor;
FT                   PFAM: helicase domain protein; transcription factor CarD;
FT                   TRCF domain protein; type III restriction protein res
FT                   subunit; DEAD/DEAH box helicase domain protein; SMART:
FT                   DEAD-like helicases; IMG reference gene:2503005745; PFAM:
FT                   Helicase conserved C-terminal domain; TRCF domain;
FT                   CarD-like/TRCF domain; DEAD/DEAH box helicase; TIGRFAM:
FT                   transcription-repair coupling factor (mfd);
FT                   InterPro:DEAD-like helicase, N-terminal; InterPro:DNA/RNA
FT                   helicase, DEAD/DEAH box type, N-terminal;
FT                   InterPro:Helicase, C-terminal; InterPro:Helicase,
FT                   superfamily 1/2, ATP-binding domain; InterPro:Transcription
FT                   factor CarD; InterPro:Transcription-repair coupling factor;
FT                   InterPro:Transcription-repair-coupling factor domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01760"
FT                   /db_xref="GOA:B8FKE5"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR004576"
FT                   /db_xref="InterPro:IPR005118"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR037235"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE5"
FT                   /protein_id="ACL01760.1"
FT                   /translation="MSSPNPNAVKAAAQYLALTRESQGPVECLGLERSSQAYFIAQLFR
FT                   EKKRTVLVLAPTKKEAKTLCADLDFFLQDLKQPESALPGQGWILEFPAYHILPFKGISY
FT                   HTETAANRISALSRMANSPDPAIVVTTPQAMASRLIPKSALNSFGELIMAGEELDRDAF
FT                   VEKLVSGGYVKNLIVEEPGDFCVRGSIVDVYGPPYSQPLRIEFFGDEVDSIRFFSPSTQ
FT                   RTIKKMEEAVILPATEAVVSKDRLQSVIHRVREKAVLADMPVTKIREVVDSLKATQQFP
FT                   GIEGFVPLLYENGGDSLFDYLPADTLCTVLDPVAASQEYEKYLEDVEENFETAQAENRL
FT                   SIPPAMTHLPAEDFRKRLNRARPLTFPTLAVTGPQEEEAGKARMQLHVETNTELVQNLK
FT                   ASKERDQLLKPLADWVNDKRDQGYSIVMACGSKMQAERLESLLTPYGVGLSRNQNWMTR
FT                   PSARCQVVLGSLSSGFVWPAESLAVVTETEIFGPKHRRRKIETQRPRTELLDLAQLSQG
FT                   DFVVHVDHGIAQYGGLVKMDLGGVANDFLLLEYRDGDKLYLPVDKSNLIQKYRTMGETA
FT                   PALEKLGGKAWEKVKSRVKKSVEKIAGELLKLYAVRKVKQGYAFSPTDSYFAEFEANFE
FT                   YEETPDQAKAINDVLADMENRRPMDRLICGDVGYGKTEVALRASFKAVSDSKQTAFVTP
FT                   TTILSEQHYRTFLKRYEGYPVKIACLNRFRKAAEKKEILKGLENGDIDIVIGTHSVLQK
FT                   SVQFKDLRLVIIDEEQRFGVKHKETLKKIRATVDVLALTATPIPRTLHMSMVGIRDITV
FT                   INTPPEQRRPITTYVSKFDEVIAAEAIRAELARKGQVFFVHNRVQSIDAMAGRLKRLVP
FT                   EARVGVAHGQMSETMLEKVMIKFVNHEIDLLVCTAIIESGLDIPAANTILINRADMFGL
FT                   AQIYQLRGRVGRGDDQAYAYLFIPDESVLTRDAQRRLKVLMEHSDLGAGFAIAMSDLQI
FT                   RGGGTILGSAQSGQIAAVGYEMYLQLMETAIGQLKGEGSAPPLDPEINVDFSAFIPEWY
FT                   IPDVDQRLLAYRRLSRMEKVSDVGAFSKEMQDRFGKVPQETNQLFFKIMFKILCRDAGV
FT                   KKMDMAGKNLHLVISPEHQRNRDELLYMIKENFPRFRLNTEGVLKVALDTEAVKGRAVA
FT                   VKNVLKEIAGRVN"
FT   gene            complement(70487..71302)
FT                   /locus_tag="Dalk_0051"
FT   CDS_pept        complement(70487..71302)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0051"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: mth:MTH745 hypothetical protein; IMG
FT                   reference gene:2503005746; InterPro:4Fe-4S ferredoxin,
FT                   iron-sulphur binding, conserved site; InterPro:4Fe-4S
FT                   ferredoxin, iron-sulpur binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01761"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE6"
FT                   /protein_id="ACL01761.1"
FT                   /translation="MASPYWVKTLLKKSFPSRFFLARLTHFPVLGSLIEKALFENDDII
FT                   YLAKDSVVEINHDLAGREDMVMPSQVLEHFIIRSNYRFIMNTCICRESEDCKDYPINLG
FT                   CIFLGEAALDINPKFGRLASVEETLEHARKCREAGLVHLIGRNKLDTIWLNVRPKEKLL
FT                   TVCHCCPCCCLWKVIPTITDKISDRVAPMPGLTVAVTDKCVGCGACINDICFVNAIRLV
FT                   DGKAEISGDCRGCGRCVEICPSEAIRVNFHGGASVEGAINRIHGLVDFT"
FT   gene            complement(71590..74211)
FT                   /locus_tag="Dalk_0052"
FT   CDS_pept        complement(71590..74211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0052"
FT                   /product="transporter, cation-chloride cotransporter (CCC)
FT                   family (TC 2.A.30)"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   pin:Ping_1733 amino acid permease-associated region; IMG
FT                   reference gene:2503005747; PFAM: Amino acid permease;
FT                   InterPro:Amino acid permease domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01762"
FT                   /db_xref="GOA:B8FKE7"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="InterPro:IPR018491"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE7"
FT                   /protein_id="ACL01762.1"
FT                   /translation="MNNKAAEANGSKLGTFAGVFTPSILTILGIILFLRLGYVVGEAGL
FT                   WKVLIIIGLANAISVLTSVSLSAVATNMKVKGGGDYYLISRTLGLEFGGAIGLVLFLAQ
FT                   SVSVAFYCIGFGEALESMLPGGSALSPRMIALIAMALLFVFAWLGADVATKFQFVVMAL
FT                   LVLALASFFIGGLPHVKGSTLAQNWTGPSNGPGFWILFAIFFPAVTGFTQGVSMSGDLK
FT                   DPIKSLPRGTFAAVFLSIAVYFGAALVFAATSSLDVLSKDYSAMQKVAKWPVLIDAGVV
FT                   AATLSSAMASFLGAPRILQSLAQDKIFPFLTPFAKGEGASANPRRGVLLAAGIALVTIL
FT                   MGNLNLIAPVVSMFFLISYGLLNYATYFEAKAASPSFRPTFKYFNKNYSLLGFLACLGA
FT                   MLAIDPKAGAAAIAVLFAIHQYLMRTAHTERWADGQRSHHLQEMRKHLLATVNEPEHYR
FT                   DWRPYILVFTERPDRRANLLRFSSWLEGKSGAVTAIQIIEQSGAKGYKMKQEAEEELRQ
FT                   AIAEQKLPIFPLAIRTSDVQTSLETLLQCFGIGPFKANTAVLNWFEEKRYSTVGGREIP
FT                   YSRNLRIAFRAGVNIVLLAAGEEEWTVLDATPKEERRIDVWWKDDATGRLMLLLAYLIT
FT                   RNSGWENAKIRVLVQASEEDEKEAVMIMADFLQDARIKAEPVVLSKVDPQAVREESGDA
FT                   ALVFSPFRLHYNQLQNQFGGKIEDLLNKLPIVALVLASHDVDLTAQPDEGEAGKLAAAM
FT                   DEYEECLKKAQGLEHEAEMAREEALKAEKRLLDAPTGDSDQEAEKRAAMVKQAQEARDE
FT                   AAKVFKKSAKAEARLQEAAKIMESLGLTTKAPQAEKNQSEAPAEDSENNEAPENKNVEP
FT                   EE"
FT   gene            complement(74247..75629)
FT                   /locus_tag="Dalk_0053"
FT   CDS_pept        complement(74247..75629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0053"
FT                   /product="sigma54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: sigma-54 factor interaction domain-containing
FT                   protein; helix-turn-helix Fis-type; SMART: AAA ATPase;
FT                   KEGG: cbe:Cbei_3352 sigma54 specific transcriptional
FT                   regulator, fis family; IMG reference gene:2503005748; PFAM:
FT                   Bacterial regulatory protein, Fis family; Sigma-54
FT                   interaction domain; InterPro:ATPase, AAA+ type, core;
FT                   InterPro:Helix-turn-helix, Fis-type;
FT                   InterPro:Homeodomain-like; InterPro:Homeodomain-related;
FT                   InterPro:PAS; InterPro:RNA polymerase sigma factor 54,
FT                   interaction"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01763"
FT                   /db_xref="GOA:B8FKE8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE8"
FT                   /protein_id="ACL01763.1"
FT                   /translation="MSQSRKKSAAPRKIPQDLLDALLNNPYEGLILVDAQGIIRHMSSA
FT                   NEGIYPFTPQESVGRHIHDVSPKSRMDRTIRTGKAEIGRSMILDDKTRVVARFPLSKDG
FT                   KVIGAAGKLLFMDPGKMKELYERITHLERRLEKYEDELAQIYRTNYSLDSILGDSPDII
FT                   QAKRLAEQAAGADSPVLIMGESGTGKELFAHAIHGLSQRGSGALVKVNCAAIPGELLEA
FT                   ELFGYEEGAFTGARKKGKAGKFELAHGGTIFLDEIGDMPLPMQIKILRVLQEREVERVG
FT                   SNRPKKVDFRLICATNRDLPKLMRQGLFRQDLYYRINVMTLKLPPLRDCRDDIFPLFQH
FT                   FSRILGREKTPPKILPGVKEILEKYSWPGNVRELRNVTERALIVCRDNTVSPADLPDLS
FT                   QQEVLPQVIEEKASLKALMDQAEKKIIEQALVQASSRAEAARNLGIHRTGLYQKMKKHG
FT                   IE"
FT   gene            76300..77172
FT                   /locus_tag="Dalk_0054"
FT   CDS_pept        76300..77172
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0054"
FT                   /product="3-Hydroxybutyryl-CoA dehydrogenase (NAD-binding)"
FT                   /EC_number="1.1.1.157"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   saq:Sare_4006 3-hydroxybutyryl-CoA dehydrogenase; IMG
FT                   reference gene:2503005749; PFAM: 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain; 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain;
FT                   InterPro:3-hydroxyacyl-CoA dehydrogenase;
FT                   InterPro:3-hydroxyacyl-CoA dehydrogenase, C-terminal;
FT                   InterPro:3-hydroxyacyl-CoA dehydrogenase, NAD binding;
FT                   InterPro:6-phosphogluconate dehydrogenase, C-terminal-like;
FT                   InterPro:Dehydrogenase, multihelical;
FT                   InterPro:NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01764"
FT                   /db_xref="GOA:B8FKE9"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKE9"
FT                   /protein_id="ACL01764.1"
FT                   /translation="MAIKSMFVVGSGLMGAGIAQVSAQAGIEVFLTDMSEAALEKAKKN
FT                   IAWSVGKFAEKGKISEDVDTVMKRITTVTGYEAAKDVDLAIEVVFENLEVKEGIFKALD
FT                   EACGPDALIASNTSAIPITELAAVTKREEQVLGIHFFSPVPMMMAVEVIKGVATTDETA
FT                   QAGREYVLQIGKEPIMVNRDIAGFVINRINFPSNIEAMRLVEQGVASCEDIDKGLRLGS
FT                   GRKMGIFETGDMVGLDVSYGAMMATYKETGDPRFYPPLLLRRKVKAGHLGRKTGKGWYE
FT                   YNEDGTRKK"
FT   sig_peptide     76300..76368
FT                   /locus_tag="Dalk_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005749_SP"
FT   gene            77491..79278
FT                   /locus_tag="Dalk_0055"
FT   CDS_pept        77491..79278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0055"
FT                   /product="Acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: dol:Dole_2366
FT                   acyl-CoA dehydrogenase domain-containing protein; IMG
FT                   reference gene:2503005750; PFAM: Acyl-CoA dehydrogenase,
FT                   C-terminal domain; Acyl-CoA dehydrogenase, middle domain;
FT                   Acyl-CoA dehydrogenase, N-terminal domain;
FT                   InterPro:Acyl-CoA dehydrogenase, N-terminal;
FT                   InterPro:Acyl-CoA dehydrogenase/oxidase; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase C-terminal; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase, N-terminal; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, central domain; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, type 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01765"
FT                   /db_xref="GOA:B8FKF0"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF0"
FT                   /protein_id="ACL01765.1"
FT                   /translation="MSDFKINQKDLFFILKEQLGYGKLCEFERYESLNEDALDMLVNEA
FT                   IRFAKGVVSPLNEIGEEQGVHWENNTVTCPKEFKTAFKAYGEDGWTAAVRDPEFGGQGF
FT                   PTMMRIVVNDLMYGACQSFNMAPSLTHGAAHLIESFGTDEQKQTYIPKMYGGEWAGTMA
FT                   LTEPNAGSNLAALETMAYPEGDHYKIKGNKIFISWGDHDLAGNIVHLALARIEGAPEGV
FT                   RGISLFIVPKYRVDENGNPGEFNDVVCTGIEKKLGLHSSPTAALAFGGKDGCIGYLCGK
FT                   ANMGLAHMFQMMNAARINTGVSGMSMASAAYQHALDYTKSRVQGRDIAKRKQGSVPIID
FT                   HPDVRRMLLWMKGAVDGMRSMIYTTAFWADLAQVTTDPEEKERCTMLMEFMTPIVKSYC
FT                   SDIGFKVCETAMQCLGGYGFCKDYPIEQYLRDSKIMSLYEGTNGIQSTDLMGRKMHMNE
FT                   GAPYKAFLKEITDFCEKNHAHPGLGSQVRFLKDVMDDLQEMAREMSSRYSADPLQWASY
FT                   TYPALMCFSEVIMVWRLVDMAIIAYDRAQKSGKKNDFFRGKVAQATFFTDITLPHTQAR
FT                   ARTCTRVDREVVEMADNAF"
FT   gene            79297..80541
FT                   /locus_tag="Dalk_0056"
FT   CDS_pept        79297..80541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0056"
FT                   /product="Acetyl-CoA acetyltransferase (thiolase II-like)"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: sfu:Sfum_2280 acetyl-CoA acetyltransferases;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase; IMG
FT                   reference gene:2503005751; PFAM: Thiolase, C-terminal
FT                   domain; Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases; InterPro:Thiolase; InterPro:Thiolase,
FT                   C-terminal; InterPro:Thiolase, N-terminal;
FT                   InterPro:Thiolase-like; InterPro:Thiolase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01766"
FT                   /db_xref="GOA:B8FKF1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF1"
FT                   /protein_id="ACL01766.1"
FT                   /translation="MTKEIVIVSGVRTPVGRYMGALKTIEAYDLAALVLNEAIKKAGIK
FT                   PDQVDEVIMGQSYQNGEYVNIARMGLLNAGWPEEIPGLTIDRRCCTGLETIRLASALIQ
FT                   SGQAEIIVAGGVESMSNAEFYLPGNIKWGVGGQKGMPRGHGDLGIWGMPMYDRIQRARV
FT                   MSQPESRYGILPSMMSWAETGAKEEGVTREECDEWALGSHQKACAAQEAGKFDEEMIPI
FT                   TIPQRKGDPIIVAKDENPRPDSAIEKLAMLKPVLGGVCTAGNSSTENDGAAAVVVMSAE
FT                   KAKELGLEVLASVKAVAVAGADPTRTYLTVGAAARKALAQADVSLDQMELIEIQEAFAA
FT                   QVLADLKDMGVGKEDYGKINVNGSGISLGHPIAATGVRVLVSLVYEMRRRDAKMALECI
FT                   CGGGGLGIAAVLERK"
FT   gene            80544..81734
FT                   /locus_tag="Dalk_0057"
FT   CDS_pept        80544..81734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0057"
FT                   /product="Acetyl-CoA acetyltransferase (thiolase I-like)"
FT                   /EC_number="2.3.1.16"
FT                   /note="KEGG: lxx:Lxx10480 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase; IMG
FT                   reference gene:2503005752; PFAM: Thiolase, C-terminal
FT                   domain; Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases; InterPro:Thiolase; InterPro:Thiolase,
FT                   active site; InterPro:Thiolase, C-terminal;
FT                   InterPro:Thiolase, conserved site; InterPro:Thiolase,
FT                   N-terminal; InterPro:Thiolase-like; InterPro:Thiolase-like,
FT                   subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01767"
FT                   /db_xref="GOA:B8FKF2"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF2"
FT                   /protein_id="ACL01767.1"
FT                   /translation="MAGKLSEVVAVDAVRTAFGRAGEKGIFWNTRAEDLCIPLLHALME
FT                   RNPPAKPEMVEDILWGVTNQMKEQGGTIGRMISMLAGWGWNVPGCSIDRMCASGLTALG
FT                   FACSNIASGMVDCLVAGGVEHMGHLPMGFMRDPHPRAEEAMGDASAFNMGQTAENIHDR
FT                   WPEFTKEMADAYAVECQAKAHKAIEAGKMKSMIIPVETVDAEGNKVVIDQDQAPRPSTT
FT                   MEGLASLKTPFRENGRVTPGNASGLNDGASAVLLMEADKAWDMGLHPVMRYVSSAVAAL
FT                   DPRVMGIAPVPATQKALKKAGLTMDDIDIIEINEAFAVQALYCLNRLGVEWNDPRVNPW
FT                   GGALAFGHPLAASGPRLAAFMAAQFRENPKARYGLCTMCVGRGQGYSIIWENIAQK"
FT   gene            81779..82942
FT                   /locus_tag="Dalk_0058"
FT   CDS_pept        81779..82942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0058"
FT                   /product="Short-chain specific acyl-CoA dehydrogenase"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: sat:SYN_00480
FT                   acyl-CoA dehydrogenase, short-chain specific; IMG reference
FT                   gene:2503005753; PFAM: Acyl-CoA dehydrogenase, C-terminal
FT                   domain; Acyl-CoA dehydrogenase, middle domain; Acyl-CoA
FT                   dehydrogenase, N-terminal domain; InterPro:Acyl-CoA
FT                   dehydrogenase, conserved site; InterPro:Acyl-CoA
FT                   dehydrogenase, N-terminal; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase C-terminal; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase, N-terminal; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, central domain; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, type 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01768"
FT                   /db_xref="GOA:B8FKF3"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF3"
FT                   /protein_id="ACL01768.1"
FT                   /translation="MIFELSKELQMLQKAVREFATKNIAPNADQWDADHYLPIKEVLKP
FT                   MGELGFFGAVVPEEYGGEGMGWLAASIITEEIARASSSLRVQINLLGLGCAYPIYKYGT
FT                   EEAKKKYVEKLCRAQYLGGFGITEPNAGSDVLAIETEATDMGDHYVLNGSKTWISNAHQ
FT                   ADVIIIYAYTDKSAKTKGLSAFIVEPRNFNGIKTTDLNKMGSHSSPTGELFFDNTRVPK
FT                   ENLLGKPGDGARIVFSSLANTRLSAAAGAVGCAQACLDIATKYITKREQFGKSVGTFQM
FT                   NQDLIAQMTTEIEAARLLVYKASWQKDQGMENNGMAVAQAKYFAGETAMKCANYGMRLM
FT                   GAYGYSTEYPLARYYRDIPTYVLVEGSANICKMIIAMDQLGYRKANR"
FT   gene            82956..83726
FT                   /locus_tag="Dalk_0059"
FT   CDS_pept        82956..83726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0059"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   dol:Dole_2365 enoyl-CoA hydratase/isomerase; IMG reference
FT                   gene:2503005754; PFAM: Enoyl-CoA hydratase/isomerase
FT                   family; InterPro:Crotonase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01769"
FT                   /db_xref="GOA:B8FKF4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF4"
FT                   /protein_id="ACL01769.1"
FT                   /translation="MNLENMIYEKKGHIAVITFNHPPANAWNLAAVTDFLAAVDEAEKD
FT                   KDVRVVILTGAGDKCFSAGMDVSDAANLPKTSPMAKTLWTRIDRFEKPVIAAINGHALG
FT                   GGLELALCCTFRIMADNPKAKIGLTELNLGIIPGWGGTQRLSRVIGEAKALDMILFSRR
FT                   LDANQALEIGLVNQVSAPEMLMEDAMAFAEALAKRPPVAVAMVLKAMSAGAYEGIEIGL
FT                   EVEGQGSAVVKNTKDSQEGFAAFLEKRPPNFIGE"
FT   gene            84149..85195
FT                   /locus_tag="Dalk_0060"
FT   CDS_pept        84149..85195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0060"
FT                   /product="Putative glutaconate CoA-transferase, alpha
FT                   subunit"
FT                   /EC_number="2.8.3.12"
FT                   /note="PFAM: coenzyme A transferase; KEGG: sen:SACE_4008
FT                   3-oxoadipate:succinyl-CoA transferase, A subunit; IMG
FT                   reference gene:2503005755; PFAM: Coenzyme A transferase;
FT                   InterPro:Coenzyme A transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01770"
FT                   /db_xref="GOA:B8FKF5"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF5"
FT                   /protein_id="ACL01770.1"
FT                   /translation="MEGKRSKVTTAQEAVQRLIHDGDELVIGNYTVGTCADLVCEVIRQ
FT                   GRRNLTLYSQSGIFDAEILTAAGCLSRMVSTYVMRSGGKTGGSSVERALQDGSLELEDY
FT                   SNFNYNARMVAGMHGFSFMQVLEGIRETDLFTKRTFMGDDKYRIITCPYTGKEILTVPA
FT                   ANPDVCIVHVQRADKHGNAQYWGALGSVAAAALASKKIIVSCEEIVDESIVRASPHFTI
FT                   IPAYRVDAVVESPWGAHPCEVLGYYNQDKLFYGLIMAAMKKREDMEKWLDEWVYSCPSR
FT                   QAYLDHYAKVFHISRLQALKAKPLPSAPASYGAAFHSAWDENGRDRYLGKTPEELELLL
FT                   EQRETLYG"
FT   gene            85188..86018
FT                   /locus_tag="Dalk_0061"
FT   CDS_pept        85188..86018
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0061"
FT                   /product="Putative glutaconate CoA-transferase, beta
FT                   subunit"
FT                   /note="PFAM: coenzyme A transferase; KEGG: drm:Dred_1891
FT                   glutaconate CoA-transferase; IMG reference gene:2503005756;
FT                   PFAM: Coenzyme A transferase; InterPro:Coenzyme A
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01771"
FT                   /db_xref="GOA:B8FKF6"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF6"
FT                   /protein_id="ACL01771.1"
FT                   /translation="MAKPFTLNEMLIIAAAREINDGENIILGVGLPMTAGALAKALHAP
FT                   NATLMLESGIVDFEPLVPLNHIADAHAMRGYSYNTDLFSIFTALYRGFVDVCFLGVGQV
FT                   DRYGNLNTTTIGDYYKPNLRLPGSGGAADFISYSKRTVLTMRSGEFKEKLDYLTSPGHL
FT                   RGGNSRNESGYFPKDSGPCALITTQGIFHFDEETKEMFLARIHPGVEVEEIQAKVPWKM
FT                   KVAEDLKVTERPSDEEIAFIRHFAPNQTMSRALGIELGIENAIAQIKQMRGGIV"
FT   gene            86477..87745
FT                   /locus_tag="Dalk_0062"
FT   CDS_pept        86477..87745
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0062"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   pap:PSPA7_0119 transposase DDE domain-containing protein;
FT                   IMG reference gene:2503005757; PFAM: Transposase DDE
FT                   domain; InterPro:Ribonuclease H-like; InterPro:Transposase,
FT                   IS4-like; InterPro:Transposase, Tn5-like, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01772"
FT                   /db_xref="GOA:B8FEP3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B8FEP3"
FT                   /protein_id="ACL01772.1"
FT                   /translation="MERFLPADKSQSQAPFKSKDFSRNRILTLPVVLALILNMVRPGKR
FT                   VGYDEVLARFFAAASLMNGQNITPPDKSAFCRARKKVPFEALTELYGKALEHAKDLAAK
FT                   APGTTWRGRRVLAIDGTKIMLPRTKELLDAFGKCSHGWFPQTHACVLYDVLAGLPLDVA
FT                   WGHYKSGERGLARDMFDGFLPGDILVLDRGFPGFAFFLDLMEQGIDFIVRLRGDGQFAA
FT                   LRPFLQENRRDQIIEIPPTRVAIEEYARQGKPAPGPVTLRFVKVSLGKGKSALYATTLV
FT                   DRKRYKFKELKHLYHLRWQEEEFFKHMKDLLEAENIRGKSEALVDQEIVAVHLYHLLAR
FT                   ILIMESALRHEIPLAEVAQRAAFYATARVLDFLLLLDDRQELRRLLKNCLEEISRKRYK
FT                   RRPGRKFPRKSKSSYGKWGIQNT"
FT   gene            complement(87926..89956)
FT                   /locus_tag="Dalk_0063"
FT   CDS_pept        complement(87926..89956)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0063"
FT                   /product="UvrD/REP helicase"
FT                   /note="KEGG: rpc:RPC_3542 UvrD/REP helicase; IMG reference
FT                   gene:2503005758; PFAM: UvrD/REP helicase; InterPro:DNA
FT                   helicase, UvrD/REP type; InterPro:Helicase, superfamily 1,
FT                   UvrD-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01773"
FT                   /db_xref="GOA:B8FKF8"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF8"
FT                   /protein_id="ACL01773.1"
FT                   /translation="MENNAPFVPPEITDADIEWATELLGLPKNAFLGEDGDDPRKEVLK
FT                   DMTTFDVSACPGSGKTTLLVAKLAILANKWSHRTSGICVLSHTNAARDEIEKRLGSSAV
FT                   GRQLLNYPHYIGTIHGFVDQFLALPWLRSKNCPIKIIDTDICQNFRWKYVFFRTSKWSS
FT                   QMQKILKEKSLRGDKILIQSSDFTLTNVKYGEKTKLYKVMKDSCVLSTEKGYFCFEEMF
FT                   MWAKELMDTTPSIILTIRKRFPLSFIDEVQDNSDSQTAILQRIFTENGNSAIQQRFGDE
FT                   NQAIYSSPESQSAPGNILPIDEKNKKVLPNSHRFCQHIADLSGPLSMTADTCSLEGHGP
FT                   KCRHISCYSEDGNHTIFLFDDNSINRVLDAFGHLLIATFSDESLRHGVFTAVGHIHKPK
FT                   RDEPKPCHVQHYWPDYNPELCKKEPRPSSLLQYIHVGLGKSQRAGISHPAAEKIAEGLF
FT                   RLAGMSENPTRVSRRGFCHRSVLKALENRPKAKGVYLDLLHSLVVDRNLPTRDEWKAQS
FT                   PIYYKLASIIAEAPINKPEANSFLQWHEFAAIPQPDEEPTTCMDNIYRYSHDGREVPIR
FT                   VGSIHSVKGETHTATLVLETYWHKHNLESIFDWICDNNAGCCKKEKRNNPRLKTHYVAM
FT                   TRPTHLLCLAMKKSCFEDQEGNLNQEKIDKLTERGWKYQVV"
FT   gene            complement(89946..91961)
FT                   /locus_tag="Dalk_0064"
FT   CDS_pept        complement(89946..91961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0064"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: rpc:RPC_3543 SMC
FT                   protein-like; IMG reference gene:2503005759"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01774"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034139"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKF9"
FT                   /protein_id="ACL01774.1"
FT                   /translation="MYLSKITIENFRCFGERDKKFEMSLKPGLTTLVGENDAGKSAIID
FT                   AIRYVLCTTDQEWLRIKENDFHVGANPKEIRIVCKFDDLEAHHQRAFIEYLTHDASGAK
FT                   PPVFFLHWTAKETGEIMKGRPYRRIELHSGEKGEGPSIDPKVRELLSVTYLRPLRDAER
FT                   ALSAGRGSRLSQVLYHTEEVKSSGKPYGEGVANEELSVTGIGELADALIKNQPGIVETR
FT                   KQIDNHLEKLTLLGNPICSKVEVSGAAASPDVRLRQLLEKLDLSLDEIGKPGLGSNNLL
FT                   FMACELLLLAQENEGNRMLLIEEPEAHLHPQRQLQVMKTLQEEAEEKKIQIIVTTHSPN
FT                   LASAIKLKGLTLIHENKAFSMAEGETKLEKSDYQFLERFLDVTKANLFFARGVMIVEGD
FT                   AENILIPTLAKLIGRDFTENGVSIVNVGGVGLRRYARIFQRVHIEKDGLLKIPVACVTD
FT                   LDVMPNCAPAIIDKLDKEGHVPEIKKRQWRMKHDYNEEKPLEQKYFSTEQKATGQCVRT
FT                   FVSDEWTMEYNLAIGPQDDNGEFPGGLGYQTFAAAYLASKDDSLYTNKKTTSQWQEEIK
FT                   KNYKKIILESEAQDGCLVEEVIASKIYNFFVNKKASKTIAAQHLSYILQLHVQRGDLSE
FT                   DQLRAVLPTYLVEAIEYVTGNLILEIKDGKEGHDGE"
FT   gene            complement(92650..93834)
FT                   /locus_tag="Dalk_0065"
FT   CDS_pept        complement(92650..93834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0065"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   rpt:Rpal_1428 extracellular ligand-binding receptor; IMG
FT                   reference gene:2503005760; PFAM: Receptor family ligand
FT                   binding region; InterPro:Extracellular ligand-binding
FT                   receptor; InterPro:Leu/Ile/Val-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01775"
FT                   /db_xref="GOA:B8FKG0"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG0"
FT                   /protein_id="ACL01775.1"
FT                   /translation="MKTKWVVLLLTLLMAAGFAFTASAEVGITDDEIVIGSHLDLSGPI
FT                   AGWGTQAKLGMEMRAKECNDAGGIHGRKIRLVIEDNAYDPKKAIMVTNKLIARDKVFMF
FT                   VGNMGSPTAGATKPLISGKKIPQIFPITAASLFFDPYDRYSFGGWVPYYDQVRAAVKWF
FT                   VENKGAKKIGMMYQDDEMGHIMMKGLKDQLAVHGLEVAAAESYKRGATDFSSQMAKLKK
FT                   ADVDLVCLGTVIRETVGGVKEAKKLNWDVDMVCFSPGYNSYVVGLCLKAGFSPDGLYAT
FT                   GQSNYVYPDSELESIREFCKKHKEWYGKDPDLPTSAGWGGMDYLIKVAEKAGPDLTREK
FT                   WIDTAESYGVYKDPIFGGVDVEFTSEQHQGAFDAILSQVKNNKFVKIDYVSFRE"
FT   sig_peptide     complement(93763..93834)
FT                   /locus_tag="Dalk_0065"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005760_SP"
FT   gene            complement(93868..95685)
FT                   /locus_tag="Dalk_0066"
FT   CDS_pept        complement(93868..95685)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0066"
FT                   /product="Long-chain-fatty-acid CoA ligase (AMP-forming)"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   dol:Dole_3006 AMP-dependent synthetase and ligase; IMG
FT                   reference gene:2503005761; PFAM: AMP-binding enzyme;
FT                   InterPro:AMP-binding, conserved site;
FT                   InterPro:AMP-dependent synthetase/ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01776"
FT                   /db_xref="GOA:B8FKG1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG1"
FT                   /protein_id="ACL01776.1"
FT                   /translation="MTPSQINIQNETVPTLFWRRVHDWADNTALRAKVYGIWRKITWRE
FT                   YGQKARYAGLGLISLGLEKGDRVTIISENNPEWLFSDMGAMCAGGISVGIYPTDSPQQV
FT                   EYVLNHCQAKFYIAEDEEQLDKVLEVRERTPHLKKIIVMDMEGLRHFEDDMCMSFDDLL
FT                   ELGKKMDEENPLLFEQRLREPQPEDTAILIYTSGTTGPPKGAMITHSNILNTMDMQNEV
FT                   NAGDETDEVLSFLPLCHIAQRTVSVFAPLLTGGRINFVEEMDTIPQNMQEVSPTIFFAV
FT                   PRIWEKFYSSLILTMKESTRFEKLAFKWATGIGQKLSDIRLHGQEPPVHLKVLFKLADW
FT                   AVLRNLKKVIGLNRARYCMSGAAPISPDLLKFYHGLGLDIREVYGQTENCGPTTVHYSG
FT                   HVKFGTVGQPLPRAQVKIAEDGEILLKGPHVFKGYFNDPEKTAETVIDGWLYTGDVGRI
FT                   DEDGHLIITDRKKDIIITAGGKNITPSEIENQLKFSPYITDAVVIGDGRKYLTALIMVD
FT                   DENVMKFAQENKVPFTTYASLTKAQEVVDLIQNEVEEVNKQFARVETVKKFRLIDIQLT
FT                   TDDDEITPTGKLKRNFVNEKFKDVIESMY"
FT   gene            complement(95760..96530)
FT                   /locus_tag="Dalk_0067"
FT   CDS_pept        complement(95760..96530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0067"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:bll7929 ABC transporter ATP-binding protein; IMG
FT                   reference gene:2503005762; PFAM: ABC transporter;
FT                   InterPro:ABC transporter, conserved site; InterPro:ABC
FT                   transporter-like; InterPro:ATPase, AAA+ type, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01777"
FT                   /db_xref="GOA:B8FKG2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030660"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG2"
FT                   /protein_id="ACL01777.1"
FT                   /translation="MSVMLKVRNIETYYGPIMAIKGVSFDILEGAVVTILGANGAGKTT
FT                   ILKTLSSIMDPEKGTIEFMGRRIEGLPPEKIVAMGISQVPEGREVFHDLTVKENLLMGA
FT                   YLRNDRAGIKRDIDMVYDYFPILKDRTGQLAGDMSGGQQQMVVIGRALMARPKLLMLDE
FT                   PSLGLSPLLVKEIYQIIERINQEHNTTILLVEQNAPMALSIASHGFVLELGRIVMDDTC
FT                   QALMANEDVQEFYLGIKEDSVRGAKRWKRKKKWR"
FT   gene            complement(96514..97290)
FT                   /locus_tag="Dalk_0068"
FT   CDS_pept        complement(96514..97290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0068"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bja:bll7930 ABC transporter ATP-binding protein; IMG
FT                   reference gene:2503005763; PFAM: ABC transporter;
FT                   InterPro:ABC transporter-like; InterPro:ATPase, AAA+ type,
FT                   core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01778"
FT                   /db_xref="GOA:B8FKG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG3"
FT                   /protein_id="ACL01778.1"
FT                   /translation="MAFFQAQEISISFGGLKALDRVSFTVNKGEIFSIIGPNGAGKTTI
FT                   FNCINRFYDLDEGVFLLDGKNLSSAKTHQIADMGIARTFQNIELFKNMTVLDNLILGRH
FT                   RKRRSNILTEMFFFKPVQRQEINSREKAEEIIDFLDLEAHRDQLVVNLPYGVQKTVELG
FT                   RALAMEPTLLLLDEPTSGLNMEESEDLAFWLDDMKEELGITVLMVEHNMRFVKQTTDRV
FT                   LAIDFGQTIIEGETNEVLNHPDVMRAYLGEENVCNA"
FT   gene            complement(97291..98364)
FT                   /locus_tag="Dalk_0069"
FT   CDS_pept        complement(97291..98364)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0069"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rfr:Rfer_3500 inner-membrane translocator; IMG reference
FT                   gene:2503005764; PFAM: Branched-chain amino acid transport
FT                   system / permease component; InterPro:ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01779"
FT                   /db_xref="GOA:B8FKG4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG4"
FT                   /protein_id="ACL01779.1"
FT                   /translation="MRFLMKTDYYQDIRLFKYRSTFFWYLALVVGCLFLPKILDEYMLS
FT                   QLTFICIYAVAGVGLMLLTGFTGQISMGHAAFLAIGSYTSAVLTAKGVPFLLALPASGV
FT                   TAALVGIVIGRPILHLTGLYLAIATMGAAFIIEEILVRWESVTNGNMGMMVDAPTIFGF
FT                   GFDTEIRFFYLSLAVLIIVLLLAKNILRSPTGRAFIAIRDSEIAAEAMGINLASFKTQS
FT                   FAISAFFTGIAGSLYAHKIFFINPESYTIMQSIELLAIVIIGGLGSLHGAVYGSIFFIF
FT                   LPQLIIISKDYLPTFVQDQTGLQPALFGLLIILVMLFEPMGIYGRWLKTKFYFEWFPLY
FT                   KKDSFKREKKYQKAERH"
FT   gene            complement(98370..99257)
FT                   /locus_tag="Dalk_0070"
FT   CDS_pept        complement(98370..99257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0070"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   rpt:Rpal_1423 inner-membrane translocator; IMG reference
FT                   gene:2503005765; PFAM: Branched-chain amino acid transport
FT                   system / permease component; InterPro:ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01780"
FT                   /db_xref="GOA:B8FKG5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG5"
FT                   /protein_id="ACL01780.1"
FT                   /translation="MEFFNELTQTILNGVAIGCIYGMVALGFVLIYKSTEVINFAQGEL
FT                   LMLGAFISYSLITQLHLSYWTALVITILAMGIVGAILERVVLRSLVGEPTYAIVIVTIG
FT                   ISYFIRSVVSMVPGWGTDTYGFRTPFTDKFLRWGDVVISYEYLSIVVLAFVLIAVVFVF
FT                   FGYSRMGTAMRATSQNQLAAVYMGISVTRVFSLTWTIAAALGGIGGILLAPITFVHMNM
FT                   GFIGLKAVPAAVLGGFTSPPGAIVGGLIIGITESLAGVYLEEGWKDIAAWIILIAVLII
FT                   RPQGLFGIQEKKKV"
FT   gene            complement(99874..101679)
FT                   /locus_tag="Dalk_0071"
FT   CDS_pept        complement(99874..101679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0071"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF11; KEGG: afw:Anae109_1571
FT                   hypothetical protein; IMG reference gene:2503005766; PFAM:
FT                   Domain of unknown function DUF11; TIGRFAM: conserved repeat
FT                   domain; InterPro:Domain of unknown function DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01781"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG6"
FT                   /protein_id="ACL01781.1"
FT                   /translation="MKKPAAYMLIRMITAILLTALLAPASALAWPAASEWNPLLQNGAF
FT                   LLDPNGDAQGSRNIVSEATHAAAYIYNDGTYIYFRMRLDQNPQGTGGQGLLKPYGWGFE
FT                   FDTDSDPTSYEWLLILDGISKTENIILEQNTVQQSIDDPSDASEIDAFAISVSGNYQIN
FT                   LADTSFNGDQDYFLDFRFPYSTFLQMTGLSDSSPIRVFGGSSSSANALTERGADLLGSS
FT                   TLSGGFTDIITPTGTTPTDGSVQFVENLAGTGDMTAACPGDALFVRVIDGDKNYVDASP
FT                   QTLEVTLTVPSGDSETIVLTETGMNTSWFTGSIPTAAAASNPGDGTLQVFPGETATVTY
FT                   VDEITADGSVNLARTDSIVMGLPAISIAKTTPTPSVTSGGYAEYTITVTNSGCGAGAIT
FT                   QIQDVLPGNFTYQAGSTQGLTATDPALSGQVLTWSGPWSVPPYSHVNLSFQVYAGTASG
FT                   VFYNNASVSGANFAQVSTGDAAPVTVIAPLLEIEKNVDKTNAKPGEELIYSIHYHNIGS
FT                   DAAHDIVITDEIPAFTAFLPGSLRIGPADGDYASATPVTDAGDGDEGAVIAPNIVFVIP
FT                   LTGADDGVPGSGPDEGKAYFKVLID"
FT   sig_peptide     complement(101593..101679)
FT                   /locus_tag="Dalk_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005766_SP"
FT   gene            complement(101720..107707)
FT                   /locus_tag="Dalk_0072"
FT   CDS_pept        complement(101720..107707)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0072"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF11; KEGG: gbm:Gbem_2718
FT                   conserved repeat domain protein; IMG reference
FT                   gene:2503005767; PFAM: Domain of unknown function DUF11;
FT                   TIGRFAM: conserved repeat domain; InterPro:Collagen-binding
FT                   surface protein Cna, B-type domain; InterPro:Domain of
FT                   unknown function DUF11; InterPro:Immunoglobulin-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01782"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG7"
FT                   /protein_id="ACL01782.1"
FT                   /translation="MLRTPEKQPEHYIKRMAVACLLLLWCVLAQAYPALALSPPVGTQI
FT                   TNTAEATYADANGNDMPELSASVGTEVGGAPVLKISKTASSNPIAMGSEIVYTILYSNQ
FT                   GNAPATGVIITDDLSDLLTFQEASDGGAYAPGPPGGGRVTWSLPDLAAGSSGSITIKAL
FT                   VKTPGDYAPGDPDAIAAGSLIYNTAKIDSNEIDEEETIITTVGSGPNLMLTKSVQSNSV
FT                   APGGEIQYTLRYKNLGNAAATKVRIQDDLPDQTSYVENSASAGGALNARTLSWSLDNLA
FT                   PGASGQVIYKAQVSVLAKEGAVIANTGVLLSNETGGVLSNEVRVTVSGAFSMTLEKTVS
FT                   PASVRAGENLVFSILVENNGAIALSGITVVDPLPHGATFVSADNGGVLDAKTVTWSIDA
FT                   LAPGQTRTLTLEVKSNAIDQGQNSIENTATARAPGLNPISASATAALTCRSQGVVSFVG
FT                   PGGEAVRDFSIGDQIYLTVQDADRNLDPLTAETVTVTLSVPGTGDVETIILTESMFNKA
FT                   PAVDSGLFFGGLPSSGDAASPQDGTLQLSQDIVIDALYEDPLDPLCGLPGQSQASILVE
FT                   PGGVVFDASTGAPVAGVQVILFTNSGQRASTLPDWPAGMPDVTTTGADGAFSFRNAPFG
FT                   SYFFSVVPGLEFQFPSQTPDGELPPGFTVGMGSRGEIFTLSVQNPSVNMDIPLDPSPGV
FT                   LSVSKTCSKERAEIGDIVLYELTLSNQGYSAITDLTIQDVLPHGFLYKDGSTTIDGKKA
FT                   DDPVASSGRTMEWTIPVLAPSTIMTLSYRVVIGPDSHLGDGRNTVAALGVTTGGVVHSN
FT                   AASHQLKIVQGVFTTDGTIIGKVFLDRNGNGIQDPPGSDGSILEPGVPDAVIFTEYGLR
FT                   IRTDKDGKYSVFSVKPGTHVLRLDETSLPPSLAPVSLHNRFMGDDRSQFVDMHPHGLVK
FT                   ANFGVRVRPGHAWPPEAELLNEEDVQAPDESPKIPLEEQIPGMDNALAFISPADKAVLP
FT                   KDNVDVILKGHSAGTIKLFVNGREVSKDRLATVVADNRAMVSAYEFLGVSLRAGESNTL
FT                   EARILDPYGNQRGAVSIIVECVGKPVKIKIDEDDKGFPANPSAPVEIPVILVDNKERAV
FT                   GHNGLMDVEASMGKILNPDANPDEDGLQIAYESGRALLLIQPPGETGQGVIRVRSEGLS
FT                   KEQEVYFTPYLRDMMIVGSGEVVLGLGDSDGDYTALKKERSFDENGYADGRAAVFAQGR
FT                   VFDKNLLTIGVDTAKDRDRRDDNIFNAQEQTLDSPDKYPIYGDESENEYPAQSREKVYA
FT                   KIERDKSSLMYGDFETGFTGSRLAEYNRSFTGGYGDLNLKRFRLQGMATKSDQALIVDV
FT                   LRAKGSSGYYYLSEMDLVEGSERVVIEVRDRNQVERVLSRETLSRGSDYNMEYDLGAVL
FT                   FMEPVPSYDINFNPIYIVVNYESRSPYLDYYAYGGRSQAAVFSWLDLGATGVVEENALA
FT                   NYNLTGGDMALHLPWKTDLRAEYAQTRAIFDELGVLGPENGEGWRFDLESRPFDKLSLS
FT                   GYYQNLSEFFSNPSAIGAQRGVESLGGKAKYSLDSGLSFSAQYYEDDDRLNNRVSQTGA
FT                   AAVAKKFEKTRVEAGVVYENITEGANTSKRPDYLRTFETDRPALDHETSVMAGAGYDYS
FT                   EKLSFQARHHHSVTGSGYHLTDAGVNAALTDKTTGYIRQEYAEYSEYDDMHTVAGLESQ
FT                   VGENTTAYNEMRLEGGASGERNHQIVGLKHRLRFTNSLTGDASMEYAQTIAGKADSSIP
FT                   DGFALGGALRYLPDDLLKVTTRAEYTMEDSAQQTRRTYLGEAGLIYKLHPDYSLLARAR
FT                   GFWDLSEQDGDQVYSRTMAGLAFRPIQSDAFHMLAKTEYKYEDNQKSTPKYESHSVIPS
FT                   IEGVYQVSHKTQFIGKYAAKFQTDGDLEAYTDLWSGRIIYDITDRFDASAGYRVLTAHT
FT                   ANGSMRQGGFAELGVRAFKNLWISGGYCFDDFDTDLTGDSFQGQGPYIRIRFKFDENLF
FT                   AKK"
FT   sig_peptide     complement(107615..107707)
FT                   /locus_tag="Dalk_0072"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005767_SP"
FT   gene            complement(107736..109493)
FT                   /locus_tag="Dalk_0073"
FT   CDS_pept        complement(107736..109493)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0073"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF11; KEGG: ttj:TTHB180
FT                   hypothetical protein; IMG reference gene:2503005768; PFAM:
FT                   Domain of unknown function DUF11; TIGRFAM: conserved repeat
FT                   domain; InterPro:Adhesion, bacterial; InterPro:Collagen
FT                   binding; InterPro:Domain of unknown function DUF11"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01783"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR008966"
FT                   /db_xref="InterPro:IPR026466"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG8"
FT                   /protein_id="ACL01783.1"
FT                   /translation="MKNFRILAFLCLIAACLVWAGLGYAALTPAGTVISNQAHADYKDA
FT                   NGNSLPRVFATPVTTLVGQVAAVDLSPPTSTKSKAKGTTVNFGAEIVNTGNGQDAYTLA
FT                   VATCPGWTAVIYLDDNENGIRDAGEDTEVTATAALDPNENYWVVVQVTSPAGASNGDAC
FT                   DTDLTATSQFDGTVYDMGTFTYVVQDAELTVNKTVSPSGGVDPGTVLTYAIEGSNTGTA
FT                   TAENVIVTDPIPANTTYVANSIRVGPSGGTYGTATPQTDLADNGQVGGDTADYNISNPG
FT                   KVTVFWGDAPAGDSGIIYFQVKVNANVQAGVHIENTADIDYEVGGVSQPTDNSTKAQNT
FT                   VDSQPDVSITTDQSLSGDPSDEMVYPIEVCNYGNSADVIDLTVQSSQGWTWTLWLDLDL
FT                   DGMVEDDGDYILTDTDGDGKVDTGSLAVGACRTILALVTIPAGSADQSQDTTLITVASS
FT                   VDPTVTDSVTLITTVTAPVLNITKTVNPTGTQNPGTVLVYTITATNTGTGAATEVSVTD
FT                   QIPTYTTFVAGSIHTGSTVASLAARSDAIDGDGAGYSQGVNSVVAPDGGTLSLGQNGQW
FT                   IVRFSVTID"
FT   sig_peptide     complement(109419..109493)
FT                   /locus_tag="Dalk_0073"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005768_SP"
FT   gene            complement(109919..110155)
FT                   /locus_tag="Dalk_0074"
FT   CDS_pept        complement(109919..110155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0074"
FT                   /product="hypothetical protein Dalk_0074"
FT                   /note="IMG reference gene:2503005769"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01784"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKG9"
FT                   /protein_id="ACL01784.1"
FT                   /translation="MERLSYGERKALTALQSYGRIIWRRIEGAVHSEEGAPRMGGFSVE
FT                   DMESLVNQGFAKRTQVAPNLVFRVTGPGMGAEL"
FT   gene            110553..111557
FT                   /locus_tag="Dalk_0075"
FT   CDS_pept        110553..111557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0075"
FT                   /product="PpiC-type peptidyl-prolyl cis-trans isomerase"
FT                   /note="PFAM: PpiC-type peptidyl-prolyl cis-trans isomerase;
FT                   KEGG: sfu:Sfum_0568 PpiC-type peptidyl-prolyl cis-trans
FT                   isomerase; IMG reference gene:2503005770; PFAM: PPIC-type
FT                   PPIASE domain; InterPro:Peptidyl-prolyl cis-trans
FT                   isomerase, PpiC-type; InterPro:Peptidyl-prolyl cis-trans
FT                   isomerase, PpiC-type, conserved site; InterPro:Trigger
FT                   factor, C-terminal, bacterial"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01785"
FT                   /db_xref="GOA:B8FKH0"
FT                   /db_xref="InterPro:IPR000297"
FT                   /db_xref="InterPro:IPR023058"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH0"
FT                   /protein_id="ACL01785.1"
FT                   /translation="MIGFFKGTAILCVSLCFLCASLPAACADDLTEDYSRVVLRVNGMD
FT                   FHKWEMNLAEILTQDHMFREGAFFRPSEIPAFRQAMMESTIWAMLIYQEARAAGEKADP
FT                   AKVDEFIWSFQKRFPSLEAYEKGLEALHVTSEQFRRIAERYVMTQDYLDRKFDPLSKVS
FT                   EAEAREYYDGHRENFYQEEMVRASHILVEFKEEDGDRADEKALITAKRIVRKLKKGENF
FT                   AAAAREYSDCESKKRGGDLGYIQKGDLPKAQLKPLEEVVFGMEVGEISEPVESVFGYHI
FT                   LYVEDKKPRTLLGFDEIKDKLIAKMTEDRKAAMILDHGTKLKETARIERLEEP"
FT   sig_peptide     110553..110633
FT                   /locus_tag="Dalk_0075"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005770_SP"
FT   gene            complement(111642..112340)
FT                   /locus_tag="Dalk_0076"
FT   CDS_pept        complement(111642..112340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0076"
FT                   /product="RCC1 repeat domain protein"
FT                   /note="KEGG: mxa:MXAN_0889 RCC1 repeat domain protein; IMG
FT                   reference gene:2503005771; PFAM: Regulator of chromosome
FT                   condensation (RCC1) repeat; InterPro:Regulator of
FT                   chromosome condensation, RCC1; InterPro:Regulator of
FT                   chromosome condensation/beta-lactamase-inhibitor protein
FT                   II"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01786"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH1"
FT                   /protein_id="ACL01786.1"
FT                   /translation="MNSHSRRFGFLLIFIMLPMILLIQGKALSAAPMVAAGDGHTLALK
FT                   ADGRVWAWGGNEHGQLGDGSREDRTLPVMIPGLTEITAIAAGHGRSVALEKNGTVWFWG
FT                   YLPDAHMEKSIAKTFESPVRVEGLDHVIAIASGRRHSAALKDDGTVWTWYAVPPCPFEC
FT                   KYPIILEPLQIQGLQGIARIFFSGWRLIAIDKDGGVFEWRCDGDGEGKTDCPAKAVPGP
FT                   DGQGSFNIMK"
FT   sig_peptide     complement(112254..112340)
FT                   /locus_tag="Dalk_0076"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005771_SP"
FT   gene            complement(112558..112839)
FT                   /locus_tag="Dalk_0077"
FT   CDS_pept        complement(112558..112839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_06343 hypothetical protein; IMG
FT                   reference gene:2503005772"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01787"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH2"
FT                   /protein_id="ACL01787.1"
FT                   /translation="MSKLMQIKDLVQNLVDKGATTVEEIHKAVADMPFDALKKIDPGAG
FT                   ATESAREFHHQTVGGVYNLIRKINQEVGNFAEEILEGVDQTRDDSENY"
FT   gene            113125..113334
FT                   /locus_tag="Dalk_0078"
FT   CDS_pept        113125..113334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0078"
FT                   /product="hypothetical protein Dalk_0078"
FT                   /note="IMG reference gene:2503005773"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01788"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH3"
FT                   /protein_id="ACL01788.1"
FT                   /translation="MAVKRLDDKDASKTAILRVTVPKRLLNEIRETKKKCKEKGFSFDI
FT                   KPDVARAIENAISEAKKVLAEEGD"
FT   gene            113542..114213
FT                   /locus_tag="Dalk_0079"
FT   CDS_pept        113542..114213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0079"
FT                   /product="hypothetical protein Dalk_0079"
FT                   /note="KEGG: sru:SRU_2865 hypothetical protein; IMG
FT                   reference gene:2503005774"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01789"
FT                   /db_xref="GOA:B8FKH4"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH4"
FT                   /protein_id="ACL01789.1"
FT                   /translation="MKKIGIVMLLVLAMVLACGAMAAGETEQNAQQNLAVQTAGQGGDA
FT                   DASEKGSVVKVNADWEQMGNVLALFLVLSLIFETAMTPIFNWTYFARFCEGKGVKTPLV
FT                   IILAYAIFSKYNLDIIANSVQAFTTYEGTFWGGKVLSAMLIAGGSDGIFRIFTKLGIRN
FT                   PQERKDKSESVRLQAEAAKAAQAAEEARTAEAAKGGAQAPKPAAPSPAAGASQGGDIVQ
FT                   P"
FT   sig_peptide     113542..113607
FT                   /locus_tag="Dalk_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005774_SP"
FT   gene            complement(114332..118561)
FT                   /locus_tag="Dalk_0080"
FT   CDS_pept        complement(114332..118561)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0080"
FT                   /product="conserved repeat domain protein"
FT                   /note="TIGRFAM: conserved repeat domain protein; PFAM:
FT                   protein of unknown function DUF1566; KEGG: sus:Acid_3175
FT                   hypothetical protein; IMG reference gene:2503005775; PFAM:
FT                   Beta-propeller repeat; Protein of unknown function
FT                   (DUF1566); Domain of unknown function DUF11; TIGRFAM:
FT                   conserved repeat domain; InterPro:Beta-propeller;
FT                   InterPro:Domain of unknown function DUF11;
FT                   InterPro:PapD-like; InterPro:Protein of unknown function
FT                   DUF1566; InterPro:Quinoprotein amine dehydrogenase, beta
FT                   chain-like; InterPro:Six-bladed beta-propeller, TolB-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01790"
FT                   /db_xref="InterPro:IPR001434"
FT                   /db_xref="InterPro:IPR010620"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011460"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH5"
FT                   /protein_id="ACL01790.1"
FT                   /translation="MCANSSLLPGKRMKNCVRLSSRLFWAAFLLTCIFPVFDPLAAQVA
FT                   PDPPAQSKWANAAVRRLPMTFEPNAGQAQGQVRFIARCPGAVLYFYDNAVDFCVEGGNG
FT                   ASGDRGGNTSGIRRTDRIRMRLDGARPSPQIEAVGRLPGKANYFTGKNPAQWKTGIPTY
FT                   RKVKYHSVYPGIDLVFYGNPRMLEYDFIVRPGTDPSQIRIAFEGAKADKATPNGALELS
FT                   APGGLRVLQHKPVIYQEDGGLRQPVEGGYEKLGPGLYGFELASYDAARPLVIDPALQFS
FT                   SYIGGTDEDIINADRVDGIAVDADGGVYIGGITTASDFPVISQISGAVYSSPVTKKYDA
FT                   WVAKVHRSGAFLEWSTLLGGSGQDKVNALALNSNGDVVVVGRASSNFPEMSPLFSEGEF
FT                   FAAQISGDGASLMFSTRFGGSDGGEASAIAVDSNDNICITGHTTAEDFPVTAGAYQSAL
FT                   NVDEAQFADDAFVLKINPQAGMLLYSSYLGGSKTDWGRGVAVDGSGCIYVAGETMSTDF
FT                   PTASAYQGAHGGGSYDGFVAKLTANGSALEYSTYLGSDETGSGSASERCTAIALDSSNR
FT                   AYVTGVTTSTSFPTLNAVQSACGGGADAFVTEFSASGNELVFSTYLGGANTDYGYALTL
FT                   DASGYIYVAGQTSSDGADGDAFPLVDAIQPSYALGGDPNNNWWDGFVSIYTPGGAALDF
FT                   STYLGGNNWDSLAAIAVDALGDVYVGGNTTSQTYPVLGAITFPGGAFPTQDSLQGTYDG
FT                   IVAKISLGAPVFSDMELSLEEEADPVKVGQTLTYTFTVENKGPDLATNATLTGELSGIF
FT                   DSVVLTPSSGTCSGGESFNCDLGDIDPASTATVTLTATPARIGTGGVEAFAFSDSGESN
FT                   TDNNYVSEETDFTPASDLIPDPTFMVFPATETGGRSKLQTFTITNSASVNRSIGQVNFS
FT                   GANAGEFIIDSDACSGETLSPGAQCSIVAALAPINSGDKEALLNIPSDDPAFPVVEIPV
FT                   SGEGFVLGPPTIVLRKTGQTTSYATGDDGDLQKGMDWPDPRFQDNGDGTVTDLLTGLMW
FT                   LKHSTCSAAIGIGTFYYGELTWQQALDFVAGINDGTYDISACGGYTADYTDWRLPNANE
FT                   MKTLFCGEPTMSGSDLLTSWGFIPWYSPIGGEQRWWTSTSDASYYSTAALYGAVRLYPI
FT                   KNRAKDPGPYSTSYTQAWPVRDAGVTPVCAVARTGQTKCFDAANTEISCLGSGQDGELN
FT                   SGVAPPSPRFIDHKDGTVTDFMTHLMWLQNASSQGERTWTSALARIQELNASSYLGYTD
FT                   WRLPNSEEMASLLDHSNSDPTLPSDHPFSNVQRKYWTSTAYTAAWRLRLNMREGDFYGE
FT                   DPSEYNYVWPVRGGAKDFYLVDAVAVLQILTLQETSMTSRIKDINDDGVIDLAEAIYIM
FT                   QSLLEMR"
FT   sig_peptide     complement(118430..118561)
FT                   /locus_tag="Dalk_0080"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005775_SP"
FT   gene            119231..119644
FT                   /locus_tag="Dalk_0081"
FT   CDS_pept        119231..119644
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0081"
FT                   /product="hypothetical protein Dalk_0081"
FT                   /note="IMG reference gene:2503005776"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01791"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH6"
FT                   /protein_id="ACL01791.1"
FT                   /translation="MKLDYFIVLVAPDAESLVGRHQFFQAMVQSGRLNDIVRLRTGQKS
FT                   IQGNLSLARTAQEAVETIDRNYKYTEDAVQIVCADYRVNPAQGDFGSDLTGRNIQNGLD
FT                   LTDYLRWNFVGKKNGLCGFRRGRGPFAPSILPQ"
FT   gene            119619..120590
FT                   /locus_tag="Dalk_0082"
FT   CDS_pept        119619..120590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0082"
FT                   /product="hypothetical protein Dalk_0082"
FT                   /note="IMG reference gene:2503005777; InterPro:Acyl-CoA
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01792"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH7"
FT                   /protein_id="ACL01792.1"
FT                   /translation="MPLQSFRNKGAYDAIPEPLNTDIVLSSFDRLLEAIFSKQVHAKQV
FT                   VQSVFTARIIDNYQDFLASCRLSYGVYDHLHYLNQHNRLRIDLDKFSPYSIPFGVFERT
FT                   GAGDVLVGTTRLIFRERQEPFASYIDALLDHDNPPLEDHPGLTLADYVRQPLRAFSPMA
FT                   ESVDLSHLLTEWDAGGVQYAESSRNVVHPDYRGFGVSRLVMASSLTYACHSGLDLLIGQ
FT                   SDVNHVPMYQKYGVTPIPGMSLYMEQTVRNITAALIIDFRTPLAGPAEYMIKKVYRDKW
FT                   DKDGFLCLCPNRACTAKGAPYIAKKTHECPMENEQLKTEGRN"
FT   gene            120593..122425
FT                   /locus_tag="Dalk_0083"
FT   CDS_pept        120593..122425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0083"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: tvo:TVN0581 Fe-S oxidoreductase;
FT                   IMG reference gene:2503005778; PFAM: Radical SAM
FT                   superfamily; B12 binding domain; InterPro:Cobalamin
FT                   (vitamin B12)-binding; InterPro:Elongator protein
FT                   3/MiaB/NifB; InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01793"
FT                   /db_xref="GOA:B8FKH8"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH8"
FT                   /protein_id="ACL01793.1"
FT                   /translation="MKQAKIYLWNSMMGQVYSASDSFLDNGLAYLQAACEAKGMDVELD
FT                   DPANMDFMTGFVQSIPGVRSLSAKLSLLAPRVFRSNPDAGDMRSWYALQEEASQIIAGK
FT                   MEGYLLDLALKIQKGRYHILGIKTWLGKRHIYSERLAALVQEHAPETIIISGGPQMNQF
FT                   QEDCLTDNQFDLGVYSEGEKALVRVAEIAADKRAQGWKKGQILSFIASMADRDLIPNLV
FT                   YRKDGAILKTSAKFASLDDLPLPLYSCGEGKVNVGVVVDDLGCYYKKGCAFCAHKTSLG
FT                   GYRPRKIIRTMAEIEHLITQDIGLFRFSSSATPANKGYKIALKALSRGVNMEFSMFTRG
FT                   EHSAIKRYPELVHKYQVMAKAGLRAVFLGVEAANQRVLDEIVEKGNTVDDLFYTVAAIK
FT                   EASMLEKTHVDVGLSFIHPVPLPKGLGAEEIMHDNLEFLQKLEERNCRVDSVLVTPAGP
FT                   LPGARWFEEQVRYGFDLPEDFLPTYMRYNFELGKDPKTWPDIGINLNGRSFKEMLEEAG
FT                   RFSQILADKGYAVNLTDEHCLCARACGFEGHEGLLEFKQKSDQAILCLDYAFLNKMAGI
FT                   INKHSRLIARKNAFHPLNMRSAGLEAQKRKAVHG"
FT   gene            complement(122588..124936)
FT                   /locus_tag="Dalk_0084"
FT   CDS_pept        complement(122588..124936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0084"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: dol:Dole_3268 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; IMG reference gene:2503005779;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; Response regulator receiver domain; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:CheY-like superfamily; InterPro:PAC motif;
FT                   InterPro:PAS; InterPro:PAS fold; InterPro:PAS fold-4;
FT                   InterPro:PAS-associated, C-terminal; InterPro:Signal
FT                   transduction histidine kinase, core; InterPro:Signal
FT                   transduction histidine kinase, homodimeric; InterPro:Signal
FT                   transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01794"
FT                   /db_xref="GOA:B8FKH9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKH9"
FT                   /protein_id="ACL01794.1"
FT                   /translation="MQAKPSYEDLEKTVLKLQRQLSSSANILDETGRMAKIGGWEFDLE
FT                   TGKTAWTRSLYDILEFDGSEPISPLEHMHFYSEDGRLALESAIAECLETGKPFDLEVNR
FT                   KTWRGREIWCRLTGEAVFEEGEPKKVRGTFQDITSRKQAEIDLRSSEQKYHDYISHAPY
FT                   GVFVTNEQGEYLEVNGEACRQTGYSEEELLSMSILSLVPPESHEEGKAHFQKIDKNGKA
FT                   YGEFPLIRKDGEVRWWSVFATKLSETRFLGYTNDITDRRIMEQELRRRENLISRVFDIL
FT                   PVGLWFTDKKGQLLRGNPMGQKIWGGEPTVGQEEYGVFKARKLPSGEEVAPDDWALAKT
FT                   VNQGVTILDEMLEIEAFDGEKRVILNYTAPVLDHKGEVEAAVVVNLDITQRQKAEEEKQ
FT                   RLQRQLLQAQKMESVGRLAGGVAHDFNNMLGVIVGHAEMALDATAMDSEIREDLTEILD
FT                   AAKRSANLTRQLLGFARKQTARPIVMNINEAVNSMLKMLRRLIGENIELYWNPSPDVWP
FT                   VEMDPSQVDQILANLAVNVKDAIQGIGRMTIATYKVCITNMKSPESADFTPGDYVVLEV
FT                   GDNGKGMDEETMHMIFEPFFTTKGVGEGTGLGLATVYGIVRQNKGFIKVESELGQGTVF
FT                   RIYLPRSQKAEAALRKASPTPAPGTETILVVEDEKAILNMCAAILKRNGYQVLASSSPH
FT                   EALEIVRQWDGPLDLVITDVVMPEMNGSAMKSKLEGIRPGLKHLFMSGYTSNVIAHHGV
FT                   LDRGVLYIQKPFSVNDFLSKTRKVLDSKI"
FT   gene            complement(125138..126793)
FT                   /locus_tag="Dalk_0085"
FT   CDS_pept        complement(125138..126793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0085"
FT                   /product="Pyrrolo-quinoline quinone"
FT                   /note="PFAM: Pyrrolo-quinoline quinone; KEGG: mac:MA1904
FT                   hypothetical protein; IMG reference gene:2503005780;
FT                   InterPro:WD40/YVTN repeat-like-containing domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01795"
FT                   /db_xref="GOA:B8FKI0"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI0"
FT                   /protein_id="ACL01795.1"
FT                   /translation="MDKGGAIAAYARGVFMNRWVFPIWTAWAVFLYMHGVLILCCTKTV
FT                   TSLLAVVLLFTPVMLFEWRATKKYTDLHPRSQGSATSGRRRFYYWLCNVVMWAMFYGIF
FT                   VVYILIKLRATPGFKVYWSFFLVNNFLMWRSVMGWAWVALAYWMVMYYLLAVRAGRFRL
FT                   ICAVFLPLAITTIIFIVQWKIGGAGAASDETILSQAGVVKIMDVGEVSQALLRDYPDNL
FT                   AYLTPLKTGFKTRGEIKASNKVREVFYDEALNAVFAFYGGTYYAYGSTTIPAIVKKDLG
FT                   TGEISYLLTEHNVRRVEMTGDSMFVAPWHDNHLYEISKKDLSIVRSIPVGGYVTPMLWE
FT                   PMDMALDVNGKALYIATSMYPSIAVVDLEANRQVKVMPLYEPGTLSEGGWAWCISQSRE
FT                   TRLLYMVVATWQGRDISEIDPDSLKILRTQQWDLFSLTSMALTPEEDALYCQSNVWDGL
FT                   TKVRVKDFAIERVYEGERHARYLSLDPKRNVIYVLGYCSGKVFSIDLESGKRLWEIRVG
FT                   GRPHGMHLDSQDRLWIHSMSGVFRIDLPSVWKDK"
FT   gene            complement(126813..128303)
FT                   /locus_tag="Dalk_0086"
FT   CDS_pept        complement(126813..128303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0086"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: dol:Dole_2407 radical SAM domain-containing protein;
FT                   IMG reference gene:2503005781; PFAM: Radical SAM
FT                   superfamily; B12 binding domain; InterPro:Cobalamin
FT                   (vitamin B12)-binding; InterPro:Elongator protein
FT                   3/MiaB/NifB; InterPro:Methylthiotransferase;
FT                   InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01796"
FT                   /db_xref="GOA:B8FKI1"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI1"
FT                   /protein_id="ACL01796.1"
FT                   /translation="MSRVLLIKAMRKAVLETGDSVAPPLGLLCLAAYAKKVRPGKDQFT
FT                   ILDERIHPRIQEEWIAYIKELRPDCIGLSAMSADAGRVGVLIPFLKDNFPNIPVVLGGP
FT                   LASSVGPELMRQVPADYLVMGEGEKAFVSLLEMFEQGLSHPGREVSGLAFSDPDGKTVC
FT                   WPKNKDLIDIKSIPFPAYDLIDLKKYQYQPRMTPMSTKEPYAYIMTSRGCPYHCIYCHD
FT                   IFSKKFRPMDALQVVNEIERLITDFGIHEFEIIDDVFNLNRKRVLAICSEIKRRGLKTA
FT                   FTFPNGLRSDILDREVLEALASVGTYHIDVAVESASPRIQKLAQKNINLEKLEENAVIA
FT                   SELGIFCWGLFMLGFPTETRREILKTLFWAWKSPMHGAFFFIVIPQEGTELARKYCNKK
FT                   PGDSKVGSSLYFNVKDSLTHVSATELRMYQSLAYILFLCSPRRLWAIYRHISNNGRRIS
FT                   GTIFRFLDYLLLQKTKNLAKQVWGAAAGRFGQGAGQKI"
FT   gene            complement(128334..129212)
FT                   /locus_tag="Dalk_0087"
FT   CDS_pept        complement(128334..129212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0087"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG: rpd:RPD_4322
FT                   radical SAM family protein; IMG reference gene:2503005782;
FT                   PFAM: Radical SAM superfamily; InterPro:Elongator protein
FT                   3/MiaB/NifB; InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01797"
FT                   /db_xref="GOA:B8FKI2"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI2"
FT                   /protein_id="ACL01797.1"
FT                   /translation="MSAPLFGATAMISLTYQCQCQCPHCGSRTNQQKNRPELSKSQIID
FT                   LIKQCSKAGTANLYLFGGEPLLHPNLDDFVRTAKGLGMRVSMDTNGYLLDSDRVKSLAA
FT                   LGVDHVRVSIDHARPRLHDAFRGVEGLHARAVQGVRLCLENGVRCDVSAVATKKNLADG
FT                   NLQAVLDLAGGLGARVRMLTSIMCGGWEGKKRVVLSRDEIAQMRNLLKPGRVYWESDWI
FT                   NHPQAVFSCAALDRLMFHVTAFGDVQPCCYMEERFGAVTNEPLSDIVLRMWRSDLTRSY
FT                   KRFHDCPVNRP"
FT   gene            complement(129389..130873)
FT                   /locus_tag="Dalk_0088"
FT   CDS_pept        complement(129389..130873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0088"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: dol:Dole_2407 radical SAM domain-containing protein;
FT                   IMG reference gene:2503005783; PFAM: Radical SAM
FT                   superfamily; B12 binding domain; InterPro:Cobalamin
FT                   (vitamin B12)-binding; InterPro:Elongator protein
FT                   3/MiaB/NifB; InterPro:Methylthiotransferase;
FT                   InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01798"
FT                   /db_xref="GOA:B8FKI3"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI3"
FT                   /protein_id="ACL01798.1"
FT                   /translation="MANILLIKNRKREYTDHYLATSPPLGVLYLAAYAREQRPGKDVFT
FT                   MVDERVYAKTSREWEAYLKDLQPEVIGFSSMSIEQDQVDYLLPVFKRALPRAKIVIGGP
FT                   LASSSGARLLDDANIDYVVKGEGEIPFTQLLEALDGNEDYPFDQIAGLAFRDDSGKIID
FT                   NPPSKNRADLDALPYPAYDLINLQDYVGRDRMTPVRTTQLYAPLFTSRGCPYHCIYCHD
FT                   IFSGKFRAMSAMRVVDEIEHMINAYGVHEFEVYDDIFNLDKQRVKDISAEIKKRGLETY
FT                   FTFPNGVRGDILDRETLEALKDMGTVHMAFAVETASPRIQKVLRKNINLKKIRENIAIA
FT                   ADLKIFTWGFLMMGLPKESRWELWKTIWFATSSKLHGAYFFPVVPFEGTELAQKYEEAI
FT                   ESHGEKRLWDYFLPEGALGAVGPRELSIMHSLAYFIFFFNPWRVYLIYTSGVAPFRRLV
FT                   SLAFGIVRYIVADKILYTIKAKARKIFKFRITPRTA"
FT   gene            complement(132215..133183)
FT                   /locus_tag="Dalk_0089"
FT   CDS_pept        complement(132215..133183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0089"
FT                   /product="hypothetical protein Dalk_0089"
FT                   /note="IMG reference gene:2503005784"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01799"
FT                   /db_xref="GOA:B8FKI4"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI4"
FT                   /protein_id="ACL01799.1"
FT                   /translation="MAINAKAKRLALMYWPLAVALIFLALAAAGPLEKAYRAVMRPMAE
FT                   YNDSFLETSVRDTAQLMIPIGLAKGAADIIEGTTLQFEAGVVFANAGTEMEVGDALQPV
FT                   LDYLNLAWRILILSIIFSTVTKSVLQGCYPVAHILMIVSLSGFSLWFLIRPWLKKTNAW
FT                   AVSVERISKMTLLAAIVFLLVLPSSVYLAANLSQAATAPLEASLFSSFEEAGRHFDVSE
FT                   FHRIDKITDKAKFLYDKSLELMQYSLTATKDIALSVARLFVIKLLNGVVFPLGALAFLL
FT                   WLLRGVLYPALGLTQTGLAREDFRNLKLWTQSEKDEERSTS"
FT   sig_peptide     complement(133103..133183)
FT                   /locus_tag="Dalk_0089"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005784_SP"
FT   gene            133892..134788
FT                   /locus_tag="Dalk_0090"
FT   CDS_pept        133892..134788
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0090"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dol:Dole_0365 radical SAM
FT                   domain-containing protein; IMG reference gene:2503005785;
FT                   PFAM: Radical SAM superfamily; InterPro:Aldolase-type TIM
FT                   barrel; InterPro:Elongator protein 3/MiaB/NifB;
FT                   InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01800"
FT                   /db_xref="GOA:B8FKI5"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI5"
FT                   /protein_id="ACL01800.1"
FT                   /translation="MSEKEIPNGFHYVGNCIRPPSEANSILLQATLGCSHSKCTFCGAY
FT                   KDKRFAIKDRKHLESDLRFARHYCKRQDRVFVMDGDAFIMPMKHWKWLLGEIRDKLPWV
FT                   RRTTCYANLKSIMLKSDEDLKWLYDNGLKAVFLGLESGHAQVRKDIRKGGTPEELIHHC
FT                   KRLRKSGIKLVSIVLLGLGQTHLSMEHARETGRALSEIDPEAVSALSLMPLRNTPLGEA
FT                   YEKGEFDMPDPLGIIRELRELVEHTNLSRGSFRSVHASNYLPIDAKFPRDKEAVLATLD
FT                   QALAGNVQLKPEWMRGL"
FT   gene            134792..135967
FT                   /locus_tag="Dalk_0091"
FT   CDS_pept        134792..135967
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0091"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   mem:Memar_0422 major facilitator transporter; IMG reference
FT                   gene:2503005786; PFAM: Major Facilitator Superfamily;
FT                   InterPro:Major facilitator superfamily; InterPro:Major
FT                   facilitator superfamily MFS-1; InterPro:Major facilitator
FT                   superfamily, general substrate transporter; InterPro:Sugar
FT                   transporter, conserved site; InterPro:Tetracycline
FT                   resistance protein, TetA"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01801"
FT                   /db_xref="GOA:B8FKI6"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI6"
FT                   /protein_id="ACL01801.1"
FT                   /translation="MAKSSSGILVLLSVSVGVSMIGLGIIWPLIPVYAVELGAGGFMVG
FT                   LIIASFNLSKAAFGPFMGRFSDSLGRKKFITVGLIAYTCMSVMYVLAGSAETLIAVRIF
FT                   HGMASVMVVPIAMALAADIAPKHELGLYMGTLNMAVMLGLGAGPVLGGALRDHFGMDSA
FT                   FIAMGLLALITCILVVIVIPSDAETRSFKENQARSSVGQIVRHRIALGIIFMRFLAASG
FT                   QGAVYTFLPLLGLKMDMSSSQVGILLSANIFLIAFLQRFSGRLADRVNPKYLVIFGTFL
FT                   AGFAVLGMPMVKGFFLVLVLNIVMGAANGLALPGGLVITAQLGRTMGMASLMSITDAAW
FT                   SLGMIVSPILSGIILDVYGLPYVFLMGSALILTGGAAVSLFLRTYDPAKEY"
FT   sig_peptide     134792..134893
FT                   /locus_tag="Dalk_0091"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005786_SP"
FT   gene            136635..140879
FT                   /locus_tag="Dalk_0092"
FT   CDS_pept        136635..140879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0092"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: rpb:RPB_2413 response regulator
FT                   PleD; IMG reference gene:2503005787; PFAM: GGDEF domain;
FT                   TIGRFAM: diguanylate cyclase (GGDEF) domain;
FT                   InterPro:Adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   InterPro:Armadillo-like helical; InterPro:Armadillo-type
FT                   fold; InterPro:Diguanylate cyclase, predicted; InterPro:PBS
FT                   lyase HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01802"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI7"
FT                   /protein_id="ACL01802.1"
FT                   /translation="MEELADLVFFLENSGKDPTSMIFDDELTGLRNRRFIKNHLEFRVQ
FT                   WGDLKARPTSMVFVDIDNLDQINDALGRDLGTAVLKHLAELVKQAAPEGSTPVRYGADE
FT                   FVILLPEEPKKTAVTIGRKLISAVHGAPYISEDATLEIPFTISVSITTAPEDAESDKTF
FT                   VERALTALKMAKDLGGDRAINAAEISPENEAAESMLHKDAAKNAGRKSQLAQVSQALKR
FT                   FGKRESQLVLVEGGPGMGKTSFLDTINTQLSKTKVARIRLAGVTQELFRPYYLVSNLVQ
FT                   ELLYRRKDKGGEILANLDPVALCALSSAFVPSGDMRIHTRQAPDVDLGDVAQKREHVFN
FT                   AMASIIPKLIENKPLIVLVDDLHMVDEASLLIFKHLIAQKSLPLFLCGSGPDSLQADGE
FT                   HGPLWRFVQSVIEMAPLETIHLTPLSPQEIEAHFNKLYPGVRLPEQLCEDIAQVSQGNP
FT                   LFFNGIMFKLVFDEKIRRADGHWVVDPIEEDYLPRSMDEIISQKVASLDQESQALLDRA
FT                   SAFGDRVTLSLLTGSSEMDEAAVLDFLDNAAAQGLVSATFHMNDENIRFLGNQVRQVIY
FT                   GKIGQEEKERLHENIGDYQEELYKKRLMPSPAILAYHYQRSANLEKAKLYEQIQAQQNE
FT                   MIFNPDEAESYSGRTPEWDDDAQAPDQPLAPEHYPLAAKVIRALLIAIRNTKLYPTGSD
FT                   LTANAVNKFKEVLETVLVHTPRLTIVLEKDVIYANGDALDIPEIKTVSEAFSGFMGTMD
FT                   LKSIAFSHGATLAELVRLVEGISEVDPKNIHKRFWKEFSTENRLRRVQVKQVTYTQVSG
FT                   EEQQTSGASAKEAELGSEEQVLAAKVVKTLLSSASKLKLYPASGPVAQESIEEVMKILK
FT                   VFLDKHEVMTLAGVDQSLLLNGNKVDARVFDKLTPFMLKFLESACLKSVTFYQKASKQE
FT                   LTVFLANVGKQPQDGTADEFWANVGMENKLSTIYFNISVYDVLADQIALQAAGEGQGGQ
FT                   EEEEEVEEPLELESDEGDLEMPPESEEQDISLEPSVENIRDLFLKGNEKGVARVLEVLF
FT                   YKYSEKEEGRREQVLETCRELLNAPELSPEPRFAPLLVDPLLAVLPAESDAQLLENMAS
FT                   LLYDTAANFVRIGEYSLATWIFGHFARRREAMEMEDPEGIIPEALTRQPEGDMALTLMA
FT                   DVASGEGFRQQSAFALIGGMGDSGVRLLLNIIKDNDDVRTRQIAASQLEKIGYQAVEKL
FT                   KQELVNENSGKRKARIVEVIDTATTDLKTELTFLLADSNTSVRKAGFALAERLNAPYVV
FT                   NILSNLLDDERPEIAKEAVVCLGKTAAPGSAGIIVKQMDVNKAPELLEACCQALGRLAD
FT                   PEAIVPLSKILSYKKTLFSKKEYAASVRAAAAFALAGIPHKLAKGALAAYADDPEPRVR
FT                   EAAQKVMGVSQD"
FT   gene            141020..142345
FT                   /locus_tag="Dalk_0093"
FT   CDS_pept        141020..142345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0093"
FT                   /product="hypothetical protein Dalk_0093"
FT                   /note="KEGG: ade:Adeh_2722 hypothetical protein; IMG
FT                   reference gene:2503005788"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01803"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI8"
FT                   /protein_id="ACL01803.1"
FT                   /translation="MNLKGNFEPASLASILQLLSNEERTGTLHLTNGENEVKIFVLNGG
FT                   VISAAGSQKQTRLGDLLRKNGMISANDLTYCLTASQQKKQALGSVLVQRGFITEEMLRE
FT                   TIHKQAEEVIFDLFSWKTGYFEYHDSNLVPQGALDTKIDIMNIIMEAMYRIDEMCYFVK
FT                   QIPTEDLVFKVKPEIMKNEEKNFKPHERRFISLINGSKTVRQLINTSGFDDFSAYHLLH
FT                   TLLTLEAIEKAGKETVYESQEEGDYSGLIIFYTELLLIIYDNIHSELSEWVDAMFREAG
FT                   VNREEKEAIGRLLDTAPNRWTYNIVENCKPQMMKQKLSIFAGYHPHNTLAENSEALNQV
FT                   LKPIKNREKGGVFLRKSFNQFITNLLNTVVATFGPRSTRKMLLEINNILVHGNENPPHF
FT                   PEKLNAIKEMLDLLIRMAQEGKNQGDPKKNSLGIFALFNQKN"
FT   gene            complement(142876..144957)
FT                   /locus_tag="Dalk_0094"
FT   CDS_pept        complement(142876..144957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0094"
FT                   /product="Protein with methyl-accepting chemotaxis protein
FT                   (MCP) signaling domain"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   pca:Pcar_1336 putative methyl-accepting chemotaxis protein
FT                   (MCP); IMG reference gene:2503005789; PFAM:
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain;
FT                   InterPro:Chemotaxis methyl-accepting receptor;
FT                   InterPro:Chemotaxis methyl-accepting receptor, signalling"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01804"
FT                   /db_xref="GOA:B8FKI9"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033462"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKI9"
FT                   /protein_id="ACL01804.1"
FT                   /translation="MSRRMNLGAKVMGLASAAVLITCLVMMGLLAWQGKQMQAKMKGQM
FT                   DGMARQQVANIVQGLYRMAINQDEAIRRSMESNLRIAQKMVQDMGGINMGRATVDWEIT
FT                   NQFTKEKSTISLPTMLAGDLWLGKNTKFTAPSPLVDDITDLTHVTCTIFQRIPETGDML
FT                   RVSTTVKKLDGQRAIGTYIPNMHNGEPNKVIETVMQGETFFGRAFVVNAWYLTAYQPIT
FT                   SDAGEIVGILYVGAPEDEMLESIKGAIASTSVGKTGYSWVLAGTGKEAGLYVVSKDRKS
FT                   DGKNILGVKDSDGNYFVKKVIDKSLKANPGEINFESVPWKNPGEEKTRVKIQAFTYYPP
FT                   WDWVIGAGAYEEDFMEAQQEVDNTIKRLLTILGGASLGIILLALLASFLLAKGISNPVQ
FT                   EIVKGLNEGLGFVACASDQVASSSQSLANGATEQAASVETTSAALVEMSSMTKQNAQNA
FT                   GQADGLMKEMESVFTEANQAMEGLTRSMAEITSASDETFKIVKTIDEIAFQTNLLALNA
FT                   AVEAARAGEAGAGFAVVANEVRNLASRAAEAARNTALLIEGTVRKIEQGSGLVTETNDS
FT                   FGLVAGRASKVAQLVSEIAEASHEQADGIEQINHAIAEMEKVTQQNTGSAEESASASEE
FT                   LKSQSQRMQQLVAKLLTMITGENSAQAAVGKRAANASGGGGRIRLPKTDGKQIPYSGD"
FT   sig_peptide     complement(144865..144957)
FT                   /locus_tag="Dalk_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005789_SP"
FT   gene            complement(145293..145838)
FT                   /locus_tag="Dalk_0095"
FT   CDS_pept        complement(145293..145838)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0095"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_0547 hypothetical protein; IMG
FT                   reference gene:2503005790"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01805"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ0"
FT                   /protein_id="ACL01805.1"
FT                   /translation="MKESLTHFSKEQIFTVGDAAAMAEELVSNSYKMSASQWLWHRYDV
FT                   KTLADLAPGEIVEGPFAQIVRYRGQKSETSLGSSSYDFYKICLMDHTILSALESDRDLR
FT                   LFPFALYILCHELIHIVRFAKFLQSFHASQEEKMAEENRVHQKTREVLNSVRVPGKEAL
FT                   FAFYKAWEAPMDAAIASQ"
FT   gene            complement(146218..146418)
FT                   /locus_tag="Dalk_0096"
FT   CDS_pept        complement(146218..146418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0096"
FT                   /product="hypothetical protein Dalk_0096"
FT                   /note="IMG reference gene:2503005791"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01806"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ1"
FT                   /protein_id="ACL01806.1"
FT                   /translation="MQKIVIVSSQPDKDNPLLVAMLNVLFPECEIQVTNGAAESEFDGI
FT                   ASEPIEFDLRAGRDETSNVEC"
FT   gene            147016..147807
FT                   /locus_tag="Dalk_0097"
FT   CDS_pept        147016..147807
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: abu:Abu_1545 hypothetical protein; IMG
FT                   reference gene:2503005792"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01807"
FT                   /db_xref="InterPro:IPR025245"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ2"
FT                   /protein_id="ACL01807.1"
FT                   /translation="MRKSIVYVLAVLACIIFAAGVMSPAMAGWADAIKGVVKSATDDSS
FT                   EETAETTSTASDSGLSETEMNSGIKEALHQAVTTAIASLGQENGFLSNDLVKIPVPDKL
FT                   AQAESILRKLGQDELVDNFVESMNRAAEKAVPKTTEILGGAVTSMTLTEAAEILQGEDD
FT                   AATQYFETKTRDQLFAEIEPVVQEATDSARVTSYYKAMMDKATASMPLLQSYSPDLDQY
FT                   VTEKALDGLFVIMAQEEKKIRENPAARTTELLEKVWGYFGN"
FT   sig_peptide     147016..147096
FT                   /locus_tag="Dalk_0097"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005792_SP"
FT   gene            complement(147937..148746)
FT                   /locus_tag="Dalk_0098"
FT   CDS_pept        complement(147937..148746)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0098"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: mac:MA2730
FT                   hypothetical protein; IMG reference gene:2503005793; PFAM:
FT                   Methyltransferase domain; InterPro:Methyltransferase type
FT                   11"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01808"
FT                   /db_xref="GOA:B8FKJ3"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ3"
FT                   /protein_id="ACL01808.1"
FT                   /translation="MTENLYVHGYSEREKERLEDQANTLTELLHHDTVYPPGSRVLEAG
FT                   CGVGAQTVTLAAKSPDAQITSIDISAESLAAAQARIIQAGFTNVAFQQANIFDLPFETE
FT                   SFDHLFLCFVLEHLPNPDEALDALQKMIKPGGTITVIEGDHGSTYFHPQNSYAAQCVQC
FT                   LVYLQAQMGGDSQIGRRLFPLLKEAGFQDVQVSPRMVYVDSSKPDLVEGFTKNTFTAMV
FT                   EGVREKALEQGLMDPRAWEQGIRGLYRAAEEDGVFCYTFFKGMGVKE"
FT   gene            complement(148772..149314)
FT                   /locus_tag="Dalk_0099"
FT   CDS_pept        complement(148772..149314)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1538 hypothetical protein; IMG
FT                   reference gene:2503005794"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01809"
FT                   /db_xref="InterPro:IPR029464"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ4"
FT                   /protein_id="ACL01809.1"
FT                   /translation="MADEHHYVFGETEDFLTGEVLTDTHDERYRQKIARILVEEKGYAK
FT                   EDVRPRLDLMAQAGENRRQLMVDFAVSVDGKTAMIIRYAPGSLITRHRPCIAAARLLEP
FT                   YQVPFVVVTNGEDAQVLDVKTGKVIAEGLDSIPDKAALEELAGDAAFDPIDDKRREMES
FT                   RIIYTYEAVGACNCDIC"
FT   gene            complement(149393..150103)
FT                   /locus_tag="Dalk_0100"
FT   CDS_pept        complement(149393..150103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0100"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: dol:Dole_1922
FT                   phosphoglycerate mutase; IMG reference gene:2503005795;
FT                   PFAM: Phosphoglycerate mutase family; InterPro:Histidine
FT                   phosphatase superfamily, clade-1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01810"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ5"
FT                   /protein_id="ACL01810.1"
FT                   /translation="MSVIYLIRHGQASFGEDNYDKLSDLGVRQSQIVAQRLAEHGVKFD
FT                   SVITGTLQRQIHTAQALYDAYEKKGLELPERKTMPEFNEYPSDEVLMGYLPRLEAKEPS
FT                   LAEHFDKIYTDRRSFQLVFEKAMQTWASGQDDVPGITPWLEFTATVNKGLDAIMASHGS
FT                   GTNVAVFSSGGPISVALQRTMHLSHERTMEVSWQVMNASITRLKFSGNRINLYAFNQFG
FT                   HLEAVKDKTVLTYR"
FT   gene            complement(150201..150815)
FT                   /locus_tag="Dalk_0101"
FT   CDS_pept        complement(150201..150815)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0101"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   dps:DP1072 hypothetical protein; IMG reference
FT                   gene:2503005796; PFAM: NADPH-dependent FMN reductase;
FT                   InterPro:NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01811"
FT                   /db_xref="GOA:B8FKJ6"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ6"
FT                   /protein_id="ACL01811.1"
FT                   /translation="MTAHPQAKILLVGGSPRPNGNTDALLQSAAQGAEARGVPCTIVHL
FT                   RDYQFSPCVGCEKCRKDKACTKLMDGMQLLYPLIEECRGIILASPTHHYNITAWMKAFI
FT                   DRLYCYYDFTNDRPRGWSSRLAGQGRCAAVMAVCEQEDIRDMGFTLEAMEMPLQALLGC
FT                   GMTARVSALLHFSKGAVKKDQQAMDAAFEAGKAVARQAASG"
FT   gene            complement(150925..151965)
FT                   /locus_tag="Dalk_0102"
FT   CDS_pept        complement(150925..151965)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0102"
FT                   /product="Putative TRAP-type C4-dicarboxylate transport
FT                   system, DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: dol:Dole_3157 TRAP dicarboxylate transporter-DctP
FT                   subunit; IMG reference gene:2503005797; PFAM: Bacterial
FT                   extracellular solute-binding protein, family 7;
FT                   InterPro:Extracellular solute-binding protein, family 7,
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01812"
FT                   /db_xref="GOA:B8FKJ7"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ7"
FT                   /protein_id="ACL01812.1"
FT                   /translation="MHFVKTAVLTALVAGLSFLTPFNYACAGDSPTPPKRYKLATIAPK
FT                   GVGWAVHYENLVLPAVRELAGDDFDVKVFWGGAMGDDEEILNKMRKGFLQGAGLSGQGA
FT                   TQACPAMSVVELPFLFENYDEVDYVKEKMTPLFEELFRQNGFYLFAWCDQDFDIIISKG
FT                   VSFTRLEDFKDVRFMTWYGPLEEKLLTNLGADLVPLDIPEIAPAAQAGKYEAAIGPAAF
FT                   VLGAQMHNVVRNINPCKIRYSPSVDLLTNAAWDAVPQATKESYFKQREALMKKFNAKVR
FT                   EDNERSLQALYTYGMKKDEFSPSELRRIKAATRHIGADLAGKLYSQALLDELLQHLEDY
FT                   RAAHAE"
FT   sig_peptide     complement(151885..151965)
FT                   /locus_tag="Dalk_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005797_SP"
FT   gene            152319..152984
FT                   /locus_tag="Dalk_0103"
FT   CDS_pept        152319..152984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0103"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: hmo:HM1_0226
FT                   TetR family transcriptional regulator; IMG reference
FT                   gene:2503005798; PFAM: Bacterial regulatory proteins, tetR
FT                   family; InterPro:Homeodomain-like; InterPro:Tetracycline
FT                   transcriptional regulator, TetR-like, C-terminal;
FT                   InterPro:Tetracycline transcriptional regulator,
FT                   TetR-related, C-terminal; InterPro:Transcription regulator,
FT                   TetR-like, DNA-binding, bacterial/archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01813"
FT                   /db_xref="GOA:B8FKJ8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ8"
FT                   /protein_id="ACL01813.1"
FT                   /translation="MAGKSRKKQIRGEYTRISLLEAATELFAAHGFEGASVKQITERAG
FT                   ASVGSFYHHFNDKADLFTQVLDNGSMTLRRYFRKVRNLPPDVSLEERTHQAITALVDFA
FT                   TEHRSLWVWLLLETDKLPQPIRKIVKKDQELYLRDQAQDLEAAVRLGRLKPLDAKLGAQ
FT                   AVFGMCVHMLSVYLNDPNPDRDAYVDSITKATVGILRAMAGSRQPAYTEPGEKALKAG"
FT   gene            153014..154516
FT                   /locus_tag="Dalk_0104"
FT   CDS_pept        153014..154516
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0104"
FT                   /product="Acetyl-CoA acetyltransferase (thiolase II-like)"
FT                   /note="Catalyzes the synthesis of acetoacetyl coenzyme A
FT                   from two molecules of acetyl coenzyme A. It can also act as
FT                   a thiolase, catalyzing the reverse reaction and generating
FT                   two-carbon units from the four-carbon product of fatty acid
FT                   oxidation; IMG reference gene:2503005799;
FT                   InterPro:Thiolase-like; InterPro:Thiolase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01814"
FT                   /db_xref="GOA:B8FKJ9"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR040771"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKJ9"
FT                   /protein_id="ACL01814.1"
FT                   /translation="MPHVPVIVGISQLTQFPELEKPLDPMRLMADAARAALADAGPPAL
FT                   ASLVDCVWVSNILSWGYKDAPGLLSANLGLKPSHNHYGIMSGHVPQWFVNQAARRIASG
FT                   QSRAVLMAGAEAQHSVKQSYKDAVKLNWPARENPEIIGDGASPDLGTNSLENSHQLMIP
FT                   VNMYALFETAIRAAKGREPKEHQAFLGRLFEKFSAAAAKNPLAWNRRKYTAEEIATPGP
FT                   DNPAACEPYTRRMCAAMNVDMAAAVVMNSEETAKKMGVNSSQLVYPMGGADLNNIRYVT
FT                   QRPKLNDSPALDHCIKRALDQAGLGVSQIRAFDLYSCFPSMVEIAMEALGLDPEDPRPL
FT                   TVTGGLPFFGGPMGNYSMHAIAEATAQIRTGKLDNVMVAANGGFNTRHSVGVYGREPSP
FT                   KGWSRDDSAIQESILSAALPEPVKEAAGRLVVDGCIVRNTREGVPEKGLVLGTLEDGRK
FT                   TLAVLDVEPALLGQFCNKELVGGAGAVRFDSNSGCNMFVPEL"
FT   gene            154537..155688
FT                   /locus_tag="Dalk_0105"
FT   CDS_pept        154537..155688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0105"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   dol:Dole_0933 2-nitropropane dioxygenase NPD; IMG reference
FT                   gene:2503005800; PFAM: 2-nitropropane dioxygenase;
FT                   InterPro:2-nitropropane dioxygenase, NPD;
FT                   InterPro:Aldolase-type TIM barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01815"
FT                   /db_xref="GOA:B8FKK0"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK0"
FT                   /protein_id="ACL01815.1"
FT                   /translation="MAKRVLRTPLCDMLNIDYPILSAGMGPTLIGEPNGAPVELVVAVS
FT                   EAGGLGVLGGAGFTLDGLQEAIREIKAQTGKPFGVDLLLPKNLPGGTMTGGKENLTLAQ
FT                   VIEFLPKEHLDWFRKVEKEMGFPALEDLMVNNDTTTMNPKEAVAICIEERVPLFAAGLG
FT                   DPGWMVDEAHAKGMKVLGVVGNAKNAGRVSKSGVDLIAAQGHEGGGHTGRVGTFALLPQ
FT                   ALDAAYPVPVLAAGGVGDGRGLAAALAMGCIGVWVGTRFLATNEGGAMDLCKQRIVEST
FT                   DEGTRVSKLYTGKTSRANVTRFHELWDSSGLEALPFPFQVLLASALLGGLIRSGHDDHV
FT                   GGFAGQVSGLIHEIKPAAKVVEDMVEQAADILSSKLPSTVKTA"
FT   gene            155809..157629
FT                   /locus_tag="Dalk_0106"
FT   CDS_pept        155809..157629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0106"
FT                   /product="Acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   dol:Dole_1305 acyl-CoA dehydrogenase domain-containing
FT                   protein; IMG reference gene:2503005801; PFAM: Acyl-CoA
FT                   dehydrogenase N terminal; Acyl-CoA dehydrogenase,
FT                   C-terminal domain; Acyl-CoA dehydrogenase, middle domain;
FT                   Acyl-CoA dehydrogenase, N-terminal domain;
FT                   InterPro:Acyl-CoA dehydrogenase, N-terminal;
FT                   InterPro:Acyl-CoA dehydrogenase, N-terminal, bacteria;
FT                   InterPro:Acyl-CoA dehydrogenase/oxidase; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase C-terminal; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase, N-terminal; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, central domain; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, type 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01816"
FT                   /db_xref="GOA:B8FKK1"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK1"
FT                   /protein_id="ACL01816.1"
FT                   /translation="MAQQLVDRRDLDFVLWEQLDCEGEILKKYDAYKEFNKKTCDMILN
FT                   EAKALAVKELLPTMQEGDRQGVRYENNEVKVPDSFHRPHELLLEGEWQNLGVEPEMGGQ
FT                   GAPAFISSATAEMFMAASWACYSYATMGNGTSDMIEKYGTQEQKDLYIPKITTGEWGGT
FT                   MLLTEPDAGTDVGALTTTAVKNDDGTYSLTGNKIFITNGEHDLCENIIHPVLARIEGDP
FT                   AGTKGISIFIVPKYFVNPDGSLGDRNDILCTGVEHKHGIKASATCQMSMGSKGKCIGFL
FT                   LGKEREGMKVMFNMMNGARMATGLQALAYASASYLDALNYARDRIQGRSIDDMANHGAP
FT                   PVAIINHPDVRRNLLWMKSYVCGFRSFFQYSSMLATKAAMAEDEEERKLNNGLYELMTP
FT                   LIKAYLSDLGYEVCVQGIQVYGGVGFCQDFLAEQYARDCKITSIYEGTSGIQSMDLLGR
FT                   KLGMEKGKVFMAFMGEVGKTIAKAKGQEALKGLAEDLEAALNRLGETAMHLGKTAVSPD
FT                   FKAAFAHSLPFLYVMGDVIMAWMLLWRASVAVEKLAGKVKKKDEAFYTGQVKTAEFFIQ
FT                   SLLPITHGKMNAIFNTCKAAIEMPDDGYGI"
FT   gene            158122..161565
FT                   /locus_tag="Dalk_0107"
FT   CDS_pept        158122..161565
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0107"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: cpc:Cpar_0784 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; IMG reference gene:2503005802;
FT                   PFAM: Response regulator receiver domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:CheY-like superfamily; InterPro:PAC motif;
FT                   InterPro:PAS; InterPro:PAS fold; InterPro:PAS fold-4;
FT                   InterPro:PAS-associated, C-terminal; InterPro:Signal
FT                   transduction histidine kinase, core; InterPro:Signal
FT                   transduction histidine kinase, homodimeric; InterPro:Signal
FT                   transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01817"
FT                   /db_xref="GOA:B8FKK2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK2"
FT                   /protein_id="ACL01817.1"
FT                   /translation="MSCKPSYEELEQQVLSLQRDNSQLREEERRCRSLMDEAPGLICTF
FT                   LPDGEIVYVNQPYCAYFKKDFDELAGTSFLLLLPEPDRDAVLKNIHALTRENPTMPHEH
FT                   QVVAADGSVRWQRWTNRAFFNSNGEAEMYQAVGEDVTERKLAAQAILKERKKFEDVLEK
FT                   FPYGVCVVDENRRIEFVNKKIREEFGEPGDLLCHQYFKDMPGLCPACRTGAAFQEEFCK
FT                   MEWRSQGKDRHYEVYDIPLKNENGSKSRVQIFNDITEQKKAESALQESEAKYRALVENA
FT                   GEAIYIVQNGVIRFVNAKAGDFTGVDPQGMLARDMTDFIHPEDLALVTERHAQRLRGEA
FT                   PPSSYSFRLLHESGHVRWVELSVTPIEWEGKPATLNFLRDISDRKKAENEIIEREKRFR
FT                   ATLDNMLEGCQIIGFDWSYIYLNDAAAKHGRMNKQDMTGKSMLDLYPGIEQTEIFALMQ
FT                   DGMINRVSHQVENVFYYGNGSNRWFELSIQPVPEGIFVLSIDVTERKWAEHSFKESESR
FT                   FRTLFEQAPIGIIMVAPNGFPIRSNKALRELVGYTEKEICARSFLEWTHPDERKASQRL
FT                   IKSIAAGEETLKIMEKRYLHKNGDMVWGRTAVTAVRNSAGAVEYFIAMVEDIRESKMAE
FT                   QVLQDSENRYRSLFMHSPDAVFTALDGKVFLVNQACLNLFGAKKDEDIVGKPILDLVAP
FT                   EFRSLAAKRRDILDAEGRPLPLVEMQMLRMDGKPVDVEVLTSAFSMGAAMATHVILRDI
FT                   SARKNMEKEKEQLQEQLSMSQKLESIGRLAGGVAHDLNNLLSPIIGFGEILSDDIGPDD
FT                   PKREAVEEILGAGLRARNLVRQLLAFSRKQTLEFKPLDISKTLGAFKNLLRRTIPEDIE
FT                   IRVISSQKVLPVMADAGQIEQVIMNLAVNAADAMPNGGVLTLETGMADLDADYAKLHSE
FT                   VQPGRYAALVISDTGQGMDQAARERAFEPFFSTKGKHGTGLGLATVYGIVKQHGGSIWL
FT                   YSEEGQGATFKIYLPVAEESPPAGGPEKKAVITLDGDETILLVEDNENVLHLAGTILKR
FT                   RGYKTLAAKGSAEALKIIQSSTEPIHLLLTDVVMPEMNGRDLYNKALEMLPALKVLYMS
FT                   GYTDNVIAHRGVLDEGGQFIQKPFSGKGLAQKVRKILNEK"
FT   gene            161749..162276
FT                   /locus_tag="Dalk_0108"
FT   CDS_pept        161749..162276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0108"
FT                   /product="hypothetical protein Dalk_0108"
FT                   /note="IMG reference gene:2503005803"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01818"
FT                   /db_xref="GOA:B8FKK3"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK3"
FT                   /protein_id="ACL01818.1"
FT                   /translation="MSLKILSFIIIVLAVALIAACAFILRLRRPLSARLGSMGGIFDFG
FT                   AKVRGVYPPFVEGMCGAYYMRFRFVPGKRFKEIVSAKIEIPVDSQVVWTFTPDDIENGD
FT                   PQAFGASLDSFKALANMEGFEAIHMEKELLTAIFSAETAGGEQELQNVPAMRQRVVAMG
FT                   KLARKLGCMAKL"
FT   sig_peptide     161749..161814
FT                   /locus_tag="Dalk_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005803_SP"
FT   gene            162539..162739
FT                   /locus_tag="Dalk_0109"
FT   CDS_pept        162539..162739
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0109"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; KEGG: pde:Pden_2267
FT                   30S ribosomal protein S21; IMG reference gene:2503005804;
FT                   PFAM: Ribosomal protein S21; TIGRFAM: ribosomal protein
FT                   S21; InterPro:Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01819"
FT                   /db_xref="GOA:B8FKK4"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK4"
FT                   /protein_id="ACL01819.1"
FT                   /translation="MQVTVQDNQLERAVKVLKKMLRKEGVLTQLKEKRFYEKPSVKKRR
FT                   KRAKAAKRRRRIELRANQRRR"
FT   gene            162841..163356
FT                   /locus_tag="Dalk_0110"
FT   CDS_pept        162841..163356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0110"
FT                   /product="hypothetical protein Dalk_0110"
FT                   /note="IMG reference gene:2503005805"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01820"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK5"
FT                   /protein_id="ACL01820.1"
FT                   /translation="MAMNTVWRDYQVPSDIIAPGALSTAKSVSLTETKDLRKKDPCHVM
FT                   QKIRQGGGPSIGAYMSDRPVAEILHQAASQALEIAGNAKSPGRAELNLTLKIQSLDFNV
FT                   MVGFAQGMLKGVIQAQAVFTDPASGKVVWEGICEGAGRTGTGDLVKSAFTSALTDFIQN
FT                   LSACPGFK"
FT   gene            complement(163381..163866)
FT                   /locus_tag="Dalk_0111"
FT   CDS_pept        complement(163381..163866)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0111"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Bacterio-opsin
FT                   activator HTH domain protein; KEGG: sat:SYN_01028 LuxR
FT                   family regulatory protein; IMG reference gene:2503005806;
FT                   PFAM: Bacterial regulatory proteins, luxR family;
FT                   InterPro:Signal transduction response regulator, C-terminal
FT                   effector; InterPro:Transcription regulator LuxR,
FT                   C-terminal; InterPro:Winged helix-turn-helix transcription
FT                   repressor DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01821"
FT                   /db_xref="GOA:B8FKK6"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK6"
FT                   /protein_id="ACL01821.1"
FT                   /translation="MADKPTVASLEKKIRELEIRNGELEETNKALRTLIEQTRMASQDF
FT                   QQRVVANVEDLVMVYVARLQDTDLDVDQSIFVNVIEQNLSEIVAPFMRRIGSQHANLTP
FT                   REIEVANLVRMGVKSKDIAKLLKISKRAVEFHRDSLRKKLGLKKTKKNLRAYLASLG"
FT   gene            complement(164230..165000)
FT                   /locus_tag="Dalk_0112"
FT   CDS_pept        complement(164230..165000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0112"
FT                   /product="1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate
FT                   (AIR) carboxylase"
FT                   /note="PFAM:
FT                   1-(5-phosphoribosyl)-5-amino-4-imidazole-carboxylate (AIR)
FT                   carboxylase; KEGG: dol:Dole_0969 hypothetical protein; IMG
FT                   reference gene:2503005807; PFAM: AIR carboxylase;
FT                   InterPro:Phosphoribosylaminoimidazole carboxylase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01822"
FT                   /db_xref="GOA:B8FKK7"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK7"
FT                   /protein_id="ACL01822.1"
FT                   /translation="MNPDFLKKILDGVAAGDTPVEQAMDKLRHFSHEDLGFAHVDHHRG
FT                   LRKGFPEVIFGLGKTAEQICGIMEKMAAQDDVILVTRVDREKAHAVLKAFPEAEYHAQP
FT                   RMIMHAPNPIREKGRGEIVALSAGTSDIPVAMEAVLTARAMGNRVRTIFDVGVAGLHRL
FT                   YAHREILDQASVLVVVAGMEGALPSVVAGLVPRPVIAVPTSVGYGTSFGGLTALLSMLN
FT                   SCASNVAVVNIDNGFGAGYMASMINMDMEREIAK"
FT   gene            165293..166582
FT                   /locus_tag="Dalk_0113"
FT   CDS_pept        165293..166582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0113"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: sru:SRU_2052
FT                   hypothetical protein; IMG reference gene:2503005808"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01823"
FT                   /db_xref="GOA:B8FKK8"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR014555"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK8"
FT                   /protein_id="ACL01823.1"
FT                   /translation="MHEFHNFKGFKEARIDLFKPLTVLIGPNGSGKSNLIEGVELLSFL
FT                   GRGGRIHDITDIGRGNRGLEIRGGLQACPKYFSDRFYLTFSLNYPINNVFGTKCIYGIG
FT                   LQTKPEPRVFIERLFFEDGEAIFRADAKKEFSQSSDILVEYNTFTGEENQPKTPVSNSR
FT                   SILSQYESFAKNNTKYNACGEIVSFIMQYLKQSFVFDPRPKLMRTYERISNSILTRDGS
FT                   NLSAVLFRLDNGSQEEKQSLERLLGWIRHLPGEPYTGFKFVTTELDDVIFGLKIGDDGQ
FT                   FMDARVLSDGTLRCLSVLTALETAEPGSRVVIEEFDNGLHPSRVHILLQAMKSCCERRK
FT                   LNVLVTTHNPATLNALDDDQMQGVVFCYWDKESKSSKLVSFKDLPRHDVLMESGRLGDL
FT                   VTRQVVDQYFAKDFEEKYKEKALSWLENLP"
FT   gene            166579..167073
FT                   /locus_tag="Dalk_0114"
FT   CDS_pept        166579..167073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0114"
FT                   /product="hypothetical protein Dalk_0114"
FT                   /note="KEGG: sru:SRU_2051 hypothetical protein; IMG
FT                   reference gene:2503005809"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01824"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKK9"
FT                   /protein_id="ACL01824.1"
FT                   /translation="MSVIAYVVDTNYLCELFKVGGKCSYAGHAEVKSRFKKGVQAKARF
FT                   YVPLPCIFELGNHIAQISKGDSRKKIAKALCAVVKTSIEGNGPWIIKPSEDIHNTISRL
FT                   CDVFSQDFVQQQIGLTDSFAISEASHLKKKYKNDYKVHIWTTDSSLKSREPDKEPNPYT
FT                   G"
FT   gene            167080..167817
FT                   /locus_tag="Dalk_0115"
FT   CDS_pept        167080..167817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0115"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number="2.7.7.38"
FT                   /note="KEGG: dol:Dole_0968 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase; IMG reference gene:2503005810; PFAM:
FT                   Cytidylyltransferase; TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; InterPro:3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; InterPro:Acylneuraminate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01825"
FT                   /db_xref="GOA:B8FKL0"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FKL0"
FT                   /protein_id="ACL01825.1"
FT                   /translation="MKVVVIIPARYGSTRFEAKPLALIAGKPMIQRVYERAAAASSVTG
FT                   VAVATDDERIVSAVEKFGGKAVMTSDACRSGTDRVFEAGRTLGLTGSDIVVNVQGDQPV
FT                   FDPECIDEVTAPLIGDPGTGMTTLAFAIVNEREMTDPKDVKMVFDQDGWALYFSRATIP
FT                   HDRDGNMEFDTYKHLGVYAYTMDFLAEFCSLPEGHLEKIEKLEQLRALEYGLGIKTVVT
FT                   AYDSPEVDLPEDIARIEALLKDQ"
FT   gene            complement(167884..168933)
FT                   /locus_tag="Dalk_0116"
FT   CDS_pept        complement(167884..168933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0116"
FT                   /product="hypothetical protein Dalk_0116"
FT                   /note="KEGG: mxa:MXAN_2991 adventurous gliding motility
FT                   protein AglZ; IMG reference gene:2503005811"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01826"
FT                   /db_xref="GOA:B8FKL1"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL1"
FT                   /protein_id="ACL01826.1"
FT                   /translation="MPFETGFGQDDGLGKEEKEFEDIYGEELTIERFQKMERRITVQWV
FT                   ILLALVVALASFMAVNFTQRLTTIADKGDVKVEGLSKDVNQKVEALMKELDGAEDELQE
FT                   KIASVSKQAGEVQGLLDQATKSIQASKVDRSEVQNLLKEEREYTDKAVHDARVKTDNFK
FT                   AAVLATMDEEIKKLEKGLKDDDAAQAKKTAALAKSIETTKREMEDQEDALTTFRTDLGA
FT                   FSEDVFAVKKDSAKTAADIKTLKDDVQALRKEQEAVLSATKSEMEKSVERKLESMEKRL
FT                   AALEVMLKASSGAAPAASAAKPATTTPPAAPGAAKSTTEEKPATPAPPRTVPVPLPGDG
FT                   DFMEQDLGN"
FT   gene            complement(168950..170479)
FT                   /locus_tag="Dalk_0117"
FT   CDS_pept        complement(168950..170479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0117"
FT                   /product="GMP synthase, large subunit"
FT                   /note="contains glutamine-hydrolyzing domain and glutamine
FT                   amidotransferase; GMP-binding domain; functions to produce
FT                   GMP from XMP in the IMP pathway; IMG reference
FT                   gene:2503005812; PFAM: Glutamine amidotransferase class-I;
FT                   GMP synthase C terminal domain; NAD synthase; TIGRFAM: GMP
FT                   synthase (glutamine-hydrolyzing), C-terminal domain or B
FT                   subunit; GMP synthase (glutamine-hydrolyzing), N-terminal
FT                   domain or A subunit; InterPro:Anthranilate synthase
FT                   component II/delta crystallin; InterPro:Carbamoyl-phosphate
FT                   synthase, GATase domain; InterPro:Glutamine
FT                   amidotransferase class-I, C-terminal; InterPro:Glutamine
FT                   amidotransferase superfamily; InterPro:Glutamine
FT                   amidotransferase type 1; InterPro:GMP synthase, C-terminal;
FT                   InterPro:GMP synthase, N-terminal; InterPro:NAD/GMP
FT                   synthase; InterPro:Rossmann-like alpha/beta/alpha sandwich
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01827"
FT                   /db_xref="GOA:B8FKL2"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL2"
FT                   /protein_id="ACL01827.1"
FT                   /translation="MIIIIDFGSQYNQLIARRVREHKVFCQIEPPTLTVEKVKSLAPDG
FT                   IILSGGPASIYSENSPKIDPELLNLGIPVLGICYGLQFMVHTQGGKVERADKREYGLAM
FT                   FHPKEAAGLFEGVPEATECWMSHGDSIKELPEGFVITGSTDNTKVAAIAHKKKKLFGLQ
FT                   FHPEVTHTPKGKRMLKNFLFNVCDCKRNWTMKSFVKEAVDEIKEAAGDDKVILGLSGGV
FT                   DSSVAAVLIHKAIGKNLYPIFVDNGLLRKGEADRLKEVFTQNLNMKVRYAKASRKFLSG
FT                   LKGVTDPEKKRKIIGKVFMDVFEEEAKKIKGAKFLAQGTLYPDIIESVSAFGGPSAVIK
FT                   SHHNVGGLPKKMKLKLIEPLKYLFKDEVRLLGEELGLPGDMVWRQPFPGPGLAIRVIGE
FT                   VTAKRLSILREVDALIIEEIRKNDYYRKLWQSFGVLLPIKSVGVMGDQRTYENIIAIRA
FT                   VTSTDAMTADWARLPHDMLAVMSNRIINEINGVNRVVYDISSKPPSTIEWE"
FT   gene            170728..171492
FT                   /locus_tag="Dalk_0118"
FT   CDS_pept        170728..171492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0118"
FT                   /product="N-(5'phosphoribosyl)anthranilate isomerase
FT                   (PRAI)"
FT                   /note="KEGG: dol:Dole_2359 N-(5'phosphoribosyl)anthranilate
FT                   isomerase (PRAI); IMG reference gene:2503005813; PFAM:
FT                   N-(5'phosphoribosyl)anthranilate (PRA) isomerase;
FT                   InterPro:Aldolase-type TIM barrel;
FT                   InterPro:N-(5'phosphoribosyl)anthranilate isomerase (PRAI);
FT                   InterPro:Ribulose-phosphate binding barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01828"
FT                   /db_xref="GOA:B8FKL3"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL3"
FT                   /protein_id="ACL01828.1"
FT                   /translation="MTTVQIYEIQEAEEAREMARLGVDTVGSVLTSREIWKQDALVEAM
FT                   AAAREEGLVVSLIPLFSEAELVLEVLGFYKPDLAHFCDTLTDSQGVPLDLAPMIDLQKK
FT                   VRSAFPKIKIMRSIPIARPGRGHVVPTLKLARELEPVSDIFLTDTWLGDGQDNDPTDPV
FT                   QGYIGITGLICDWDIAADLVKQSGVPVILAGGISPENAYEGVLRVRPAGVDSCTQTNAV
FT                   DENGAPIRFKKDPAKVKTLVEETARADRKITG"
FT   gene            171663..172007
FT                   /locus_tag="Dalk_0119"
FT   CDS_pept        171663..172007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0119"
FT                   /product="hypothetical protein Dalk_0119"
FT                   /note="IMG reference gene:2503005814"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01829"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL4"
FT                   /protein_id="ACL01829.1"
FT                   /translation="MNCIDGIEGVLRCILSEFQERYVAGTLDDSDFIPNLRVVIDGAAR
FT                   FLEQNEELGIAPAILKKVMHQACKEWWLEFVKNQQDAAAAEDKDTPSGDSLEYLEHYFD
FT                   HIFYHGVYPD"
FT   gene            172036..172218
FT                   /locus_tag="Dalk_0120"
FT   CDS_pept        172036..172218
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0120"
FT                   /product="hypothetical protein Dalk_0120"
FT                   /note="IMG reference gene:2503005815"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01830"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL5"
FT                   /protein_id="ACL01830.1"
FT                   /translation="MQDKELEDLEIKAEIDEIMESVNQVVQRLEKHGLLNKKEDKSSET
FT                   EGRSIPGAGAGTVGE"
FT   gene            172230..172517
FT                   /locus_tag="Dalk_0121"
FT   CDS_pept        172230..172517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0121"
FT                   /product="histone family protein DNA-binding protein"
FT                   /note="PFAM: histone family protein DNA-binding protein;
FT                   KEGG: sfu:Sfum_0002 histone family protein DNA-binding
FT                   protein; IMG reference gene:2503005816; PFAM: Bacterial
FT                   DNA-binding protein; InterPro:Histone-like bacterial
FT                   DNA-binding protein; InterPro:Histone-like DNA-binding
FT                   protein, conserved site; InterPro:IHF-like DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01831"
FT                   /db_xref="GOA:B8FKL6"
FT                   /db_xref="InterPro:IPR000119"
FT                   /db_xref="InterPro:IPR005684"
FT                   /db_xref="InterPro:IPR010992"
FT                   /db_xref="InterPro:IPR020816"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL6"
FT                   /protein_id="ACL01831.1"
FT                   /translation="MALTKCDIVEKIYDMGFTKKESVDVVEQLIEIIKDSLQEGDDVLI
FT                   SGFGKFCIKQKDQRRGRNPATGKDLMLRERKVVTFKCSGKLRDLINDSQE"
FT   gene            complement(172868..173341)
FT                   /locus_tag="Dalk_0122"
FT   CDS_pept        complement(172868..173341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0122"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: dol:Dole_0159 UspA
FT                   domain-containing protein; IMG reference gene:2503005817;
FT                   PFAM: Universal stress protein family;
FT                   InterPro:Rossmann-like alpha/beta/alpha sandwich fold;
FT                   InterPro:Universal stress protein A; InterPro:UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01832"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL7"
FT                   /protein_id="ACL01832.1"
FT                   /translation="MANSILIALDDSENAQKALEYVANNMNPSATVVIITILPKVSTAC
FT                   GMDSPSLTPLFNKNSQVFCTMEDVKRERMKEYVGEAEKRLVAAGFSPDNLKSRVEEQRS
FT                   GVARDILQEIKEGKYDTVVLGRRGLSGVKEFFSGSVTTKVLQGATGVTVIVVD"
FT   gene            173828..174268
FT                   /locus_tag="Dalk_0123"
FT   CDS_pept        173828..174268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0123"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: gur:Gura_2933 UspA
FT                   domain-containing protein; IMG reference gene:2503005818;
FT                   PFAM: Universal stress protein family;
FT                   InterPro:Rossmann-like alpha/beta/alpha sandwich fold;
FT                   InterPro:Universal stress protein A; InterPro:UspA"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01833"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL8"
FT                   /protein_id="ACL01833.1"
FT                   /translation="MNIKNILFPTDFSSTSVSALPWVYSLTEKYGAQVHFFHVVEKLGQ
FT                   SGFGYVPAPTLSSWKDQIFESAEKTFERFCHEQMDQCPNFIKAMKIGNPVEEIIAYAND
FT                   NDIDLIVIPSRARKGMDRLLMGSVAEKLVRSSSVPVLVVNPG"
FT   gene            complement(174376..175188)
FT                   /locus_tag="Dalk_0124"
FT   CDS_pept        complement(174376..175188)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0124"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   tte:TTE0544 3-hydroxybutyryl-CoA dehydratase; IMG reference
FT                   gene:2503005819; PFAM: Enoyl-CoA hydratase/isomerase
FT                   family; InterPro:Crotonase, core; InterPro:Enoyl-CoA
FT                   hydratase/isomerase, conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01834"
FT                   /db_xref="GOA:B8FKL9"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKL9"
FT                   /protein_id="ACL01834.1"
FT                   /translation="MDYKYFDVSIEKNIAFCTFNNPPRHTITADGVFEFQRLLADLEAM
FT                   DELMVFMLTGGNERFFIAHYEVGELASMSEDRQKKTEKPADKPKKLYPFNRLNLALEQS
FT                   RLITIAAMNGQAHGGGLEIALSCDFRLAGKGKHTYGLPETNVGIIPGAGGTQRLARLLG
FT                   VAKAMDLILHGKVYSAEEAYDLGVIHRLYEKETFWEEAKAFARKIGSRSPVALSLAKKA
FT                   IRQGVLEPDFEKALLIEQNGLDAALKSEDAGGAMSAWLKGEKYQWKGR"
FT   gene            complement(175190..177592)
FT                   /locus_tag="Dalk_0125"
FT   CDS_pept        complement(175190..177592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0125"
FT                   /product="hypothetical protein Dalk_0125"
FT                   /note="IMG reference gene:2503005820"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01835"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM0"
FT                   /protein_id="ACL01835.1"
FT                   /translation="MTQTNDITVKSDMGEISLDNSGAAIGAARVSPEKSYIGSPALLKK
FT                   VIEEDDQEAWAEIKAKIDYTYENMDKAMSALNQAEGFLQDVRARIKAGKKLLLKPNLVT
FT                   VENIEPYSHSLFNGAVANTDWAFLAAVMRWFHDKGGIRYSRMCMGEAASNSTYRSAQYT
FT                   QVKKTGRAVTPEAAYEGKCDDFYGGWGFYFVRRYLAETLPAGSDENPMLGYEESLSGEF
FT                   VAPGDAGDRLMIYDLNRLHDDPNRGRAIDLPDGECFKSIVLHKAIVGGDPSDPEDCRKY
FT                   PGCVLVNVPKLKVHSQAMFTNAIKNLGIGLYPLQANQAGCKKWMYGTPDTDIPVIKSRI
FT                   PHQVWVPELDPKQMIPVKGEDGVYKVEKTGGLTGTMLDIIRATASQDVMMMHIVDGIET
FT                   VNRDHQGVGLGQALAEGLIMASSDVAAVDLMCARYLFCNMGLKKAMEAGLDDGFGGSFP
FT                   QIQPVPKLEGKAITTGQALDNPISRDFSIAKAIEWGMGRSDYFVTGWDDVSGAPLASYG
FT                   GRLGYVSDGAFTNIHTKHMYWDIYKMPWDLQKTFFGYLDAVDELEGLSMKKEFLEAFDE
FT                   TGDGVVSYEENGKKGIFGPSLFLGGQFISYRGEKDQKNVFKGFFDLTANPLRGTDPAWS
FT                   AEGHYFNREFFWGAQAVVAMAMAFIKKDVPDQFFPGMTWGNGNWPSFAQLKYAHIHQIT
FT                   YGWKFPKRIGLFSLWGCAFGYADRYLNNSRFVGEKFGVPNPKAPHLYLDALKNGELEPL
FT                   DFVLYVPKGFGAGGMVPHVQETSDPAKVFTAEFDGGKIQWPDRPLED"
FT   gene            178226..178351
FT                   /locus_tag="Dalk_0126"
FT   CDS_pept        178226..178351
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0126"
FT                   /product="hypothetical protein Dalk_0126"
FT                   /note="IMG reference gene:2503005821"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01836"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM1"
FT                   /protein_id="ACL01836.1"
FT                   /translation="MDLSMNIITSLNPSQKDRSIFYQEVYMVFKFLVHELSRLIL"
FT   gene            complement(178434..179111)
FT                   /locus_tag="Dalk_0127"
FT   CDS_pept        complement(178434..179111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0127"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="KEGG: tye:THEYE_A0188 sensory box histidine kinase;
FT                   TIGRFAM: PAS sensor protein; PFAM: PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; IMG
FT                   reference gene:2503005822; PFAM: PAS fold; TIGRFAM: PAS
FT                   domain S-box; InterPro:PAC motif; InterPro:PAS;
FT                   InterPro:PAS fold-3; InterPro:PAS-associated, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01837"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM2"
FT                   /protein_id="ACL01837.1"
FT                   /translation="MAPKPTYSELLSTIKNLEQSVRIYRSLADNSSDLLYRTNLQGEII
FT                   FISQSVTKLSGYTVEEAIGMKMAEEVYLVPEERKEFTALLMEKGHVKNFEARLRRKDGS
FT                   VWWASTNAHFFKDEKGEVGGVEGITRDVTELKDALDSQKDLIKQLREALDNVQTLRGLL
FT                   PICSRCKKIRDDKGYWGLLESYIETHSEAKFSHGLCPECLEELYGDKEWYKKMKDKKTD
FT                   ESS"
FT   gene            179505..181274
FT                   /locus_tag="Dalk_0128"
FT   CDS_pept        179505..181274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0128"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dol:Dole_1870 beta-lactamase domain-containing protein; IMG
FT                   reference gene:2503005823; PFAM: Metallo-beta-lactamase
FT                   superfamily; InterPro:Beta-lactamase-like; InterPro:SCP2
FT                   sterol-binding domain; InterPro:Tetratricopeptide-like
FT                   helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01838"
FT                   /db_xref="GOA:B8FKM3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR029228"
FT                   /db_xref="InterPro:IPR029229"
FT                   /db_xref="InterPro:IPR036527"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR038536"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM3"
FT                   /protein_id="ACL01838.1"
FT                   /translation="MKKVLLVFVVLLLVCAGGVGLFVKLRSQPAMEKKTIANVQAAGSL
FT                   KEHTKHFERKVYKVADNIYSAVGFGLANSIMIEGDDGLIIVDTMESLQEAREVLAEFRK
FT                   ISDKPIKAIIYTHNHTDHIFGAQAFAEGGEPEVYAHENLGYYVNRLVSKMKPIIGNRSM
FT                   RMFGNFLDQEGLENDGIGPFLGIGPDRELGYIPPTQTFRDKMDVEVAGVKMELIYAPGE
FT                   TNDTIYVWLKGPRILMTGDNLYRSFPNLYTIRGTPYRSVKSWYQSVDIIRDLKPEIMVP
FT                   SHGQPIFGAEKVYSIATDYRDAIQYVHDQGIRCVNMGMTPDQIVEQVHLPPHLAASPYL
FT                   QEYYGKVSWSLRSLFDGNLGWFDGDSATLQPLSQKDNAQLMADLAGGKDKLQKEAQARF
FT                   DNGQYQAALQLTGYVIALDPQNPDARGLRSQALIKMGEREENANARHYYLTEALEIRDD
FT                   FVASTGDVKSSPEMVHRFPIEGFFELMAVGLDPVKSADLDMKVSIRFTDVGKDFTIHVR
FT                   RGVAEIQPRLLDNPDILVKVDSKIWKEMLSGLRNPVTTMAGFDYEKGGTIAFAKFMKMF
FT                   KTPAPKLAFEPAA"
FT   sig_peptide     179505..179573
FT                   /locus_tag="Dalk_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005823_SP"
FT   gene            complement(181343..182839)
FT                   /locus_tag="Dalk_0129"
FT   CDS_pept        complement(181343..182839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0129"
FT                   /product="Acetyl-CoA hydrolase"
FT                   /EC_number="3.1.2.1"
FT                   /note="KEGG: sfu:Sfum_0388 acetyl-CoA hydrolase; TIGRFAM:
FT                   succinate CoA transferase; PFAM: acetyl-CoA
FT                   hydrolase/transferase; IMG reference gene:2503005824; PFAM:
FT                   Acetyl-CoA hydrolase/transferase N-terminal domain; Citrate
FT                   lyase, alpha subunit (CitF); TIGRFAM: succinate CoA
FT                   transferases; InterPro:Acetyl-CoA hydrolase/transferase;
FT                   InterPro:Citrate lyase, alpha subunit; InterPro:Succinate
FT                   CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01839"
FT                   /db_xref="GOA:B8FKM4"
FT                   /db_xref="InterPro:IPR003702"
FT                   /db_xref="InterPro:IPR017821"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM4"
FT                   /protein_id="ACL01839.1"
FT                   /translation="MTKYGPYPVITAKEAASFIKDGQTIGFSGFGAAGGAKAVPYALAD
FT                   KAESEHRKGRPFAMRVLTGASSGLAIDEVLAQSGAISWRAPYQTGRSLRKQINNQDVEY
FT                   VDMHLSHVPQAMLFGFLGKMDAAVVEASEVTPDGRVYLTTSIGISPTMLALADKVIIEI
FT                   NTVQSPRLREMADIVILPPPPHRDPIPIAHPMSRIGVPYATVDPKKVAGVVLNSEPDTV
FT                   SEFSQPNHVSQQIAEHLVEFLVSEMKAGRIPKELLPLQAGVGNVANGVMGVLGTHPDIP
FT                   PFSMYTEVFQDSQVELMQKGRLLGASATSLNITEDALGVIVDNMDFFAKRLILRPQELS
FT                   NHPGIIRRLGVIAMNTALEMDIYGNVNSSHVYGMDIMNGIGGSGDFSRNSYLAVFMSPS
FT                   IAKDGRISSVVPMCPHIDNGEHSVQVVVTEQGLADLRGLGPLHRAKKIIENCAHPMYRD
FT                   YLFRYIENSRAGHIPHDLNKCFELHRNLMETGSMLPGLSA"
FT   gene            complement(183077..184426)
FT                   /locus_tag="Dalk_0130"
FT   CDS_pept        complement(183077..184426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0130"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="TIGRFAM: phosphoglucosamine mutase; PFAM:
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: sat:SYN_02959 phosphoglucosamine mutase;
FT                   IMG reference gene:2503005825; PFAM:
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain III; Phosphoglucomutase/phosphomannomutase,
FT                   alpha/beta/alpha domain II;
FT                   Phosphoglucomutase/phosphomannomutase, C-terminal domain;
FT                   Phosphoglucomutase/phosphomannomutase, alpha/beta/alpha
FT                   domain I; TIGRFAM: phosphoglucosamine mutase;
FT                   InterPro:Alpha-D-phosphohexomutase;
FT                   InterPro:Alpha-D-phosphohexomutase, alpha/beta/alpha domain
FT                   I; InterPro:Alpha-D-phosphohexomutase, alpha/beta/alpha
FT                   domain II; InterPro:Alpha-D-phosphohexomutase,
FT                   alpha/beta/alpha domain III;
FT                   InterPro:Alpha-D-phosphohexomutase, alpha/beta/alpha
FT                   I/II/III; InterPro:Alpha-D-phosphohexomutase, C-terminal;
FT                   InterPro:Alpha-D-phosphohexomutase, conserved site;
FT                   InterPro:Phosphoglucosamine mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01840"
FT                   /db_xref="GOA:B8FKM5"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM5"
FT                   /protein_id="ACL01840.1"
FT                   /translation="MDNKAEKLFGTDGVRGRANQHPITPEMAVKIGRAAALYFQSRKNG
FT                   AVKIGIGRDTRISGNMLESAAAAGICSAGADAMFADVIPTPGLAHVIRKFDLDAGVMIS
FT                   ASHNPFEDNGLKIFGGKGFKLSDEVENEIEALAFKDFPGGRVGKTHQIPDAQDSYAAFL
FT                   QSLLPGETPLKGLKIVLDASNGATYSIAPQVFSRLGAEIIPLFTSPDGMNINVDCGSQH
FT                   PETLQKEVIAGKAHLGLAFDGDGDRLIAVDETGARISGDQILIICGAWLKETGRLAQNT
FT                   VVSTVMSNLGFKKALDRMDIKHIAADVGDRYVLEAMQASGAVIGGEDSGHMIFLDCHTT
FT                   GDGILSGIQLIGAMLHFQKPLSELGRMMDVFPQVLINIPVTSKPDLATVKPVAAAIEKA
FT                   ENALGDQGRILVRYSGTRSVCRVMVEGPTREATQGTAQAIAEIVKQELGE"
FT   gene            complement(184482..185705)
FT                   /locus_tag="Dalk_0131"
FT   CDS_pept        complement(184482..185705)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0131"
FT                   /product="UDP-N-acetylglucosamine pyrophosphorylase"
FT                   /note="KEGG: sfu:Sfum_2914 UDP-N-acetylglucosamine
FT                   pyrophosphorylase; IMG reference gene:2503005826;
FT                   InterPro:Trimeric LpxA-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01841"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM6"
FT                   /protein_id="ACL01841.1"
FT                   /translation="MANKQIDILLNSGVAMPHPESVFVGEEVNPARISGRGVVIHPGCR
FT                   ITGASTCILDGAVLGEEAPATVQDCQIGPKVKLKGGFFQGAVFLDEASMGSCAHVRPGT
FT                   ILEEQASGAHSVGLKQTILFPFVTLGSLINFCDCLMAGGTDRKNHSEVGSSFIHFNYTP
FT                   QQDKATASMIGDVARGVMLNQPPIFLGGQGGLVGPCRIEYGNTTAAGTVWRKDVSKPGN
FT                   LLMERAAPKASMPFTPGVYRAVKRIAANNLAYTADLLALRLWYVHVRSCFYKTDLEKAL
FT                   FEGLLKACDKALDERVKRFNAFCGKLEKSNEILRKAGQGSDALFAQKTELAEKADKVSA
FT                   CLEKWKSAAQAPNGGESFITLAQTGQGAYLDFIKSLSPEQAAQGTAWLNGFIEKILEES
FT                   LAIIPSCR"
FT   gene            complement(185731..186438)
FT                   /locus_tag="Dalk_0132"
FT   CDS_pept        complement(185731..186438)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0132"
FT                   /product="protein of unknown function UPF0005"
FT                   /note="PFAM: protein of unknown function UPF0005; KEGG:
FT                   dol:Dole_1724 hypothetical protein; IMG reference
FT                   gene:2503005827; PFAM: Uncharacterised protein family
FT                   UPF0005; InterPro:Inhibitor of apoptosis-promoting
FT                   Bax1-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01842"
FT                   /db_xref="GOA:B8FKM7"
FT                   /db_xref="InterPro:IPR006214"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM7"
FT                   /protein_id="ACL01842.1"
FT                   /translation="MEPITYQSPEQVQARVNAFVASVYNWMFIGLTLTGVLAYATFQVP
FT                   ALTKLIFNTPGVFIGLIIAELALVFILSSRITTMKAGTATGMFVVYSALNGLTMSFIFA
FT                   VYAKTAIFGAFFATAGTFAACSVYGWVTKKDLTSMGGFMFMGLIGVIIASVVNIFLAST
FT                   ALYWAITYLTIAIFVGLTAYDTQKIKEMALTQPEDIGASAVRKGAIMGALHLYLDFINL
FT                   FLMMLRLFGGGRD"
FT   gene            complement(186524..188374)
FT                   /locus_tag="Dalk_0133"
FT   CDS_pept        complement(186524..188374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0133"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: sat:SYN_00192 TPR
FT                   repeat-containing protein; IMG reference gene:2503005828;
FT                   PFAM: Tetratricopeptide repeat; InterPro:Tetratricopeptide
FT                   repeat; InterPro:Tetratricopeptide repeat-containing;
FT                   InterPro:Tetratricopeptide TPR-1;
FT                   InterPro:Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01843"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8FKM8"
FT                   /protein_id="ACL01843.1"
FT                   /translation="MFNVPKGACDFKPAEQPPKKTASGKSASTSVRAGVCALVGLALLI
FT                   TPGCVRSGLTFKMQPPGQSAPARSVIPGREHQKIIIPESSGAYYNYLLSQRMLWNRNLD
FT                   AASLYLDKAIAKDPESRFLKQGLLEILVEKGNYQGALEESALLLKEDPDNVRVLLTRAA
FT                   VLLQLKKWNEASAVYEKVLKTAPEESQTYFLLAETYHKANQPEKAISVYQRFIENLPNS
FT                   PDVISAWFFIGRVAYNMGDYALAAQAFEETLLLKPDFEQVQLNLAEVYRELGNDEKVQA
FT                   IYSKMMRDAPSNTLPYLGLGQYYLSRRELEKANEVFGKLREEHPQDPLVAKGIAHSYMN
FT                   NGYFAEAAEIFSALHKQTPNDGELSYFLAYALESTGRKQEALEAYQSIPPKSSYYFQGL
FT                   IYSAYLTGKPEDAMAALEALKAVESADHLETEFVIHASNLQQQAGNKELAVKALTDRIE
FT                   EEPDNINLLYSLGVLYDKQGDKQACIETMKQVLKIEPDNADALNFLGYTYADLGQNLQE
FT                   AKKLVAKALEISPDDGYIVDSMGWVYFKLGEYEKALGYLKRAVELAPKDPVIREHLGDA
FT                   YLKTGNPEKALETYRISLQGKILRGDDPTELKEKIRALEQ"
FT   gene            complement(188431..189417)
FT                   /locus_tag="Dalk_0134"
FT   CDS_pept        complement(188431..189417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0134"
FT                   /product="putative RNA polymerase, sigma 70 family subunit"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; sigma-70 region 1.2; KEGG:
FT                   dol:Dole_2474 RNA polymerase sigma 70 family subunit; IMG
FT                   reference gene:2503005829; PFAM: Sigma-70, region 4;
FT                   Sigma-70 region 2; Sigma-70 factor, region 1.2; TIGRFAM:
FT                   RNA polymerase sigma factor, sigma-70 family; alternative
FT                   sigma factor RpoH; InterPro:RNA polymerase sigma factor,
FT                   region 2; InterPro:RNA polymerase sigma factor, region 3/4;
FT                   InterPro:RNA polymerase sigma-70; InterPro:RNA polymerase
FT                   sigma-70 factor; InterPro:RNA polymerase sigma-70 region
FT                   1.2; InterPro:RNA polymerase sigma-70 region 2;
FT                   InterPro:RNA polymerase sigma-70 region 4; InterPro:Winged
FT                   helix-turn-helix transcription repressor DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01844"
FT                   /db_xref="GOA:B8FMH7"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMH7"
FT                   /protein_id="ACL01844.1"
FT                   /translation="MTENKGDSLEEKQKKEKSAKAKPPAVVSKASKERALVSYDPLQRY
FT                   LSEISKYPLLTREEERELAVRVQEFDDPDAAYRLVTANLRLVVKIALEFQRVWMQNLLD
FT                   LIQEGNIGLMQAARKFDPYKNVKFSYYSSFWIKAYILKFIMDNWRLVKIGTTQAQRKLF
FT                   FKLKKEKQKLLEEGFDPKPKLLSEKLGVSERDIIDMDQRLNNWDLSLDAPVKDDSDSER
FT                   IEFLSTPSESAEDQVARKEMETILREKIDIFRKTLKERELEIFDERVFSDSPVTLQQIG
FT                   DRHGISRERVRQVESGVVKKLKAFLEKEIPDFSNYQGGFEPDTQGNP"
FT   gene            189676..190146
FT                   /locus_tag="Dalk_0135"
FT   CDS_pept        189676..190146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0135"
FT                   /product="Putative PTS IIA-like nitrogen-regulatory
FT                   protein"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: gka:GK1838 PTS
FT                   system, fructose-specific enzyme II, BC component; IMG
FT                   reference gene:2503005830; PFAM:
FT                   Phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system, EIIA 2; InterPro:Phosphotransferase system,
FT                   phosphoenolpyruvate-dependent sugar EIIA 2;
FT                   InterPro:Phosphotransferase/anion transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01845"
FT                   /db_xref="GOA:B8FMH8"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMH8"
FT                   /protein_id="ACL01845.1"
FT                   /translation="MKVTDYMSPEQVYLDAPIRDKEEILGFVSQAFAQCGAAPDKGTVY
FT                   DCMKEREDVMSTGIGGGVGIPHAACAGVTRPAVVIARPAQPVDFQALDAQPVDVIIAMV
FT                   VPNAQVSLHLRLLAAISRLVKSTNFLDDVRSASSSGDLFSLIKEIENSMAFH"
FT   gene            190182..190523
FT                   /locus_tag="Dalk_0136"
FT   CDS_pept        190182..190523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0136"
FT                   /product="hypothetical protein Dalk_0136"
FT                   /note="KEGG: aoe:Clos_2092 hypothetical protein; IMG
FT                   reference gene:2503005831; InterPro:Nitrogen regulatory
FT                   PII-like, alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01846"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMH9"
FT                   /protein_id="ACL01846.1"
FT                   /translation="MYLLIAVINNEQVLEDLVTGWIDMGITEATVAETTDLLQLISNNI
FT                   PIFAGFRTMTTGGSTHNKTIFTAVEDKELLEKATGFIQSLFRQTGKPSQGFYFVVPLVD
FT                   KGALGLEAL"
FT   gene            191050..192753
FT                   /locus_tag="Dalk_0137"
FT   CDS_pept        191050..192753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0137"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DbpA RNA-binding
FT                   domain protein; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: bfs:BF0134 putative RNA
FT                   helicase dead-box protein; IMG reference gene:2503005832;
FT                   PFAM: Helicase conserved C-terminal domain; DbpA RNA
FT                   binding domain; DEAD/DEAH box helicase; InterPro:DbpA,
FT                   RNA-binding; InterPro:DEAD-like helicase, N-terminal;
FT                   InterPro:DNA/RNA helicase, DEAD/DEAH box type, N-terminal;
FT                   InterPro:Helicase, C-terminal; InterPro:Helicase,
FT                   superfamily 1/2, ATP-binding domain; InterPro:RNA helicase,
FT                   ATP-dependent, DEAD-box, conserved site; InterPro:RNA
FT                   helicase, DEAD-box type, Q motif"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01847"
FT                   /db_xref="GOA:B8FMI0"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005580"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI0"
FT                   /protein_id="ACL01847.1"
FT                   /translation="MDFRILGLSDELARAVESLGFEKPTPIQEKAIPYLIEGERDFVGL
FT                   AQTGTGKTGAYGLPLIQSIDLSIPRPQAIVICPTRELCLQIAGDLRDFAKYMEDIRVAA
FT                   VYGGADIVKQIRTVKGGAQIIAATPGRLLDLINRKAIKPGHVTRVVLDEADEMLNMGFQ
FT                   EDINAILSSLPDERRTWLFSATMPKGVAAIAAKYQTNPVEVTMGGRNQASPDISHICYM
FT                   IHAKNRYAALKRILDYCPDMFGLVFCRTRKDTQEIAEALMADGYNADALHGDLSQPQRD
FT                   QVMGRFRRKAVQVLAATDVAARGLDVDDISHVIHYVLPDDPEAYTHRSGRTARAGKQGK
FT                   SIALITPRENYRLKDLERRGKFSFQLDSLPQGRDICQKQVAGLAEKLASVSVRENDIAE
FT                   YMPDILEAFEGLSREEIIQKAVSTEFNRLLDYYRNAGDINAKPREKVKGQAGAKFTREK
FT                   IVGKGRHGKGPKKDRLKGRKTQRFFINRGRLDKVNEGAIVRLVCENSGIKSRSIGQIDL
FT                   NREFSFFEVEKSLAPRVLRGLENATLDGKALQVRAADKQKPAEKGRKKAA"
FT   gene            192871..193074
FT                   /locus_tag="Dalk_0138"
FT   CDS_pept        192871..193074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0138"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: btk:BT9727_4273 hypothetical protein; IMG
FT                   reference gene:2503005833; PFAM: Uncharacterized conserved
FT                   protein (DUF2196); TIGRFAM: conserved hypothetical protein;
FT                   InterPro:Protein of unknown function DUF2196"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01848"
FT                   /db_xref="InterPro:IPR019240"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI1"
FT                   /protein_id="ACL01848.1"
FT                   /translation="MSVPLRKDIKPGMEADIVLKQDQRSGKLTRGEVKDLLTKSPSHPH
FT                   GIKVRLTNGLVGRVKKVYSVAE"
FT   gene            193222..193893
FT                   /locus_tag="Dalk_0139"
FT   CDS_pept        193222..193893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0139"
FT                   /product="Spermine synthase"
FT                   /note="PFAM: Spermine synthase; KEGG: cak:Caul_3084
FT                   hypothetical protein; IMG reference gene:2503005834; PFAM:
FT                   Protein of unknown function (DUF752); InterPro:Domain of
FT                   unknown function DUF752"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01849"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI2"
FT                   /protein_id="ACL01849.1"
FT                   /translation="MKPWTMMETSQTPTDGGAVSLHRRGKEYSIRIDGQELMNSRRHGS
FT                   EEELARLACQAVADRADCRVLIGGLGMGYTLAAALKHLDSTGTAVVAELIPAVVRWNQN
FT                   YIGHLADKPLEDERAAVIQGDVAQTIQKSRQAFDAILLDVDNGPEGLTQKENDRLYQPE
FT                   GLEEARKALRPGGVLAVWSAAKDSRFSKRLKAAGFQVDVHKVRAHLGKGSRHFIWIAKK
FT                   K"
FT   gene            194011..195042
FT                   /locus_tag="Dalk_0140"
FT   CDS_pept        194011..195042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0140"
FT                   /product="outer membrane protein"
FT                   /note="KEGG: sfu:Sfum_0514 outer membrane protein; IMG
FT                   reference gene:2503005835"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01850"
FT                   /db_xref="GOA:B8FMI3"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR024884"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI3"
FT                   /protein_id="ACL01850.1"
FT                   /translation="MKQAAEFDEKTWAELNESIDPQTLYLPNLEDGRFFAPWNRYKEKR
FT                   FRDVMGWRLSPKEKFTEEEESFLPQVLPNPVERIKAQQGDFIMWIGHNTFLIRIDDVYW
FT                   ITDPMFSKRALLPARQTPPGISLDELKSIAPKVRVIISHNHYDHLDSASVKALPEDALV
FT                   YVPLGLKETVEGMNKSNVHEMDWWDETAAPGGFRLVCLPAQHWSIRAGMGRNASLWASF
FT                   MLIKGDTVVYLGGDSGYFPGYKEYGKVFPDIDYALIPTTAYHPRWFMHYQHMNVTEALQ
FT                   AFDELNARYFIPTQWGTFRLSDEPPGFPALDLKRQITQQGRDASRFIIPDIGRIIPIQT
FT                   GDK"
FT   gene            complement(195298..196233)
FT                   /locus_tag="Dalk_0141"
FT   CDS_pept        complement(195298..196233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0141"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: rci:RCIX762 putative
FT                   amidohydrolase; IMG reference gene:2503005836; PFAM:
FT                   Carbon-nitrogen hydrolase; InterPro:Nitrilase/cyanide
FT                   hydratase and apolipoprotein N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01851"
FT                   /db_xref="GOA:B8FMI4"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI4"
FT                   /protein_id="ACL01851.1"
FT                   /translation="MKIKIGLIQPKVGHYQVDSNLGMYADRLIELKQAGVQLAVLPEFF
FT                   PTGNTLEPRLLQTAVRTGVKTAQWMEDQADGLDMVIAGSYLCPENGRVYNRFAIQAPGG
FT                   PLIRRRKSFIPAAEKVYSLEADDSPIVETSLGKIGLILCAETFAPKIVCADFSGCVLIL
FT                   IAFAIPNLFAQTPGIRDRLTNLPRLLAKKWGVPAILCSIGGRFSTKGSLAAPLIWRGNY
FT                   AGRSGIYLPDGTSIGPLAPGAEGVLTAEVDLSPSKGANASVKIPAGYPRCMALYNRVFG
FT                   AGAKAIYIKQKDAGSPLAGHPEKAGPPLRG"
FT   gene            complement(196274..197635)
FT                   /locus_tag="Dalk_0142"
FT   CDS_pept        complement(196274..197635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0142"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: scl:sce4348
FT                   sodium/hydrogen exchanger family protein; IMG reference
FT                   gene:2503005837; PFAM: Sodium/hydrogen exchanger family;
FT                   InterPro:Cation/H+ exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01852"
FT                   /db_xref="GOA:B8FMI5"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI5"
FT                   /protein_id="ACL01852.1"
FT                   /translation="MNPNPQPNAKPRWLPISLAIGIMAILGLWYVTYNPEESWQASGSM
FT                   NFSLGFLMLAGYVGAIIFQVMKLPRITGYIFAGILIGPHALGIFTHERVMDLRLVDDLA
FT                   LSFIALTAGGSLELKELSKRFVHIGLTVLFIVLIVFCSVAALVSLAGPQFSFTAQLSPR
FT                   EILAMGLLLGVLAVAISPSSVIAIIAEAKAKGPFTETALGVTVAIDVIVIVLFTIAMAA
FT                   ARGLLMSQGADPMVFAALGGELLVSVLLGSMLGWGLAYYIKKVGHDLPLVLLLAAFGVA
FT                   RLSAFLSWYIHENYNASVHMEPLLICMAAGFVVANFSDYGRIFVDTLERFSLPVYLLFF
FT                   CLTGASLDLHALASTWPLALAIAFMRAAGIWTATNLSGLLTKSPAPHRKRAFMAFVSQA
FT                   GVAVGLAGLAQAQFPEIGGYLLTVVLALIAVNQIAGPVLLKLALNQVGETPDKK"
FT   gene            complement(197625..198818)
FT                   /locus_tag="Dalk_0143"
FT   CDS_pept        complement(197625..198818)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0143"
FT                   /product="hypothetical protein Dalk_0143"
FT                   /note="KEGG: mxa:MXAN_3848 sodium/hydrogen exchanger family
FT                   protein; IMG reference gene:2503005838"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01853"
FT                   /db_xref="GOA:B8FMI6"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI6"
FT                   /protein_id="ACL01853.1"
FT                   /translation="MKTTFVFLLILILAFAGYRRSFKSLKAPVLAQNFYLTGIEYLFFG
FT                   FLIGPGFLNILDAESQKGLAPLCALVLGWVGLLSGFQFEIPKLRRAPNSHLGAAAVACG
FT                   LTALLMMLGAWLVLPRVLDLPDAAYVLSGVAIAAAACNTAQVSLALSPLARAPRNRALV
FT                   NLIQVMSSADGALALGVFSAAFLLRPDSAAHMHFGWLALKAVACIACQTLLFLLFLNRR
FT                   RSQEELTVVLMGGVILGSGVASMLDLSPLVVNFATGVLLVNITREKERLYGMIAAVEKP
FT                   AYLVLLIFLGSVWHMDSFLYFFGGLMYFAWRILAKIAGGVAAAHGIPALRGAPSDLGLG
FT                   LLDHGGMAMAILLDFSMSFPQSYAIPVVSTVLVGVVLNELLGPAFIHLILQGGGRES"
FT   sig_peptide     complement(198756..198818)
FT                   /locus_tag="Dalk_0143"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005838_SP"
FT   gene            199152..201338
FT                   /locus_tag="Dalk_0144"
FT   CDS_pept        199152..201338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0144"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1004 hypothetical protein; IMG
FT                   reference gene:2503005839; InterPro:Acetyl-CoA
FT                   hydrolase/transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01854"
FT                   /db_xref="InterPro:IPR026888"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="InterPro:IPR038460"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI7"
FT                   /protein_id="ACL01854.1"
FT                   /translation="MADNQPTFYDDVEKCADDIIRIMGKRVNFAMPLALGKSYHLTNEL
FT                   YRRAKEDPEIQLTFVTALALEKPTWSSDLEKRLVKPMRERIWKGVPDFDYVLDMRKNAL
FT                   PKNVVVTEFFFKAGSYNNVPMAQQNHSSSNYTHAIRDITNCFDTLVACQCVCKGEIDGE
FT                   TVYSNSCNSDLAYEIYPSKLEAERMGKKVIYIGHVNDTLPFMYGDAVEPEHHFDMILDS
FT                   PKYCFPLFSAPKAPVCTKDYMIGLHVSSLIKDGGTLQIGIGTLGDAIASGLLMRHHNNG
FT                   DYNQLLDDLGINNRYSRLIDKIGGRDEFAQGLYGATEMLVDVFIELYTGGIIKRNVYHN
FT                   IPLMRMINDGALQEEFTPESVKELLLQDEHFPILKEQDFISLRNYGIFKDDLRYEDYHL
FT                   VNGAGKYSVDFRDSANLDAVLENCLGDRLKNGVVLTGSFFIGPNGFYDFLRDMSDEERK
FT                   KFEMTGVKVVNQLYGDEVLRSLERKDARFVNAGMKISLMGNVASDALRNGTVISGVGGQ
FT                   YNFVSMAHALPDARLIMMLRSTKETPKEVKSNILFNYGYTTIPRHLRDIVVTEYGIADL
FT                   RSKQDWVVMTELIKVADSRFQDELLDEAKKAGKVPMDYEIPYEYRNNYPDQLEKKLAPF
FT                   KAKGYFKPFPFGKEFTDEEVALGASLRKFKGGMTANKFKASKALIKDFKAPVPPEATPY
FT                   LKRMNLDAPKGVKEKLMQKLVVHALSNAGYVKLQ"
FT   gene            203518..206754
FT                   /locus_tag="Dalk_0145"
FT   CDS_pept        203518..206754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0145"
FT                   /product="hypothetical protein Dalk_0145"
FT                   /note="KEGG: aba:Acid345_0352 hypothetical protein; IMG
FT                   reference gene:2503005840"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01855"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI8"
FT                   /protein_id="ACL01855.1"
FT                   /translation="MKKRFLFFCAAFVFLCTVNAFANVQGDVNGDGRIDIMEAIYSLRI
FT                   SAGLDVDLPDDCVLTGGGDWGAGETYDRCEAVKYTDGAYYLCIQQHDSSEENAPPDQTN
FT                   WVVLALKGDDGTGNSLSSADGSVSEALYVDNGGNVGIGTTAPGAALDVVGRISQTGLGN
FT                   STFLGEDAGKNDDGSNNNNTAVGKYALKANVSGFNNTAIGNLALANNAGDHNTALGSSA
FT                   LNSNTTGALNTALGESSLFSNTSGQSNTATGRYSLFFNETGSSNTADGVSSLFSNSTGS
FT                   ENTAAGFYALAFNSSGGRNTALGYHAGSYQSDGWSLLNDPENSIYIGNMAKGKDNDDNN
FT                   SIVIGYNAVGLGANTVVLGNTNTTLTSLRGNVGVGTDEPSEKLDVSGNINASGTVSANA
FT                   FTGDGSGLTNTYNPILGSSEAAADNSIFVDHRGYTGIGTVNPGAKLDVAGRISQTGLGF
FT                   STYVGASVGENDDGTDNYNTGIGDMAMRYNTSGNRNVAVGSGSLGSNNTGSYNTAIGTG
FT                   AFWQNTTGNKNVAIGHNAGISTNYEYLSGAEQSIYIGFQARGRNPGESNSIVIGGEAVG
FT                   LGSNTVVLGNSETDLTSLRGNVGVGTDEPSEMLDVAGNIKAAGDLYAGADIHADGDINA
FT                   GANIHATGSITSSGMNIGSDNTQLGHQALFKNGEGATLDSESVENTAVGSKSLYANTTG
FT                   SQNTAVGMETLTANTTGAGNTSTGAYSLESNTEGDRNTGLGAFALTSNTTAEDNTSVGY
FT                   KSAYHLNGSYNAALGSLSLYSTSSGTYNSAFGYSSLFLNETGDENTAIGYKALYKNAAG
FT                   NENTAIGSRAGYEALGSGNVFIGRYAGYNETGSDKLYIDNSDTATPLIYGDFSTNRVAV
FT                   FGSLGVNTNDPDEELDVRGDVKVSSDVEVGHDVEIGHNVEVGNDVVTAGEYRYAAPKTH
FT                   VLKIPAASFSLSTNQDADKMSFDVRGVWHINNDDGNGSYNIQAGFNLPDGAVVTRFSIY
FT                   YGGADESITVSLIERELMDNNSTKMGEIAVAPTAYSWCSKYDDETISSPTIDNSSYFYF
FT                   ITAEFRGHGDLDFGYLHGAEIEYTLDYVAR"
FT   sig_peptide     203518..203583
FT                   /locus_tag="Dalk_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005840_SP"
FT   gene            complement(207321..210170)
FT                   /locus_tag="Dalk_0146"
FT   CDS_pept        complement(207321..210170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0146"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: pph:Ppha_0700 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; IMG reference gene:2503005841;
FT                   PFAM: Histidine kinase-, DNA gyrase B-, and HSP90-like
FT                   ATPase; Response regulator receiver domain; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:CheY-like superfamily; InterPro:GAF; InterPro:PAC
FT                   motif; InterPro:PAS; InterPro:PAS fold; InterPro:PAS
FT                   fold-3; InterPro:PAS-associated, C-terminal;
FT                   InterPro:Signal transduction histidine kinase, core;
FT                   InterPro:Signal transduction histidine kinase, homodimeric;
FT                   InterPro:Signal transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01856"
FT                   /db_xref="GOA:B8FMI9"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMI9"
FT                   /protein_id="ACL01856.1"
FT                   /translation="MENSYHEKNMPDGAIRSEEILIAQRDLSIALAGAVNIDEAAVTCL
FT                   DAALKITGLDVGSVHLIDPIKGARLVANKGLSQTFLNALLRLAMDSSQMRLILDGQPIY
FT                   ANAGSPPWNQIKGLDSEHLSGMGLIPIMHGAKVIACFGLASHKLKAVPIEARTAVELIA
FT                   TTVGNAIARIQAQEALVESEEKFRFLAENQKDVVLSVGLDRTIRYCSPAIKEFAGYGRD
FT                   EVEGRDFLDFVVEDKDRRFLGDYTPEQAQKRDAMTVEFLFQPKNRDPFFVEIVTTRQFE
FT                   NNRVIALNAIMRDISKRKRAEQSLENNEKQLRSLMEAPANFAVYRLRYDPEKPLSVSVV
FT                   FASPSLKTIFGIENPMDFDTWWDIIHEDDRTAFAQGMLISMNQMSFQRSARYCHPDGSR
FT                   SGWLKVIASNTFDDMGRPEYTNGVVLDITGRMEAERNLIESKRELEQSEEKYRLLVENA
FT                   NEAIGIIQHNVLKFPNQAMCSLLGYDGNETNYIDVFKQIHPLDKGRARDAFEHLLDSDE
FT                   PHKSLSLRVVARSGATKWATANLVRIKWEDEPAAMAIIRDVTNEKHLETKLRQAQKMEA
FT                   IGTLAGGIAHNFNNLLNIIMGFTELTMSDMRPKTRSRENLQQVLNASHRAKDLVSQILT
FT                   FSRQDSMEKSPINLGALAADAVRLLQATLPATVVVNSKIPPEPCPIKGNDTQIKQLIMN
FT                   LGTNAVQAMNGKGGALSLLLDNVEAEAWELEMEAPGLLIPAIRLMVTDTGRGMDAKTLA
FT                   QIFDPYFTTLEPGQGTGLGLSVVHGIVKAHGGSISVRSTPGKGTSFTVLFPRLEDAIME
FT                   APKKPSIALGEGERVVFVDDEPSIAELGKNLLEKLQYKPVIFTSPLKALEYLQEGGEPV
FT                   DLLVTDQTMPIMTGEALILRLREFAPDLPVIACTGHSDFFDRAKAAKLGIQAFCTKPLS
FT                   LVQFSGTVRKVLDESQAKS"
FT   gene            210353..211186
FT                   /locus_tag="Dalk_0147"
FT   CDS_pept        210353..211186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0147"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   npu:Npun_R4309 alpha/beta hydrolase fold protein; IMG
FT                   reference gene:2503005842; PFAM: Putative
FT                   lysophospholipase; InterPro:Alpha/beta hydrolase fold-1;
FT                   InterPro:Alpha/beta hydrolase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01857"
FT                   /db_xref="GOA:B8FMJ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ0"
FT                   /protein_id="ACL01857.1"
FT                   /translation="MEHLEGIIQRGPGQDLYYQRWRPDQDAKAVLAIVHGFGEHSSRYA
FT                   NVVNVLVPAGYAVYSFDNRGHGKSFGKRGHISNWEDFRTDVFAFLQLVREKEPDKPLFL
FT                   MGHSLGGLIALEFLLRLPDGIDGAVISGPALTQGAVSPVLLLIGKLISYVIPSFTLDSK
FT                   LESNDISRDPRVVMDYKKDPMVHSLASARFGAEMGSAIKWVRKHAGDLKTPILIIHGGD
FT                   DRLVDPKCSREFFEKITIEDKTRIEYDGYFHETHNDLNWEKPVSDILEWLDKRVG"
FT   gene            complement(211308..212474)
FT                   /locus_tag="Dalk_0148"
FT   CDS_pept        complement(211308..212474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0148"
FT                   /product="hypothetical protein Dalk_0148"
FT                   /note="IMG reference gene:2503005843; PFAM: Protein of
FT                   unknown function (DUF1624); InterPro:Protein of unknown
FT                   function DUF1624"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01858"
FT                   /db_xref="GOA:B8FMJ1"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ1"
FT                   /protein_id="ACL01858.1"
FT                   /translation="MSKHANQRRTNFESLDRDPGLDFLRALSVVCMTAAHFSYHLPHLT
FT                   AASRILQFFFELAPPLFFFSFGMTFDRFLSKGPAEMRVRSRHFFYLTLCVNLLFHRRLL
FT                   ASDFFWFLWFWQAAAALAESFSGSLTRLWGLMTVLIAAALFIFPFTSVSNVFSLGMPGS
FT                   FPLIPWGGLVLAGIVFSRLGGKPARDLAAGAILLSAGLGLGLAGRMGVWSNLVLIRWPM
FT                   SGPYFLTGLGFVIFVTSAVRLWTPAYYSLTGISKACEYLSKNLLLSVVLHFAAYVPVVL
FT                   FMGIFGGMDLIRTHPGLNAAFLLTGGAASAAVLVLMVMAAKALWPAVKNAWPFKMARKN
FT                   FDLTAILMIAAVTLFGGDATHVPTAWTFTLTDAVIWFMMWYFALEMKQ"
FT   gene            complement(212486..212959)
FT                   /locus_tag="Dalk_0149"
FT   CDS_pept        complement(212486..212959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0149"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG:
FT                   sen:SACE_3001 hypothetical protein; IMG reference
FT                   gene:2503005844; PFAM: HxlR-like helix-turn-helix;
FT                   InterPro:Helix-turn-helix, HxlR type; InterPro:Winged
FT                   helix-turn-helix transcription repressor DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01859"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ2"
FT                   /protein_id="ACL01859.1"
FT                   /translation="MKKNKDHRTCSVGRVLEILGDRWTFMILREAFFGVRYYDQFQANL
FT                   GIASNILSDRLKSLVSNGILNKRKDPEDARRVVYRFSQKGVELYSVTLALMRWGDKWLS
FT                   GEEGPPLRLHHKTCGHDLEPMMCCAHCREEIRAFDVSYESGPGLDKSEDEEAD"
FT   gene            213115..213396
FT                   /locus_tag="Dalk_0150"
FT   CDS_pept        213115..213396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0150"
FT                   /product="Putative uncharacterized protein with partial
FT                   Enoyl-CoA hydratase domain"
FT                   /note="KEGG: rxy:Rxyl_2054 short chain enoyl-CoA hydratase;
FT                   IMG reference gene:2503005845; PFAM: Enoyl-CoA
FT                   hydratase/isomerase family; InterPro:Crotonase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01860"
FT                   /db_xref="GOA:B8FMJ3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ3"
FT                   /protein_id="ACL01860.1"
FT                   /translation="MSQDILILEMDGDVARITLNRPEGRNALSMELSYRLVEAVETVKR
FT                   STKIKFVVFKGAGDTFCAGDDIKEMFRWVEDEEGQYTLQKRKISIASL"
FT   gene            213614..214012
FT                   /locus_tag="Dalk_0151"
FT   CDS_pept        213614..214012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0151"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   dol:Dole_0759 thioesterase superfamily protein; IMG
FT                   reference gene:2503005846; PFAM: Thioesterase superfamily;
FT                   TIGRFAM: uncharacterized domain 1; InterPro:Phenylacetic
FT                   acid degradation-related protein; InterPro:Thioesterase
FT                   superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01861"
FT                   /db_xref="GOA:B8FMJ4"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR039298"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ4"
FT                   /protein_id="ACL01861.1"
FT                   /translation="MSKRLREVISNPLHVFLGVTDIKSENGCGEIVLTINKNVINPQGT
FT                   LHGGIIYTLSDVCAYAGLLSLLDDDTEAVTHDIQVSVMRAAMLGDEIRFKSEVIKRGRS
FT                   ICFLQTKVTLGEKVIATAKITKSLIPMF"
FT   gene            214054..214797
FT                   /locus_tag="Dalk_0152"
FT   CDS_pept        214054..214797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0152"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   vei:Veis_2505 protein of unknown function DUF81; IMG
FT                   reference gene:2503005847; PFAM: Sulfite exporter
FT                   TauE/SafE; InterPro:Protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01862"
FT                   /db_xref="GOA:B8FMJ5"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ5"
FT                   /protein_id="ACL01862.1"
FT                   /translation="MLESIDPSLFILAGIVLLSYTVQTFSGFGSTIIAVTLGSHLYPIP
FT                   FLLPILVPLDLFLNAYLTTRHRRFIDKPVLLRRILPAMGAGLLIGMALFSLAEGVLLKK
FT                   IFGVFVVLLSSRELWIRLRSKARIRPLGASGFNGFTAAAGVVHGIYASGGPLLIYALSR
FT                   LNMPKASFRSTLAALWTILNLILTAYYLVSGRVTGVTLTYNLLLFPMILLGIVIGEKLH
FT                   SLINEYAFTILVFVLLLGAGASIIF"
FT   gene            complement(214805..216169)
FT                   /locus_tag="Dalk_0153"
FT   CDS_pept        complement(214805..216169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0153"
FT                   /product="Na+/glutamate symporter-like protein"
FT                   /note="KEGG: acl:ACL_0641 Na+/glutamate symporter; IMG
FT                   reference gene:2503005848"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01863"
FT                   /db_xref="GOA:B8FMJ6"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ6"
FT                   /protein_id="ACL01863.1"
FT                   /translation="MNAPFEFNSMLVFAWLSFFLIMGLYLRARVAFIQKFLFPSCLVGG
FT                   FAGLVAMQTGLLNIETGTLENFGYHFFNVSFISVGLTRNDAEDETGAKIAGVKGPAWMA
FT                   LIQGLTFPMQAVIGGLFVLIFGALGFELFSTFGFLVPLGFNEGPGQALSIGKAWEAVGF
FT                   ADGATIGLTFAAVGYFFSFFVGVPLVNYGMRKGRAFHGGENLSPDCVLGVFSPGVDCEN
FT                   AGKLTIHSGNAETMAFQAALIGVVYGLTYAFIRMAASFLPPDVGAILWGFFFFFGLGAA
FT                   LVLKKIMSLAGLGHIADPGVQRRITGWSVDYLIVATVMAIQLRVVWEYILPIAAISIAV
FT                   GLSTTLVIIWFGRRVPGYSLERTAAIFGTVTGTVSCGLLLLRIVDPEFRTPVAYEIAVM
FT                   NAFALPIVGGGTVLVNAPLWWGWSVWQTMLVFVGVMAVSLILLLMLGLVGKKAAD"
FT   gene            complement(216188..217624)
FT                   /locus_tag="Dalk_0154"
FT   CDS_pept        complement(216188..217624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0154"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: aminotransferase class V; Pyridoxal-dependent
FT                   decarboxylase; KEGG: rca:Rcas_2190 pyridoxal-dependent
FT                   decarboxylase; IMG reference gene:2503005849; PFAM:
FT                   Pyridoxal-dependent decarboxylase conserved domain;
FT                   InterPro:Pyridoxal phosphate-dependent decarboxylase;
FT                   InterPro:Pyridoxal phosphate-dependent transferase, major
FT                   domain; InterPro:Pyridoxal phosphate-dependent transferase,
FT                   major region, subdomain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01864"
FT                   /db_xref="GOA:B8FMJ7"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ7"
FT                   /protein_id="ACL01864.1"
FT                   /translation="MKLPEKGLPEDKIFEALQDFRKNDVKWKDGRVFGYVFDPGAEVQH
FT                   TAKQAYNEFLSENGLDFTVFQSLQRLEKELAAFGAQHLRGGDQAVGNFTSGGTESIILA
FT                   VKAARDYYREEWPGVTAPEIILPTTAHAAFYKAAHYLNLKVLQVPVDPQTYQVDPETVW
FT                   QTITDDTIMLVGSAPTYSQGVIDPIEDLGKIALKTDLWLHVDACMGGFLLPYFKRLGEP
FT                   VPDFDFSVPGVSSMSMDLHKYAYCPKGASLVMYRDKSLRKHQIFACAEWIGYTIINNAV
FT                   QSSKSGGPMAAAWAVLNRIGDLGYLEIARKKLEAVKKITAGIPKIKGLRLLAQPQMTLI
FT                   AFTSDSVNVFHIIDEMNSRGWYIQPALSYDNCPAHIHLSVSASNVGWEDKLLEDLEECT
FT                   AIAAGMPEGELVTSLRPMLQDLDLSQATDEDINGLLAMAGLEGQGLPDRMAEINGVLNL
FT                   LPAPARKKILVSFVNDLFVQ"
FT   gene            218003..219529
FT                   /locus_tag="Dalk_0155"
FT   CDS_pept        218003..219529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0155"
FT                   /product="filamentation induced by cAMP protein Fic"
FT                   /note="PFAM: filamentation induced by cAMP protein Fic;
FT                   KEGG: dol:Dole_0828 filamentation induced by cAMP protein
FT                   Fic; IMG reference gene:2503005850; PFAM: Fic/DOC family;
FT                   InterPro:Filamentation induced by cAMP/death on
FT                   curing-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01865"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ8"
FT                   /protein_id="ACL01865.1"
FT                   /translation="MAPTKEKLAQSLAVLKKLQDKGIVAIHTKNMTRTHRERLVKNGFI
FT                   KEVMKGWYIPSRPDEPAGESTAWYASYWGFCVDYLNARFGGEWCLSPEQSLRIHSGNWS
FT                   VPGQLVVRTPKGGNKPVTLLHGTSILDLRLKLPEKKDITSKENLRVMALPAALIASAPS
FT                   YYPNNAVDARAALSMISDASEILHKLLEGGHSTVAGRLAGAFRNIGRGDIADNIVEAMK
FT                   AAGFSIIEDDPFEQKPSIDFSGRERSPYVNRIRMHWADMRGVVLENFPQAPSPPMKVDK
FT                   YLERVDEIYLTDAYHSLSIEGYRVSRELIDRVRSGDWDPETNRKDQEYADALAARGYWQ
FT                   SFQAVKNSLATILNGGSPGKAAGRDHSIWYRELFAPGVNAGLVAPSDLAGYRNQPVYIR
FT                   ESRHVPPRWEAVPDLMPAFFSLLEDEDTPAVRAVLGHFFFVYIHPYIDGNGRMGRFLMN
FT                   VMLASGGYPWAVIPVETRSQYMAALEEASVNLNIKPFSRFLAELVQKGMA"
FT   gene            complement(220049..220576)
FT                   /locus_tag="Dalk_0156"
FT   CDS_pept        complement(220049..220576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tbd:Tbd_0485 hypothetical protein; IMG
FT                   reference gene:2503005851"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01866"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMJ9"
FT                   /protein_id="ACL01866.1"
FT                   /translation="MPLLKTVKPEEATGVTKEAYSIFENMGAPVALPMQMMSISPFFVE
FT                   AQGNGLKYYISHPNLKFPLLAHIRMLVAYNEGYEYCIALNEGMLKMLGGLSQEDVDAVK
FT                   ADPSKAKLDDKDKAMLLYVLKVTQDPAMSSAEDIAALKDMGWAEQDIFEAVQHGLGMIT
FT                   AGMAFKIFKMSE"
FT   gene            complement(220602..222239)
FT                   /locus_tag="Dalk_0157"
FT   CDS_pept        complement(220602..222239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0157"
FT                   /product="formylmethanofuran dehydrogenase subunit E
FT                   region"
FT                   /note="PFAM: molybdopterin binding domain;
FT                   formylmethanofuran dehydrogenase subunit E region; KEGG:
FT                   sfu:Sfum_0032 molybdopterin binding domain; IMG reference
FT                   gene:2503005852; PFAM: Prokaryotic dksA/traR C4-type zinc
FT                   finger; Probable molybdopterin binding domain; FmdE,
FT                   Molybdenum formylmethanofuran dehydrogenase operon;
FT                   InterPro:Formylmethanofuran dehydrogenase, subunit E
FT                   domain; InterPro:Molybdopterin binding;
FT                   InterPro:Tubulin/FtsZ, 2-layer sandwich domain;
FT                   InterPro:Zinc finger, DksA/TraR C4-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01867"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR003814"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK0"
FT                   /protein_id="ACL01867.1"
FT                   /translation="MKTICGNTYEHYLDMVKNFHGHLAPGMLIGGFMVDAAVNNLPEGE
FT                   FFDAVCETRACLPDAIQLLTPCTIGNGWLKILNMGLFALTMFEKFDGEGIRVYVDPPKL
FT                   EPWPEIKSWFFKLKPKKEQNFELLLKQISDAGADFCSLAKVQMKPEYVDHKRRKGFDIC
FT                   RQCGEAYPWEDGSLCLSCQGQNPYVTAAKTPELSISPAPDLTAVNVEESEGMHALHDMT
FT                   RIIPGEEKGPLYKKGQQLKGADVCRLQKMGRTRVYTAEKNNPGAEWVHEDEAALAFAKA
FT                   MAGDGAAFTDNPREGKAEIIADRDGLLTVDVLALEAFNSVLGVACAGRHSCTVVKKGDK
FT                   LAGTRALPLYLHRQYFNQAMDGLVHRPVYQVHPMRQAKVGVLVTGTEVFQGLVQDKFTP
FT                   IIQKKVEHYGSQVICSDIVADDREAISACAKKFVEAGVDLLVTTAGLSVDPDDVTRLGL
FT                   TDAGAENLLYGAPILPGNMTLLANMGETQVIGVPACALFHERTSFDLLLPRLLANLEIT
FT                   RKDLAKMGHGAFCLDCKTCIYPRCGFGK"
FT   gene            complement(222369..224606)
FT                   /locus_tag="Dalk_0158"
FT   CDS_pept        complement(222369..224606)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0158"
FT                   /product="molydopterin dinucleotide-binding region"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: dol:Dole_1621 nitrate reductase; IMG
FT                   reference gene:2503005853; PFAM: Molybdopterin
FT                   oxidoreductase; Molydopterin dinucleotide binding domain;
FT                   Molybdopterin oxidoreductase Fe4S4 domain;
FT                   InterPro:Aspartate decarboxylase-like fold;
FT                   InterPro:Molybdopterin oxidoreductase;
FT                   InterPro:Molybdopterin oxidoreductase, Fe4S4 domain;
FT                   InterPro:Molydopterin dinucleotide-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01868"
FT                   /db_xref="GOA:B8FMK1"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK1"
FT                   /protein_id="ACL01868.1"
FT                   /translation="MGQWHKSGCVLCAQNCGLELLVEDGKIVKSRPDKDNPRSEGYACR
FT                   KGLNVRYHQYPKDRLTEPLKKVNGKFEPVAWDQAISEIAEKMQAIHKEHGPRALAYMGG
FT                   SAQGGHLEATFGLTWLRNLGSRYYYSSAGQEFSDSWWLFGRMLGKQYNVAAPDEHAAEV
FT                   LIAWGWNGMMSHQMPQARKTLRAISKAPDKMLIAVDPRKSETAAIANMHVAVRPGSDAL
FT                   LLKAMIAIIVEKGWEKAEYIQANVEGWNAIKSWFEGFDYKSAIAACELDLGQILEFCRI
FT                   LATKKWCVHPDLGLYMGRKGVYSLYLLNVLAAICGRFCVRGGNVIPGFVVPMGFHADER
FT                   DPKTWRTMATDMPPVAAGSFPPAVMPEEILSDNPRKLRAVYVSAVNPLRSYPDSQAYEE
FT                   AFSKVDLLVVNDIAMTETARLADYVLPCRTFYESYDGTFFPNNFPEVFFQIRKPIVEPP
FT                   PLCRESSQITTMLADKMGLIPKIPEELHQAAKGDRLTFGAKLMEFAGANPDAMKVMPLV
FT                   LAKTLGEEWDSAALAAIWGLFMTAPKAFRENAARAGFEPGLDMGDRIFQALMDNPQGLW
FT                   VGKVDPDENLSQIKTPSGKVEVVIPELEEGVKALDAKSESVDMVMPKSFPLILHAGRHM
FT                   DYNINTLMRNPEWNKGKRACTVAVHPSQAEALGLRDGQQVEVFTEAGSAQGELQTSDQI
FT                   REGTVLIPHGFGLQYGDEVYGLNVNHLTKNTHRSTLGTPIHRFVPCRVEAV"
FT   gene            complement(224643..225236)
FT                   /locus_tag="Dalk_0159"
FT   CDS_pept        complement(224643..225236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0159"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: gvi:gll3826
FT                   TetR family transcriptional regulatory protein; IMG
FT                   reference gene:2503005854; PFAM: Bacterial regulatory
FT                   proteins, tetR family; InterPro:Homeodomain-like;
FT                   InterPro:Homeodomain-related; InterPro:Tetracycline
FT                   transcriptional regulator, TetR-like, C-terminal;
FT                   InterPro:Tetracycline transcriptional regulator,
FT                   TetR-related, C-terminal; InterPro:Transcription regulator,
FT                   TetR-like, DNA-binding, bacterial/archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01869"
FT                   /db_xref="GOA:B8FMK2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011075"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039419"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK2"
FT                   /protein_id="ACL01869.1"
FT                   /translation="MKNETKEKILQHGARLVYQKGFNHTGIGEILKAAKVPKGSFYHYF
FT                   PSKEDFGLELLDYMAVWAASVGIAALYDKSYTPLERLKNFFQAYEDNFERMNYTGGCPV
FT                   GNLCLEMSDQSDPFREKLEKILEQMRRGIAKVLEEAVKAREVPEDLSVEATAHFIISAW
FT                   QGTLLQTKVMKNGESIQVFKRIVFEQLLQNKQPL"
FT   gene            complement(225321..225701)
FT                   /locus_tag="Dalk_0160"
FT   CDS_pept        complement(225321..225701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0160"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: psp:PSPPH_0202 hypothetical protein; IMG
FT                   reference gene:2503005855"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01870"
FT                   /db_xref="GOA:B8FMK3"
FT                   /db_xref="InterPro:IPR019109"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK3"
FT                   /protein_id="ACL01870.1"
FT                   /translation="MQIEHTPIENQAPDQNARRWAALCHIGGLLGLLALPSIGNILVPL
FT                   VLWLIKKESHPFIDQEGKKALNFQICTTIYTWITGLLCFVLIGFVIAPVLAIFVLVVCI
FT                   IATVKAADGVGYKYPLTIRFIK"
FT   gene            complement(225789..227840)
FT                   /locus_tag="Dalk_0161"
FT   CDS_pept        complement(225789..227840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0161"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: sfu:Sfum_2943 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; PAS fold-3
FT                   domain protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; IMG reference gene:2503005856;
FT                   PFAM: Response regulator receiver domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:CheY-like superfamily; InterPro:PAC motif;
FT                   InterPro:PAS; InterPro:PAS fold-3; InterPro:PAS fold-4;
FT                   InterPro:PAS-associated, C-terminal; InterPro:Signal
FT                   transduction histidine kinase, core; InterPro:Signal
FT                   transduction histidine kinase, homodimeric; InterPro:Signal
FT                   transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01871"
FT                   /db_xref="GOA:B8FMK4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK4"
FT                   /protein_id="ACL01871.1"
FT                   /translation="MNTENDNQQPMNFLQMLRKAEEDKKSGDITPEYAQWLMETEGHLR
FT                   AFMTNAKNFAVYRLVRDDNSPYGVEVVFVSPSMKDILGVEDPTQVHLWFEKAHPDDFER
FT                   IIRANMEAFQTLKLDETIRYFHAPTEQWRWIQVLGTGSQDAEGEAMYANGIIIDVTEQK
FT                   KAEQAHKESEEKYRDLVENINDVLFALDREGLCTYMSPVVKNVLGVDPDDLVGKYLHEF
FT                   MPEHQKKAYLENMAKLDAGQNLSSEYEIIGPDGQSHWIRTSSRPTEVDGKVTGIRGTFR
FT                   DITDYVRAQQDKRRLEEQLEHSQKLEAIGTLAGGIAHNLNNVLYPIVGYTEMAIEDIPE
FT                   DSPAHESLQEVLYAADRARELVYQILTYSRRSEEKLEALDLNPIMKEVIKLISAAVPST
FT                   IKVEQSLAPNIPAILADAAQIHHVVMNLCTNAYHSMRDTGGILDITLGFVEIKQDQDAP
FT                   VPNMPPGGYVKISVSDQGQGIDEGIRDRIFEPYFTTKGVGEGTGMGLALTLAIVTKVNG
FT                   FINVTSIPGRGSTFDLYFPSTDKAPVISIPEFHGPAPRGGESILLVEDDQQILHMTQQM
FT                   LERQGYRVDPYDSGIDGLEAFYKNPKKYDLVITDMTMPLMTGDQLAVEIMQKSPDTPVI
FT                   LCTGFSEHISQEQAEALGVAAFLMKPMARNRVAGIVRRVLDKAKMKRD"
FT   gene            complement(227863..228708)
FT                   /locus_tag="Dalk_0162"
FT   CDS_pept        complement(227863..228708)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0162"
FT                   /product="hypothetical protein Dalk_0162"
FT                   /note="IMG reference gene:2503005857; PFAM: Pyridoxamine
FT                   5'-phosphate oxidase; InterPro:FMN-binding split barrel;
FT                   InterPro:FMN-binding split barrel-related;
FT                   InterPro:Pyridoxamine 5'-phosphate oxidase-like,
FT                   FMN-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01872"
FT                   /db_xref="GOA:B8FMK5"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK5"
FT                   /protein_id="ACL01872.1"
FT                   /translation="MESSDFFNEADIAALEPETKIGLLATVNPEGLPHVTLITSLQAGG
FT                   PKRVMFGQFAQGLSKIHVKSNPRTAFLVLTLDRKIRMGKALWKESKTSGPEFEMFNEKP
FT                   MFRYNAYFGIHTVHYLDLVEKQGPVGLPLLRLGAAMAATRLTGKSGAASKEKGVLKPWG
FT                   KKLFNRLDAMKFISWVGEDGFPVIVPVLQCTAPSDSRLVFSPLAYSSQLKSLEKGQNAA
FT                   VFGLTMKMEDILVRGFFRGYFRKRGMTIGMMDINWVYNSMPPVAGQIYPEPELKPVTEF
FT                   "
FT   gene            complement(228748..229701)
FT                   /locus_tag="Dalk_0163"
FT   CDS_pept        complement(228748..229701)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0163"
FT                   /product="Pyruvate formate lyase activating enzyme"
FT                   /EC_number="1.97.1.4"
FT                   /note="KEGG: cpo:COPRO5265_1566 putative pyruvate
FT                   formate-lyase 3-activating enzyme (PFL-activating enzyme 3)
FT                   (formate-C-acetyltransferase-activatingenzyme 3); TIGRFAM:
FT                   glycyl-radical enzyme activating protein family; PFAM:
FT                   4Fe-4S ferredoxin iron-sulfur binding domain protein;
FT                   Radical SAM domain protein; IMG reference gene:2503005858;
FT                   PFAM: 4Fe-4S binding domain; Radical SAM superfamily;
FT                   TIGRFAM: glycyl-radical enzyme activating protein family;
FT                   InterPro:4Fe-4S binding domain; InterPro:4Fe-4S ferredoxin,
FT                   iron-sulphur binding, conserved site; InterPro:4Fe-4S
FT                   ferredoxin, iron-sulpur binding domain; InterPro:Glycyl
FT                   radical enzyme-activating; InterPro:Pyruvate formate-lyase
FT                   activating enzyme; InterPro:Radical SAM;
FT                   InterPro:Radical-activating enzyme, conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01873"
FT                   /db_xref="GOA:B8FMK6"
FT                   /db_xref="InterPro:IPR001989"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR012839"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR034457"
FT                   /db_xref="InterPro:IPR040074"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK6"
FT                   /protein_id="ACL01873.1"
FT                   /translation="MQGRIFSIQRMSTEDGPGIRTTVFLKGCSLSCTWCHNPESISALP
FT                   QVQWIGSRCIGCRSCVEVCPHNALELTQEGMQIDRGLCEGCGRCADECPSTAMEMLGED
FT                   RTLEDLAAELEKDRAYFESSGGGVTISGGEPALQADFAASLLRICQGKGLHTALDTCGM
FT                   VKPAALESILPFANMVLFDVKFADTSLHKRFTGAPNDQILKNLALVAEYMQGHENPREL
FT                   WIRTPLIPGATAAKENIVNIGRFLANNLGQAFSRWELCAFNNLCKDKYTRLGKEWDFAE
FT                   IPLMTQEEVSALESAARESGVNPEIVFATGATRSGD"
FT   gene            complement(229718..232234)
FT                   /locus_tag="Dalk_0164"
FT   CDS_pept        complement(229718..232234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0164"
FT                   /product="Pyruvate formate lyase"
FT                   /EC_number="2.3.1.54"
FT                   /note="PFAM: formate C-acetyltransferase glycine radical;
FT                   pyruvate formate-lyase PFL; KEGG: cbh:CLC_3093 formate
FT                   acetyltransferase; IMG reference gene:2503005859; PFAM:
FT                   Glycine radical; Pyruvate formate lyase; InterPro:Formate
FT                   C-acetyltransferase glycine radical; InterPro:Pyruvate
FT                   formate-lyase, PFL"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01874"
FT                   /db_xref="GOA:B8FMK7"
FT                   /db_xref="InterPro:IPR001150"
FT                   /db_xref="InterPro:IPR004184"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK7"
FT                   /protein_id="ACL01874.1"
FT                   /translation="MAGSNAQVKEHSVKEPKGLSPRIEWLRDYYFQGAERAWNNEYTAW
FT                   TTGDPWDEVYDELSFYIVPETYAFMQTFCSSYLQAARKVPLNGEFWDLSLPERRAWFVK
FT                   KVMTKHLPVEILPGDLIAGGRFNIQTSMCLDEKQAKTRKKLVQGKKGSRAEMKWFHDHG
FT                   YGNAGATSGHLVPGYEDVLKKGWKGVHDYLASRLDALGPENQNSHQANQLKAMMTAATM
FT                   PRDLAARYASLIRDMEQKESDPERKEELARMAANLDHTPWNPPRDFWEAIQALWLTHML
FT                   VLSDENYPGPGVSFGRVDQYLLPYWEASMAQGMDREWGKEILKCFWIHANTAYDAMIRT
FT                   GANGGITAGYGQLITLSGMGPDGTDLTNDLTYVFLEVIDEMSPILEPKPNVRLHANTPE
FT                   ELYDHIIDMIAESQGAPFLLNFDERSMAGMMREAEKAGRQDLINESNVWQYAPVGCLEN
FT                   TMVGNDRSGTVDINLNLLKAVEFALTGGADLLPYKDTIMGKEYPIDASGIPTGDPTEFT
FT                   VFEEFFAAFAKQTRHIIKKAMDLYETSESVRAAYHPTPYLSCLVKGCAEKGKDVTQGGA
FT                   ELSFVTIEAVTFATTVDSLLAVKYLVFDEKICTMAELIQALKDNWEGHDILMARAKFKA
FT                   PKYGRDDDEADEMARKVMDLWTEETWKHKTQSTGRQARPGMLSWNYWVGDGYILHASPD
FT                   GRPKGQFLSNAICPTNGADINGPTSNANSVGKALGGRKPGKGDFGDYLNSLPNGASHTI
FT                   TFNPSILADPLHKEKFKAYLKGYVQNGGTALQINMLDADMLKDAQKNPADYRHLLVRIT
FT                   GYNAYFTSIGKELQDEVIARLSHEGL"
FT   gene            232496..232873
FT                   /locus_tag="Dalk_0165"
FT   CDS_pept        232496..232873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0165"
FT                   /product="Response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   sat:SYN_00173 response regulator receiver domain-containing
FT                   protein; IMG reference gene:2503005860; PFAM: Response
FT                   regulator receiver domain; InterPro:CheY-like superfamily;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01875"
FT                   /db_xref="GOA:B8FMK8"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK8"
FT                   /protein_id="ACL01875.1"
FT                   /translation="MSRILVIDDDSQIRKMLRKMLATAGYAVAEARDGAQALDIQAREP
FT                   ADMIITDIIMPVKGGIDTIQEFTEKYPGVKIIAMSGGGFLGAEDHLTIPQRMGVVHTFA
FT                   KPLEREKILSAVKDLLNQPVA"
FT   gene            complement(232992..234446)
FT                   /locus_tag="Dalk_0166"
FT   CDS_pept        complement(232992..234446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0166"
FT                   /product="hypothetical protein Dalk_0166"
FT                   /note="KEGG: hau:Haur_3361 hypothetical protein; IMG
FT                   reference gene:2503005861"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01876"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMK9"
FT                   /protein_id="ACL01876.1"
FT                   /translation="MLGISVVYALDEPSTAMLAVGNQFYNGTLQMEEFVYDIDNGLVVS
FT                   ATAQAPVQSGYLFNPFADLAMDEDSNLHRAVIGAYFTNLTMHALGPGEYGGVNCYKGEY
FT                   YENTRIFCPYVVNTDEDETNIDIMNKGNSAAQVSVIYYNEGGVAVGAWIAPAELQPGET
FT                   IRPDVASELPQTTASAVISATEPLVASVEIFGDNQSMVYAGVSVMDSYLYVPKLNDGQD
FT                   DGWESTTWVQNAEEEAQDVLMEFFSPSGNFVQSETVQIAPGGVFGFETPVGASCAYIRG
FT                   QDDVAAVVVSAGDSSYYAYKTRGVSWLPLIPLVMKNADGWNTSITIQNPASGDCEVYWK
FT                   YLDQGGNQVGNNSSSVVIAPDGAYTFSLEDDPTLSSNQSFLGAVKIFAYHAQNPANYKS
FT                   AASSIYVPVVATHEKGGKKAAVSVGPYMGDKASKDFNEPLTWGYVYGFPVVYQYAYDVE
FT                   ENEEENPLPDLSFGDNLFCFVDSLKN"
FT   sig_peptide     complement(234420..234446)
FT                   /locus_tag="Dalk_0166"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005861_SP"
FT   gene            234914..236071
FT                   /locus_tag="Dalk_0167"
FT   CDS_pept        234914..236071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0167"
FT                   /product="hypothetical protein Dalk_0167"
FT                   /note="IMG reference gene:2503005862"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01877"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML0"
FT                   /protein_id="ACL01877.1"
FT                   /translation="MPRRFLFAGAVLLLCLAPAVLYSVLVGDINNDGKIGLEESIYSMR
FT                   ASAGLVDPMSNPGAIWGEWYVKSTSKVTFNPNNTYDMGRLCGGLYPASERGVYTYDPQT
FT                   GAFHAEVTEDSNGDYGFGSGAGATLDATVEAIDYQTMKMLLPYGEEAVFSRLDPGYPIA
FT                   GVYDDFSDGELDETLWEWGSGDGSETGYYFTEANGRLTLACTDLDGMYLNPNARGYLSM
FT                   SAKMAISEVNGNSWLEMGGSFFTETITTFDTRIYAQAGIQTESNSTTDNMDSTATLRAG
FT                   VYRSFPYAQLHKVDAPISGKDEWHTLKITIEQELDGGQPTGAHYVRFYLNGALWSEKYM
FT                   STDYALRPCDSSTRDQYVTWGCDGTPTEGGSPQVVYRIDDYILGE"
FT   sig_peptide     234914..234982
FT                   /locus_tag="Dalk_0167"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005862_SP"
FT   gene            complement(236309..237298)
FT                   /locus_tag="Dalk_0168"
FT   CDS_pept        complement(236309..237298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0168"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: pmy:Pmen_0125
FT                   transcriptional regulator; IMG reference gene:2503005863;
FT                   PFAM: DJ-1/PfpI family; Bacterial regulatory
FT                   helix-turn-helix proteins, AraC family;
FT                   InterPro:Helix-turn-helix, AraC; InterPro:Helix-turn-helix,
FT                   AraC type, DNA binding domain; InterPro:Homeodomain-like;
FT                   InterPro:Homeodomain-related; InterPro:HTH transcriptional
FT                   regulator, AraC; InterPro:ThiJ/PfpI"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01878"
FT                   /db_xref="GOA:B8FML1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML1"
FT                   /protein_id="ACL01878.1"
FT                   /translation="MPDVAFLAYEQCMLSGISSLMDAFGIANEWLKHFARREGVPASED
FT                   VLFRTEIVSPGGRPITAQGGIPLSPHRAMEEVKSTDLVLIPPHMFGVRHDREQIGDMLD
FT                   WLVMHHQANARIGALCTGTFILAMTGLLDGRIATTNWQLVNRFRRQFPKVRLKPERVLT
FT                   EDGGLICSGAVTASYNLGLYVMELFGSPELMRACSKALLVDPSRTTQAPYMTASFKKNH
FT                   GDKAILAAQEWMEEHFMEGVTMEDAADYVGLSSRHFKRRFKQAVEETPLNYLQQVRLEA
FT                   AKKALETTTDNIDEITRQVGYEDASTFRRLFKKHTTLSPREYRDKFAI"
FT   gene            237493..238551
FT                   /locus_tag="Dalk_0169"
FT   CDS_pept        237493..238551
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0169"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: dol:Dole_2064 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain-containing protein; IMG reference
FT                   gene:2503005864; PFAM: 4Fe-4S binding domain;
FT                   InterPro:4Fe-4S binding domain; InterPro:4Fe-4S ferredoxin,
FT                   iron-sulphur binding, conserved site; InterPro:4Fe-4S
FT                   ferredoxin, iron-sulpur binding domain; InterPro:Fumarate
FT                   reductase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01879"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML2"
FT                   /protein_id="ACL01879.1"
FT                   /translation="MTDVYQHLAKHLDELPGGFPPTENGVELRLLKRFFSPEEAGLAAL
FT                   LTMMPETPQSVAERAGLDVEVLAPKLEEMSRKGLIFRAGRGENRSYSAAMFIMGIWEYH
FT                   CNDLTEELALDFNEYLPQIHVKSWMKSKTNHKRIVPVSKEIVPEMKIFSYDDAEALIKS
FT                   QKKIVLGTCICRKEQQLIGKGCSGPLDVCLFFGAGAYYCEENGLGRDIQTEEALDALER
FT                   GRKAGLVLQPSNSQNPLTLCMCCGCCCLFLKNIKAMDKPGQYVHTSYFAQVDDEKCIAC
FT                   GACAEACHMDAITVEDAAFVNPDRCIGCGVCVSQCPSDAMAYQQKKQPDQYVPPATVVE
FT                   TFMNMALERGKV"
FT   gene            238580..239035
FT                   /locus_tag="Dalk_0170"
FT   CDS_pept        238580..239035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0170"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   swo:Swol_0025 uncharacterized aromatic compound
FT                   catabolism-like protein; IMG reference gene:2503005865;
FT                   PFAM: Thioesterase superfamily; TIGRFAM: uncharacterized
FT                   domain 1; InterPro:Phenylacetic acid degradation-related
FT                   protein; InterPro:Thioesterase superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01880"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML3"
FT                   /protein_id="ACL01880.1"
FT                   /translation="MRKINPAYIEELKQTINTSPYPSHMSMRLESVDYDKAEMVLDTGR
FT                   QHLQPFGIVHGGVFATLIDTATFWAGFLRIPEDAGLVNVDLKLNYLKSVTDQKLRAFGL
FT                   VLRPGRTVSYAEAKVYDESGDLVAHGTSSLLVLPGKGLPSRAKKFLD"
FT   gene            239104..239694
FT                   /locus_tag="Dalk_0171"
FT   CDS_pept        239104..239694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0171"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: ava:Ava_1692
FT                   cyclic nucleotide-binding protein; IMG reference
FT                   gene:2503005866; PFAM: Cyclic nucleotide-binding domain;
FT                   InterPro:Cyclic nucleotide-binding domain; InterPro:Cyclic
FT                   nucleotide-binding-like; InterPro:RmlC-like jelly roll
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01881"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML4"
FT                   /protein_id="ACL01881.1"
FT                   /translation="MAADLDAVRKALGFDSLAPDSEWEKLLALSAPLHVPKNGFFIKAG
FT                   EKPHLVGAVVSGLFRTYCITDKGDERILAFRHIGHLLGGYAPYLLGRSNWYSIQALEDS
FT                   ELLCFSFQDLEDLAAGHPCWADIMSDYTKRMFLEKECRERSLLMDDAATRYLDFLEAHP
FT                   GLEDRVSQYHIASYLGISPVSLSRIRSSLKNVQ"
FT   gene            239833..240099
FT                   /locus_tag="Dalk_0172"
FT   CDS_pept        239833..240099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0172"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: tpd:Teth39_1678 SAF
FT                   domain-containing protein; IMG reference gene:2503005867;
FT                   PFAM: SAF domain; InterPro:SAF domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01882"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML5"
FT                   /protein_id="ACL01882.1"
FT                   /translation="MKPNAIMVNPADNVAVALEDIGQGEEVRVGEKVLCRTIADIAYSH
FT                   KVLLKDLSEGEDVIKYGEIIGQAAQDLKQGEWVHTHNLTLKGE"
FT   gene            240102..241262
FT                   /locus_tag="Dalk_0173"
FT   CDS_pept        240102..241262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0173"
FT                   /product="Altronate dehydratase"
FT                   /EC_number="4.2.1.7"
FT                   /note="PFAM: D-galactarate dehydratase/Altronate hydrolase
FT                   domain protein; KEGG: stm:STM0650 putative hydrolas; IMG
FT                   reference gene:2503005868; PFAM: D-galactarate dehydratase
FT                   / Altronate hydrolase, C terminus; InterPro:D-galactarate
FT                   dehydratase/Altronate hydrolase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01883"
FT                   /db_xref="GOA:B8FML6"
FT                   /db_xref="InterPro:IPR007392"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML6"
FT                   /protein_id="ACL01883.1"
FT                   /translation="MDSFMGYGREDGSVGVRNYVAVIPSVACAAPVAAAIARAVPGVVP
FT                   LLHGMGCGRGGSDADMHTRTFQNLCKNPNVGAVIIVGLGCEVVNAEGMALAAAMAGRPH
FT                   ARLMIQAEGGSRKTTAKGIGIAKDFMTQIQVQERKPFPLDKLTLGLECGGSDAFSGVTA
FT                   NPAVGRASDWLVAKGGKVILTETTEMIGTSHILERRSANPEIAEQIKNLISSVEAKTYE
FT                   VLGPIAKMIMSPGNMDGGMSSIREKALGCIIKGGTTPINQVVDYAEIPTQPGLSIMHGP
FT                   GYDAESLTGLAASGAQVIVFTTGRGNPIGFPIVPVVKVASTSRMFQSMEDDMDLNAGAI
FT                   LEGKSLDQMGEDVVQCILDAVNGRRTKAEINEQDGVLCVYSQNTSF"
FT   gene            complement(241412..242431)
FT                   /locus_tag="Dalk_0174"
FT   CDS_pept        complement(241412..242431)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_2014 hypothetical protein; IMG
FT                   reference gene:2503005869; InterPro:Acyl-CoA
FT                   N-acyltransferase; InterPro:GCN5-related
FT                   N-acetyltransferase (GNAT) domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01884"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML7"
FT                   /protein_id="ACL01884.1"
FT                   /translation="MEKQSQETSFTVGLFQPEDAPGVGDLFRAVYGEGYPVKLYYNPNE
FT                   LREAFKKKEVLPFVAKDQDGALIGVTAIYRSSPFERLYESGSGIVLPQYRGAGIASRLQ
FT                   GMLADRKLLKELQIEGLWGEAVANHVFMQKISVHMGFCEAGLEVDLMPAEAYDREKSAA
FT                   GRVGAVIGFKTVKPRPHTVYLPGCYEEELRFLYEDMDDARPLEKAHAGVPADGTTSVDP
FT                   TIYDFAQVARFAIHSVGPDFSEEFQKKEKEIREANKIQVCQAWVKLSHPWCAAAVEALK
FT                   GQGYFLGGLLPRWFDDDGLLMQKILHTPNWEGVKLYSDRAKRIMDMAYKDWENVGGVK"
FT   gene            complement(242435..243646)
FT                   /locus_tag="Dalk_0175"
FT   CDS_pept        complement(242435..243646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0175"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   ppd:Ppro_1511 major facilitator transporter; IMG reference
FT                   gene:2503005870; PFAM: Major Facilitator Superfamily;
FT                   InterPro:Major facilitator superfamily; InterPro:Major
FT                   facilitator superfamily MFS-1; InterPro:Major facilitator
FT                   superfamily, general substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01885"
FT                   /db_xref="GOA:B8FML8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML8"
FT                   /protein_id="ACL01885.1"
FT                   /translation="MTDASRRQENPLKEPAQAPLLTAPFVLLILAFFLGLCNMAVFFNF
FT                   YACLIANGVEAGTAGFLLGLFSLTALIVRPFISPLIHPGNALPWIGLGAAGMILCLGGY
FT                   TLSHETLIIGIIRAAHGLSFVVMVTAVISSTVGVISPQKSGLAFGIMSIVNLLPFAIIP
FT                   ALVEFGLSHGLTQANIYMLAAASTALVFPLLLVIKRLHTRTSSAENGEKAIPTRREIMN
FT                   NFKRADIILALSLGAVAYLCFAIIFMFLKSYGPTIGVEKVSPFFALATVSMIGIRLASA
FT                   ALFDHWNKVRLCTGALIFVGLMFLLLQSTRSQWCFYASGALLGLGWGIAMPVIMAIVFN
FT                   LSEPRLRAFNTNMMIEMVDLGYFLGPFLGGLVVSSYGYSVLFFIMSAVSIIFGLLALRL
FT                   AGKV"
FT   gene            complement(243664..244641)
FT                   /locus_tag="Dalk_0176"
FT   CDS_pept        complement(243664..244641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0176"
FT                   /product="adenosine deaminase"
FT                   /EC_number="3.5.4.4"
FT                   /note="KEGG: saq:Sare_1766 adenosine deaminase; TIGRFAM:
FT                   adenosine deaminase; PFAM: adenosine/AMP deaminase; IMG
FT                   reference gene:2503005871; PFAM: Adenosine/AMP deaminase;
FT                   TIGRFAM: adenosine deaminase; InterPro:Adenosine deaminase;
FT                   InterPro:Adenosine/AMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01886"
FT                   /db_xref="GOA:B8FML9"
FT                   /db_xref="InterPro:IPR001365"
FT                   /db_xref="InterPro:IPR006330"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8FML9"
FT                   /protein_id="ACL01886.1"
FT                   /translation="MIDAIQDRFRALPKAELHVHLEGALPLEFLNRLAADKGRDPIKPD
FT                   IFAFKNFEEFALCFFTTTSLLEDEEDFYQAARAFVEAQAEENIVYTEFSFMPGFHVKRG
FT                   VKPEAMFQGLYSGLQDGMKQHPVQVKILFSISRMFGAEAGEETLDYIRRFPDDHILGID
FT                   LAGMEVPDSITPFASCFKEARAMGLETVAHAGEFSGPDHVAQTIEILRPRRIGHGLGAA
FT                   LDNRICRMLAERDIALELAPTSNVLLGAAASYEKHPLAKLMKMGVPVTLNSDDPIFFST
FT                   TLSREYAIARTVMGLDEDSLMAILANGFQYGFLDPKDKERTDDQ"
FT   gene            complement(244634..245764)
FT                   /locus_tag="Dalk_0177"
FT   CDS_pept        complement(244634..245764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0177"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class I and II; KEGG: sfu:Sfum_2015
FT                   histidinol-phosphate aminotransferase; IMG reference
FT                   gene:2503005872; PFAM: Aminotransferase class I and II;
FT                   TIGRFAM: histidinol-phosphate aminotransferase;
FT                   InterPro:Aminotransferase, class I/classII;
FT                   InterPro:Histidinol-phosphate aminotransferase;
FT                   InterPro:Pyridoxal phosphate-dependent transferase, major
FT                   domain; InterPro:Pyridoxal phosphate-dependent transferase,
FT                   major region, subdomain 1; InterPro:Pyridoxal
FT                   phosphate-dependent transferase, major region, subdomain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01887"
FT                   /db_xref="GOA:B8FMM0"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM0"
FT                   /protein_id="ACL01887.1"
FT                   /translation="MTTCALPDFDRLVPPHIKCFEAYVPSKPDDVLMQYYGCSSLLRLN
FT                   NNENPLGPPGESRQAILDFPPNKASVYPSGDAYHLRRKLAERFGMGPDQFLVGNGANEV
FT                   IAFVIKAFCQEGDNIVTADKTFAVYEWVAQFSGFEARTVPLKDYGFNDEAMLAAADERT
FT                   KIFFVCNPNNPTGTYWDRNKLLNFLNRVGNKSIVVVDEAYCEFVEKPDFPDAMELLSQY
FT                   PNLVTFRTFSKMFGLASLRIGYLAGSPEVVDIIRRTCVVYSVNALAQAAALAALESKHH
FT                   IENTRALVREAKEYLNHEMNSLGLFTVGEEGCYLMVRLPMSDSLAYRKLMSQGVMIRTM
FT                   TGFRFPNFIRVSVGEMPAMQRFVHCLKNILRESGHD"
FT   gene            complement(245775..247070)
FT                   /locus_tag="Dalk_0178"
FT   CDS_pept        complement(245775..247070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0178"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: sfu:Sfum_2016 hypothetical protein; IMG
FT                   reference gene:2503005873"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01888"
FT                   /db_xref="GOA:B8FMM1"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM1"
FT                   /protein_id="ACL01888.1"
FT                   /translation="MNASEVVLELAASPEFFPVARSVTENASLAMGLEKAEARRVAMAT
FT                   EEIFMSLCKSAPGRKLSIRCTPGGYCVITEFIFQDPGFPLEYFNMTSSVSTSNEQDMAN
FT                   LGLLVASRIMDGFSVERDDSGRFMLKLIKEKCYPRHTGEGASYLPPLAAFSVRKANSEE
FT                   AAYAAAQAVGLYPSHALPRHFLHPRMLADRIDFGGATAAIAVGPGGEIAGIIAWDLSSS
FT                   GNMVECHGPFLFTRDGNPALCEALLDFCIGDIAKLPVMGLINRRHNRDIPIHYFETVGS
FT                   LPLTAGNGETFQAPAYFRQMQEDTGCNAWAHESLEEFLEKQYARLCLPRKILRPSGRAL
FT                   DPQSRSVLFSEFDRNAGNVTFLPVSPGQDILPNVEAHLKMANKESIKNVFFGIDLGRPW
FT                   QADFAPAILQAGFSPRYILPYAGCGDMAFFSL"
FT   gene            complement(247390..248244)
FT                   /locus_tag="Dalk_0179"
FT   CDS_pept        complement(247390..248244)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0179"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; 4Fe-4S ferredoxin iron-sulfur
FT                   binding domain protein; KEGG: dol:Dole_1688 nitroreductase;
FT                   IMG reference gene:2503005874; PFAM: Nitroreductase family;
FT                   InterPro:4Fe-4S ferredoxin, iron-sulphur binding, conserved
FT                   site; InterPro:4Fe-4S ferredoxin, iron-sulpur binding
FT                   domain; InterPro:Nitroreductase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01889"
FT                   /db_xref="GOA:B8FMM2"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM2"
FT                   /protein_id="ACL01889.1"
FT                   /translation="MDIFTIDPDKCNRDGICVTECPVAGIQMLDKEGVPTPGPGLEQTC
FT                   MACGHCVAVCPTGALSHRDVPIEQCPEIKKDLVINQDQAEQFLRSRRSVRVYKDKSAPR
FT                   EVLKQLVDMAHYAPTAHNDQEVCFTVIEDKEEVKMLAGLSIDWMRGIMEADPGLGKKMS
FT                   LPLFIGAWDMGFDVVCRSAPHMILAHAEHGKSPFSRYYPTDCASALAYVELAAPTLGLG
FT                   TFWGGMFMGAALAYPPLLEAMNLPKDHRLNGVLMLGYPKFKYHRLPERKPVPVRFSVKD
FT                   SMA"
FT   gene            complement(248436..248936)
FT                   /locus_tag="Dalk_0180"
FT   CDS_pept        complement(248436..248936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0180"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   drm:Dred_0287 3-isopropylmalate dehydratase, small subunit;
FT                   IMG reference gene:2503005875; PFAM: Aconitase C-terminal
FT                   domain; TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; InterPro:3-isopropylmalate dehydratase, small
FT                   subunit, subgroup; InterPro:3-isopropylmalate dehydratase,
FT                   small subunit-like; InterPro:Aconitase A/isopropylmalate
FT                   dehydratase small subunit, swivel;
FT                   InterPro:Aconitase/3-isopropylmalate dehydratase, swivel;
FT                   InterPro:Aconitase/isopropylmalate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01890"
FT                   /db_xref="GOA:B8FMM3"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM3"
FT                   /protein_id="ACL01890.1"
FT                   /translation="MENIKGKVWTFGDDVDTDLIIAARYLTTSDPDELAKHCMEDADPA
FT                   FAGKVGKGDIMVAGKNFGCGSSREHAPISIKAAGVTCVIAKSFARIFYRNAFNTGLPIL
FT                   ECAEADAIEDGAVLTVDFDNGVITDESTGKTYQTKPIPPFMQELLDSGGLMEHIAQKIK
FT                   ANG"
FT   gene            complement(248950..250209)
FT                   /locus_tag="Dalk_0181"
FT   CDS_pept        complement(248950..250209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0181"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="catalyzes the isomerization between
FT                   2-isopropylmalate and 3-isopropylmalate in leucine
FT                   biosynthesis; IMG reference gene:2503005876; PFAM:
FT                   Aconitase family (aconitate hydratase); TIGRFAM:
FT                   3-isopropylmalate dehydratase, large subunit; homoaconitate
FT                   hydratase family protein; InterPro:3-isopropylmalate
FT                   dehydratase, large subunit, prokaryotic; InterPro:Aconitase
FT                   family, 4Fe-4S cluster binding site;
FT                   InterPro:Aconitase/3-isopropylmalate dehydratase large
FT                   subunit, alpha/beta/alpha;
FT                   InterPro:Aconitase/3-isopropylmalate dehydratase large
FT                   subunit, alpha/beta/alpha, subdomain 1/3;
FT                   InterPro:Aconitase/3-isopropylmalate dehydratase large
FT                   subunit, alpha/beta/alpha, subdomain 2;
FT                   InterPro:Aconitase/isopropylmalate dehydratase;
FT                   InterPro:Homoaconitase/3-isopropylmalate dehydratase, large
FT                   subunit, prokaryotic;
FT                   InterPro:Homoaconitase/3-isopropylmalate dehydratase, large
FT                   subunit, subgroup; InterPro:Homoaconitase/3-isopropylmalate
FT                   dehydratase, small/large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01891"
FT                   /db_xref="GOA:B8FMM4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FMM4"
FT                   /protein_id="ACL01891.1"
FT                   /translation="MGMTIAEKILAAHAGQEEASPGDLINAKVDIALGNDITAPIAIKL
FT                   FRQSGAAKVFDKDRVVLVPDHFTPTKDINSAMQVKMVRDFAREQELSHWYEGGDSGVEH
FT                   ALLPEKGIVGPGDLVIGADSHTCTYGGLGAFATGVGSTDLAAAMITGEVWLKVPESIKF
FT                   VYKGKLRPHVEGKDLILHTIGDIGVDGALYMAMEFTGEVIDALPMAERLTMANMAIEAG
FT                   GKAGIIAPDAKTKEYADGRVIRKPVFYASDPDAKYAKVIEYDVTDLEPQVAFPHLPENT
FT                   RPISQVGEVPIHQVIIGSCTNGRIEDMRSAARILTGNKADKNVRLIIIPATPQIYRQAM
FT                   EEGLFDTFLSAGAVISPPTCGPCLGGHMGILAAGERAVATTNRNFVGRMGHVESEVYLA
FT                   NPAVAAASAIAGKIAGPDDI"
FT   gene            complement(250223..252019)
FT                   /locus_tag="Dalk_0182"
FT   CDS_pept        complement(250223..252019)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0182"
FT                   /product="GTP-binding protein LepA"
FT                   /note="binds to the ribosome on the universally-conserved
FT                   alpha-sarcin loop; IMG reference gene:2503005877; PFAM:
FT                   Elongation factor Tu domain 2; Elongation factor G
FT                   C-terminus; Elongation factor Tu GTP binding domain;
FT                   GTP-binding protein LepA C-terminus; TIGRFAM: GTP-binding
FT                   protein LepA; small GTP-binding protein domain;
FT                   InterPro:Elongation factor G/III/V; InterPro:GTP-binding
FT                   protein LepA; InterPro:GTP-binding protein LepA,
FT                   C-terminal; InterPro:Protein synthesis factor, GTP-binding;
FT                   InterPro:Small GTP-binding protein; InterPro:Translation
FT                   elongation factor EFG/EF2, C-terminal; InterPro:Translation
FT                   elongation factor EFTu/EF1A, domain 2; InterPro:Translation
FT                   elongation/initiation factor/Ribosomal, beta-barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01892"
FT                   /db_xref="GOA:B8FMM5"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006297"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013842"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035654"
FT                   /db_xref="InterPro:IPR038363"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM5"
FT                   /protein_id="ACL01892.1"
FT                   /translation="MDRIRNFSIIAHIDHGKSTLADRLIQATDVVNERDFKDQILDTMD
FT                   IERERGITIKSQTIRLPYKAKDGKEYVLNLIDTPGHADFTYEVSRALASCEGVLLVIDA
FT                   SQGVEAQTLANLYLAMEHDLEIIPVINKIDLPSADIDRVMGQIDEDLGLDPDKTVCVSA
FT                   KEGTGVPELLEAIVTHLPPPKGDPDAPLKALIFDSHYDPFRGTIVHFRVFHGTLNKGDT
FT                   IKFMYNSSSYKVEETGFFQIQRIPKKSLSAGEVGYIIAGIKTVSDTRCGDTITLKSAPC
FT                   DKPMPGFKEAKPVVFSSIYPVASDDYPDLTIALEKLKLNDASLTYEKDSSAALGFGFRC
FT                   GFLGLLHLEVVQERLEREFDLSLLLTAPSVQYRINMSDGDTMIVDNPALYPDPTLIDSS
FT                   EEPYIKAAIIVPDRYMGAVMKLCLDRRGNNLGYQYLTANRMEMTFELPLAEVIYDFYDK
FT                   LKSVTQGYGSFDYEITGYKPSSLVKVDILINGDRVDALSMLVHKDNAVFRARHACDKLQ
FT                   DEIPRQMFKIAIQGAIGGTIIARKTISAYRKDVTAKCYGGDISRKRKLLEKQKKGKKRM
FT                   KMIGNVEIPQSAFLAVLKTDDE"
FT   gene            complement(252487..253074)
FT                   /locus_tag="Dalk_0183"
FT   CDS_pept        complement(252487..253074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0183"
FT                   /product="hypothetical protein Dalk_0183"
FT                   /note="IMG reference gene:2503005878; PFAM: Domain of
FT                   unknown function (DUF3335); InterPro:Protein of unknown
FT                   function DUF3335"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01893"
FT                   /db_xref="InterPro:IPR021770"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM6"
FT                   /protein_id="ACL01893.1"
FT                   /translation="MKQPAPLAFWKQSKFNSCGPAVMMTALHELGMPGLSEKREMEIWK
FT                   QVKHPFGLGSLPARMAIYAASQGVKVKFLHKNISPDHFKIYWKTPRKTLHKQLIRTYYE
FT                   TAKEAENNGLPTEHYQDEQEILDRLMETPGLRVIYLIIDDDGVLHFVLAREKDGRIVVM
FT                   DPYYGRNNVFDLPDFQNRRFPAMVGYAILLSA"
FT   gene            253266..254141
FT                   /locus_tag="Dalk_0184"
FT   CDS_pept        253266..254141
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0184"
FT                   /product="hypothetical protein Dalk_0184"
FT                   /note="KEGG: azo:azo1674 hypothetical protein; IMG
FT                   reference gene:2503005879; PFAM: SprA-related family;
FT                   InterPro:SprA-related family"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01894"
FT                   /db_xref="InterPro:IPR021973"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM7"
FT                   /protein_id="ACL01894.1"
FT                   /translation="MEIFASQAALAYMAYMPSFQNSGAPSKESEESNPYDVKDKVSISR
FT                   EAADLYQNIAGHNEMEESEFAEEAGEAGEAGEGSESGEARDAEKMGKSAESSVTNEAEL
FT                   SEGEKEMVRELQARDKEVRAHEAAHMAAGGGVVKSGATFSYQQGPDGKRYAVGGEVQVD
FT                   TSRESEPEATLQKMQQVKRAALAPASPSGQDRSVAARAARIMTEARAEVAEQTRAESEA
FT                   ETTGETEESTEMENAPEAALGDGEGRVESAEVETDEPVEQAAPQPRQRIVSRSGDVNYG
FT                   IDPGDHPASG"
FT   gene            254303..257272
FT                   /locus_tag="Dalk_0185"
FT   CDS_pept        254303..257272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0185"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: dde:Dde_0558 multi-sensor signal transduction
FT                   histidine kinase; TIGRFAM: PAS sensor protein; PFAM:
FT                   ATP-binding region ATPase domain protein; histidine kinase
FT                   A domain protein; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein; IMG
FT                   reference gene:2503005880; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:GAF; InterPro:PAC motif; InterPro:PAS;
FT                   InterPro:PAS fold; InterPro:PAS fold-4;
FT                   InterPro:PAS-associated, C-terminal; InterPro:Signal
FT                   transduction histidine kinase, core; InterPro:Signal
FT                   transduction histidine kinase, homodimeric; InterPro:Signal
FT                   transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01895"
FT                   /db_xref="GOA:B8FMM8"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM8"
FT                   /protein_id="ACL01895.1"
FT                   /translation="MQENSEQIVNKVKSLEIETLRQKRLLTRLEGLTNLKEELIFPYSL
FT                   EEKVGLIAREIVNIFDADFARIWLVGPGDRCEKGCFHAQAPKGPHYCADRSQCLHLVSS
FT                   SGRYSSLDGRHARVPFGAYKIGLIGSGALPDFLTNEVTTDPRVHNHEWAKELGLQSFYG
FT                   HRLLSDDGRVSGVLAVFSRHKIPPEEFTILRSLAVTATHAINAAYTENALKESEARLRN
FT                   VFDNMQDCFYRTDLKGRITWVSPSTPKLLGYEMEEVLHRDIKNLFYFNPADRDKFLAKL
FT                   NVTGKVTDAEVKLKHKDGSPIWVSTNSAYYKDAKGAVAGVEGSFRDVSQRKRRMEEIAR
FT                   YQDRLEEMVEERTRALVESEQKYRALFENSGNAIFVLAKDSVVDCNAKAAEVFGVPQEY
FT                   LINKHPLAYSTPRQPGGEDSLILGEKLLARAFEGEEFFLEWRYQRPDGSIFDSEVILNP
FT                   VSIGGVSFVIGTVADITERKQAEAQRSMLIKILESTSDMVSFSTPDMQITYINPAGRRI
FT                   LGLDKGDELPLVKDVMTPEAFDIISREGAPAAVEHGHWSGETALAMEDGTEIPVSQVIM
FT                   SHKDAEGRVENFSTIIRDISGPKKTEEELERLRDFLSAVIDSMPSVLVGLDEQGRITRW
FT                   NTKTEELLGKTSAQVRGRLLSEVFPHNPDILRMVDEAIENEKVSERLKAPIQFQGILRF
FT                   WDVTVYPLSESAMKGAVIRVDDVTERVRLEEMMIQSEKMLSVGGLAAGMAHEINNPLAG
FT                   IIQNVQVLEKRLGTGLSKNHNVAEEAGTSMDAIARYLEKRDLLRVMQAIRESGGRAAAI
FT                   VNNMLDFSRKGDSAFLPQDLCQVMDQTIELASSDFDLKKRYDFRQIKIKKDYQDCMPKI
FT                   RCEKTKVQQVILNLLQNAAQAMAGQWDDDNPPEIAIRIFSKDDKACIEVADNGPGMDES
FT                   VRKRVFEPFFTTKEIGVGTGLGLSVSYFIVTENHNGTMHVESAPGKGAKFTICLPAEEI
FT                   "
FT   gene            complement(257281..257790)
FT                   /pseudo
FT                   /locus_tag="Dalk_0186"
FT   gene            complement(257888..258073)
FT                   /locus_tag="Dalk_0187"
FT   CDS_pept        complement(257888..258073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0187"
FT                   /product="hypothetical protein Dalk_0187"
FT                   /note="IMG reference gene:2503005882"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01896"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMM9"
FT                   /protein_id="ACL01896.1"
FT                   /translation="MPKITIDPLVYSEAKWAAESLGYSSLEEFVHHVIEKELSKLASPE
FT                   EDAAIDRRLKGLGYIK"
FT   gene            complement(258088..260034)
FT                   /locus_tag="Dalk_0188"
FT   CDS_pept        complement(258088..260034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0188"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: sus:Acid_6180 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; IMG reference
FT                   gene:2503005883; PFAM: Type I phosphodiesterase /
FT                   nucleotide pyrophosphatase; InterPro:Alkaline
FT                   phosphatase-like, alpha/beta/alpha;
FT                   InterPro:Alkaline-phosphatase-like, core domain;
FT                   InterPro:Twin-arginine translocation pathway, signal
FT                   sequence; InterPro:Type I phosphodiesterase/nucleotide
FT                   pyrophosphatase/phosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01897"
FT                   /db_xref="GOA:B8FMN0"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN0"
FT                   /protein_id="ACL01897.1"
FT                   /translation="MADFHTSIGRRAFIKGAASTLAGLTAATRAAPVLARKTVQNVPKV
FT                   AVLGIDGMDPFFTHELLSRGLLPHFARLANQGGFYKLATVNPPQSPVVWASFINGAGPG
FT                   AHGLFDFIHRNPSDQCRPFYSAAQTKDGKTLCGRQGDPFWEALDQAGVPSVFYDLPADY
FT                   PPSPSKKGNRRCLAGMGVPDLMGTHGTYQYFSHDGPGYILREGGGLRTRIVFHDGQAKA
FT                   RLEGPANPHDEQKPVYVEFRVKADPSRKSAEIRIQGQNISLREKEWSPWIRVEFILKTP
FT                   FYMADKKANGICRFYLQEAAPGFRLYVSPINADPSDPILPLSEPKGFVRDIAKENGLFY
FT                   TSGFQEDHKAFSNGIFSAREYKDQAWLVLKERERLLDYALDHYRDGLLFFYFSTLDLMS
FT                   HMFWTDHDFRKGRKSGQNHERMVRAYREMDRMLGKVQDRLGARAAVMVMSDHGFAGFRR
FT                   QFHVNAWLRDNGYLGSGEAESIMEGMDWKDVRAYGLGINGLYVNLKGREREGVVEPGRA
FT                   YNRLVEELAAKLEAIRDANGVQVIKKAHRADRIYKGPALALAPDLVLGYSRGYRTSWES
FT                   CLGGLAPQVLSDNPSAWAADHCCDASEVPGVLFTNRPLSRVEPSVMDIAPTVLSLYGLD
FT                   ALSGMEGRSLKFT"
FT   sig_peptide     complement(259945..260034)
FT                   /locus_tag="Dalk_0188"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005883_SP"
FT   gene            complement(260010..262133)
FT                   /locus_tag="Dalk_0189"
FT   CDS_pept        complement(260010..262133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0189"
FT                   /product="type I phosphodiesterase/nucleotide
FT                   pyrophosphatase"
FT                   /note="PFAM: type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: sus:Acid_6181 type I
FT                   phosphodiesterase/nucleotide pyrophosphatase; IMG reference
FT                   gene:2503005884; PFAM: Type I phosphodiesterase /
FT                   nucleotide pyrophosphatase; InterPro:Alkaline
FT                   phosphatase-like, alpha/beta/alpha;
FT                   InterPro:Alkaline-phosphatase-like, core domain;
FT                   InterPro:Type I phosphodiesterase/nucleotide
FT                   pyrophosphatase/phosphate transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01898"
FT                   /db_xref="GOA:B8FMN1"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN1"
FT                   /protein_id="ACL01898.1"
FT                   /translation="MKKQNPCLISQVILFAGLCCLAAPGQAWAYIGPGAGIALAGSYLP
FT                   AIIGFVAALLLALIWPIRIFLKDRATRKVLKNRPIQKCVILGIDGFDPELAQDYMDQGL
FT                   LPNFQRLATSGCFKKLQTTAPAITPVAWSTFQTGTNPGKHGIFDFLARGRASYAPVLSS
FT                   VKAGGAAPHIRLGKFKIPRGVAPQRLLRKSKPFWEILGDEQIYSQILRVPVSFPAGEFN
FT                   GAILAGAYTPDIRGTQGVFSYYYTGENRFENSEGDLHKVEFIGGAIHGVLTGPADPFED
FT                   DGEDLKSSFSVEVLSGAQAILKIGKTRLSLEQGVFSPWTRVRFKAAPGVHIHGICRFLL
FT                   VSDQPEFALYVSPVHIDPARPAAPISQPKAYASFLARKLGPYATLGIPEDTQALETGIL
FT                   DQTAFLDQCLSVENERRKMFLHALKSAKQGLIACVFDSPDRIQHCFWDRLQSAGRDQDN
FT                   PIKDVYVRMDKLVGEALEECRNRRSVFMVVSDHGFAPFNHAVDLNCWLEQKGYLKRLEN
FT                   PKSNKNLSAIDWGQTKAYAFGLAGIYLNIKGREPLGAVNRGLEARKLAEKIAGELKSLI
FT                   HPEMEAAPITNVYHAKEIFKGPYAHESPDLVVGFARGYRVSWETASGAVGDRVFRKNNR
FT                   VWSGDHCVDPSHVPGVLFCNKHFSKEDPHISDIAPTVLKMFGVNVPGFMDGAPLKIGKP
FT                   SEDSVAWRISTPV"
FT   sig_peptide     complement(262047..262133)
FT                   /locus_tag="Dalk_0189"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005884_SP"
FT   gene            complement(262150..263643)
FT                   /locus_tag="Dalk_0190"
FT   CDS_pept        complement(262150..263643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0190"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; type I phosphodiesterase/nucleotide
FT                   pyrophosphatase; KEGG: sus:Acid_6183 sulfatase; IMG
FT                   reference gene:2503005885; PFAM: TAT (twin-arginine
FT                   translocation) pathway signal sequence; Sulfatase;
FT                   InterPro:Alkaline phosphatase-like, alpha/beta/alpha;
FT                   InterPro:Alkaline-phosphatase-like, core domain;
FT                   InterPro:Sulfatase; InterPro:Twin-arginine translocation
FT                   pathway, signal sequence; InterPro:Twin-arginine
FT                   translocation pathway, signal sequence, bacterial/archaeal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01899"
FT                   /db_xref="GOA:B8FMN2"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN2"
FT                   /protein_id="ACL01899.1"
FT                   /translation="MGDHAIPASTGKRHSAKCEDILSKGFSRRDVLKWAVAGAAAGAIP
FT                   MGAGCGSSEAGPPVPKHIILISMDTLRRDHLPVYGYSRNTAPGVSMLAESSVIFDNALA
FT                   AASNTAPSHASMLTGVHPLTHGVKSNWAMLSPDAVTLAEILRGQGFAAGAFVSCIALHS
FT                   NITGLDRGFDVYRQVGPAPGHCRARETFLDASAWLNALKNKRRVFLFFHVFDPHFPYSA
FT                   PGGEIRPEWEGSSRKRDLPLDYPAMRARMKRGFSQDEIQAYTDWYDEEIRYADLYIERL
FT                   LQTLRDKGMFDDSLVIFLSDHGETLGERPWMFDHGSKVYEEQIRIPLVIKFPGAWKKGT
FT                   RIAAPVHHVDVTPTVLDALGLQPPEIMEGVPLAPMVQKPEAAAERFMFCMAQSDPERTS
FT                   ELKQPIAPGKPVFCIRRPPHKLVMYPGEKARPVVCLHDLSSDPKEMNNTAQVQPAIAGD
FT                   LKRRLDAWINASLSKGRKYETVPLSPEMDRALRSLGYIG"
FT   gene            264234..265166
FT                   /locus_tag="Dalk_0191"
FT   CDS_pept        264234..265166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0191"
FT                   /product="hypothetical protein Dalk_0191"
FT                   /note="KEGG: fre:Franean1_5633 DoxX family protein; IMG
FT                   reference gene:2503005886; PFAM: Methylamine utilisation
FT                   protein MauE; InterPro:Methylamine utilisation MauE;
FT                   InterPro:Thioredoxin fold; InterPro:Thioredoxin-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01900"
FT                   /db_xref="GOA:B8FMN3"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN3"
FT                   /protein_id="ACL01900.1"
FT                   /translation="MTHRPKKSLPGISPYISKGSALVLGLIFVAGGAAKVVDMNEAVRQ
FT                   AGAYSIVSDRAMLLFLVWALVVAEFAVGAALVIRYRVRLALAGATAMLAVFFAALAWAW
FT                   ATGVTEDCGCFGQWASRSPGQALIEDLVLLLLLVLAWFHGDYKKSLAKLTIVIAALPLA
FT                   LGLPFAFGFTLDSMILPGAEGPPIEPLPILSGETVDWSASPYLVEMMSTDCLHCQESVM
FT                   DVNILGDAPGMPPIMALSYDSQEAVASFKEDYFPEYPILRISEDHFWRLVGPGASPRFL
FT                   LVVQGHVVHAWEERPPEAREVLNALEARQ"
FT   sig_peptide     264234..264335
FT                   /locus_tag="Dalk_0191"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005886_SP"
FT   gene            265163..266308
FT                   /locus_tag="Dalk_0192"
FT   CDS_pept        265163..266308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0192"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: rfe:RF_0310 TPR
FT                   repeat-containing protein; IMG reference gene:2503005887;
FT                   PFAM: Tetratricopeptide repeat; InterPro:Tetratricopeptide
FT                   repeat; InterPro:Tetratricopeptide repeat-containing;
FT                   InterPro:Tetratricopeptide TPR2;
FT                   InterPro:Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01901"
FT                   /db_xref="GOA:B8FMN4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN4"
FT                   /protein_id="ACL01901.1"
FT                   /translation="MNFLSLDIILTAFPAASCLFFLVQCSRIAVTAKPIVLSSRRHFSF
FT                   IAIPVMVMVGVSMYKITVIPGYIPERVYFVIAAVFFAVCAGVILRRGDWYYMFAADKKA
FT                   LFTALRQSLLGWEIQFEENKAPEGEGSEHLTEFVLEDVPARLRVSVYEGQDMAQIGAVP
FT                   SDNRLLGCLMSDLKKQASQLGGSRGVSGFLITACILSGLASYWTYTNIHSMDDAWFAEK
FT                   GRTYLEMKKYHAAISTFDAALEKNSANVEALRWRGKTYGETGREDLALADWQKALDLDP
FT                   NNSDIMAHAARILFLSQDQGQKSRAMTLARKAVNLQPDNVFVLDTLAWILAGMGEFEEA
FT                   VEHQEKVLVILGRKKADSALMQRVTARLNAYKLGKPAPAQP"
FT   gene            266479..266673
FT                   /locus_tag="Dalk_0193"
FT   CDS_pept        266479..266673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cps:CPS_1237 hypothetical protein; IMG
FT                   reference gene:2503005888; PFAM: Protein of unknown
FT                   function (DUF2892); InterPro:Protein of unknown function
FT                   DUF2892"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01902"
FT                   /db_xref="GOA:B8FMN5"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN5"
FT                   /protein_id="ACL01902.1"
FT                   /translation="MTMEHMIRLIAGTMILLSIFLTLIHSPYWLLLTGFVGANLLQSAF
FT                   TKWCLMEDILTKLGVDKGC"
FT   gene            266703..267581
FT                   /locus_tag="Dalk_0194"
FT   CDS_pept        266703..267581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0194"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: ter:Tery_1841 peptidase
FT                   C14, caspase catalytic subunit P20; IMG reference
FT                   gene:2503005889; InterPro:Armadillo-like helical;
FT                   InterPro:Armadillo-type fold; InterPro:PBS lyase HEAT-like
FT                   repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01903"
FT                   /db_xref="GOA:B8FMN6"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN6"
FT                   /protein_id="ACL01903.1"
FT                   /translation="MAKVILLQPRQRLLERARNYVESPDLFAENMKRAVRELIKVLPVA
FT                   DGPLRHKIMILLAGYAKDQAVEPLYDILKDEDQPPRTRHYAAVQLCAVLPFVKDAQSVI
FT                   DLLEKDLVCPDPNLRRYATTAMGWQCKTPTFVLLTRRLYDDDLGVRLAAVNSLCNCGDA
FT                   RALPLLLERLEEAPLEEKRAILFNLWRLERPELQLSHIYKKYLADQAPELRLAALALLT
FT                   FSHRDEESHQLIRPCLSDEDHRVRRLALERLMDCGLKTLGAFEQEIRQLLNDSNMDIKR
FT                   SALNALKMLEN"
FT   gene            complement(267636..269627)
FT                   /locus_tag="Dalk_0195"
FT   CDS_pept        complement(267636..269627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0195"
FT                   /product="signal transduction histidine kinase, nitrogen
FT                   specific, NtrB"
FT                   /note="KEGG: dvl:Dvul_0316 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB; TIGRFAM: PAS sensor
FT                   protein; PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein;
FT                   IMG reference gene:2503005890; PFAM: HAMP domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:HAMP linker domain; InterPro:PAS; InterPro:PAS
FT                   fold-4; InterPro:Signal transduction histidine kinase,
FT                   core; InterPro:Signal transduction histidine kinase,
FT                   homodimeric; InterPro:Signal transduction histidine kinase,
FT                   subgroup 1, dimerisation/phosphoacceptor domain;
FT                   InterPro:Signal transduction histidine kinase-related
FT                   protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01904"
FT                   /db_xref="GOA:B8FMN7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN7"
FT                   /protein_id="ACL01904.1"
FT                   /translation="MKISTRLRYNAAASVVLVCLLFVLLLSFSQSMKKQIATYNYANEL
FT                   LHKTSTLNALTHEYLMKHDQRSEKQWRYQFDDIMDSLGRNQNSEPMIRVRNNLDMLKNH
FT                   YNKLNIEIQALKAMDPKAISEEESKRFKFSKRLLSDQMQICSQRILTHVFRITTEASQK
FT                   LNELRTRSIYVLLLFGGFMVFITVLNAFTTLNRIARPLADLVKQVNVLEKTDFSKGILQ
FT                   ETMWDTPNKNDEVGRLWAAFGDMKVRLAKAFRKINRELKDRQAAEQEVRERNAQLKELQ
FT                   DMLESIINSMPSMLVGIDSDGRITHWNSEAERQINLNMAQAEGRYLQDLLPALRPWVDE
FT                   AKGTVKAGQPFKLEKQPLEINGKEIHADITLFPLVSGRQSGAVIRVDDVSERVAMDEII
FT                   IQSEKMLSVGGLAAGVAHEINNPLAGILQNMQVVINRLSTELPKNKAVAEKCNTSMEAV
FT                   NAYLEAREIMRLLSLIRDSGERASAIVDNMLSFSRMNRSQPERRSLAELTDKTLELAAS
FT                   DYDLKKKYDFRSIKIMRDYEDSLPEVMCEAGKIQQVMLNLFKNAAQAMINGSSKSINPE
FT                   IRLGLHRNGDMVDIEVEDNGPGVPKEIRSKIFEPFFTTKEVGEGTGLGLFVAYFIVVNN
FT                   HHGSMRVESSPGKGAKFIVQLPIEQSGK"
FT   sig_peptide     complement(269529..269627)
FT                   /locus_tag="Dalk_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005890_SP"
FT   gene            complement(269687..270712)
FT                   /locus_tag="Dalk_0196"
FT   CDS_pept        complement(269687..270712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0196"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: glo:Glov_2683 hypothetical protein; IMG reference
FT                   gene:2503005891; PFAM: NMT1/THI5 like;
FT                   InterPro:NMT1/THI5-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01905"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN8"
FT                   /protein_id="ACL01905.1"
FT                   /translation="MSIIRQLVLVFAVLAIGFGAYWASQTKERAGDAPEIMEKVRLAVP
FT                   KGIITAPVLLAQSRGLFAEAGLDVAYEDAYSSGKTAFEAMLRGEADVSVVATAPVVANS
FT                   FSRDDFFIFCTFTTSYEGVKVIARQDLGVKNASDLKGKTVGFVPGTISQLFLDSLLAYN
FT                   RILPQEVNAQPIKPQNASALLNSGEMQAVSIWEPHAYTALKDNQGSAVKVPSSSVYRIS
FT                   ICTASTKDFAAKSPNVLKKIILALKRTTAFMNDQPAQAQKELGELINMDQEPLTLFWKE
FT                   TSFRLSLDQVLLMTMENEAAWMIANRYKDDRLIPDFTRFVYCAPLEEIDPQAVTIVRQQ
FT                   G"
FT   sig_peptide     complement(270644..270712)
FT                   /locus_tag="Dalk_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005891_SP"
FT   gene            complement(270929..271948)
FT                   /locus_tag="Dalk_0197"
FT   CDS_pept        complement(270929..271948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0197"
FT                   /product="Putative TRAP-type C4-dicarboxylate transport
FT                   system, DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: dol:Dole_3157 TRAP dicarboxylate transporter-DctP
FT                   subunit; IMG reference gene:2503005892; PFAM: Bacterial
FT                   extracellular solute-binding protein, family 7;
FT                   InterPro:Extracellular solute-binding protein, family 7,
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01906"
FT                   /db_xref="GOA:B8FMN9"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMN9"
FT                   /protein_id="ACL01906.1"
FT                   /translation="MVKKQACLLIVWAALFSVLLAMPAGAEEWKDRWKFGTIAPDGIGW
FT                   AKQIKNIVIPAVEEATQGTLEVKVYWGGVMGDDEDFVSKMRIGQLQGAGWSGQGVLIAV
FT                   PEMEVVTLPFLFNNYDEVDYIKQEMSEEFDEIAKKNGYMCIAWIDEDICSIYSTKYDMS
FT                   KLQDYKDAKILSWFGDVEERLYKSLGASPISVNMPEAPPALRQGVGDAITASAAWILGT
FT                   QLYSSIKYVSPYKLRYAPAMIAVDWKTWSSMPEPYKEHYYKIRADVVKRFVAGVRSDNI
FT                   KSLEAMKEYGLKEMPVSPEEMEAIRKNAVTIWQESLDSPDTGELLEELLEHLEDFRAK"
FT   sig_peptide     complement(271871..271948)
FT                   /locus_tag="Dalk_0197"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005892_SP"
FT   gene            complement(272381..274054)
FT                   /locus_tag="Dalk_0198"
FT   CDS_pept        complement(272381..274054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0198"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; SMART: Rhodanese domain
FT                   protein; KEGG: sfu:Sfum_1398 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; IMG reference
FT                   gene:2503005893; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase; Pyridine nucleotide-disulphide
FT                   oxidoreductase, dimerisation domain; Rhodanese-like domain;
FT                   InterPro:FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; InterPro:FAD/NAD-linked reductase,
FT                   dimerisation; InterPro:Pyridine nucleotide-disulphide
FT                   oxidoreductase, dimerisation; InterPro:Pyridine
FT                   nucleotide-disulphide oxidoreductase, NAD-binding region;
FT                   InterPro:Rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01907"
FT                   /db_xref="GOA:B8FMP0"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP0"
FT                   /protein_id="ACL01907.1"
FT                   /translation="MNTPKIVIVGGVAGGASCAARSRRLSEEAEIIMIERGPFVSFANC
FT                   GLPYHVGEVIKEEEDLLVASPELFRDRFNIDVRIQCEVTKIDRENKTVTIRKMTTGETY
FT                   DETYDYLVLSPGAAPLRPPLPGIDHPAVFTVRNIPDIRAIKEMTGNGEAKSAVVVGGGF
FT                   IGLEMAENLHHIGMQVSVIEMAEHVMPVLDKEMATMVNEHLDSMRVDLYLGSAVQSFEN
FT                   GPDGKPLVNLASGEQIAADIVIMAIGVRPETGLAKAAGLDLGPRGGIAVDGFMHTNDPN
FT                   IFAVGDAVEVEGYVMGGKRLIPLAGPANRQGRLVADVILNPDKPKPFRGVQGTAVCGVL
FT                   GMTVACTGETEKSLGLMAKDGKVIEYEKVYSHPFSNATYYPGAQQISFKLIFAKEDGRV
FT                   LGAQAVGLAGVEKRIDVVAMAIQMGATVYDLEEAELCYAPQYGSAKDPVNMAGMIAANV
FT                   LKGVSKIVHWPDLENFDGILIDVRDPEEYATGFAEGAINMPLDSLRKNLDSLPKDKEIW
FT                   AYCYVSQRAYFAERILTQHGYNAKTVSGGILSYWAADADA"
FT   sig_peptide     complement(273998..274054)
FT                   /locus_tag="Dalk_0198"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005893_SP"
FT   gene            complement(275107..276390)
FT                   /locus_tag="Dalk_0199"
FT   CDS_pept        complement(275107..276390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0199"
FT                   /product="Transposase"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: pvi:Cvib_1053
FT                   transposase IS116/IS110/IS902 family protein; IMG reference
FT                   gene:2503005894; PFAM: Transposase IS116/IS110/IS902
FT                   family; Transposase; InterPro:Helix-hairpin-helix
FT                   DNA-binding motif, class 1; InterPro:Transposase,
FT                   IS111A/IS1328/IS1533, N-terminal; InterPro:Transposase,
FT                   IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01908"
FT                   /db_xref="GOA:B8FBC8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8FBC8"
FT                   /protein_id="ACL01908.1"
FT                   /translation="MEQQNFSRIENFRQLKTEIRNSPRHLIVGIDVAKEKHHAFFGTPY
FT                   GAVIQRKLVFDNSMEGFEKLLETVRIHTRPKGLEIPVFGLEATANYHKPLGEFLIRRGF
FT                   HVALVSGVAVRRNRELLDGRWDKNDTKDAANVADLVSQGKILFYDFPSQAVREIQSLVS
FT                   LKIKLKKMETGLLVRIRNHILAMYFPELDRFCQRGPDLSLAVIRRMLDPKRIAEMDFAD
FT                   FCMETIGRYPKPNQQLRLAAIQNAARNSVGCGFTEAAGVEAAMLVESLLHTREQVKRTE
FT                   KMIRKIAKQLPHYEYLMSIPGFGPDITSRVIAAIGDPWRFDNYRQVLKLAGLDLNASRS
FT                   GKTSGGAKPVLSKRGKSNLRYALYQAALIASTRNPPFMEWMAEKIQGREKERGIKTKMR
FT                   VKLAAKMLVIAWTLMKNQEPFDPKYLNI"
FT   gene            complement(276655..277737)
FT                   /locus_tag="Dalk_0200"
FT   CDS_pept        complement(276655..277737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0200"
FT                   /product="GTPase EngC"
FT                   /note="PFAM: GTPase EngC; KEGG: ana:alr8077 hypothetical
FT                   protein; IMG reference gene:2503005895; PFAM: Protein of
FT                   unknown function, DUF258; TIGRFAM: ribosome small
FT                   subunit-dependent GTPase A; InterPro:EngC GTPase;
FT                   InterPro:Ribosome biogenesis GTPase RsgA, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01909"
FT                   /db_xref="GOA:B8FMP2"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP2"
FT                   /protein_id="ACL01909.1"
FT                   /translation="MSLENLGWNGFFENNAYSFDDPNLTPARIIGVRKNAFIVHDGDRE
FT                   ILATAAGRLYHDDSPDSLFPAAGDWVLIRDTIIAHVLPRRNALSRGASGARHGRAESAV
FT                   RGQVIAANLDTVFIVCGLDRDYNVRRIERYLTLIYNCGCSPVVILNKADLHPAPLDCAA
FT                   EVESVAFGVPVFAVSAKSGQGVEVLRQFLPPGQTAALLGSSGAGKSTLVNQLSGAEVRA
FT                   AKEVSEAVGKGVHTTTTRDIIPIPGAGMILDNPGIREIALWDDAGGIDDAFPDIQALAK
FT                   ECHYTDCTHEHEPGCRVREAVEIGVLKPARLQNYLKMQKELEFLNQRQEKSANRVEKER
FT                   WKEIAIYQKQFKNKKRPRIR"
FT   gene            278309..278809
FT                   /locus_tag="Dalk_0201"
FT   CDS_pept        278309..278809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0201"
FT                   /product="dCMP deaminase"
FT                   /EC_number="3.5.4.12"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   dps:DP2271 deoxycytidylate deaminase; IMG reference
FT                   gene:2503005896; PFAM: Cytidine and deoxycytidylate
FT                   deaminase zinc-binding region; InterPro:APOBEC/CMP
FT                   deaminase, zinc-binding; InterPro:CMP/dCMP deaminase,
FT                   zinc-binding; InterPro:Cytidine deaminase;
FT                   InterPro:Cytidine deaminase-like; InterPro:dCMP deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01910"
FT                   /db_xref="GOA:B8FMP3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP3"
FT                   /protein_id="ACL01910.1"
FT                   /translation="MSEKRRDYLTWDEYFMGVACLSAQRSKDPNTQVGACVVNRKKKIV
FT                   GIGYNGFPTGCSDDELPWAREGGALDTKYAYVCHAELNAILNSIVSDLEGCTLYVALFP
FT                   CNECAKIIIQSGIKEIVYLSDKYAETDIVRASKTMLEMAGVKWRKLSDCRDSVTVRLSE
FT                   DCV"
FT   gene            280124..280801
FT                   /locus_tag="Dalk_0202"
FT   CDS_pept        280124..280801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0202"
FT                   /product="adenylate kinase"
FT                   /note="PFAM: adenylate kinase; KEGG: dol:Dole_0469
FT                   adenylate kinase; IMG reference gene:2503005897; PFAM:
FT                   Adenylate kinase; TIGRFAM: adenylate kinases;
FT                   InterPro:Adenylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01911"
FT                   /db_xref="GOA:B8FMP4"
FT                   /db_xref="InterPro:IPR000850"
FT                   /db_xref="InterPro:IPR006259"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033690"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FMP4"
FT                   /protein_id="ACL01911.1"
FT                   /translation="MRILFFGPNGSGKGTQGSIVKGKYNIPHIESGAIFRENISKGTEI
FT                   GKKAKEYIDRGDLVPDEITIPMILGRLQADDCGNGWLLDGFPRSKEQAIKLDEALKEAG
FT                   MALDVVIEMILDRQIAKNRIMGRRLCENDNNHPNNIFIDAIKPDGDKCRVCGGALSARS
FT                   DDQDEDAIDKRHNIYYDTDTGTLASAYYFKAIAEKDGSVKYITLNGEPSVPEVTDELVG
FT                   KLG"
FT   gene            281008..281220
FT                   /locus_tag="Dalk_0203"
FT   CDS_pept        281008..281220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0203"
FT                   /product="ribosomal protein S21"
FT                   /note="TIGRFAM: ribosomal protein S21; KEGG: dol:Dole_0468
FT                   ribosomal protein S21; IMG reference gene:2503005898; PFAM:
FT                   Ribosomal protein S21; TIGRFAM: ribosomal protein S21;
FT                   InterPro:Ribosomal protein S21"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01912"
FT                   /db_xref="GOA:B8FMP5"
FT                   /db_xref="InterPro:IPR001911"
FT                   /db_xref="InterPro:IPR038380"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP5"
FT                   /protein_id="ACL01912.1"
FT                   /translation="MKDLEVKVFDNDLEKAMRVLKKKIQNDGLFRRLKMKKAYEKPSES
FT                   RRRKQRESVRRLRSAARKARSRGRR"
FT   gene            281317..282651
FT                   /locus_tag="Dalk_0204"
FT   CDS_pept        281317..282651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0204"
FT                   /product="FolC bifunctional protein"
FT                   /note="TIGRFAM: FolC bifunctional protein; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: dol:Dole_0467 FolC
FT                   bifunctional protein; IMG reference gene:2503005899; PFAM:
FT                   Mur ligase family, glutamate ligase domain; Mur ligase
FT                   middle domain; TIGRFAM: folylpolyglutamate
FT                   synthase/dihydrofolate synthase;
FT                   InterPro:Folylpolyglutamate synthetase;
FT                   InterPro:Folylpolyglutamate synthetase, conserved site;
FT                   InterPro:Mur ligase, C-terminal; InterPro:Mur ligase,
FT                   central"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01913"
FT                   /db_xref="GOA:B8FMP6"
FT                   /db_xref="InterPro:IPR001645"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP6"
FT                   /protein_id="ACL01913.1"
FT                   /translation="MTDINAFNQAMEELFSLGRFGIKLGLETILAMLKGIGDPHLRIQC
FT                   IHIAGTNGKGSVAQNTASILQAAGYKVGVYTSPHLVHINERFTVNGRPISDDEVLEAYQ
FT                   AVKSVSGLERHATFFEYTTAMALYAFDRAGVDYAVMETGMGGRLDATNVLKPELCIITN
FT                   ISVEHEMYLGNTIAQIAYEKAGIIKPGVPVVTGVRQPDAIKAVEKAAAESKAPLYRMGK
FT                   DFKTRRLQGGGFNFYGQDHAWKGLQCRLKGEYQIPNASLALAGCQALTKRGAKITEEQA
FT                   KAGLEQVKWPGRLETIQESPMVILDGAHNLAAMKVLTKYLAETFADRDVTVITGFLDDK
FT                   PYKKMLPMLEALAAKIIITRPKIGRAVETKELTPLIRNKKDRFVEKPSVEEAVKYALEN
FT                   ARDTDVIVVAGSLYIVGEARQTLQDMGLIQDESFSSLSPRNLGPG"
FT   gene            282700..282775
FT                   /locus_tag="Dalk_R0001"
FT   tRNA            282700..282775
FT                   /locus_tag="Dalk_R0001"
FT                   /product="tRNA-Arg"
FT                   /note="IMG reference gene:2503005900"
FT   gene            283036..284028
FT                   /locus_tag="Dalk_0205"
FT   CDS_pept        283036..284028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0205"
FT                   /product="hypothetical protein Dalk_0205"
FT                   /note="KEGG: vfm:VFMJ11_A1183 hypothetical protein; IMG
FT                   reference gene:2503005901; PFAM: Protein of unknown
FT                   function (DUF3187); InterPro:Protein of unknown function
FT                   DUF3187"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01914"
FT                   /db_xref="InterPro:IPR021523"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP7"
FT                   /protein_id="ACL01914.1"
FT                   /translation="MDEQGPETSLESKQAVGVKLKPWAGPNVGYGLLRMPSQSPFQSLR
FT                   LALLPRTPSTLDVHSWEFRLTQTLANTWVNEPNKYFMDYETLHSTASVSRRFHEILFEF
FT                   SFEEQRMLNGMLDGFIKNFHDALNLDQDGRDKAAYGEVNVDVWTPDGREKINWEGGKGA
FT                   FSQNIALVMQHNLTPGGKVWPAFSYSLSFRYDIWNAFDMERDFPVDMGVSFSLAKKMGR
FT                   FHGYLVPGFFWYGSTAMETVEFERTQTSFLAGLEWNFHESASLLVQYLYSEGSCKNLWG
FT                   FKEPSHEVTLGLKGRLTKRFAWEIGVLENIIAYDNSPDFGLHWGLTFRI"
FT   gene            complement(284939..287230)
FT                   /locus_tag="Dalk_0206"
FT   CDS_pept        complement(284939..287230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0206"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein; GAF domain
FT                   protein; PEP-utilising protein mobile region; PEP-utilising
FT                   protein domain protein; KEGG: cja:CJA_0466
FT                   phosphoenolpyruvate-protein phosphotransferase PtsP; IMG
FT                   reference gene:2503005902; PFAM: GAF domain; PEP-utilising
FT                   enzyme, TIM barrel domain; PEP-utilising enzyme, mobile
FT                   domain; PEP-utilising enzyme, N-terminal; TIGRFAM:
FT                   phosphoenolpyruvate-protein phosphotransferase;
FT                   InterPro:GAF; InterPro:PEP-utilising enzyme;
FT                   InterPro:PEP-utilising enzyme, active site;
FT                   InterPro:PEP-utilising enzyme, conserved site;
FT                   InterPro:PEP-utilising enzyme, mobile domain;
FT                   InterPro:Phosphoenolpyruvate-protein phosphotransferase;
FT                   InterPro:Phosphotransferase system, PEP-utilising enzyme,
FT                   N-terminal; InterPro:Pyruvate/Phosphoenolpyruvate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01915"
FT                   /db_xref="GOA:B8FMP8"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP8"
FT                   /protein_id="ACL01915.1"
FT                   /translation="MAPFVNSDRVDLHLKIIQEISELINHAQGLDAVLSQVVEKIAKSL
FT                   HFDVVSIYIWDPTLEKLVMRGNWGLNFEPGTSIMLSPDEGITGSVFSRRRAIAAMPASK
FT                   HPDFKYFPDLGEDKYEVYMGVPILLQRKALGVLVAQTASTRPLLPAEQTLFEIVASRLA
FT                   GLLEVADRLERLGTAPGAVSARKTLQGKGVSGGPGIGPVYLFHGLLHKLPLSGIAGQGV
FT                   DEEMGRFKKAANVAKQELKDLSAVMANEGKISNHDAAIFETHSMMLDDGLFLREIEGLI
FT                   TESKLSAEEATAKGAENVALRFESRGNPLLMERAVDVREVGERVLAALFKLSGRKIKME
FT                   SPATGCVVVAKDLGPAAVARLEGAKPAAIITERGGENSHTTILARSMHIPAVVGVQGAT
FT                   KLLSSGQQVLVDGDTGFVFVEPNAGLIEEYEKTFEESRLVQAEIIAKAQESDLPYGYQV
FT                   DVNVGFPSDVATAKELGIENVGLFRTEFSFMRFDGWPTVEEQIAVYREVGDLFPGDITV
FT                   RTLDIGADKRLPYFAFPDEANPLLGLRSIRFSMEYPDLFREQIKAILSLVKQGHHFRIL
FT                   LPMISRIWEVETAREILEETVTDLAMPPGAVPPMGIMVEVPGLFHQLEDYKDLVDFFSV
FT                   GTNDLIQYLLAVDRDSSVVGHLYSGYHPSVIRMMKSLKEKADSLRKDIAVCGEMASIPG
FT                   GALALCALGYRHFSVPPFQAPGVRYLIQSVTQDVLDQVADTILGLSHEKDIRAYLDHCI
FT                   EQIDPLLLEI"
FT   gene            287575..289389
FT                   /locus_tag="Dalk_0207"
FT   CDS_pept        287575..289389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0207"
FT                   /product="Acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein; KEGG:
FT                   dol:Dole_2366 acyl-CoA dehydrogenase domain-containing
FT                   protein; IMG reference gene:2503005903; PFAM: Acyl-CoA
FT                   dehydrogenase N terminal; Acyl-CoA dehydrogenase,
FT                   C-terminal domain; Acyl-CoA dehydrogenase, middle domain;
FT                   Acyl-CoA dehydrogenase, N-terminal domain;
FT                   InterPro:Acyl-CoA dehydrogenase, N-terminal;
FT                   InterPro:Acyl-CoA dehydrogenase, N-terminal, bacteria;
FT                   InterPro:Acyl-CoA dehydrogenase/oxidase; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase C-terminal; InterPro:Acyl-CoA
FT                   dehydrogenase/oxidase, N-terminal; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, central domain; InterPro:Acyl-CoA
FT                   oxidase/dehydrogenase, type 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01916"
FT                   /db_xref="GOA:B8FMP9"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMP9"
FT                   /protein_id="ACL01916.1"
FT                   /translation="MAQVIADRRDIEFVLYEQLEADKINKHKEYSDLDKKSLDLIITEA
FT                   RNLALKELLPINAEADKTGLRFENNQVFVPEVFHKPFRILAEDGWGSVTEDPDLGGQGL
FT                   PTLIMQPIIEYLMGACGVCLGYVTMGHGTGKMIELFGTDKQKELYLKNLYSAKWGGTMV
FT                   LTEAEAGSDVGNLSTTARKNDDGTYSITGNKIFITYGEHDLTENIIHPVLARIEGAPAG
FT                   TAGISIFIVPKIWVNDDGSLGEPNDVVCTGIEEKMGIHASSTCSLAFGGKGQCRGYLLG
FT                   EENKGMKVMFLMMNEARLNVGFQGFSAASVAYMYACNYAKERIQGRALEDSANKDAKPV
FT                   AIINHPDVRRNLLTMKAYTDGMRSFIYYVADLFDKEELAESPEEADRFNKLIQLYTPVI
FT                   KAYCTDKGFELASTGIQVYGGYGYISEYPMEQILRDAKIGSIYEGTNGIQAMDLIGRKL
FT                   GMDKGAIFMSFMGEVAKTVAQAKAVPGLEDMAAKVEAACNRLGETAMHLGKTAVSPQFK
FT                   AAFAHSTHFLEAMGDVIMAWMLLWRAVISAPKIEKQKKAVEKEYYEGQVKTAEFFIFNM
FT                   LPVTMGKMDSITITNPAALEIADSCFGG"
FT   gene            289411..290238
FT                   /locus_tag="Dalk_0208"
FT   CDS_pept        289411..290238
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0208"
FT                   /product="Unclassified short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   dol:Dole_0115 short-chain dehydrogenase/reductase SDR; IMG
FT                   reference gene:2503005904; PFAM: short chain dehydrogenase;
FT                   InterPro:Glucose/ribitol dehydrogenase;
FT                   InterPro:NAD(P)-binding domain; InterPro:Short-chain
FT                   dehydrogenase/reductase SDR; InterPro:Short-chain
FT                   dehydrogenase/reductase, conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01917"
FT                   /db_xref="GOA:B8FMQ0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ0"
FT                   /protein_id="ACL01917.1"
FT                   /translation="MRKFPGKRVIITGAGSGFGRALALEFAKENWKIGVADINEERADE
FT                   TVDLVAQKGGQGLKILCDVTDAAQLENAAALLEKEWGGVDVVVNNAGVGAAGFMEKIPM
FT                   DKWDWIIGLNLKSVIHGCRAFIPLMEKQGKGHIINMASNAGIACLPEMASYNVTKAAVI
FT                   ALSETLRSELSTKNIGVTVVCPTFFKTNLMDQFNSTDDRQRDMAEKFFSTSRTTAEKVA
FT                   KAAMKALKKNKLYVVTPWDGKLVWTLKRLCPEIWYKLVSMGYHRFDKSVGESS"
FT   sig_peptide     289411..289479
FT                   /locus_tag="Dalk_0208"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005904_SP"
FT   gene            290235..291236
FT                   /locus_tag="Dalk_0209"
FT   CDS_pept        290235..291236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0209"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dol:Dole_2600 beta-lactamase domain-containing protein; IMG
FT                   reference gene:2503005905; PFAM: Metallo-beta-lactamase
FT                   superfamily; InterPro:Beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01918"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ1"
FT                   /protein_id="ACL01918.1"
FT                   /translation="MTMPRLSREIMPGVHRISLPLPGKQPGPVNAYVFVGDTVTLLDTG
FT                   TSKTVGLLGAAMGELGLSFSDIDRIVVTHGHLDHYGGAKKIKEASRYDIELVAAEEDIR
FT                   GVEQGSTVPNSSMTYFLKTMGVPKIFPPLMIALNYVFARMADNCPVDAVMEEGQKLDMG
FT                   RHEATVVRTPGHTRGSVCLYLEKDGVVFSGDHVLEHITPNALPMLEDWPGLPERKSQME
FT                   FYDSIDRIEALDPAVLHTGHGKRIRDLASVIDMYRKAFTARQKRVLSSIRPKDESVFTI
FT                   ARRLFPNIELNLRFPMEMYLAISEVYTHLQVLEEEGEVCLALEKNRLRVFRH"
FT   gene            291249..292301
FT                   /locus_tag="Dalk_0210"
FT   CDS_pept        291249..292301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_2824 hypothetical protein; IMG
FT                   reference gene:2503005906; PFAM: Uncharacterised protein
FT                   family (UPF0227); InterPro:Uncharacterised protein family
FT                   UPF0227/Esterase YqiA"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01919"
FT                   /db_xref="InterPro:IPR008886"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ2"
FT                   /protein_id="ACL01919.1"
FT                   /translation="MLNKLSKPLDFAGGCVDGVFLMLPKILKPFAKSKVVDKDSYMAQV
FT                   EFYLDQGYADDPASFFDLPEAPPEYPSVNRDPFWDGQREHITWESGFEAKNPLLREEYA
FT                   SYLENRTAHMLRWTHGEPGRKTVVCLHGFMLGEPDQAERMFKVKKLYNMGLDVALFIAP
FT                   FHWERAPSGPGAANMALQPDNVPMTAEFMGQIMFDLASALLLLKKMEAGELGLIGASMG
FT                   GYTASLFSCLSDMHSFAAMMVPAVNFSKPIGPDTVSMPFAMDKSMKEKVNKVWEFHSPL
FT                   HLAPIIPRDRILVIASKGDRICPFEYVEALCRKWQGIRCTFMTGGHWMVFNGKLRGQAW
FT                   YGFLRDMGFI"
FT   gene            292323..292601
FT                   /locus_tag="Dalk_0211"
FT   CDS_pept        292323..292601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0211"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_0270 hypothetical protein; IMG
FT                   reference gene:2503005907"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01920"
FT                   /db_xref="GOA:B8FMQ3"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ3"
FT                   /protein_id="ACL01920.1"
FT                   /translation="MFKNPLFWYASMAVTAMGWFIFILGLLLGAGGAFKSLWIVLALIF
FT                   LVIHPLEIPIGMKVGERAGLDKGISAFKTLAFGLTWWIPVKMGVIHD"
FT   sig_peptide     292323..292409
FT                   /locus_tag="Dalk_0211"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005907_SP"
FT   gene            293315..293596
FT                   /locus_tag="Dalk_0212"
FT   CDS_pept        293315..293596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0212"
FT                   /product="acylphosphatase"
FT                   /note="PFAM: acylphosphatase; KEGG: rxy:Rxyl_0794
FT                   acylphosphatase; IMG reference gene:2503005908; PFAM:
FT                   Acylphosphatase; InterPro:Acylphosphatase, conserved site;
FT                   InterPro:Acylphosphatase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01921"
FT                   /db_xref="GOA:B8FMQ4"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR020456"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ4"
FT                   /protein_id="ACL01921.1"
FT                   /translation="MADIKCVRARITGVVQGVSFRYHTQETANLHGVNGWVRNMPDGSV
FT                   EAVFQGDPKAVKAVLDWCWIGPSFARVDDVVIQDEPADEEFSSFRIAY"
FT   gene            294217..294744
FT                   /locus_tag="Dalk_0213"
FT   CDS_pept        294217..294744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0213"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: rso:RSc0942 oligoribonuclease;
FT                   IMG reference gene:2503005909; PFAM: Exonuclease;
FT                   InterPro:Exonuclease; InterPro:Exonuclease, RNase T/DNA
FT                   polymerase III; InterPro:Ribonuclease H-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01922"
FT                   /db_xref="GOA:B8FMQ5"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR022894"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ5"
FT                   /protein_id="ACL01922.1"
FT                   /translation="MVWIDMEMTGLNPDNSVIVEIATLITDGDLNLVAEGPELAIFHPP
FT                   HVLENIDPWSLDQHTASGLLDRVKASDVDTAQAEKLTLDFIKEYCAEKECPLAGNSVWQ
FT                   DRRFMVKYMPLLEDFLLHRMVDVSTIKELFKRWYPDMAPFVKTHEHTALADIMESINEL
FT                   RYYREKVFLPIP"
FT   gene            294767..295975
FT                   /locus_tag="Dalk_0214"
FT   CDS_pept        294767..295975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0214"
FT                   /product="TraB family protein"
FT                   /note="TIGRFAM: TraB family protein; PFAM: TraB determinant
FT                   protein; KEGG: dol:Dole_2685 TraB family protein; IMG
FT                   reference gene:2503005910; PFAM: TraB family; TIGRFAM:
FT                   pheromone shutdown-related protein TraB; InterPro:Pheromone
FT                   shutdown, TraB; InterPro:Pheromone shutdown-related, TraB"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01923"
FT                   /db_xref="GOA:B8FMQ6"
FT                   /db_xref="InterPro:IPR002816"
FT                   /db_xref="InterPro:IPR005230"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ6"
FT                   /protein_id="ACL01923.1"
FT                   /translation="MEEAVSENNGAGYPDDKDIHRFQLDGKEIVILGTAHVSKASADLV
FT                   ARVIQREKPDTVCVELCPSRLEAINNPDRWKEMDIVSVIKEKRAYMLLSHLLLSSFQKK
FT                   IADKLEIQAGQEMMTAIQEAAAIEASVHPIDRDIRTTLARCWRLMGLKAKFSLLLDVMG
FT                   AMDEADKITEEDVEALKDKDALEMVLEELGEMLPQVRTVLIDERDLYMVHTINHAPGDK
FT                   VVAVVGAGHVPGIKKHFDEQIDIEELESLPPKGKLGKVFKWGIPAAIIALIAYGFFSRG
FT                   GAVGVEMVGWWVGVNAFFAGLGALLALGHPLTILAAMAAAPLTSLNPMIAAGWVSGLTE
FT                   AYLRKPQVKDLESLSSDIVTFRGFWKNKVTRILLVTVLSNVGSMIGTFVALPFILRAFG
FT                   VEQ"
FT   gene            296079..298166
FT                   /locus_tag="Dalk_0215"
FT   CDS_pept        296079..298166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0215"
FT                   /product="Dihydropyrimidine dehydrogenase (NADP(+))"
FT                   /EC_number="1.3.1.2"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; FAD dependent oxidoreductase; Fe-S cluster
FT                   domain protein; KEGG: dol:Dole_2825 electron transport
FT                   complex, RnfABCDGE type, B subunit; IMG reference
FT                   gene:2503005911; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase; Putative Fe-S cluster; 4Fe-4S binding
FT                   domain; InterPro:4Fe-4S binding domain; InterPro:4Fe-4S
FT                   ferredoxin, iron-sulphur binding, conserved site;
FT                   InterPro:4Fe-4S ferredoxin, iron-sulpur binding domain;
FT                   InterPro:Alpha-helical ferredoxin; InterPro:FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   InterPro:Fumarate reductase, C-terminal;
FT                   InterPro:NAD(P)-binding domain; InterPro:Putative Fe-S
FT                   cluster; InterPro:Pyridine nucleotide-disulphide
FT                   oxidoreductase, NAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01924"
FT                   /db_xref="GOA:B8FMQ7"
FT                   /db_xref="InterPro:IPR007202"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR010207"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028261"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ7"
FT                   /protein_id="ACL01924.1"
FT                   /translation="MIGAFLFMLGLGGACAILLSVASRVFYVYEDPRIAEVEDRMAGAN
FT                   CGGCGYAGCNAAAVAVVAGKAPASVCIVGGMESAQGVAEVMGMDVGGAEPILSYNPCKG
FT                   GDRAEDKFIYQGVPTCAALTRLYEGKRFCSVGCLGLGDCVKACLFDAISIGPDGYPVVN
FT                   ADNCVGCGACERACPKGVLEVMTMSQRLLAMNETDDALAPCQQICPAQINIPLYIEQIK
FT                   KGDYEGAVNTIRERNPLLLSCGRVCPHPCEDKCRRGVEDEPVSINQLKRFVADYELHSG
FT                   KRFPISKAPATEKKVAVIGGGPAGLSCAFFLARLGHSVTIYEAMPKLGGMIRYGIPEYR
FT                   LPKKILDWEIQGILDLGIEAKTDARFGFDFNLSDLMEEGFDAVFMGIGAWKDMKLRAEG
FT                   EDMEGCFTGIDFLARVANGEKVKIGKNPIIVGGGNTAIDCVRTLIRMGSKVTLAYRRTR
FT                   AEMPANEVEIVAAEHEGCDFVFLAAPTRVVGDENGKVIGLEYQKMELGEPDASGRRRPV
FT                   PVEGSETILDADMIVSAIGQRPDISFMDNPEKALADLKTTRWDTMDHNEDTLQTDIPFI
FT                   FVGGDSATGPDLVVSAIGGGRKAARSIHQFVMGEEVKAAPKDLKKPLIPESDFKTVPGI
FT                   IQSPRAPMPELPVQERIYSFIEVDQVLDEESALRESGRCLRCCRTCYDKDTERKTQKSA
FT                   A"
FT   sig_peptide     296079..296144
FT                   /locus_tag="Dalk_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005911_SP"
FT   gene            298395..299324
FT                   /locus_tag="Dalk_0216"
FT   CDS_pept        298395..299324
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0216"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_1335 hypothetical protein; IMG
FT                   reference gene:2503005912; InterPro:Metal-dependent
FT                   phosphohydrolase, HD domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01925"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ8"
FT                   /protein_id="ACL01925.1"
FT                   /translation="MRNQSVTREPPVVVLPEIDDLVSMEKPREVLKEAENIVRLMFDET
FT                   SFDFIRSVFDDILTLFAGKYPDFKRCNTRFHDLQHTTDAFLAMARLMHGAVVEGKPLNE
FT                   TDVFLGLIAALLHDTGYIQRQDDHRGTGARYTLIHVQRSVEFMKLYFNSRGFSERDFKI
FT                   CSCFLECTDLDVEVCDICFSNESYRMLGQMLGTADLLGQMAARNYLEKLIFLYYEFEEA
FT                   GVPGFASELDLLRKTADFYEMAKVRLDNDLNGVRHYVRAHFRERWNIDKDLYEAAIEKN
FT                   VAYLRFILNEHPEEYRTYLRRALVKEWN"
FT   gene            299431..301065
FT                   /locus_tag="Dalk_0217"
FT   CDS_pept        299431..301065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0217"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; tyrosine protein
FT                   kinase; Serine/threonine protein kinase-related; SMART:
FT                   serine/threonine protein kinase; KEGG: mab:MAB_0033c
FT                   serine/threonine-protein kinase PknB; IMG reference
FT                   gene:2503005913; PFAM: Protein kinase domain; Cyclic
FT                   nucleotide-binding domain; InterPro:Cyclic
FT                   nucleotide-binding domain; InterPro:Cyclic
FT                   nucleotide-binding-like; InterPro:Protein kinase, ATP
FT                   binding site; InterPro:Protein kinase, catalytic domain;
FT                   InterPro:Protein kinase-like domain; InterPro:RmlC-like
FT                   jelly roll fold; InterPro:Serine/threonine-protein
FT                   kinase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01926"
FT                   /db_xref="GOA:B8FMQ9"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMQ9"
FT                   /protein_id="ACL01926.1"
FT                   /translation="MTEKIEPPNCWEYTQCGKEPGGANVDENGPCQAALETALDGVNNG
FT                   KNAGRLCWAVDGTLCHNQTPGPEEDKISSCISCPFFQKVQEAEDQGDLRTKFLRFVTMD
FT                   GKKPLMQGLEIKHVAQGERFIIQNANSEAGYIIQKGSCRILVEKDGELVAIGRRGLGEV
FT                   VGVTALLTGAPYSAHVEAETPMCLWVIRRDQFEALVEKDRDLMEFLTELVADRLSADRP
FT                   MADRAVGRYTAREVLGKGGFSMVYKGIHTALEMPVAIKMLHHDKALDPDFLAAFRNEAE
FT                   SIAKFNHENIVRVFDIEELYRTVFIIMEYLEGELLSDMIKRLGRLSPLLAADFMVQACR
FT                   GLEYAHKFGIIHRDINVSNLFIQTGDRLKIMDFGIACKIGTEDFGETGTAAFMSPEQID
FT                   GDPVDERTDIYSLGLAAYEMVTGERAFPGNDIMALLDGHLERDVPDPAEKAPDLPPALR
FT                   QVIMKAGKRAPDERFNKAGEIIEVLTEILPQCDLPLECATPVRKMTSLFLIYEEDKQKE
FT                   VGRLTEEFSSAMKKLGVTLKAADFPDI"
FT   gene            301083..301790
FT                   /locus_tag="Dalk_0218"
FT   CDS_pept        301083..301790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0218"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Stage II sporulation E family protein; SMART:
FT                   protein phosphatase 2C domain protein; KEGG: mjl:Mjls_0019
FT                   protein phosphatase 2C domain-containing protein; IMG
FT                   reference gene:2503005914; PFAM: Stage II sporulation
FT                   protein E (SpoIIE); InterPro:Protein phosphatase 2C-like;
FT                   InterPro:Sporulation stage II, protein E C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01927"
FT                   /db_xref="GOA:B8FMR0"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR0"
FT                   /protein_id="ACL01927.1"
FT                   /translation="MESFALSDMGLKRNENQDRRLVKETPDGAVLLAIADGMGSSAGGG
FT                   IAAQMIMDGLDAMPDHDLTAGGIMEKLVQQTDQAIFCKASEDACFEDMGATLTAVVVRG
FT                   SSAQWVHVGDSRLVLFENGRLRYVTKDQNMAWFLYDEGEITAEEARRHPGLRLLDQCVG
FT                   AGDCEPVTGALEFSPGALFMLTTDGVHDHITPKALTAILSGPESLEHKAQAILRRIRDD
FT                   GSTDDATMVLAVI"
FT   gene            302723..302917
FT                   /locus_tag="Dalk_0219"
FT   CDS_pept        302723..302917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0219"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: dvl:Dvul_1274 FmdB
FT                   family regulatory protein; IMG reference gene:2503005915;
FT                   PFAM: Zinc ribbon domain; TIGRFAM: putative regulatory
FT                   protein, FmdB family; InterPro:Regulatory protein, FmdB,
FT                   putative"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01928"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR1"
FT                   /protein_id="ACL01928.1"
FT                   /translation="MPIYEFNCKKCGRDFEEIVGMSDKETPPCPKCGAKETERLMSCFS
FT                   SRRGGSFAKSSCGPPGGFS"
FT   gene            303358..305523
FT                   /locus_tag="Dalk_0220"
FT   CDS_pept        303358..305523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0220"
FT                   /product="Homodimeric methylmalonyl-CoA mutase Sbm"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: ppd:Ppro_1285 methylmalonyl-CoA mutase, large
FT                   subunit; TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; IMG reference
FT                   gene:2503005916; PFAM: Methylmalonyl-CoA mutase; TIGRFAM:
FT                   methylmalonyl-CoA mutase N-terminal domain;
FT                   methylmalonyl-CoA mutase, heterodimeric type, beta chain;
FT                   InterPro:Cobalamin (vitamin B12)-binding;
FT                   InterPro:Cobalamin (vitamin B12)-dependent enzyme,
FT                   catalytic; InterPro:Cobalamin (vitamin B12)-dependent
FT                   enzyme, catalytic subdomain; InterPro:Methylmalonyl-CoA
FT                   mutase, alpha chain, catalytic; InterPro:Methylmalonyl-CoA
FT                   mutase, alpha/beta chain, catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01929"
FT                   /db_xref="GOA:B8FMR2"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR2"
FT                   /protein_id="ACL01929.1"
FT                   /translation="MSNNAPTLTPRGEGEKLFSEFSFPSYQEWYDAAVASLKGAPFEKK
FT                   VITKTYEDIDLQPMYWQHEIKDLPHIDTMPGSAPFVRGTKADGFLINPWNICQAISCSM
FT                   PEEFNKAAVHDLERGQTGLQVVLDPAVKLGQDPGQAKAEDVGAMGLSAACAGDFAKALA
FT                   GVDTANIPMFVNAGATALPIASLMAAGQLVSGKFAASLAGCVGADPLGELAAKGAIPIS
FT                   LNAAYDSMTALLMWAKSNARHVRTIIASGSPYHDAGASATQELAFAVATAVEYVRAMQD
FT                   RRVEFDVIAPKVCFSFSVGGHFFMEIAKLRAARILWTQIADAFGGNEESQKMFMFARTS
FT                   AWTKTLCDPYVNMLRNTTECFAAAMGGADMIYVAPFDEVARQPNEFSRRVSRNLQIVLQ
FT                   EESRFTQPVDPSGGSWYVETLTNTVAEKAWGIFQEIEKAGGMAKALEQGLPQSMCAEVA
FT                   EQKAKNIKKRKDVFVGTNMYANLAEKPLEVPVVDHAALQSERAAQVEEFCKAAGNGGDM
FT                   LKALEEAMKDSPAAPETMDKAVAAAQAGASLSAIFGAMEAGSGSVTPLAIQRGSEPFES
FT                   LRAAMDKHVKETGERIKIFLANMGPVPQHKARADFSGGFFQPGGFEMVENTGFQTPEDC
FT                   AQAFVDSGAKIAIICSTDKAYPEIVPPLAKLLKEKVSDAFVLLAGKPAKDLEQSYRDAG
FT                   MDDYIFMGADCYTLLLNLQKRSGLTHE"
FT   gene            305516..307693
FT                   /locus_tag="Dalk_0221"
FT   CDS_pept        305516..307693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0221"
FT                   /product="Homodimeric methylmalonyl-CoA mutase Sbm"
FT                   /EC_number="5.4.99.2"
FT                   /note="KEGG: bha:BH2955 methylmalonyl-CoA mutase; TIGRFAM:
FT                   methylmalonyl-CoA mutase, large subunit; PFAM:
FT                   methylmalonyl-CoA mutase; cobalamin B12-binding domain
FT                   protein; IMG reference gene:2503005917; PFAM:
FT                   Methylmalonyl-CoA mutase; B12 binding domain; TIGRFAM:
FT                   methylmalonyl-CoA mutase N-terminal domain;
FT                   methylmalonyl-CoA mutase C-terminal domain;
FT                   InterPro:Cobalamin (vitamin B12)-binding;
FT                   InterPro:Cobalamin (vitamin B12)-dependent enzyme,
FT                   catalytic; InterPro:Cobalamin (vitamin B12)-dependent
FT                   enzyme, catalytic subdomain; InterPro:Methylmalonyl-CoA
FT                   mutase, alpha chain, catalytic; InterPro:Methylmalonyl-CoA
FT                   mutase, alpha/beta chain, catalytic;
FT                   InterPro:Methylmalonyl-CoA mutase, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01930"
FT                   /db_xref="GOA:B8FMR3"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR3"
FT                   /protein_id="ACL01930.1"
FT                   /translation="MNKTPDFTAMAYNPPKSKAGLAEWKAALDQAAADAIDFEWMTNEQ
FT                   IPVKALYTGEDVADLEHTGFVSGIPPYLRGPYPTMFVTRPWTVRQYAGFSTAEESNAFY
FT                   RRNLAMGQKGLSIAFDLATHRGYDSDHERVVGDVGKAGVAVDSILDMKILFDGIPLDQM
FT                   SVSMTMNGAVLPILAYYIVAAEEQGVSHEQLTGTIQNDILKEYMVRNTYIYPPTPSMKI
FT                   IADIFEFTSQNMPKFNSISISGYHMQEAGATADIELGYTLADGYQYVKTGVAAGMSVDT
FT                   FAPRLSFFWGTGMNHFMEVAKLRAGRLIWAKLIKGFDPKNPKSLALRTHTQTSGWSLTE
FT                   QDPYNNVCRTCIEAMSAALGHTQSLHTNSLDEAIALPTDFSARIARNTQLFLQDETKIC
FT                   KVVDPWAGSYYLESLTSQIVDRAWGHICEIESLGGMAKAIDTGLPKMRIEEAAARRQAR
FT                   IDSKKEVIVGVNKYRPETEDPMEVLEVDNTAVRESQLKRLAQLKDGRDEAAVSQALEAI
FT                   TKAAETGSGNLLDLAVKAARVRASLGEISYAIEKVTGRHKAVTRSVSGVYSTEFGEEEE
FT                   VAAVRKMTDEFEEAEGRRPRIMVAKMGQDGHDRGAKVISTAFADLGFDVDIGPLFQTPE
FT                   EAALQAVENDVHIVGMSSLAAGHKTLLPKLVEELKKHGREDIMVIVGGVIPAQDYQFLR
FT                   EHGASLIFGPGTVIPVAAQKVMVELNKRLAE"
FT   gene            307770..308912
FT                   /locus_tag="Dalk_0222"
FT   CDS_pept        307770..308912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0222"
FT                   /product="Putative methylmalonyl-CoA mutase
FT                   metallochaperone"
FT                   /note="KEGG: rrs:RoseRS_0546 arginine/ornithine transport
FT                   system ATPase; TIGRFAM: LAO/AO transport system ATPase;
FT                   PFAM: ArgK protein; SMART: AAA ATPase; IMG reference
FT                   gene:2503005918; PFAM: ArgK protein; TIGRFAM: LAO/AO
FT                   transport system ATPase; InterPro:ArgK protein;
FT                   InterPro:ATPase, AAA+ type, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01931"
FT                   /db_xref="GOA:B8FMR4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005129"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR4"
FT                   /protein_id="ACL01931.1"
FT                   /translation="MSSGKRPEWAPQDCDGKGFASLVVDGVEGGHDGMPGASSKPAAAP
FT                   VVRRKNLRVQDFVQGVLAQDRTVLGRAITLVESNVPAHMERAQRMLKELIPHTGNSVRV
FT                   GITGVPGAGKSTFIEALGSLLCDRGHKVAVLAVDPSSSLTRGSILGDKTRMQNLSRNKN
FT                   AFIRPSPSSGVLGGVTRKSRETMLICEAAGFDVILVETVGVGQSETEVRSMVDFFLLVL
FT                   IAGAGDELQGMKKGIMELADAILINKADGDNKQRAEMARSEFERIIHYLLPATEGWTTQ
FT                   ALTASSLTGDKIPDVWQTVEDFKANTMASGVFQRRRNAQTVRWVHSMVDDYLRTAFYGN
FT                   PTVKAMIPGIESDVVEGNLSPTQAVQKLVQEYENHRKANS"
FT   gene            308987..309454
FT                   /locus_tag="Dalk_0223"
FT   CDS_pept        308987..309454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0223"
FT                   /product="hypothetical protein Dalk_0223"
FT                   /note="IMG reference gene:2503005919"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01932"
FT                   /db_xref="GOA:B8FMR5"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR5"
FT                   /protein_id="ACL01932.1"
FT                   /translation="MGKEDASKEYKWFWPDTSDPTQRKKAVDQGAWAGLWITLSFCFIL
FT                   FINSSTLEIPAANIESIVLQFILFRLFVYIIVIPGFLTWRVWKENCFISAILILIYMVC
FT                   EVILTIMDSGSDLFFLKILAVVLAMNGVRGTLAERKIRLSQQGLPQEQPIL"
FT   gene            complement(309842..312052)
FT                   /locus_tag="Dalk_0224"
FT   CDS_pept        complement(309842..312052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0224"
FT                   /product="molybdopterin oxidoreductase"
FT                   /note="PFAM: molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; KEGG: mgm:Mmc1_1581
FT                   aminotransferase, class V; IMG reference gene:2503005920;
FT                   PFAM: Molybdopterin oxidoreductase; Molydopterin
FT                   dinucleotide binding domain; InterPro:Aspartate
FT                   decarboxylase-like fold; InterPro:Molybdopterin
FT                   oxidoreductase; InterPro:Molybdopterin oxidoreductase,
FT                   Fe4S4 domain; InterPro:Molydopterin dinucleotide-binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01933"
FT                   /db_xref="GOA:B8FMR6"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR6"
FT                   /protein_id="ACL01933.1"
FT                   /translation="MTQTKHGICGLCFHSPGCGVIVHFDDEEKIDHLEPDPDVPMGEVL
FT                   CPISKSARDIVYSDKRLSTPLRRTGPKGTYEFEPITWDEAYDEIAAKLNELKDKHGPES
FT                   VGFYAGTGTYERSFKDAYQLKGSEIYLASSVLFPFGSPNTFGVGAPCYTSLGVLAPKVT
FT                   MGCLHIDMYSDLDNADLILVWGTDPSTSTPPAAFSKLERAAEEGAEIIVIDPRRTKSAD
FT                   LPGAEWLPIRPGTDGALALALAHVIIRDDLHDVEFTENWCRGFEEFAEYVKDFTPEYVS
FT                   ELTGIDADRIEELAESIAEADGATYVMYTGLEYTKSGVQNIRAVMALWAVAGQLDVEGG
FT                   RNFLHHDAFIPLNKSILKETPGFDKSIGKGKFPVYAEYCGGEPHAILLPKAIIDGTPYK
FT                   IRGLFIQGASILTAWPDPKVWQKAMEELDFLVCIDLQMTKDAAFADIVLPASTAFEQES
FT                   YCYYGNAIRYREKMIEPVGEAKPNHQILAELAERLGYGDLYAKDPKTLLGSVLEGSGYS
FT                   MDDLLSAENYVIKKPGKPMEYKKWEKGLLRKDGKPGFETPSGKFEIKSTVLEKHGYDGL
FT                   PKYEESFETPVSDPDRFKKFPLILGTGPFKPDMKSCFRAIPRFMKKFPSPAIQISPADA
FT                   AERRLETGDLATLKTARGSVVMRIFVTDKIMEGFVYAPVGGGGPLGTEEWQAANVNMLT
FT                   DLEQFDPISGFPVYKTLLCQIKRKRDKRHKIEVPDPTLGCVG"
FT   gene            complement(312076..313017)
FT                   /locus_tag="Dalk_0225"
FT   CDS_pept        complement(312076..313017)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0225"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: protein of unknown function DUF343;
FT                   Methyltransferase type 11; KEGG: sfu:Sfum_1245
FT                   methyltransferase type 11; IMG reference gene:2503005921;
FT                   PFAM: Methyltransferase domain; InterPro:Methyltransferase
FT                   type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01934"
FT                   /db_xref="GOA:B8FMR7"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR7"
FT                   /protein_id="ACL01934.1"
FT                   /translation="MKKWLHNDLACPECFSNKNLLDLIVKEEVDDDVMEGRLVCTDCGA
FT                   QFEISGGVAILLPKKTRHILSETSGYNSQSMLSAYLWSHFSEFFNGPNATEAYTIWSSL
FT                   FDGKNGYAVDIGCAVGRLSFDLSRTHSRVIGLDTSLSFIKRARRIMKERSLHFDMILEG
FT                   NITERQVCELNPDWNFDRVEFVVADALALPFHEDLFSTASSINILEKVPHPIQHLQDVN
FT                   RVLKKKDSVFVFSDPFSWDASVSTPDLWLGGRNQGPFQGRGVDNMERLLSNGDGVFTPP
FT                   FEVSKKGDVLWKIRKTENLWEYIHSQYLIGVR"
FT   gene            313656..314816
FT                   /locus_tag="Dalk_0226"
FT   CDS_pept        313656..314816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0226"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   gka:GK1923 multidrug-efflux transporter; IMG reference
FT                   gene:2503005922; PFAM: Major Facilitator Superfamily;
FT                   InterPro:Major facilitator superfamily; InterPro:Major
FT                   facilitator superfamily MFS-1; InterPro:Major facilitator
FT                   superfamily, general substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01935"
FT                   /db_xref="GOA:B8FMR8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR8"
FT                   /protein_id="ACL01935.1"
FT                   /translation="MENQRCIVALNIAVFLIMFGVGLIVSLLPHKIFTLTGSFKTVGWL
FT                   ASFFAVSFVLLQFPIGRLSDRYGFKRFLAGGYLICSLSGLLYWFSQSQETVFFGRMLQG
FT                   AGEAPLWALAPALLCTLRPESKGKAIGVYNASLHLGLTLGSGFGIVISSRWLNNEPFLL
FT                   FALLCALGALLIIAFVQEPESRTLAPDGEIDYRELHLLIKRPETLAVLSGIILYGAGYG
FT                   SFITVLPGFLMEYKGFSQAGVGWFFMFFYTAVSLSQIVAGPMSDRCGSGKIMLCGLAAA
FT                   AAGLVIFPCMDGWTVHPWLFLASWGLGMFCVSSLAWLNNAVGDSLKGTASGAFYLFWGL
FT                   GYFGGPIILGACLGSAGGPAGFRILAGLYLITAMLQGGIQLRGVNR"
FT   gene            complement(314932..315441)
FT                   /locus_tag="Dalk_0227"
FT   CDS_pept        complement(314932..315441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0227"
FT                   /product="hypothetical protein Dalk_0227"
FT                   /note="IMG reference gene:2503005923"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01936"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMR9"
FT                   /protein_id="ACL01936.1"
FT                   /translation="MHLKPYFDPHSPFMSQYTPRFLERFDLSFHDEGLCTEYFIETLDE
FT                   HQTISSALVLSQNTFANNLHVSRFYPELAKRTNCKYMSAVAFYLMIHHFSQTHHLNNQC
FT                   RISLDTTNRVFDQFYSHLLDFNFCIRRQMAGGNVALISDYCHDKINLAMIHPHAEQDDG
FT                   PAFLYT"
FT   gene            complement(315684..316133)
FT                   /locus_tag="Dalk_0228"
FT   CDS_pept        complement(315684..316133)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0228"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: dol:Dole_2645 thioredoxin; IMG reference
FT                   gene:2503005924; PFAM: Thioredoxin; TIGRFAM: thioredoxin;
FT                   InterPro:Thioredoxin; InterPro:Thioredoxin domain;
FT                   InterPro:Thioredoxin fold; InterPro:Thioredoxin, conserved
FT                   site; InterPro:Thioredoxin-like; InterPro:Thioredoxin-like
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01937"
FT                   /db_xref="GOA:B8FMS0"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS0"
FT                   /protein_id="ACL01937.1"
FT                   /translation="MSDNSVIISCSSCGAKNRVPVSRLEDRPVCGKCKTRLPAPSATNR
FT                   PVDVTDASFQNEVLASPIPVLLDCWAPWCGPCKMVAPVLDEIAREYAGTIKVAKLNVDN
FT                   NPATASHFRTQSIPTMILFKNGREVDRLVGAAPKQQIINFVQNQL"
FT   gene            complement(316365..317186)
FT                   /locus_tag="Dalk_0229"
FT   CDS_pept        complement(316365..317186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0229"
FT                   /product="MscS Mechanosensitive ion channel"
FT                   /note="PFAM: MscS Mechanosensitive ion channel; KEGG:
FT                   dol:Dole_2296 MscS mechanosensitive ion channel; IMG
FT                   reference gene:2503005925; PFAM: Mechanosensitive ion
FT                   channel; Conserved TM helix; InterPro:Conserved TM helix;
FT                   InterPro:Like-Sm ribonucleoprotein (LSM)-related domain;
FT                   InterPro:Mechanosensitive ion channel MscS;
FT                   InterPro:Mechanosensitive ion channel MscS, C-terminal;
FT                   InterPro:Mechanosensitive ion channel MscS,
FT                   transmembrane-2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01938"
FT                   /db_xref="GOA:B8FMS1"
FT                   /db_xref="InterPro:IPR006685"
FT                   /db_xref="InterPro:IPR008910"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="InterPro:IPR011014"
FT                   /db_xref="InterPro:IPR011066"
FT                   /db_xref="InterPro:IPR023408"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS1"
FT                   /protein_id="ACL01938.1"
FT                   /translation="MDIEVILAKAQELLTLYGLKIVAALLIFILGRWISKFLRKVIVNL
FT                   MTKAKVDATLVSFVSNISYIGLLIFVIVAALNQLGIQTTSFIAILGAAGLAIGLALQGS
FT                   LSNFAAGVLMIIFRPFEVGHRIDGGGVSGVVEDIHIFTTKLKTVDNKTVIVPNSVLTGD
FT                   NIINYSAKPTMRVDFVIGVSYDADVDHCRKVLTEEILKDDRVLKNPELFVGVLELADNS
FT                   VNWVVRPWVKTENYWPVYFSYMENIKKRLDAEGIGIPYPQRDVHLYQHAPE"
FT   gene            317589..318722
FT                   /locus_tag="Dalk_0230"
FT   CDS_pept        317589..318722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0230"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: sat:SYN_00198
FT                   outer membrane porin protein; IMG reference
FT                   gene:2503005926; PFAM: von Willebrand factor type A domain;
FT                   OmpA family; InterPro:Outer membrane protein, bacterial;
FT                   InterPro:Outer membrane protein, OmpA/MotB, C-terminal;
FT                   InterPro:von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01939"
FT                   /db_xref="GOA:B8FMS2"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS2"
FT                   /protein_id="ACL01939.1"
FT                   /translation="MKKLMWMPLIALVVLAMVSGCAVKQPAPAPFKVCDLNAKMGEYTQ
FT                   KVDNFLVILDKSGSMRGGKLGTAVNTLRHMNQTIPDLDLQAGLRTFGSICPFSQVSKLE
FT                   YGMTQYVTKEMCGALAVQKKASGDSPMDLALSGAADDLARTNGSTAVILVSDGYKNAMD
FT                   AAAAVAAAKELKSRYMNKVCIYTIQIGSDPTGKAILDKIVKAGGCGFSVNAADIADGDA
FT                   MCDFVTKVFLKKSNQPLDSDGDGVYDNADKCPGTPKGADVNKVGCWIIKDLEFDFDSYE
FT                   IKKEYQSCIKKIVAILRANPGLKLIVEGHTDNKGSKAYNDKLSLNRADAVIDSMVGKGI
FT                   MPERLSAKGYGFSKPVASNDTEEGRARNRRVQLTPVF"
FT   sig_peptide     317589..317660
FT                   /locus_tag="Dalk_0230"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005926_SP"
FT   gene            318871..322161
FT                   /locus_tag="Dalk_0231"
FT   CDS_pept        318871..322161
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0231"
FT                   /product="protein of unknown function DUF748"
FT                   /note="PFAM: protein of unknown function DUF748; KEGG:
FT                   dar:Daro_1599 hypothetical protein; IMG reference
FT                   gene:2503005927; PFAM: Domain of Unknown Function (DUF748);
FT                   InterPro:Outer membrane protein, OmpA/MotB, C-terminal;
FT                   InterPro:Protein of unknown function DUF748"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01940"
FT                   /db_xref="GOA:B8FMS3"
FT                   /db_xref="InterPro:IPR008023"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS3"
FT                   /protein_id="ACL01940.1"
FT                   /translation="MNPIARWKQLSRLKKIFIIILGLVTAYTIIGFVLVPAIIKWGVVR
FT                   IIEKDYGRKASIEDVAFNPYGLTLRVDGFTILDPDETAFVSFGGLSVDVKVWDSITSMA
FT                   AVVGEVDLENPLVRITMNEDGGFNFADLIPASNPETNAPEENNEEQEKKPPRFSLDILS
FT                   VSGGNIVFVDKQKDATHKIIDLFVAVRGLSGLPDDLDNPVEINLEASINGAPLTVEAES
FT                   LIFDPKLKSSAGISFRDISAAPYKAYIPAIEGRTLVTAKTGVYAAIQYSMEESGAHNLA
FT                   VRNLKVSDTLLAWEDPFKDPEQPEIRGPYQISLGKFSLGLDVLVKDPAVMDVLVKDADV
FT                   SLDNLQLFAQNGALKLAGVEHFDVQDANADMAALKASVGAVNTNGGWFAAALEPTKRIN
FT                   ITRMIELSAKEAVEEIVAAASDAAPEEVQQDVQMDASQPPAEEVKEGAAAETAVAEASQ
FT                   EPVVEGAPDQTPAEEPAPAPEPVKQGPVWTAELAALNLDDYSFTFKDLSLADPVSLEVA
FT                   GMSVKVRDFSTTPGAKTGVSFFMNVNERGVISGTGEISLDPIAAEMDVRCQNTGLVFLT
FT                   PYLQKYVDALLKGADFTLTGKTTFAMQDDVPLATFQGDVMVSGFDFETRKESNLADWDV
FT                   LSIKGISVQTEPLSASVEEIHLKDLKSWVILEEDGSINYANLMKKPEDVAQEMAAPETE
FT                   EAQPLELPDIQVKSIVLENGVVYFQDRSIKPHFTTELAALNGTITSVSSNPDAKATIEM
FT                   TGKLDNHAPLNITGWAKPLTIPPSGKVVFGFKNIEMAPLSPYTAKYIGYRLSKGKLTLA
FT                   HEYLYEGGLIDGDNLIVIDQLTLGEKVDSPDAIKAPIELALALLKDPQGRIELPVPVSG
FT                   DPNNPEFKLGKVISKALANVIIKVITSPFAALGALVGGGEELAFLEYQPGSAALSPDDL
FT                   DKLDKLSKALKERPLLKLDIQGLTNPDADREAITQARYTALLASVKKASMGKAGQETPL
FT                   DQIQIADEEREEIIWKAYKDADFEKEKTALGLVRKIEVPDMEAMLIKSVTPPDEELVQI
FT                   AWQRAQAAKDVLLIEKQIDPARVFIVEPPALDGLDDKTSLCRAVFSLK"
FT   gene            complement(322591..323874)
FT                   /locus_tag="Dalk_0232"
FT   CDS_pept        complement(322591..323874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0232"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: dol:Dole_2566 radical SAM
FT                   domain-containing protein; IMG reference gene:2503005928;
FT                   PFAM: Radical SAM superfamily; B12 binding domain;
FT                   InterPro:Cobalamin (vitamin B12)-binding;
FT                   InterPro:Elongator protein 3/MiaB/NifB;
FT                   InterPro:Methylthiotransferase; InterPro:Radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01941"
FT                   /db_xref="GOA:B8FMS4"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS4"
FT                   /protein_id="ACL01941.1"
FT                   /translation="MKVLLIYTVTENVNIPVLPLGLGCIAAAVESKGHEFSLFNATDAP
FT                   DSLKALKERIREFQPQVMGLCARNVDNQDRTKPLFLIEPVKKIAAACKEASAAPVVIGG
FT                   AGFTMFPDEILAYSGGDLGVAGQGEESFCELLDRMEQKAALDGIPGLVVPGEPFDGRLA
FT                   AVRNLDAWPLPLPEKHMIVPEHWDLKSVMVPIQSRRGCALDCSYCSTKNIEGRILHKRS
FT                   PDTVAENVRKFMDKGFRYFFIADNTFNLPPSYARALCTALEERAPGAKWQGIIYPNMLG
FT                   DDLAQAMARAGCKAVSLGFEHGDEDMLRTFNKRFGPEKVREVSKRLKAHDIGQSGFLLL
FT                   GGPGETKESVKKAFAFLESLKLDAMRITQGVRIYPKTAVYEQAVAKGIIKRDQNILQPA
FT                   FYVEPGLEEWLKNAVAEFQASHPDWMFL"
FT   gene            complement(323925..325199)
FT                   /locus_tag="Dalk_0233"
FT   CDS_pept        complement(323925..325199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0233"
FT                   /product="Putative uncharacterized Fe-S oxidoreductase
FT                   (contains cysteine-rich region domain)"
FT                   /note="PFAM: protein of unknown function DUF224
FT                   cysteine-rich region domain protein; KEGG: gsu:GSU3297
FT                   iron-sulfur cluster-binding protein; IMG reference
FT                   gene:2503005929; PFAM: Cysteine-rich domain;
FT                   InterPro:4Fe-4S ferredoxin, iron-sulphur binding, conserved
FT                   site; InterPro:4Fe-4S ferredoxin, iron-sulpur binding
FT                   domain; InterPro:Alpha-helical ferredoxin;
FT                   InterPro:Cysteine-rich domain; InterPro:Fumarate reductase,
FT                   C-terminal; InterPro:Glycolate oxidase, iron-sulphur
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01942"
FT                   /db_xref="GOA:B8FMS5"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS5"
FT                   /protein_id="ACL01942.1"
FT                   /translation="MADNAYKPGKECIKCGSCMTVCPVFQNTHMEADVARGRLAVLKQV
FT                   EKDEKLARSAIMRDVLTRCLLCGACENVCANKVPAPSRVIQGREIARKRFNLPKQVQLA
FT                   ALMDQGLKGGLLRTGGKLAQGLLGGKIDKSSGLYLRFPASFFTGRKVIPAFTSPSWLEQ
FT                   KKGADFSGPGLRIGFFVGCGTDHLFQQNAQALERLGKEAGLNIITVPGQGCCGLPAYAG
FT                   GDRETAIACAKRNLDAFSALDLDAVATVCASCGSQIQNLPQLFEDDPEYLAKAEIMAAM
FT                   HQDAAQILLDAPGFQDLLKQINAAAHDETPRVYYHTPCHLRFGKGASSAPLDLLKSLDQ
FT                   RIDLIPPGGLTQCCGHGGGFNIDHHDLSLKIHQSGLGPILEQSPEKIVTGCTGCLMQFM
FT                   EGVFTAKRPHVEICHPLVLVDTLLK"
FT   gene            325602..326717
FT                   /locus_tag="Dalk_0234"
FT   CDS_pept        325602..326717
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0234"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecl:EcolC_3640 transposase IS4 family protein; IMG
FT                   reference gene:2503005930; PFAM: Transposase DDE domain;
FT                   InterPro:Ribonuclease H-like; InterPro:Transposase,
FT                   IS4-like; InterPro:Transposase, Tn5-like, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01943"
FT                   /db_xref="GOA:B8F976"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B8F976"
FT                   /protein_id="ACL01943.1"
FT                   /translation="MENQILLSEGDDWQAILTFLPHGWEEKAKELGALSRRRNFDGPEA
FT                   LLRVLLIHLVQGCSLRVTSALSKAGGLASASDVALLKRLKASGEWMRWMAVELMKQWFG
FT                   KQPEKILGMGRTVRVVDGSTVSEPGSTGTTWKIHYSIQLPSLQCDEVYVTDPKTGEDLK
FT                   NFNVHPGDVFLADRGYYHRTGMLHVVKGGGDLIVRMIHQYKLYDINGQEFGLIKNLRSL
FT                   TVNQIGDWDAFIHHKKEVISGRVCAIKKSKEAAEKAKRAILRENSKKGHKTKPETLVAA
FT                   EYVFVFTTLSREWKASQVLEAYRGRWQVELAFKRLKSLIGLGHLKKTDFEGAKAWLHGK
FT                   IFAAFLVEAMIAACDSFSPWGYEIQAAAEAT"
FT   gene            complement(327041..328792)
FT                   /locus_tag="Dalk_0235"
FT   CDS_pept        complement(327041..328792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0235"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; Fibronectin
FT                   type III domain protein; KEGG: hch:HCH_05006 BNR/Asp-box
FT                   repeat-containing protein; IMG reference gene:2503005931;
FT                   PFAM: PKD domain; InterPro:Fibronectin type III domain;
FT                   InterPro:Fibronectin, type III;
FT                   InterPro:Immunoglobulin-like fold; InterPro:Neuraminidase;
FT                   InterPro:PKD domain; InterPro:PKD/Chitinase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01944"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="InterPro:IPR036278"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS7"
FT                   /protein_id="ACL01944.1"
FT                   /translation="MFKKICYSIVLVFLAASFIACSSSGGDSTSSSDDEGGQTAAVQPD
FT                   PPQNITFAAGNGKVILDWDDNVQGAVYNIYFWTTSKSDNDGRTKISNVRPPYTHSGLEN
FT                   GRTYHYIVTRKVNGVESGYSQEIIVTPENSAPTAELTGDKEASLGETVSFDAGGSSDPD
FT                   GDELTYSMDFGDGQSELDQARPVFTHEYAAYGKYTATLTVTDTEGAPATSELEVKCGLF
FT                   PVTTVNLTPTDFFWNQQAPSTFYDGANLFVAWEAGNIQASRSQDQGASFSQSTEVMESG
FT                   YWPVSTDIAGYNEDVHIVWYDLYATECLYARSETGGLSFFDWEGISVWDNVGSYLTKVG
FT                   YDGDQFVMAVWCNTGGGPNHIQCTRSFDNGSFFSEPETLVYPNATGPDVEVVNSTVYLV
FT                   WIDNNATEYYTLSEIHFSKSPDQGETYSPAVCVSPAPAYSFTPTMKIGPNGEIYVIWRL
FT                   KPFVEETQTILNEFHTAFARSVDDGSTFQSQVWDFSGRNAMAVSPQGRIFIVWVKEIAD
FT                   KSWEFSLSYSDDQGTSFSGPIPINGIDGYIGSFSIEAFSSNKIAIVYTHFSDDLDGDII
FT                   CSTVEIP"
FT   sig_peptide     complement(328718..328792)
FT                   /locus_tag="Dalk_0235"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005931_SP"
FT   gene            329276..330313
FT                   /locus_tag="Dalk_0236"
FT   CDS_pept        329276..330313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0236"
FT                   /product="Putative TRAP-type C4-dicarboxylate transport
FT                   system, DctP subunit"
FT                   /note="PFAM: TRAP dicarboxylate transporter- DctP subunit;
FT                   KEGG: dol:Dole_3157 TRAP dicarboxylate transporter-DctP
FT                   subunit; IMG reference gene:2503005932; PFAM: Bacterial
FT                   extracellular solute-binding protein, family 7;
FT                   InterPro:Extracellular solute-binding protein, family 7,
FT                   bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01945"
FT                   /db_xref="GOA:B8FMS8"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS8"
FT                   /protein_id="ACL01945.1"
FT                   /translation="MLCKRLLLSVAAAMLLLGGIGQGRAETGAEKPKYVWKYATLAPNG
FT                   IGWAVHIQDLLLPMVQERTNGEVRVKIYWGGVMGDDEDILKKMRIGQLNGAGLSGQGVT
FT                   MAVPEMTVLELPFLFRNYDEVDYIREQMMPEFDSLAEKHGLFLVGLIDQDFDQIYSVKY
FT                   PMNKLENFEKSTFTCWYGDLEANMLKALGASAVPVNVPEISTSLRQGVVDANIGPAIWQ
FT                   VGSQMYSVYKYVNTSKIRYSPALMIQRKEDFEASEEVKAYKEAILEERSKFVRQFTERV
FT                   RVDNQKCLDAMLKYGLILAQASDEDMKMIAERTRPVWDEMAGVLYPRELLDELLEHLAE
FT                   FREEN"
FT   sig_peptide     329276..329350
FT                   /locus_tag="Dalk_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005932_SP"
FT   gene            330439..332055
FT                   /locus_tag="Dalk_0237"
FT   CDS_pept        330439..332055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0237"
FT                   /product="hypothetical protein Dalk_0237"
FT                   /note="KEGG: ace:Acel_0417 N-acetylmuramoyl-L-alanine
FT                   amidase, family 2; IMG reference gene:2503005933"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01946"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMS9"
FT                   /protein_id="ACL01946.1"
FT                   /translation="MANQVPEFQGKRWALWALLLVFFLSVLGCPFDDDDDMDPPRDDEI
FT                   QVKVTLNATGEIADIEYNGRHYQIDITGQGGVLDPASIDILNVNQVTQNGFPPGFSFPD
FT                   GLITFKVTGLNVGDTISAVLTFPSEFPAGSQYYKVTDDGWVLYANAVFAGNQVTITLTD
FT                   GLDGDLDALQNGEILDPGAPGLIDYGIPHFTVYPDKMLVSGTEVDLSRKGGGPWVGHTW
FT                   INTANSRVGWYVQTRQLPDWLSVWPESGTGSAYMHFYVCYSSSSLGTTWVNVPISDTGG
FT                   YTRNVKVGVNKRDPENLNPPFGSFDTPLDNSTVRSSIPVTGWALDDVGVDSVKIYNTTG
FT                   GGQIYIGDAAMVEGARPDVANQYPDYPQNSQAGWGYMMLTNFLPNGGNGTYIIEAVATD
FT                   YEGNQTSLGSKTIICDNANAVKPFGALDAPVQGGTASGSSYANWGWALTPQPNSIPADG
FT                   STLNVYVDGVYQGHPTYDQYREDIANLFPGYANSDGAAGYFYLDTTAYTNGVHTIQWTA
FT                   RDNAGNSDGIGSRFFTINNTD"
FT   sig_peptide     330439..330522
FT                   /locus_tag="Dalk_0237"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005933_SP"
FT   gene            332143..332631
FT                   /locus_tag="Dalk_0238"
FT   CDS_pept        332143..332631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0238"
FT                   /product="hypothetical protein Dalk_0238"
FT                   /note="KEGG: lwe:lwe0711 putative secreted protein; IMG
FT                   reference gene:2503005934"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01947"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT0"
FT                   /protein_id="ACL01947.1"
FT                   /translation="MRLMRFYAALAVLLLLAAGCGPKRVSSVQYGSPSAETKVLFATED
FT                   TAFKSVILENVVKAYEGQDVFIQVESVPALDKIDAEDYDAVVLINTCMAWRVEPEIEAF
FT                   VKKTADKQKIVLLTTTGDPDLNIEAPGVDSVTSASQMENADQVSQKIIDRINRILGEG"
FT   sig_peptide     332143..332223
FT                   /locus_tag="Dalk_0238"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005934_SP"
FT   gene            complement(332675..333169)
FT                   /locus_tag="Dalk_0239"
FT   CDS_pept        complement(332675..333169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0239"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: cau:Caur_3595
FT                   cyclic nucleotide-binding; IMG reference gene:2503005935;
FT                   PFAM: Cyclic nucleotide-binding domain; InterPro:Cyclic
FT                   nucleotide-binding domain; InterPro:Cyclic
FT                   nucleotide-binding-like; InterPro:RmlC-like jelly roll
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01948"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT1"
FT                   /protein_id="ACL01948.1"
FT                   /translation="MLKKKRLAQYVIVQGLSSDELDEVILCCDVLEFKDGDPIIKEHSI
FT                   NSSLYILEEGRVSVQIEVCRGEKESMEEIAILDSGDVFGEIAFLEEWRRSACVMAVGDV
FT                   TVLKLDGDRLHWLFERNNHIGYLMMRNLGLVLARRLMDTNYLRKIDIEDGSECVDPSLH
FT                   A"
FT   gene            complement(333297..333914)
FT                   /locus_tag="Dalk_0240"
FT   CDS_pept        complement(333297..333914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0240"
FT                   /product="hypothetical protein Dalk_0240"
FT                   /note="KEGG: mfa:Mfla_2213 hypothetical protein; IMG
FT                   reference gene:2503005936"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01949"
FT                   /db_xref="InterPro:IPR014549"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT2"
FT                   /protein_id="ACL01949.1"
FT                   /translation="MRCQHRIIKKNLFSARGKGALFPAAALILAAVLAFGGCSSNKRNR
FT                   PVDDGVNPIVIPHENLLESSYNAGDILAQALKRQSLPMNRPMLASSLVNIDNLEESSTF
FT                   GRLVSEQIASRLAQHGYPFVELKLRQDSVFIKEGQGEFLLSRELRHLGETHDAAAVLVG
FT                   TYAVTEDLVFVSVRLVRTQDNTVIAGHDYQLYNSDIVESLLR"
FT   sig_peptide     complement(333813..333914)
FT                   /locus_tag="Dalk_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005936_SP"
FT   gene            complement(333944..334666)
FT                   /locus_tag="Dalk_0241"
FT   CDS_pept        complement(333944..334666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dde:Dde_2399 hypothetical protein; IMG
FT                   reference gene:2503005937"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01950"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT3"
FT                   /protein_id="ACL01950.1"
FT                   /translation="MTSTKRKLAAAVLALAAAGLLWACRSQAPYPVTYSINAQQKMQAV
FT                   HHWDILAEDVANQVMMTIEQHPGIETQPVSVASPDETTAFSLMFHDLLVSHLVNRGLVL
FT                   TPSNEGSLILGYSARILQHEDRIIRKNPVKWTMLAGSMRVARAAYDWATEDILNMGIGV
FT                   GILGDLARGYTTGDKPAKELFITTTLAYGDRYLMHANDIYYINDGDWWQYDANPIAMGS
FT                   SLDAGGPGQAKTYRTVSE"
FT   sig_peptide     complement(334598..334666)
FT                   /locus_tag="Dalk_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005937_SP"
FT   gene            complement(334701..335285)
FT                   /locus_tag="Dalk_0242"
FT   CDS_pept        complement(334701..335285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0242"
FT                   /product="hypothetical protein Dalk_0242"
FT                   /note="IMG reference gene:2503005938"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01951"
FT                   /db_xref="InterPro:IPR012640"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT4"
FT                   /protein_id="ACL01951.1"
FT                   /translation="MKKIYVFLFILGAAAALSACSHGKSKDVSGASMPEEIYASPDYNM
FT                   YRNAKVGVFPFMSPEYARGAGSSAASVFCRQLEKNRVFSAVHLEADVPPQAIAEIAKAK
FT                   RYDLVITGAVLYWFEGSTLEPSRVEQEITVFKPSSKGNRVLWRARLMETGWPVQPKDYL
FT                   LGQTHAVPAPSAMTLVQKNAGKFCKMLLAGR"
FT   sig_peptide     complement(335217..335285)
FT                   /locus_tag="Dalk_0242"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005938_SP"
FT   gene            335913..336704
FT                   /locus_tag="Dalk_0243"
FT   CDS_pept        335913..336704
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0243"
FT                   /product="hypothetical protein Dalk_0243"
FT                   /note="IMG reference gene:2503005939; InterPro:Outer
FT                   membrane protein, beta-barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01952"
FT                   /db_xref="GOA:B8FMT5"
FT                   /db_xref="InterPro:IPR011250"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT5"
FT                   /protein_id="ACL01952.1"
FT                   /translation="MKDSTNAANRKAPVCSNHFNNTKGSYRALLIFIVAAMWVCALCTP
FT                   ALCGQETPAPQVTASPRPAKVPQWSWDWVEDLRETGHAIIPVPVTIDPQSSYQSNPGAN
FT                   STYRFSMDGAANNDRRSLFSMLDDGEALLGLLDRSGRENSPGFEGMLSDTLNTSFLSMG
FT                   SRLQFHVSKRFLPYLGGGIIYGGRDSESRVSPSLPAASGYELGVGFSFSDAPVRFGLDF
FT                   LYRGMDLSEEDPCMTMRKDESCPNNFDKDGYSMSLGFTVHF"
FT   sig_peptide     335913..336059
FT                   /locus_tag="Dalk_0243"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005939_SP"
FT   gene            337275..338588
FT                   /locus_tag="Dalk_0244"
FT   CDS_pept        337275..338588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0244"
FT                   /product="Putative phosphoglycerate kinase"
FT                   /EC_number="2.7.2.3"
FT                   /note="PFAM: phosphoglycerate kinase; KEGG: hypothetical
FT                   protein; IMG reference gene:2503005940; PFAM:
FT                   Phosphoglycerate kinase; InterPro:Phosphoglycerate kinase;
FT                   InterPro:Phosphoglycerate kinase, C-terminal;
FT                   InterPro:Phosphoglycerate kinase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01953"
FT                   /db_xref="GOA:B8FMT6"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT6"
FT                   /protein_id="ACL01953.1"
FT                   /translation="MNRHLIDSRLPLIQDADLAGKVVLVRVDHNVVKKGVIHDPYRIDA
FT                   TLGTLYNIVERGGRPILMTHVGRPKDKKTGTIKVDAGTSVQPIVEYLERKLYTTFAIPE
FT                   FPVDGDQGIRQIDTSINWHIRDLNEHRIGGIYLPNTRWFSGEAAKGDARERLARQLAGL
FT                   ADVFVNDAFGSWQPDASTFDVAEHLPSYAGFLMQKELINLRHVLDPEKPFVAVVAGAKY
FT                   DTKIGPLQEIYKKVDHLILGGVIYNAFLCAKYGITVGGVSETDVKAARELVAQDKEAGK
FT                   IVELPFLVESDTIEGRVEGKYRTVSASDFAPGQERGYFLDIAPESFDTPQVAQAIAGAK
FT                   TIFVNAVMGLTPHFYEGSQKLDATIDANTGAQKFYGGGDTLQEFKNLSPGLYLAAMDSA
FT                   QYYFFTGGGTVLKAIEEGSPYGLDPVKALMENKERFKG"
FT   gene            complement(339000..339362)
FT                   /locus_tag="Dalk_0245"
FT   CDS_pept        complement(339000..339362)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0245"
FT                   /product="protein of unknown function DUF1330"
FT                   /note="PFAM: protein of unknown function DUF1330; KEGG:
FT                   rpd:RPD_0120 hypothetical protein; IMG reference
FT                   gene:2503005941; PFAM: Protein of unknown function
FT                   (DUF1330); InterPro:Dimeric alpha-beta barrel;
FT                   InterPro:Protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01954"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT7"
FT                   /protein_id="ACL01954.1"
FT                   /translation="MAFIEPTGRQLKKLSEMKHEGPIVMVNLLKLKKGGGQESYAKYSD
FT                   ASLKIVQKIGGRVIYFGKYMMPVIGDGDWDGVLLVEYPSIEAFFEMVNSPEYKATVHHR
FT                   SEALEDSRLWATRPIA"
FT   gene            339875..340297
FT                   /locus_tag="Dalk_0246"
FT   CDS_pept        339875..340297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0246"
FT                   /product="hypothetical protein Dalk_0246"
FT                   /note="IMG reference gene:2503005942"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01955"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT8"
FT                   /protein_id="ACL01955.1"
FT                   /translation="MDEGDKPITTAELLELRDQMLEAADRAIAGDPALYRQIRRMLCKV
FT                   VHGDVEIGDYYSLALNIARSLDKLGPGVFLFEYYSENIHPEKKGKARFFRPECQDLLFQ
FT                   LDSIQDYKRKKRPFKIINGGKGDEGDASHPVRLHNG"
FT   gene            340366..343404
FT                   /locus_tag="Dalk_0247"
FT   CDS_pept        340366..343404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0247"
FT                   /product="Heterodisulfide reductase, subunit A-like
FT                   protein"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; 4Fe-4S ferredoxin iron-sulfur binding
FT                   domain protein; KEGG: sfu:Sfum_3013 4Fe-4S ferredoxin,
FT                   iron-sulfur binding domain protein; IMG reference
FT                   gene:2503005943; PFAM: Pyridine nucleotide-disulphide
FT                   oxidoreductase; InterPro:4Fe-4S ferredoxin, iron-sulphur
FT                   binding, conserved site; InterPro:4Fe-4S ferredoxin,
FT                   iron-sulpur binding domain; InterPro:FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase; InterPro:Pyridine
FT                   nucleotide-disulphide oxidoreductase, NAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01956"
FT                   /db_xref="GOA:B8FMT9"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039650"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMT9"
FT                   /protein_id="ACL01956.1"
FT                   /translation="MSNDVVGSVMVVGGGIAGIQASLDLAQSGYKVYMVEKTASIGGVM
FT                   AMLDKTFPTNDCSMCIMSPKLVEVGRHPNIELITLAEIQGIEGAKGDFTVNIRQAPRYV
FT                   DTEKCIACGQCAAKCPKKVTDEYNQGLIKRKAIYVPYPQAVPLKFAIDPEQCLKLTKDK
FT                   CGNCEKVCPAGAILYDDKEKILDIHVGSVILAPGFSAFDPKGIDAYAMHQSKNVMTSLE
FT                   FERILSASGPTGGHLVRPSDSKEPLKIAWLQCVGSRDINRCGNSYCSSVCCMYAIKQAI
FT                   IAKEHAPYELDCSIFYMDMRTHGKGFEDCYNEAREKHGVAFKRARVHTIDPNPETGDLD
FT                   LRYVDEDGNVLNEDYDLVVLSVGLEISDPLRELAGKMGVELTPGGFGQVDSFSPVASNV
FT                   DGIYLCGAFAGPKDIPQSVVEAGSAALMAGSGLTASRDTLTVKTEMPPEVNIKGEPPRV
FT                   GVFVCQCGINIGGVVDVPAVRDYAANLPYVEFSDDNLYSCSQDTQDAMTKLIKEKGLNR
FT                   IVVAACSPKTHEPLFQETLSAAGLNKYLFEFVNIRNQDSWVHKDDPQKATEKAKDLLRM
FT                   AVAKVALLSPLEESQLNINQHAMVIGGGISGIAAAQALSAQGYETSIVERDSSLGGQAR
FT                   SLFKTAKHEDIQEKLGQMIQEVEDDLNITVHLNAELADVTGFVGAFQSTIKNDQGEYVV
FT                   DHGVTIIATGAYELEPTEYLYGQDPRILTGQELDRKMMENDAVVKNAETAVFIQCVGSR
FT                   EPNRPYCSRLCCTHSVLSALHLKEMNPDMQVYVLYRDIRTYGERENLYKEAREKGVIFI
FT                   RYNVDDKPKVSADDSGLTIEVRDPIAGLPLAIKADLLTLASAVVPYNDERLAQQFKLPL
FT                   NDQGFFVEAHVKLAPSSFATDGVFLCGLAHYPKPIDEAVAQAQAAASAAVTLLSRKSIN
FT                   TSANVAKVDPRFCSSCMVCVSTCPYSAPSMVKEGPNAGKAEINPVLCKGCGQCVASCRS
FT                   GALHLQGFDTDQIMAQIREMCAV"
FT   gene            343865..344689
FT                   /locus_tag="Dalk_0248"
FT   CDS_pept        343865..344689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0248"
FT                   /product="putative transcriptional regulator, PaaX family"
FT                   /note="PFAM: PaaX domain protein domain; KEGG: rpe:RPE_1212
FT                   PaaX domain protein, C-terminal domain; IMG reference
FT                   gene:2503005944; PFAM: PaaX-like protein C-terminal domain;
FT                   InterPro:PaaX-like, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01957"
FT                   /db_xref="UniProtKB/TrEMBL:B8FMU0"
FT                   /protein_id="ACL01957.1"
FT                   /translation="MNWNITPKILIVSILHVSDNKAMPIKDMIAIGRLFGFTGNVIRVT
FT                   TARLVRDGRLENDERGLYRIKDMDTPISRFVNAWKQGEDRVKNWDGSWICCLAPNGTAG
FT                   RRKKNAKALELPGFREGLPGLWVRPANLTMDLPSLKELLVHQGMDPAGELFVGRDFSEK
FT                   TAAQWQKFLWPVEELVRDMEKALERIEKSKARVQGLPPDSALMETYLVGTETVHMLVKD
FT                   PLLPEEIMPPAHRVKLAGAMLEYNKIGKDVWEREAFGLRFSQSPSHMELEGV"
FT   gene            344695..345798
FT                   /locus_tag="Dalk_0249"
FT   CDS_pept        344695..345798
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0249"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-component;
FT                   KEGG: dol:Dole_0930 2-hydroxyglutaryl-CoA dehydratase
FT                   D-component; IMG reference gene:2503005945; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase, D-component;
FT                   InterPro:2-hydroxyglutaryl-CoA dehydratase, D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01958"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8S6"
FT                   /protein_id="ACL01958.1"
FT                   /translation="MNAIQSQLKALHDAGKPVLGCFPLYPPLELIHSLGIAPAVLWGFK
FT                   PYFTQVSLADRHLQNYACSVGRYLVEFVLRDAGETLDGLLMYNACDTLRNLPEIIDRGL
FT                   AKDAGLPLHTFHVPAVSMERRGAREYLKDRLDGLIAWLEATFSVKFDPDSFEKSVSLYA
FT                   EMRGLMQKVQKHVGEGKALFSELAELCSKLNFMLVEDQITALQEFCRACEEKTAAPTGS
FT                   QVLISGILPPPPEILKAMEGAGLTIVGADLANMHRAWAYTPTAGNDPAAYYADFYENHF
FT                   PCTTLLPTADRRLPALESMLEDCGAGAWIFAGEKFCEYEYFELPYVEKALKAKGIGVLS
FT                   LEFSLGDEQNLGSMKTRIEAFAEMIEE"
FT   gene            345809..347050
FT                   /locus_tag="Dalk_0250"
FT   CDS_pept        345809..347050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0250"
FT                   /product="2-hydroxyglutaryl-CoA dehydratase D-component"
FT                   /note="PFAM: 2-hydroxyglutaryl-CoA dehydratase D-component;
FT                   KEGG: dol:Dole_0931 2-hydroxyglutaryl-CoA dehydratase
FT                   D-component; IMG reference gene:2503005946; PFAM:
FT                   2-hydroxyglutaryl-CoA dehydratase, D-component;
FT                   InterPro:2-hydroxyglutaryl-CoA dehydratase, D-component"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01959"
FT                   /db_xref="InterPro:IPR010327"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8S7"
FT                   /protein_id="ACL01959.1"
FT                   /translation="MAQFVKTDSGKRLTRLITNGYMDNIVKAQQGAFVVWIAIIVPAEI
FT                   FAGFDNVLYCVPESHSALCAGKGVGVSLCEKAENLGYSMDLCSYARIDMGCHFNQGADS
FT                   PAGGLPKPDLLVSNNNNCTLLAKWFDVYHREWDIPHFILDIPFCYESQKQRDMEYIVSQ
FT                   FQDLIQTVEKLSGQKFNPEKMAQAWENSVEANKHWRRFLAAAKNKPSGITAFDSFVQMA
FT                   PTLTMRGTPELAEHYRFLADETEARVEQGIVPAPNEKYRLLWDNIAPWHQLRKMSSRLG
FT                   ALDANIISASYTYCLGSREGSLDLLDLESLSPLEGMARLQNFSICPHGLQLRGRAMKQA
FT                   IEEMDIDGVVFASNRSCKVYSLMQMDQQRYVQEELGVPTVMIDVDHADERKYSEETAFV
FT                   RMEALLESIDEARR"
FT   gene            347055..347831
FT                   /locus_tag="Dalk_0251"
FT   CDS_pept        347055..347831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0251"
FT                   /product="CoA-substrate-specific enzyme activase"
FT                   /note="TIGRFAM: CoA-substrate-specific enzyme activase;
FT                   PFAM: ATPase BadF/BadG/BcrA/BcrD type; KEGG: mta:Moth_1005
FT                   CoA enzyme activase; IMG reference gene:2503005947; PFAM:
FT                   BadF/BadG/BcrA/BcrD ATPase family; TIGRFAM:
FT                   CoA-substrate-specific enzyme activase, putative;
FT                   benzoyl-CoA reductase, bcr type, subunit D;
FT                   InterPro:ATPase, BadF/BadG/BcrA/BcrD type; InterPro:CoA
FT                   enzyme activase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01960"
FT                   /db_xref="InterPro:IPR002731"
FT                   /db_xref="InterPro:IPR008275"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8S8"
FT                   /protein_id="ACL01960.1"
FT                   /translation="MFFAGVDIGSTSTECVILNESGEIIAADMRPTGANSAKAAQAVLD
FT                   SAIQKAGLDAPPHRIVATGYGRVSAPFAHKVVTEITCHARGVLHLFPQVRTIVDVGGQD
FT                   SKVIRIGPKGNVIDFVMNDKCSAGSGRFLEVMARALEVELDDLGPLSEKSAEEISISSM
FT                   CTVFAESEVISLVARAVPVEDIINGIHKSIVNRLASQMQRMNPEPDIVMTGGVAKNSGM
FT                   VKKLSQAAGHVVLVPENPRMTGALGAALTVMGLDRE"
FT   gene            348554..349162
FT                   /locus_tag="Dalk_0252"
FT   CDS_pept        348554..349162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0252"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: ankyrin repeat protein,
FT                   putative; IMG reference gene:2503005948; PFAM: Ankyrin
FT                   repeat; InterPro:Ankyrin repeat; InterPro:Ankyrin
FT                   repeat-containing domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01961"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8S9"
FT                   /protein_id="ACL01961.1"
FT                   /translation="MIKLKRFLFPDIFQAAQQGRMQKVKSFLQKGTPVDVRDGSGRTPL
FT                   MHAAWEGHPKLLKFLLDSGADPKAEDDVKETALAHAAFYSDNLECVRLLIDHGADVNAQ
FT                   DNDGFSILMSAIGDAPLELTKMLVEAGADVNHQDCEGDTPLIAAMYGIPSEREIKYLLD
FT                   SGANKTVRNKEGKTAYDVHLEEEEGFQDPEILELVRLWP"
FT   gene            350168..350974
FT                   /locus_tag="Dalk_0253"
FT   CDS_pept        350168..350974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0253"
FT                   /product="Acetoacetate decarboxylase"
FT                   /note="PFAM: Acetoacetate decarboxylase; KEGG:
FT                   mem:Memar_1128 hypothetical protein; IMG reference
FT                   gene:2503005949; PFAM: Acetoacetate decarboxylase (ADC);
FT                   InterPro:Acetoacetate decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01962"
FT                   /db_xref="GOA:B8F8T0"
FT                   /db_xref="InterPro:IPR010451"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T0"
FT                   /protein_id="ACL01962.1"
FT                   /translation="MFKFDPYQQYMMPAHFGPRNRKAPSGWYHNVTSMVVSYRTDREKL
FT                   SAYLPEPFEVAEDPIITIVYSCNKEVDWLAGHGYNLIGVNASVVFNGAVDRLEGFYTLV
FT                   MWENLADPILTGREVQGIPKIYADIPDHSVIGGVFRAKASHFSSPIMEMSITDLYYPSL
FT                   AELKERQDFMEGRDNWMGWKYIANPDGFGSMVSEPTLFPAETKYKALQMGTGSINWESL
FT                   TWEQNPTQYHIVNALAELPIVEYLPAIVTQGSTNLAVEGVPVRALK"
FT   gene            351038..352303
FT                   /locus_tag="Dalk_0254"
FT   CDS_pept        351038..352303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0254"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase (NAD-binding)"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   dol:Dole_0830 3-hydroxybutyryl-CoA dehydrogenase; IMG
FT                   reference gene:2503005950; PFAM: 3-hydroxyacyl-CoA
FT                   dehydrogenase, C-terminal domain; 3-hydroxyacyl-CoA
FT                   dehydrogenase, NAD binding domain;
FT                   InterPro:3-hydroxyacyl-CoA dehydrogenase, C-terminal;
FT                   InterPro:3-hydroxyacyl-CoA dehydrogenase, NAD binding;
FT                   InterPro:6-phosphogluconate dehydrogenase, C-terminal-like;
FT                   InterPro:Dehydrogenase, multihelical;
FT                   InterPro:NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01963"
FT                   /db_xref="GOA:B8F8T1"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T1"
FT                   /protein_id="ACL01963.1"
FT                   /translation="MQIKEIKKAVYIGAGTMGCYNSLLAGIAGYDTVVYDISQDALEGV
FT                   PIGHQMLGDYLAAIGAYTPEQLAEGGKRIRFSSDLIGALENADIVSESVFENLELKRKI
FT                   HRQLDEMCPPETILTTNTSSLMVSEIEDVVGRGERFAAMHYHLGTPLVDVVGGPRTTTE
FT                   TVDIITRFVESLQCIPFSPAKENRGYVFNNLIPGLNQAAVALVMEYGEFFEDVDRAWMS
FT                   HENLGPFATMDLVGLNVYYDGSKDSLDYEERRQFAQMTINLLQPYIDRGELGIKTGKGF
FT                   YSYPEPSYGKPEFLSASAPREDIDRVLTNGVIIRAILLAAEGIADCDHIDKIWMINMMS
FT                   GSGPFAWLDKKGINEFLNELESEQRQLLFPEYDLLVIKRFLKPYLDSGWTGLTSGRGIY
FT                   SYPEPEFEKPDFLENPFKRASK"
FT   gene            352364..353917
FT                   /locus_tag="Dalk_0255"
FT   CDS_pept        352364..353917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0255"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: tte:TTE1915 ABC-type dipeptide/oligopeptide/nickel
FT                   transport systems, periplasmic components; IMG reference
FT                   gene:2503005951; PFAM: Bacterial extracellular
FT                   solute-binding proteins, family 5 Middle;
FT                   InterPro:Bacterial extracellular solute-binding protein,
FT                   family 5"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01964"
FT                   /db_xref="GOA:B8F8T2"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T2"
FT                   /protein_id="ACL01964.1"
FT                   /translation="MKKISQVWVAMAVMVLVFAFTPNLVLARDTVRIGVRYDPTTVNML
FT                   ELKLGSDFPVIMPMHAGLMGIHPETGERVNVLAESIEIINDKDIKIKLIETARFHNGTK
FT                   LTAHDVKWTYEQCANPKNSNIMAGPLDEIEEIEVVDDYNLVMRLWEPYAPWQELLWIGI
FT                   CSKDYFEEVGLETFRKNPIGSGPFRFVDRKIGESVTLEIVKDYPQYQISAYHELKPEYK
FT                   RLIFVTVPDDVTRLAMLETGELDFVFDVLPHQLKRLKKNSDIKIKVSDQVPSLIGLSAS
FT                   PNTDPIMSDRFLGQAIRHAINRQEIVDKIFLGQGYPMYMFASRSELGYDPDFFFDFNPE
FT                   KAKELLKKSAYKSDKVLTLTYTNLVPNSALVAAVIQKYLQDVGIKTKLQQLEEGVTATY
FT                   VRNRDPRMGHLRLYSWAGGRDPNIRILLTLMSDSPYATVTNRPRKKEMDALCKAQAKET
FT                   DSEKRLEILQKIHGIIAEDAVGTFLFGLNMIYAMRSDIDYTWTPGEAFPFHLQRIRVEK
FT                   "
FT   sig_peptide     352364..352444
FT                   /locus_tag="Dalk_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005951_SP"
FT   gene            353959..355677
FT                   /locus_tag="Dalk_0256"
FT   CDS_pept        353959..355677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0256"
FT                   /product="Aldehyde ferredoxin oxidoreductase"
FT                   /EC_number="1.2.7.5"
FT                   /note="PFAM: aldehyde ferredoxin oxidoreductase; Aldehyde
FT                   ferredoxin oxidoreductase; KEGG: gur:Gura_2421 aldehyde
FT                   ferredoxin oxidoreductase; IMG reference gene:2503005952;
FT                   PFAM: Aldehyde ferredoxin oxidoreductase, N-terminal
FT                   domain; Aldehyde ferredoxin oxidoreductase, domains 2 & 3;
FT                   InterPro:Aldehyde ferredoxin oxidoreductase, C-terminal;
FT                   InterPro:Aldehyde ferredoxin oxidoreductase, domain 2;
FT                   InterPro:Aldehyde ferredoxin oxidoreductase, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01965"
FT                   /db_xref="GOA:B8F8T3"
FT                   /db_xref="InterPro:IPR001203"
FT                   /db_xref="InterPro:IPR013983"
FT                   /db_xref="InterPro:IPR013984"
FT                   /db_xref="InterPro:IPR013985"
FT                   /db_xref="InterPro:IPR036021"
FT                   /db_xref="InterPro:IPR036503"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T3"
FT                   /protein_id="ACL01965.1"
FT                   /translation="MKFIRINMTDKTIKTHNVPIQYLGLGGRGLTSLLINEEVPGFCDP
FT                   LGPDNKLVFAPGLLSGTPLVNTSRLSVGAKSPLTGGIKESNVGGTMAKAIAGLGITAII
FT                   VEGQAPEGALSIIRISKDGSISLDDGCQHKGMRTYALTERLQTQYGKNISVACIGPAGE
FT                   YGCTSASIQATDTDDHPCRAAGRGGLGAVMGAKGIKALVVDKGGKMADEMVDLQSFKAA
FT                   AKIFAQAIKDHPFSGQLLPALGTAYLLSAVNAMGAFPCYNATKGQLEGFEKISGEILAE
FT                   TIQARGGKTAHVGCTGCVAQCSNVFVDTDGKYVTSSLEYETLWSMGGMPGITDLDIIAR
FT                   LDFLCDDIGLDTMNTGVAIGVAMDAGYKDFGDGQAALEMLEEIARGTEIGMVLGHGPAA
FT                   VGEYFKHSRVPVVKKQSIAAYDPRGMQGNGVTYSTSTMGADHTAGNLIGAYLGGELDPL
FT                   SPEGQAEASRNLQISMASLDNTGLCMLVGGALENPDAVKALGDMITAKFGIEPGPEDGV
FT                   EMGKRILNAEREFNAKAGLTKHDDRLPDFFKKEPLPPHNKTFLLSDDELDAVYNF"
FT   gene            355740..355979
FT                   /locus_tag="Dalk_0257"
FT   CDS_pept        355740..355979
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0257"
FT                   /product="thiamineS protein"
FT                   /note="PFAM: thiamineS protein; KEGG: pth:PTH_0497 sulfur
FT                   transfer protein; IMG reference gene:2503005953; PFAM: ThiS
FT                   family; InterPro:Beta-grasp fold, ferredoxin-type;
FT                   InterPro:Molybdopterin synthase/thiamin biosynthesis
FT                   sulphur carrier, beta-grasp; InterPro:ThiamineS"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01966"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T4"
FT                   /protein_id="ACL01966.1"
FT                   /translation="MNVQVKLFGTLRMSIPDYDPSKGIWVAVSEGATAGDLIASLDLPH
FT                   GKSSIAVVNNRVVGADARLKENDEIYIIQRALGG"
FT   gene            356111..356965
FT                   /locus_tag="Dalk_0258"
FT   CDS_pept        356111..356965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0258"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   amt:Amet_0318 hypothetical protein; IMG reference
FT                   gene:2503005954; PFAM: Prokaryotic protein of unknown
FT                   function (DUF849); InterPro:Aldolase-type TIM barrel;
FT                   InterPro:Protein of unknown function DUF849, prokaryotic"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01967"
FT                   /db_xref="GOA:B8F8T5"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T5"
FT                   /protein_id="ACL01967.1"
FT                   /translation="MEKLIISVAQTGGLHGKSSNPALPEQPDEIAQSAYDCYNAGASVC
FT                   HIHVRDKQGRTTADLNVYSDVLTKIQSKCPIITQVGGGIGTIVEPDGRSRGATLEEKMA
FT                   LTALAPKPDMLTINAGTFDFGWIAEPFINPMDWNEDFARRCNQRKIAVECECYDISHIE
FT                   NVKELIRRGALNSPVHFSLVLGVKGGIPSSPKMISAMVDMIPEGSTWQVITIGKHQLTS
FT                   TVMAMCQGANIRTGLEDNVYYSRGELAKSNAQLVERMVRIARELGRNIATVEEAVGALG
FT                   IER"
FT   gene            357013..357795
FT                   /locus_tag="Dalk_0259"
FT   CDS_pept        357013..357795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0259"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mva:Mvan_0894 short-chain
FT                   dehydrogenase/reductase SDR; IMG reference gene:2503005955;
FT                   PFAM: short chain dehydrogenase; InterPro:Glucose/ribitol
FT                   dehydrogenase; InterPro:NAD(P)-binding domain;
FT                   InterPro:Short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01968"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T6"
FT                   /protein_id="ACL01968.1"
FT                   /translation="MNVKAPNELFSLKNQTAVITGASSGLGVAFARGLAAAGANIILAA
FT                   RRSQPLKQLSLELAKTGIGVQSVTCDVTREQDVDNMVDVAMECFGRLDILINNAGVATV
FT                   HPAEDEPYEEFRRVMETNVNAQFLCAQRCGRIMLEAGKGSIVNIASMMGLVGIGVIPQA
FT                   AYNTSKGAMINMTRELAAQWSKKGVRVNALGPGYFPSEMTTEMFDNEKSQNFIERRTLL
FT                   KRAGRPEELIGPLLLLASEAGSYITGQTLIVDGGWTAV"
FT   sig_peptide     357013..357120
FT                   /locus_tag="Dalk_0259"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005955_SP"
FT   gene            358042..358764
FT                   /locus_tag="Dalk_0260"
FT   CDS_pept        358042..358764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0260"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: pth:PTH_2704
FT                   transcriptional regulator; IMG reference gene:2503005956;
FT                   InterPro:DNA binding domain, putative; InterPro:HTH
FT                   transcriptional regulator, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01969"
FT                   /db_xref="GOA:B8F8T7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T7"
FT                   /protein_id="ACL01969.1"
FT                   /translation="MRLKELVDKTGVSTETIQFYLREGVLPKPRKRGKALADYGEHYVE
FT                   LINTIKNLQNKHFLPLSVIKNIIKKLKRLSPEEEHYFQLQSEFFSPVGHLLFQKEVVGD
FT                   EEFLAVTGLAREWLSIAEEWGIISAATKDGAKVFSADDIAIGKLMVEMDRIGMGPKDGF
FT                   DPEVLRHYKDRLKEMISDLNLQFTEQLFGKATADEFAEIGFSAQNLMGFYFFFIFRKLA
FT                   HEDTLKRIQEKFAAQGEK"
FT   gene            358865..359419
FT                   /locus_tag="Dalk_0261"
FT   CDS_pept        358865..359419
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0261"
FT                   /product="hypothetical protein Dalk_0261"
FT                   /note="IMG reference gene:2503005957"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01970"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T8"
FT                   /protein_id="ACL01970.1"
FT                   /translation="MNKRSRIAAMMLVSLIVMVFVSACATTKPQAQPGFTPGKYENAEY
FT                   RFTVTFPDHYELQELQGDEVFKVANPNMYRIPVFSVNVAEAKPGQTLDAQAFVDSVSET
FT                   MPKAKRFKILSEESIALSDGTPALAIFFKYLYSDGATKLQTASVWAIKDGKSFSTNATT
FT                   ILGGDTGPDKLMEVAKSLTFF"
FT   sig_peptide     358865..358939
FT                   /locus_tag="Dalk_0261"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005957_SP"
FT   gene            359532..360455
FT                   /locus_tag="Dalk_0262"
FT   CDS_pept        359532..360455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0262"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_2407
FT                   binding-protein-dependent transport systems inner membrane
FT                   component; IMG reference gene:2503005958; PFAM:
FT                   Binding-protein-dependent transport system inner membrane
FT                   component; InterPro:Binding-protein-dependent transport
FT                   systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01971"
FT                   /db_xref="GOA:B8F8T9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8T9"
FT                   /protein_id="ACL01971.1"
FT                   /translation="MQGYIIKRVLIAALTIFAVLSVVFFVFRLGPADPVALMLPPEATP
FT                   QDAQALTEKFGLDKPLAVQYVNFLKNAVHGDFGISFRFNESAAQVMFQTVPATLKLGLM
FT                   ALAFSILVGLSVGIISAVKPDSIIDRVGRVFALAGMSLPAFWVGVMLILFFGVTLRWLP
FT                   IAGKGTYLHYIMPAFCLSLYPIALITRLSRSSMLDALKSDYVVMARIKGVPEFHVIMVH
FT                   ALKNASIPILTVIFSIMGTLLVGRAVVVEFIFSWPGIGKLAMESFFARDYPVVQVFVVF
FT                   VTFVVVTLNLIVDILYAYIDHRIRYQ"
FT   gene            360608..361438
FT                   /locus_tag="Dalk_0263"
FT   CDS_pept        360608..361438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0263"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH0349 oligopeptide ABC
FT                   transporter (permease); IMG reference gene:2503005959;
FT                   PFAM: Binding-protein-dependent transport system inner
FT                   membrane component; InterPro:Binding-protein-dependent
FT                   transport systems inner membrane component"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01972"
FT                   /db_xref="GOA:B8F8U0"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U0"
FT                   /protein_id="ACL01972.1"
FT                   /translation="MGRIRLPYFGLFCMALFFFAVIFADVISPYPPNEGDLFNTTLPPA
FT                   WSEDGGMEHILGTDMLGRDVLSRIIHGSRMSLIISVGCILFYGTLGVTLGLLSGFLGGR
FT                   TDMIIMRVADLWLSLPGIIVLFMLASVYGPSAKTIIITFGIMGWPNYARIVRGECLSLK
FT                   ERDFVRLARVAGCSNLRIMFSHILPNIVNTIIIISTIEIGGIIVLTASMSFLGLGTQPP
FT                   SCDWGLMLAEGRQYITYAWWLVTFPGVAIVIAVLGFNLTGDWLREVLDPKQKLR"
FT   sig_peptide     360608..360679
FT                   /locus_tag="Dalk_0263"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005959_SP"
FT   gene            361438..362433
FT                   /locus_tag="Dalk_0264"
FT   CDS_pept        361438..362433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0264"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: chy:CHY_1126 oligopeptide/dipeptide ABC
FT                   transporter, ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase; IMG
FT                   reference gene:2503005960; PFAM: ABC transporter;
FT                   Oligopeptide/dipeptide transporter, C-terminal region;
FT                   TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain; InterPro:ABC
FT                   transporter, conserved site; InterPro:ABC transporter-like;
FT                   InterPro:ATPase, AAA+ type, core;
FT                   InterPro:Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal;
FT                   InterPro:Oligopeptide/dipeptide ABC transporter,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01973"
FT                   /db_xref="GOA:B8F8U1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U1"
FT                   /protein_id="ACL01973.1"
FT                   /translation="MKWADMHMDNQKILEVKNLQTSFFTKKGEVKAVDGVSFSIGKGEI
FT                   VGLVGESGSGKSITSLSIMQLVPQPAGKIMSGQILFKNQDLLKKTPEQMRQLRGDRISM
FT                   ILQDPMVAMNQLLTVGKQLGEPLRFHNKNMGSLREMCIKLLRRVNVPAPETRVDDYPFQ
FT                   FSGGMSQRALIAMGIANDPDLLIADEPTTALDVTIAAQVLKLMKEIQRETGASIILITH
FT                   DLATVAQICSRVLVMYAGRIVESAPIKTFFRRPAHPYSVGLIQSVPVLGRPVDRLFSIK
FT                   GQPPNLFDMPKGCRFYPRCEKAEKRCQNNYPPETWLDTDHSVACWLYGGK"
FT   gene            362437..363408
FT                   /locus_tag="Dalk_0265"
FT   CDS_pept        362437..363408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0265"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: gtn:GTNG_0477 oligopeptide ABC transporter
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; IMG reference gene:2503005961; PFAM: ABC
FT                   transporter; Oligopeptide/dipeptide transporter, C-terminal
FT                   region; TIGRFAM: oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal domain; InterPro:ABC
FT                   transporter, conserved site; InterPro:ABC transporter-like;
FT                   InterPro:ATPase, AAA+ type, core;
FT                   InterPro:Oligopeptide/dipeptide ABC transporter,
FT                   ATP-binding protein, C-terminal;
FT                   InterPro:Oligopeptide/dipeptide ABC transporter,
FT                   C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01974"
FT                   /db_xref="GOA:B8F8U2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U2"
FT                   /protein_id="ACL01974.1"
FT                   /translation="MSGQEILSVKNLKKHYPVTKGTFITKEIGSVRAVSNVSFSLRSGE
FT                   TLGLVGESGCGKSTTANMLLGLTSPSGGRILFEGRDITQFNSKERFAFRRNIQAVFQDP
FT                   FRSLNPRKKVRQIVSEPLVVHKVGTRKQINRRVDELLEMVGFDSHHATQYPHEFSGGQR
FT                   QRIAIARALALEPKMIVLDEPVSALDVSIQAQILNLLIDLQKQLNLTYVIISHDLAVVE
FT                   HVSSFVGVMYLGHLMELAPRQALYENPKHPYTKALLESVPIADPESVKELSLEGEVPSP
FT                   LNPPKGCAFHPRCQEMQTFCCEVEPKYREVTPGHFCRCNVFV"
FT   gene            complement(363643..364236)
FT                   /locus_tag="Dalk_0266"
FT   CDS_pept        complement(363643..364236)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0266"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rfr:Rfer_1356 hypothetical protein; IMG
FT                   reference gene:2503005962"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01975"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U3"
FT                   /protein_id="ACL01975.1"
FT                   /translation="MGGQGSGSWMRWETRSTTEQQLWIDVRCLKRKGCLKDGYSGSLYW
FT                   SVRQKKIGSVGAKTKSDRITLTYRYHSQYGYKNRVQQVVYFEYTPCNLGGSRPWFLCPQ
FT                   CKKRVAILYGIGKYFMCRNCHGLVYACQRDRKAERLMSKAQKIRRKIGADPNLSIPIMF
FT                   KPKYMHQKTFDRLRFRADEATCQYLRIMYQRLGL"
FT   gene            complement(364381..365382)
FT                   /locus_tag="Dalk_0267"
FT   CDS_pept        complement(364381..365382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0267"
FT                   /product="P4 alpha zinc-binding domain protein"
FT                   /note="PFAM: P4 alpha zinc-binding domain protein; KEGG:
FT                   dvu:DVU2879 hypothetical protein; IMG reference
FT                   gene:2503005963; PFAM: Zinc-binding domain of
FT                   primase-helicase; InterPro:DNA primase, catalytic core,
FT                   N-terminal; InterPro:Phage P4 alpha, zinc-binding;
FT                   InterPro:Toprim domain; InterPro:Zinc finger, CHC2-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01976"
FT                   /db_xref="GOA:B8F8U4"
FT                   /db_xref="InterPro:IPR013237"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U4"
FT                   /protein_id="ACL01976.1"
FT                   /translation="MLAYDCRRQVKADGLYLKKVASTHGGEFAGPCPSCGGEDRFRVWP
FT                   EQGRYWCRGCARSGDAIQYLWDFKGIAYMEACFALGQEPKATTGRLKLKPVWAPKDAGI
FT                   PNPSWHEKASAFLVWTQEQLWTDEGGEARAFLHNRGIQDATIKKAGLGWNPTDAYRDRE
FT                   AWGLEPEIKENGRPKGLWLPKGLVIPCRINEKPIRIRIRRPKPENRPRYYALPGSTFPP
FT                   MSIGAGLVAVVVESELDAILTAQEAPQDVYSLAMGSVQAKPDLKAHNTLQQTKRILVAL
FT                   DADTAGAKASRWWLNQYPQAIRWPVPIKKDPGDAFTAGLCLKAWIESTNMEF"
FT   gene            365522..367177
FT                   /locus_tag="Dalk_0268"
FT   CDS_pept        365522..367177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0268"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   dau:Daud_0958 transposase; IMG reference gene:2503005964;
FT                   PFAM: Transposase DDE domain; InterPro:Ribonuclease H-like;
FT                   InterPro:Transposase, IS4-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01977"
FT                   /db_xref="GOA:B8F8U5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U5"
FT                   /protein_id="ACL01977.1"
FT                   /translation="MYIRTISRKNKDGSKVEYVQLAHNYRDPKSKQARAEVLYSFGRKD
FT                   QLDMEAIRRLAKSVERFLAKTGDVETQCKLQFPGEDVRFVESRPMGGVFVLKKIWDRLR
FT                   ISECLDKALADRQYTAPIGDAVFAMVANRALAPDSKLAVEDWAAKDVHLELDQPLKVQH
FT                   LYRAMDFLLENQEAIQKEVFWSTANLLNLEVDLVFFDTTSTYFERDEEDEEGLKRYGHS
FT                   KDKRKDLPQVVVGLAVTKEGLPIRSWVFPGNTPDVNTVEQIQKEMNDWKLGRVVWAMDR
FT                   GMTSEENRAILQRGGGNYILGEKLRGSNMSKAVLGSPGRFTTVRDNLEIKEVTAGDGAC
FT                   RRRYVIVRNPKQVKRDQATRERLIRRAEQEIEAIGDLTGKKHTKAACALLSHRSMGKYV
FT                   RELKSGKLKINKAKITEEEKLDGKYLLSCSDDTLSPEEIALGYKQLLEVERAFRTLKST
FT                   LDLRPVYHRKDERIRSHVTLCWLALLLVRLIELETGMTWNQVRRILERLHMGEFFLNNS
FT                   RILQRTELTQDQNKLLKKLKIKPPPLIKKIDLTS"
FT   gene            complement(367357..367839)
FT                   /locus_tag="Dalk_0269"
FT   CDS_pept        complement(367357..367839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0269"
FT                   /product="hypothetical protein Dalk_0269"
FT                   /note="IMG reference gene:2503005965"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01978"
FT                   /db_xref="GOA:B8F8U6"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U6"
FT                   /protein_id="ACL01978.1"
FT                   /translation="MNNYRDIGAIILCFLLMLCYIYSVSMHLAFLFGIEKALDSWSLGF
FT                   FVIPVVFIFPSVHLKHSKEIRAIISVKFGHATRLRLLVIMHFIYSLYNLGLFVIDASNL
FT                   LEDKLNGEIIVALMYSSMMMLASFYFVLYFLFGRSKDKFGRYRIVAEDAEGSGDRF"
FT   gene            complement(368499..368843)
FT                   /locus_tag="Dalk_0270"
FT   CDS_pept        complement(368499..368843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0270"
FT                   /product="hypothetical protein Dalk_0270"
FT                   /note="IMG reference gene:2503005966"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01979"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U7"
FT                   /protein_id="ACL01979.1"
FT                   /translation="MAQPDLPTLEMATFGARELTTVINKGMNKFGQTYTSLGIQMLGRG
FT                   NEPYWPANLLNAFIFAASSLNFVRGLNFRSVIRIRQGGRGVCRKHPVISRGSFFKRASI
FT                   CETRALLTPK"
FT   gene            complement(369188..369574)
FT                   /locus_tag="Dalk_0271"
FT   CDS_pept        complement(369188..369574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0271"
FT                   /product="hypothetical protein Dalk_0271"
FT                   /note="IMG reference gene:2503005967"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01980"
FT                   /db_xref="GOA:B8F8U8"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U8"
FT                   /protein_id="ACL01980.1"
FT                   /translation="MDVSGELISLLVLFIFFTFLRLFSLFFIQLSYPDEKERDTMGKLV
FT                   WNRAILFAVLGLAGHYVFFRFFQPESRQLVLFDAGVALAGAIITLIKDKIDVRGMILVS
FT                   GLAYVHIRMALFALDIYGRIRPFP"
FT   gene            complement(369619..369939)
FT                   /locus_tag="Dalk_0272"
FT   CDS_pept        complement(369619..369939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0272"
FT                   /product="hypothetical protein Dalk_0272"
FT                   /note="IMG reference gene:2503005968"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01981"
FT                   /db_xref="GOA:B8F8U9"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8U9"
FT                   /protein_id="ACL01981.1"
FT                   /translation="MVISGVTVLISNPHHPEYPSHFGLVQSFNENKWFFGPFIILTGVL
FT                   LIWSSLRKKAKHYLGEVFMCPVCLNPIMGIDAANLKCPTCGRDLEPLKGFYDRHPELKE
FT                   DD"
FT   gene            370631..372157
FT                   /locus_tag="Dalk_0273"
FT   CDS_pept        370631..372157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0273"
FT                   /product="YD repeat protein"
FT                   /note="TIGRFAM: YD repeat protein; KEGG: dol:Dole_1703 YD
FT                   repeat-/rhs repeat-containing protein; IMG reference
FT                   gene:2503005969; TIGRFAM: RHS repeat-associated core
FT                   domain; YD repeat (two copies); InterPro:Rhs
FT                   repeat-associated core; InterPro:YD repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01982"
FT                   /db_xref="InterPro:IPR022385"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V0"
FT                   /protein_id="ACL01982.1"
FT                   /translation="MAWTYDSIGNILSKSQDGSSMTYAYNSVTHKLDTVTAGGTAYNYS
FT                   YDANGNITACPKLEGASSISATLAIAYNVDNMPTQVVKSESGQPDVTTNFYYDGNGARV
FT                   RKEVVGEGTTFYASQYYEVKNGVATKYIFGADRRIAKITDGEGIQYFSKDHLGSSTVVT
FT                   DDSGAVVEQADYRPFGEDRFYTGTVATPTPYKYTDQELDESTGLYNYDARHYDPAIGRF
FT                   ISPDSLIPNLYDPQQLNPYAYCRNNPLIYVDPSGHYTVGDIDASHDACLGFFGGSVDDI
FT                   GRLSSLWSNNRTEEAYTSTNTNLSKPLVLVSTLEQTRPMWQAASAFGVADLIGIAARSV
FT                   LPQAVGLAVQPHLEEYAEKNKHGGLQGWVFGPLESYLFGDKAKEAQNQTTETIAQEATQ
FT                   EKTDDIGVYHRIKSDTQTFVDAMMIQKTGELWGGIPHNGKNTDIPCVKAYTGPLLEGQI
FT                   GIEFTTSVKPDSYHPNTAYWSAGNPGVQVRGGYAVINVTVTKNTHSILDY"
FT   gene            373088..373411
FT                   /locus_tag="Dalk_0274"
FT   CDS_pept        373088..373411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0274"
FT                   /product="hypothetical protein Dalk_0274"
FT                   /note="IMG reference gene:2503005970"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01983"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V1"
FT                   /protein_id="ACL01983.1"
FT                   /translation="MGEPKHTIQSAPQPEPGISTPAPGFVFEAEQAGITGIKKLFSIKR
FT                   AKRPAAQFIRAYSQVLSGIPDFKSRSRIHLYMIQAMANSLDPQAREVFLDLARRLASDF
FT                   QLL"
FT   gene            373444..374556
FT                   /locus_tag="Dalk_0275"
FT   CDS_pept        373444..374556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0275"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: ppd:Ppro_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain; IMG reference
FT                   gene:2503005971; PFAM: DNA polymerase III beta subunit,
FT                   C-terminal domain; DNA polymerase III beta subunit,
FT                   N-terminal domain; DNA polymerase III beta subunit, central
FT                   domain; TIGRFAM: DNA polymerase III, beta subunit;
FT                   InterPro:DNA polymerase III, beta chain; InterPro:DNA
FT                   polymerase III, beta chain, C-terminal; InterPro:DNA
FT                   polymerase III, beta chain, central; InterPro:DNA
FT                   polymerase III, beta chain, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01984"
FT                   /db_xref="GOA:B8F8V2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V2"
FT                   /protein_id="ACL01984.1"
FT                   /translation="MQLTIPKQALLRAVLAAEHVAAKDKNFPALGGIRMEAGHQSLTIQ
FT                   ATDLDTGYASVLTLEDIQEPGAALPPAQQLKAVIMDWPEEDARLSVENGFPTITGERTR
FT                   TSLAGMDPEDFPEIPEPDQADWFKVPGVTLETLLRQTLLSRRVPESESRPHMVGAHLAR
FT                   DGEHLVITTTDGCQLARGSFPIQDARLPEKGIILHKTGAAKLMEFAKNAPGDVALGVTS
FT                   SHLSAESQNERLISRLVQGDYPDTARIIPVLDTGFAINRFEFLAALKRVGILTSEKYQA
FT                   ASLALEHSRITVTVDNPELGSSSETLDHLESPFDGNPFTGCWNPHRLARALAVMTSENV
FT                   EVKARDAASPLVLSGEKDPGYLALVMPMKR"
FT   gene            374571..374957
FT                   /locus_tag="Dalk_0276"
FT   CDS_pept        374571..374957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0276"
FT                   /product="hypothetical protein Dalk_0276"
FT                   /note="IMG reference gene:2503005972"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01985"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V3"
FT                   /protein_id="ACL01985.1"
FT                   /translation="MKRFGILAMAIAACVLWGGPHARAADEWTNRQIMLEAAALTAIGV
FT                   DWLQTRDIAEHPGKYSEKGCFGILGERPDKSNVDLYFATWAAIHLTVAHCLPSDYRELW
FT                   QIGTTFAVVIATADNAAIGVRFEW"
FT   sig_peptide     374571..374642
FT                   /locus_tag="Dalk_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005972_SP"
FT   gene            374990..376699
FT                   /locus_tag="Dalk_0277"
FT   CDS_pept        374990..376699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0277"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: pol:Bpro_5053 ParB family
FT                   protein; IMG reference gene:2503005973; PFAM: ParB-like
FT                   nuclease domain; TIGRFAM: ParB-like partition proteins;
FT                   InterPro:ParB-like nuclease; InterPro:ParB-like partition
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01986"
FT                   /db_xref="GOA:B8F8V4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V4"
FT                   /protein_id="ACL01986.1"
FT                   /translation="MEEKQTFREIPLDQITPSPENPRKTFDGKGMDELVESIRSVGVLE
FT                   PILVRPREAQPVKKARGKKILTASTESQAFEIVAGERRFRACCILANQNGGLSKNTIPA
FT                   MVRPMTDDQAWDAMVIENLARQDLDELEEARGFKAYLDRKGPESLEDLAGRTGISPGYI
FT                   RRRVRVLDLPEKVLEAWDGDALRFGHLEQLLRLPDQEAVLEFFNHFAWETVSVKELKSV
FT                   IDSEAVPLKNALFDVTEAGCGQCMFNSDAQMMLFDTESEKTLCHKTACFGEHQKAWLQE
FT                   NWAEFKKKEKLNTQGAVIYESLKWDDYSAFYGNTPIPKECRKCKSFASIVRLQGDVYYK
FT                   AACIGEKSCYRSMTSGAKDPAGAGAPRNRNHGPEFRERFFQEQIPLRVQDVDPETDKAL
FT                   HLALFALLKSNHDARIWYGRTHGVGKVESPGEPWARLVISDRDLFQSITELSGEEARLR
FT                   IRNVSAVVALQDDAMAAREHVASYLGVDVAREWRIHKEYLEKKTKAEILAMGEDLGILQ
FT                   EKQVQDFLFEKIGKKRGRFDTCKKGELIQVFLESGVDLAGRIPAEMLGDANA"
FT   gene            376738..376935
FT                   /locus_tag="Dalk_0278"
FT   CDS_pept        376738..376935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0278"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pde:Pden_0962 hypothetical protein; IMG
FT                   reference gene:2503005974; TIGRFAM: DNA binding domain,
FT                   excisionase family"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01987"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V5"
FT                   /protein_id="ACL01987.1"
FT                   /translation="MNQEEKRMFNTKEAAHYLGLSVKTLYANTSRRGGNKSGIPFKRFG
FT                   SKILYDKKSLDEYLDNLPEG"
FT   gene            376939..378114
FT                   /locus_tag="Dalk_0279"
FT   CDS_pept        376939..378114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0279"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   tye:THEYE_A0315 site specific recombinase; IMG reference
FT                   gene:2503005975; PFAM: Phage integrase family; InterPro:DNA
FT                   breaking-rejoining enzyme, catalytic core;
FT                   InterPro:Integrase, catalytic core, phage;
FT                   InterPro:Integrase-like, catalytic core, phage"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01988"
FT                   /db_xref="GOA:B8F8V6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V6"
FT                   /protein_id="ACL01988.1"
FT                   /translation="MAIFMECPNCRKKQSLLNQKCTTCLTNLASARKSNRVRYWIHYRL
FT                   PNKKNRWELSGYSYDRARAAEGKRLAQKSEGTILDPRDAKTTFDQVTEWYLDLESVQAL
FT                   RSLQRVEDCLKRFNQVFGLTPVNSILNVNLEQYQGDRLKAGASPATVDMELRIAHTMIN
FT                   KAFDNDIITEASKVLKAFRRTKKLLKSGQNARDRLLSMEEYIKLHEAAGSHLKEIIAIA
FT                   FFTGMRRGEILGLKWPHIDFNMKMIRLSAEETKEAKPKSIPLSEKAMEILEQKKRPKKE
FT                   KHVFLYRGKPITTRVRTALWNACDKAGISYGRKQENGFVFHDLRSTVKTNMLRAGVDKV
FT                   MRDIILGHALKGMDRYYLKPNDKDLHDAMKIYTDWLDLELEKARMKLEKKG"
FT   gene            complement(378299..378374)
FT                   /locus_tag="Dalk_R0002"
FT   tRNA            complement(378299..378374)
FT                   /locus_tag="Dalk_R0002"
FT                   /product="tRNA-Arg"
FT                   /note="IMG reference gene:2503005976"
FT   gene            378903..379616
FT                   /locus_tag="Dalk_0280"
FT   CDS_pept        378903..379616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0280"
FT                   /product="CBS domain containing membrane protein"
FT                   /note="PFAM: CBS domain containing protein; amino
FT                   acid-binding ACT domain protein; KEGG: sfu:Sfum_0309 CBS
FT                   domain containing membrane protein; IMG reference
FT                   gene:2503005977; PFAM: CBS domain; InterPro:Aldolase-type
FT                   TIM barrel; InterPro:Cystathionine beta-synthase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01989"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V7"
FT                   /protein_id="ACL01989.1"
FT                   /translation="MLIKDWMKQDGVSVNTDSTVKEARRLMEVCHTRTLPVLKKGKLVG
FT                   VVTDRDLKRAAPSDATSLSRHEIAYLQEKIAVKDVMTKDPITLSPTDTVEQAAMLFLEK
FT                   KISGAPVMDDKGRLMGTITQDELFKVLITLTGAWHRGIQFGFLLDDRPGSIKEVADIIR
FT                   DYDGRILSILSSMEKAPWKSRFVYIRIRPMDKNLLQPLLDELRKVATILYVLDQTEGSR
FT                   LTLGADVDAEPAEVV"
FT   gene            380159..380998
FT                   /locus_tag="Dalk_0281"
FT   CDS_pept        380159..380998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0281"
FT                   /product="hypothetical protein Dalk_0281"
FT                   /note="KEGG: emi:Emin_0901 hypothetical protein; IMG
FT                   reference gene:2503005978; PFAM: Protein of unknown
FT                   function (DUF3108); InterPro:Protein of unknown function
FT                   DUF3108"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01990"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V8"
FT                   /protein_id="ACL01990.1"
FT                   /translation="MNNFACKLGKHTALTLFAVFFLLAGQAGGGVDPTMEIPQRIPFSP
FT                   GEKLTFELKWLFLPAGTATIEILPIELMDGEPAWHFVLKARTNRFTDAFYKVRDRIDTY
FT                   VDLNMTRTLYYKKIQREGDTKRDVEVIFDWENLKASYVQDGNKEKETEINPESFDPLSV
FT                   VYKFRSGDIALERQMQAWVTDGKKCVEGRAFITKEQSLAVPAGRYDTFVMEPELKHAGG
FT                   VFQESKDPSLRIWFSQGPERQIIKIRGKVAVGSFSANLIKVEKLPPHLLDQDIPEED"
FT   sig_peptide     380159..380245
FT                   /locus_tag="Dalk_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005978_SP"
FT   gene            381005..382612
FT                   /locus_tag="Dalk_0282"
FT   CDS_pept        381005..382612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0282"
FT                   /product="hypothetical protein Dalk_0282"
FT                   /note="KEGG: lpn:lpg2155 hypothetical protein; IMG
FT                   reference gene:2503005979"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01991"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8V9"
FT                   /protein_id="ACL01991.1"
FT                   /translation="MIGASEITERDFALQELANHRQSLESVYVNLGRLQYLIQEYTPCI
FT                   HLETMEVLDDLLLREEHTNRRTSYFTYRKAADVLALAVEKSPDPEVSQKALAILRNMVC
FT                   IKHGSVHRAVAESLGSLPLNIRGPAMETPSEKAALPKASWMSILKQAGFSPEGLPQAQG
FT                   RSLVLRSAEDQVLVVKMARDGDSVQTLHAEAAWMERLEQEAQGFPVDFHVPRPISMGQN
FT                   RVFRLEEIPEHEGGLENLHPQRLAMAYVAHGDYFTYPNDPSGPGLPAGGEFVEILGKNA
FT                   WLLGRLGASGMVHTAPIPLFHNRVQAGRRTDRGLYEWPRQGRLDQWLFSCQYPNLCSTG
FT                   LRDFEHILAFNGPMSELYLHLGTHVLSLVLVAGSYFRNKDPERVGLDPQGEPVDARDLF
FT                   DRPLLITAISEIFYQYYSGFVGREFTDPLPRDVESLADAMIREMGVDRYMEEILRVHDQ
FT                   EAMTQEQFLDFLTGRGLSPEKARSCVRGKEEIVLYTGPHLGGFNDVISVPELICFVATV
FT                   TSLCVSGRYVEQNPQQAA"
FT   gene            382661..383269
FT                   /locus_tag="Dalk_0283"
FT   CDS_pept        382661..383269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1990 hypothetical protein; IMG
FT                   reference gene:2503005980"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01992"
FT                   /db_xref="InterPro:IPR024264"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W0"
FT                   /protein_id="ACL01992.1"
FT                   /translation="MSAENSVYEQTYQKYLSDLAGIDIPQACQTLGLEYEDGKAVINFV
FT                   GRTYTVSPQGVENAKGLQPELGICVGLIRYLLMCPPFPPKDGGWTTFRDIKGAGPLTVY
FT                   WANDVEQALSDVFAGRPQDLTTASEKLHAAPPDQDYSYDVQFQVQALSRMPMLVLFNDG
FT                   DDDFPPKSTVLFRESAGTYLDPECLAILGVAVVQSLIRA"
FT   gene            383714..384736
FT                   /locus_tag="Dalk_0284"
FT   CDS_pept        383714..384736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0284"
FT                   /product="Transposase"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: spl:Spea_4213 transposase IS116/IS110/IS902 family
FT                   protein; IMG reference gene:2503005981; PFAM: Transposase
FT                   IS116/IS110/IS902 family; Transposase;
FT                   InterPro:Transposase, IS111A/IS1328/IS1533, N-terminal;
FT                   InterPro:Transposase, IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01993"
FT                   /db_xref="GOA:B8F8W1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W1"
FT                   /protein_id="ACL01993.1"
FT                   /translation="MNNSIAGLDLAKNVFHVVFFDRHFKEVRKRMLRRNQVLAFFANTP
FT                   PVLIGMEACSGSSYWGRELIKLGHEVKIIAPQHVKPYVRGNKNDYNDARGIAAAAKIPG
FT                   MPTVPVKTIEDQDIQAAHRMRTQCIRDRTALCNSMRGLLAEYGIVLARGVSKVRKGIPE
FT                   LLEDPDNALTPFFKEMLARRYEQLVEIDGHIDFYTQKIKQRAKEDDACKRLQTIPGFGP
FT                   INASAFKSAVGDGSAFSKGRDVSASLGVVPRQHSSGGKDNLLGISKRGDRYLRSLLVHG
FT                   ARSTVRAAANKDDQLSQWINRLRERRGIHKASVALANKMARIGWAGMPPAGALNKDYSF
FT                   "
FT   gene            complement(385199..385981)
FT                   /locus_tag="Dalk_0285"
FT   CDS_pept        complement(385199..385981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0285"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   dol:Dole_0437 hypothetical protein; IMG reference
FT                   gene:2503005982; PFAM: Uncharacterised protein family
FT                   (UPF0153); InterPro:Uncharacterised protein family UPF0153"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01994"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W2"
FT                   /protein_id="ACL01994.1"
FT                   /translation="MKRVEDQDLDKIPGRRLEDGDVFCFECRPDISCFNLCCRNLNLFL
FT                   YPYDIVRLKKKLRMTASEVIEKHTDVVLRPGNFFPEVLLTMADNEEKTCPFLSEKGCTV
FT                   YSDRMYACRTFPTEHGVSLDEASGVLTPVHFYKPPDFCQGRHESKEWTVSSWSQDQGAV
FT                   YYHKMMTEWTKVKILFQNDPWGADGPEGKMARMAFMAAYNMDDFKDFVFKSTFLKRYKV
FT                   PKAFLKKAKKDEVELLRLGFAWIKLFCFGYPSPELGLI"
FT   gene            complement(385989..386591)
FT                   /locus_tag="Dalk_0286"
FT   CDS_pept        complement(385989..386591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_0438 hypothetical protein; IMG
FT                   reference gene:2503005983"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01995"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W3"
FT                   /protein_id="ACL01995.1"
FT                   /translation="MTNVRTLVQDPMIQDFLSRLEEVYSKMDHAYDEVAQAHGFHCQGC
FT                   QDSCCLTLFFHHTFLEYLAIQDGCMKLGEDQYKAAVQRAREVIDQANHMAGGAYRIMCP
FT                   VNQDGKCMIYENRPMICRLHGIHYRFAMPNGAIHQGIGCRAFEDLAKTSGAEAVLDRTP
FT                   FYQQLAGLERELRQKTGFNQSIKMTVAEMLVKQSSET"
FT   gene            complement(386608..387663)
FT                   /locus_tag="Dalk_0287"
FT   CDS_pept        complement(386608..387663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0287"
FT                   /product="deoxyguanosinetriphosphate triphosphohydrolase"
FT                   /note="dGTPase family type 2 subfamily; presumably
FT                   hydrolyzes dGTP to deoxyguanosine and triphosphate; IMG
FT                   reference gene:2503005984; PFAM: HD domain; TIGRFAM:
FT                   deoxyguanosinetriphosphate triphosphohydrolase, putative;
FT                   InterPro:Deoxyguanosinetriphosphate triphosphohydrolase;
FT                   InterPro:Metal-dependent phosphohydrolase, HD domain;
FT                   InterPro:Metal-dependent phosphohydrolase, HD subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01996"
FT                   /db_xref="GOA:B8F8W4"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006261"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR023023"
FT                   /db_xref="InterPro:IPR026875"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8F8W4"
FT                   /protein_id="ACL01996.1"
FT                   /translation="MTIREKFEQRELDFLSPFACPSAKSKGRKRPEAPCPIRTAFQRDR
FT                   DRIVYSNAFRRLKHKTQVFLSPLGDHYRTRLTHTLEVAEIARTIARAMRLNEDLTEAVA
FT                   LGHDLGHTPFGHGGETVLKELFHKDFTHSRQSLRVVDCLERRGEGLNLTYEVMDGIAKH
FT                   SKGFGTIMPNDAGEVASTMEGRVVRVADIIAYLSHDLDDAIRSGVVTRDQVPSHCVEVL
FT                   GERHRDLVTTMIRDVVYSSGEEDGQMTIKMSDAMHDVMLELRTFLYNNVYRAPVVHNEF
FT                   VKAKKILSELFDYYMNNVDAFQKAAIEQELFASPEHAAPTKQNVCDLIASMTDRFALTR
FT                   YQKIFFPTPMV"
FT   gene            complement(387815..389095)
FT                   /locus_tag="Dalk_0288"
FT   CDS_pept        complement(387815..389095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0288"
FT                   /product="membrane protein involved in aromatic hydrocarbon
FT                   degradation"
FT                   /note="PFAM: membrane protein involved in aromatic
FT                   hydrocarbon degradation; KEGG: cts:Ctha_0663 membrane
FT                   protein involved in aromatic hydrocarbon degradation; IMG
FT                   reference gene:2503005985; PFAM: Outer membrane protein
FT                   transport protein (OMPP1/FadL/TodX); InterPro:Membrane
FT                   protein, aromatic hydrocarbon degradation; InterPro:Porin,
FT                   Gram-negative type"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01997"
FT                   /db_xref="InterPro:IPR005017"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W5"
FT                   /protein_id="ACL01997.1"
FT                   /translation="MKKFRLVVCCVLAAALLAPGLAYSAAFSIFDQGAKAVAMGNAFVA
FT                   QADDPTAVYYNPAGLTQLEGTQIAAGVAAIWPKAEFQASKKDAALGTYYGQVTKTNDDE
FT                   FFIPNFYLTNKYNEKVAVGLGVYSNFGLSTDWPDNWPGQYCSGATYTRIKSYAINPVIA
FT                   YQPWKFVSISAGFIANYMDAQMENNILMPGGVFGPDGHMKVEGDDWASGWNAGIMFYIQ
FT                   DEFRLGASYRSQLCHDLVGDITVTGNNLINMQSGGTLDINLPSVLQVGASWSKAPFTVE
FT                   FDYQWTKWSNYNMLQLNVDSTGAVTEIDKNWDDAHAFRLGFAYNVVKNLDLRAGLAYEP
FT                   EFVPNETLDLIVPNGDRWTWSCGFGGQYGKWVADFAYAYLYEDERSFDNEAGDVYNAAT
FT                   GVKVGRLVGEVQEVSAHILCLTVTRKF"
FT   sig_peptide     complement(389024..389095)
FT                   /locus_tag="Dalk_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005985_SP"
FT   gene            389367..390347
FT                   /locus_tag="Dalk_0289"
FT   CDS_pept        389367..390347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0289"
FT                   /product="hypothetical protein Dalk_0289"
FT                   /note="KEGG: CCDC11; coiled-coil domain containing 11; IMG
FT                   reference gene:2503005986"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01998"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W6"
FT                   /protein_id="ACL01998.1"
FT                   /translation="MAGKFQMGTILALVFLLMLPAASEAFNRDLSTVMIDDAISFCPDN
FT                   LREYLVARKALVLKGMKHGDYASGPIDPMSAERVYNLLIERLKQGKADDPNVIIGFGTL
FT                   AFFLSETVSPGACRTLDALLPEWVLYDGTDPINNVEETILSTLELSKPFHGQCDEESIG
FT                   DAYNVAVNVIVDFWVSAYNKAGLGAGTLLPVGSQVDHSRQAIYTPQELEAMRIAKEARE
FT                   AAQAAYDEEMKEMVRNGVITVEVVQWQKEQKEKKKIDQYIEKYRLQLKQLEEEADELRS
FT                   GGTMDRDEVKRMRALNDEMGEVKSRISEFEDDPNMALEKERNDNW"
FT   sig_peptide     389367..389435
FT                   /locus_tag="Dalk_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005986_SP"
FT   gene            390440..390952
FT                   /locus_tag="Dalk_0290"
FT   CDS_pept        390440..390952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0290"
FT                   /product="hypothetical protein Dalk_0290"
FT                   /note="KEGG: GL11124 gene product from transcript
FT                   GL11124-RA; IMG reference gene:2503005987"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL01999"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W7"
FT                   /protein_id="ACL01999.1"
FT                   /translation="MTGRKILMSALLCLSLALAAGCASSGYSGVIPVAGATLGPDTPAR
FT                   RMTALNAAEQVLLSKGYTPVTVVKDKGFMNFLLEADSDTVYKVNVRLVDVQSGKNDVEM
FT                   DIDMKILRSGPKTSGLSIGGGIGFGTGGGSGFGLGVATGARDYQDDDIKFSLKKEIAAA
FT                   VEKALAQ"
FT   sig_peptide     390440..390523
FT                   /locus_tag="Dalk_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005987_SP"
FT   gene            complement(390969..391622)
FT                   /locus_tag="Dalk_0291"
FT   CDS_pept        complement(390969..391622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0291"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG:
FT                   mrd:Mrad2831_0981 methyltransferase type 11; IMG reference
FT                   gene:2503005988; PFAM: Methyltransferase domain;
FT                   InterPro:Methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02000"
FT                   /db_xref="GOA:B8F8W8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W8"
FT                   /protein_id="ACL02000.1"
FT                   /translation="MHRDIENNEAGIFNRCFGSRAGRIVEIGCGNGRLTCHLEKHAESV
FT                   LGLDPCEADLDQARQCVGTAVQLAVGSGEAIPLENGACGAVVFTLSLHHQDSARALKEA
FT                   ARTLNAKERILVIEPKANTLGANLFAVIDDESHRYVIAEAAIQDSGLKVVDYGDVLIHW
FT                   TFEDYNEMVEYIFGYYGLNPDPERESAMAALTGARKNDIPLIVEDETRFWLLEP"
FT   gene            complement(391703..391879)
FT                   /locus_tag="Dalk_0292"
FT   CDS_pept        complement(391703..391879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0292"
FT                   /product="hypothetical protein Dalk_0292"
FT                   /note="IMG reference gene:2503005989"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02001"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8W9"
FT                   /protein_id="ACL02001.1"
FT                   /translation="MPQVWVLITDKGPFTAIPNECLSQEMKEFVIEKIEGHNALINDNP
FT                   ASVKELLKLIWRS"
FT   gene            complement(391965..393269)
FT                   /locus_tag="Dalk_0293"
FT   CDS_pept        complement(391965..393269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0293"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: ade:Adeh_2260 4Fe-4S ferredoxin, iron-sulfur
FT                   binding protein; IMG reference gene:2503005990; PFAM:
FT                   4Fe-4S binding domain; InterPro:4Fe-4S binding domain;
FT                   InterPro:4Fe-4S ferredoxin, iron-sulphur binding, conserved
FT                   site; InterPro:4Fe-4S ferredoxin, iron-sulpur binding
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02002"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X0"
FT                   /protein_id="ACL02002.1"
FT                   /translation="MGHLVGKDIYKKLVQKIDAQAVRVPLNERIYNIVKALYSAEEAEI
FT                   YVKMPYGLSTVDRIQKITGMNPARLKNLLEGLSDKGLVIDLFIDGEYNYMPSPIAVGIF
FT                   EFTMMRTQGDLDMKTWGKLFHHYFEDGSLYKANFSKGEQIGPLRTVPHEESLADHVEIL
FT                   DYERAVHIVESADKVAVGLCSCRHEKHHAGAKECDVPLDTCLSFGMGAEYLTRHNMAGE
FT                   VSKSALKENMARSREYGLVFQADNVQQGIASICQCCGCCCNLLLGMNKYGYENAVVTSN
FT                   FIADIEDEKCTGCGKCAKACPINAIEMVADGDPNTKRKKKPEINLELCIGCGVCGLDCK
FT                   PSACQLIPRKKRVITPETTFERVILQSLERGTLQNQIFDNPENIGNKAMNAILGAFLRL
FT                   PPVKSALMSDALRSQFLGAMRAGVRLQGKDFLTEM"
FT   gene            complement(393542..394462)
FT                   /locus_tag="Dalk_0294"
FT   CDS_pept        complement(393542..394462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0294"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: gme:Gmet_1901 twin-arginine translocation
FT                   pathway signal; IMG reference gene:2503005991; PFAM:
FT                   NMT1/THI5 like; InterPro:NMT1/THI5-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02003"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X1"
FT                   /protein_id="ACL02003.1"
FT                   /translation="MADKTVIRVGHLPITDHLILGLTKYKLEKGGETFNNASLETVSIG
FT                   GWNQVADALAAGEINAAFILAPTAMDLFKSGVKIKLVMFTHRTGSVLITNKRANIQTLE
FT                   DFAGKVIIIPYQLSVHHMLLHKLMSEKGMIPGKDVMLEVMAPGQMPMAIQYDEEGEVGG
FT                   FIVAEPFGSQAILEGYGEEFALSKDIWPNHPCCVLVMNEELTEGHPDAVLELIKSLELS
FT                   GRYAAQKPQGAAAVGAWFFNQKKEIMERVLAGEIQRIKTDELMPVIDDLAVIQEYMSGQ
FT                   MGVLSDKIDLEKFVDARFAQEVGCK"
FT   gene            complement(394534..394995)
FT                   /locus_tag="Dalk_0295"
FT   CDS_pept        complement(394534..394995)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0295"
FT                   /product="Inhibitor CheX (inhibitor of MCP methylation
FT                   protein CheC)"
FT                   /note="PFAM: CheC domain protein; KEGG: sat:SYN_00961
FT                   putative inhibitor of MCP methylation; IMG reference
FT                   gene:2503005992; PFAM: CheC-like family; InterPro:CheC-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02004"
FT                   /db_xref="InterPro:IPR028051"
FT                   /db_xref="InterPro:IPR028976"
FT                   /db_xref="InterPro:IPR038756"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X2"
FT                   /protein_id="ACL02004.1"
FT                   /translation="MDVKVINPFITATLNVLDTMAMTKAKAENLYIKQDEVATGDVTAV
FT                   IGLSGDTRGTVSVSFSEECALAIVSKMLGEQISSLNEDIKDAVGEIGNMISGQARVKLE
FT                   ELGRVLYAAVPTVVTGKNHSINHITTYPIVAIPFVTDDGSFTIEVCFEE"
FT   gene            complement(395046..396962)
FT                   /locus_tag="Dalk_0296"
FT   CDS_pept        complement(395046..396962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0296"
FT                   /product="Putative response regulator receiver modulated
FT                   CheW protein"
FT                   /note="PFAM: response regulator receiver; CheW domain
FT                   protein; KEGG: sat:SYN_00975 chemotaxis protein; IMG
FT                   reference gene:2503005993; PFAM: CheW-like domain; Response
FT                   regulator receiver domain; InterPro:CheW-like protein;
FT                   InterPro:CheY-like superfamily; InterPro:Signal
FT                   transduction response regulator, receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02005"
FT                   /db_xref="GOA:B8F8X3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X3"
FT                   /protein_id="ACL02005.1"
FT                   /translation="MSEDHRKMRVLLAEDSPLTRQIEVSALKTLGYEHILEAEDGDAAV
FT                   ALLEQGEEVDLIISDWNMPNRGGLELLQWVRKNDRCAGLPFIMATGQGDKAQEQAARDA
FT                   GATGFIPKPFQARELEEKILEAVGARKKPEKTGKRVPEYTASGKLKLKIAHIQITDHLV
FT                   LGVARHLIESGVFQPKRFELETQCMGGWNPVRQALEEGTVDGACVLAPIAMDLFAFDVP
FT                   IRLTLFAHRNGSVMVRSKHGSYKEPWKDFFKGRSFLIPHKMSIHHMLTHQFFSGMGLSA
FT                   GMITAGRHYDVNLEVVAPVDMPGYLKGNDGTCGFMVAEPLATKTIASGLTDLQFLSSEM
FT                   WNNHPCCVLAMRRELVDAHEEALLEFHELLVAAGRFIKNRPENSARIAVDFLDPEKTVG
FT                   LKVPVLKNVLTDPMGIRTDDLYPSKEELDVIQHYMVHDMGIGKLIDLDELVDCRFAEAA
FT                   CGDRQSKALTSPEFSRALAEPRGAKEHDSSRTMLAREGKYLTFALQGQEFGLDILKIRE
FT                   IIGMRPIRAIPQAPSYIKGVINLRDQVIPIMDLRLRFGMEAQDYTERTCIVVLEMESPE
FT                   KTVFMGVIVDSVSEVKDVLASQIEDTSSFGATIQPDYILGMAKLDNGVKLLLDMEHVLD
FT                   VII"
FT   gene            397382..399982
FT                   /locus_tag="Dalk_0297"
FT   CDS_pept        397382..399982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0297"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: sfu:Sfum_3740 putative PAS/PAC sensor protein;
FT                   TIGRFAM: PAS sensor protein; PFAM: response regulator
FT                   receiver; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; PAS fold-3 domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; PAC
FT                   repeat-containing protein; IMG reference gene:2503005994;
FT                   PFAM: Response regulator receiver domain; Histidine
FT                   kinase-, DNA gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; PAS fold; TIGRFAM: PAS domain
FT                   S-box; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:CheY-like superfamily; InterPro:PAC motif;
FT                   InterPro:PAS; InterPro:PAS fold-3; InterPro:PAS fold-4;
FT                   InterPro:PAS-associated, C-terminal; InterPro:Signal
FT                   transduction histidine kinase, core; InterPro:Signal
FT                   transduction histidine kinase, homodimeric; InterPro:Signal
FT                   transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02006"
FT                   /db_xref="GOA:B8F8X4"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X4"
FT                   /protein_id="ACL02006.1"
FT                   /translation="MKDQNRFLILVLIMASVCLLATGVSIWILYHTSIEVERNRLVETA
FT                   QSQARLIEAVGRFDAQYSRNYPKGSLEATLSQIRDAHGSYKGFGETGEFTLARKQDGVI
FT                   HFLLSHRHFDMTNPKPVSMKSELAVPMQLALSGKSGSVIARDYRGETVLAAHEPVSFLN
FT                   MGIVAKIDMAEIRAPYIRAMAIILGAMLGLVVVGAAFFRKISYPIARRLEEQNKSLNRE
FT                   IGERIRTEDALRANEAFLKTLLDAIPAPIFYKGRDGLYLGCNRSLEQFFGFSRDYVVGK
FT                   SVHEIFPEGIAETYEAKDMELFESGGVQQYQQQLKNARGELRDVSIHKAAFLDKQGYMA
FT                   GVIGVLNDITELKQAQEAIKNREQLLNEMGSIAKIGGWEHDLTTGKATWTKEVYKIIEL
FT                   DEKQTPPGPDEHLEYYLPGDREKLEKAYNEAIENGLPFDLELQCVNASGKRFWARAMGT
FT                   PVFQDGKCVKLKGTFQDISERKTVEERLRQAQKMESIGHLAGGIAHDFNNLLFPIVGMA
FT                   EILMEDLPEGSPEFENAQVIFESGKRGGELVKQILAFSRQTEHKMSPVRIQQVLKEVLN
FT                   LTRATIPSFIEMEAQIQWDCGMILADATQIHQVAMNIITNAFHAVEQNGGKITVNLKEI
FT                   LIDEEDGEYSAIDSGRYALMSISDNGPGMPSDLINRIFEPYFTTKEQGKGTGLGLAVAY
FT                   GLIKAHKGDIRVYSEPGKGTAFNVYLPLMEKMEMVDQQAPKEVHPTGDERILLIDDEAP
FT                   IVKLETQMLQRLGYQVTARTSSLEALEAFQTMPYGFDLIISDMTMPNMTGDQLAEEVIA
FT                   VRPDIPIIICTGFSERLNEAGAGAKGIKAFLMKPVVRSELAQIVRRVLDAAKPG"
FT   sig_peptide     397382..397444
FT                   /locus_tag="Dalk_0297"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503005994_SP"
FT   gene            400305..402227
FT                   /locus_tag="Dalk_0298"
FT   CDS_pept        400305..402227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0298"
FT                   /product="Predicted NADH:flavin oxidoreductase/NADH
FT                   oxidase"
FT                   /note="PFAM: NADH:flavin oxidoreductase/NADH oxidase;
FT                   FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: tte:TTE2131 NADH:flavin
FT                   oxidoreductase; IMG reference gene:2503005995; PFAM:
FT                   Pyridine nucleotide-disulphide oxidoreductase; NADH:flavin
FT                   oxidoreductase / NADH oxidase family;
FT                   InterPro:Aldolase-type TIM barrel; InterPro:FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase;
FT                   InterPro:flavin oxidoreductase/NADH oxidase, N-terminal;
FT                   InterPro:NAD(P)-binding domain; InterPro:NADH;
FT                   InterPro:Pyridine nucleotide-disulphide oxidoreductase,
FT                   class-II; InterPro:Pyridine nucleotide-disulphide
FT                   oxidoreductase, NAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02007"
FT                   /db_xref="GOA:B8F8X5"
FT                   /db_xref="InterPro:IPR000103"
FT                   /db_xref="InterPro:IPR001155"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X5"
FT                   /protein_id="ACL02007.1"
FT                   /translation="MLDHLMSPIKIRNLELKNRCVIPPMGTNLGNPNGTVTEKNLAYIK
FT                   RRAETGVGLVITEIVGVHSSGCVGLGIFDDKYIPGLTQMVDAIHSAGSKAALQLHHAGR
FT                   EAPFQLQKGKALGPSAIPSFVYGQPPKEMTKDDIKMIISAFGDAAVRAQAAGADAVEIH
FT                   GAHGYLLTQFMSVHANQRTDEYGGDFKNRARFVIEVVEEVRKRVGDDYPVLLRISAEEY
FT                   IKHGYTVDEVLTILPELIGAGVDVLHASVGTHGSPGGITSAPVEYEAGWNIWRAKKIKE
FT                   AVDIPVIGVGRYTDPREADKAIANGDADMIAFGRQVLADPDFLIKAQEGRYEDIRTCLA
FT                   CNQGCIERLILEMGSSVRCAINPETGQETLVPKGPAENPKNVWVVGAGPAGLTAAYEAA
FT                   KLGHKVSLFEQSNHLGGQIQFARQAPHKEVYGQWIDWLAAQVKKAGVDIQTGVTVTEDM
FT                   IKEGKPQAVILAIGGKKIMPDFQGQDQPSVCDAWQVLNQEVPAGKNAIIVGAGLIGMET
FT                   ADFLVQKGCKVTLLEMLKQSPVLKITGHGYQLHKRMREANVMFLFGAVLAAVDGDKVTL
FT                   RFDDKEDVLEGVDQVVLAAGMKPREDLKEALMNLGIQHTVVGDAVQVRRIIEATDEGAK
FT                   AAWAL"
FT   gene            complement(402294..403646)
FT                   /locus_tag="Dalk_0299"
FT   CDS_pept        complement(402294..403646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0299"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; pyridine nucleotide-disulphide
FT                   oxidoreductase dimerisation region; KEGG: dth:DICTH_1917
FT                   NADH oxidase; IMG reference gene:2503005996; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase; Pyridine
FT                   nucleotide-disulphide oxidoreductase, dimerisation domain;
FT                   InterPro:FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; InterPro:FAD/NAD-linked reductase,
FT                   dimerisation; InterPro:Pyridine nucleotide-disulphide
FT                   oxidoreductase, dimerisation; InterPro:Pyridine
FT                   nucleotide-disulphide oxidoreductase, NAD-binding region"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02008"
FT                   /db_xref="GOA:B8F8X6"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X6"
FT                   /protein_id="ACL02008.1"
FT                   /translation="MDCNIVIVGGGPAGVITALTAKSVYPEKSVCIIKEIADGVIPCSI
FT                   PYMIYTLADPAQSILGNKPLEDAGVKIIVDKAESLDTAASVLTLASSRTIDYERLVIAT
FT                   GSSPVVPPIPGVELPGVFSITKSLSAISLLREKARAAKRVVILGGGFIGAEFADELTRN
FT                   PDAEVHIVEILPRLLSQDFDDEFCDAATAELAGTGVQVHTGRRAISIGGEDKVKRVELD
FT                   DGTSLQADIVIIGVGGRPNAELAAKAGLTVTEKGSIWVDSYMRTTVKSVFAVGDCALKR
FT                   DFFTRKEAPVWLASTATSEARIAGTNLYGIRVLRQIQGTVSAFSTKIGGLCLASAGMTR
FT                   RMCEEEGFRIVTGEAMAPDRHPGFLPGPSPMKVKLIFANRSGALLGGQVSGGPSVGELI
FT                   NVISIGIQMQLNVRQLDMMQIATHPLLTSAPTVHPLINAAHNALAKLRLQK"
FT   gene            complement(404344..406758)
FT                   /locus_tag="Dalk_0300"
FT   CDS_pept        complement(404344..406758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0300"
FT                   /product="Protein with response regulator receiver domain"
FT                   /note="PFAM: type II secretion system protein E; response
FT                   regulator receiver; General secretory system II protein E
FT                   domain protein; KEGG: gme:Gmet_3473 response regulator
FT                   receiver domain-containing protein; IMG reference
FT                   gene:2503005997; PFAM: Response regulator receiver domain;
FT                   Type II/IV secretion system protein; GSPII_E N-terminal
FT                   domain; InterPro:CheY-like superfamily; InterPro:General
FT                   secretory system II, protein E, N-terminal; InterPro:Signal
FT                   transduction response regulator, receiver domain;
FT                   InterPro:Type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02009"
FT                   /db_xref="GOA:B8F8X7"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007831"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X7"
FT                   /protein_id="ACL02009.1"
FT                   /translation="MPKLASLFMGGKAQEAKEVTSLKKESSRYAILFVDDEPHVLKAMR
FT                   RIFRKENYRLLTAESAEEALETLRAARVHVIVSDHRMPGMQGADLLRKVKELYPQTIRI
FT                   MLTGHADVNAIMGAINEGAVYKFITKPWNDDDLRITVGLALEQYDLIKENVYLKNRQKE
FT                   QTKKIKTLTKCFSANRSQIGRMLVKRNLLTKEDLEKAQQVQARSDKILPAILMEMELAD
FT                   EKTIMDVMEEELKINRVNPAEFTASAPLASLIPSEICEKHLLVPLKRMDGQLVTAMADP
FT                   TDLVKIDELRFLTGMPIKPALATHEDIRKKVQELYGGESALNSVISEIELMDPTETIEI
FT                   ILEEDDVVDVDELLKSKDQPPAIRIVNSIISDALRHGASDVHIEPKTKYLMVRYRIDDL
FT                   LQEKIRIPMAMHPPIVSRIKVMSELDITERRKPQDGRVTVKASTKTVDMRISSLPTVNG
FT                   EKIVLRILDKNAASQELEDLGLTSMDMEKILRFIRQPQGMVLATGPTGSGKTSTLYAML
FT                   RRGASITKNFTTIEDPVEYHMGMAEQVNVREKIGLDFPTILRSILRQDPNVIMLGEIRD
FT                   FQTAEVAFHAALTGHLVLSTLHTNGSIASIIRLRDMGIKSYVMSEALTGIIAQRLLRRI
FT                   CPHCMEDSQVDAEVLKALRLDPDRLDFTPKKGRGCPQCNGGGYKGRIGVYEVLEFDSEF
FT                   RRMVHSGASDAELMRAASQANMKTILEDSMDKVRAGISTCEEVLRVLGPQNTLEILCPA
FT                   CNHTMAQRFNYCPYCAAALVLRCRSCHSFLEESWKICPHCGAQSPLVDKEG"
FT   gene            complement(406746..408179)
FT                   /locus_tag="Dalk_0301"
FT   CDS_pept        complement(406746..408179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0301"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: hch:HCH_00674 signal transduction histidine kinase;
FT                   IMG reference gene:2503005998; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; InterPro:ATPase-like, ATP-binding
FT                   domain; InterPro:Signal transduction histidine kinase,
FT                   core; InterPro:Signal transduction histidine kinase,
FT                   subgroup 1, dimerisation/phosphoacceptor domain;
FT                   InterPro:Signal transduction histidine kinase-related
FT                   protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02010"
FT                   /db_xref="GOA:B8F8X8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X8"
FT                   /protein_id="ACL02010.1"
FT                   /translation="MHSQKYILEDDGGLEDFDREYDITQLLPPPLMERGTYHLKGLGLD
FT                   KSFILHPDGKEYYSFHVLKNEDLAVLQEAVKNCPDKGMRLDMSEAPVRLYPLMHEAETV
FT                   GFLGLGPSNPETRPVEILIFSILKEFMTMNQQVLMTMGLHGKVVEDTYKALERRNAMLE
FT                   ESEQKYRRLAETLEKEVERKAEKIRKTQEMLLLQEKMASIGQLAAGVAHEINNPTGFIS
FT                   SNLNSLKEYGADFKLLFGKYRDLVKAIHDSHTGGRIPAQVQEKLDEVRKTEQDIDVDFL
FT                   LDDILTLVDESMDGADRIKKIVQDLKDFAHPEKHAIQYSDLNRIMDSTLNIVRNELKYK
FT                   TRVERQYGNLDEVPCYPQQIGQVFMNLLVNAAQAMESSGEIHIKTYMEEDFAVVEVRDT
FT                   GAGIAKENLSRIFDPFFTTKEVGQGTGLGLNVAYKIVDRHHGSIKADSQLGQGTCFTIK
FT                   IPKENPDMECEAGEEECQN"
FT   gene            complement(408221..408871)
FT                   /locus_tag="Dalk_0302"
FT   CDS_pept        complement(408221..408871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_3475 hypothetical protein; IMG
FT                   reference gene:2503005999; PFAM: ADP-ribosylation factor
FT                   family; InterPro:ARF/SAR superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02011"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8X9"
FT                   /protein_id="ACL02011.1"
FT                   /translation="MAQFDESGKKMVVKIVYYGPALSGKTTNLMRLHDAVNPSRRGDLL
FT                   TLETKGDRTLFFDLLPLAARSKSNFLAKIKLYTVPGQVAHDATRKAVLSRADGVVFVAD
FT                   SQLTQSMSNFESFDNLENNAQRVGLDLDSLPLVIQYNKRDLQDIEPEDEVSARWSPTGL
FT                   PLVFATALKGRGVVETFQQILSATYQSLDRMHGLEENFDMVEDDFLSLIGGGR"
FT   gene            409138..409944
FT                   /locus_tag="Dalk_0303"
FT   CDS_pept        409138..409944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0303"
FT                   /product="hypothetical protein Dalk_0303"
FT                   /note="KEGG: rci:LRC333 Fe-S cluster-binding
FT                   oxidoreductase; IMG reference gene:2503006000"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02012"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y0"
FT                   /protein_id="ACL02012.1"
FT                   /translation="MHPLIDKQTVKLIRQTGATFANAPDRKEILEQHGLPCDQKAENVI
FT                   VTGCQILPAMPRVLQALAWVFDRAGFSYTFLSEEYCCGNNLYRPAIKAKDQEALAECQD
FT                   LSKAFVEQNINKARQLGASRLVIFCSPCYPIYKHAFPDENIVFYPTAIEECLPSLERDM
FT                   DIDYYAGCYRLHKKFAPVPMDLKGVSKCFSKIKGLGVHSISAPQCCYKPEGAAHMMNSV
FT                   QTRTMVHVCTGCYFQALMNAPKDEKEPLNILMLPEFIDNILQEAKS"
FT   gene            409941..414791
FT                   /locus_tag="Dalk_0304"
FT   CDS_pept        409941..414791
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0304"
FT                   /product="alpha-2-macroglobulin domain protein"
FT                   /note="PFAM: alpha-2-macroglobulin domain protein;
FT                   alpha-2-macroglobulin domain protein 2; KEGG: cps:CPS_3969
FT                   putative lipoprotein; IMG reference gene:2503006001; PFAM:
FT                   Alpha-macro-globulin thiol-ester bond-forming region;
FT                   Alpha-2-macroglobulin family; MG2 domain;
FT                   Alpha-2-macroglobulin MG1 domain; Alpha-2-macroglobulin
FT                   family N-terminal region; InterPro:Alpha-2-macroglobulin;
FT                   InterPro:Alpha-2-macroglobulin MG1 domain;
FT                   InterPro:Alpha-2-macroglobulin, N-terminal;
FT                   InterPro:Alpha-2-macroglobulin, N-terminal 2;
FT                   InterPro:Alpha-2-macroglobulin, thiol-ester bond-forming;
FT                   InterPro:Terpenoid cylases/protein prenyltransferase
FT                   alpha-alpha toroid"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02013"
FT                   /db_xref="GOA:B8F8Y1"
FT                   /db_xref="InterPro:IPR001599"
FT                   /db_xref="InterPro:IPR002890"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR011625"
FT                   /db_xref="InterPro:IPR011626"
FT                   /db_xref="InterPro:IPR021868"
FT                   /db_xref="InterPro:IPR026284"
FT                   /db_xref="InterPro:IPR040639"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y1"
FT                   /protein_id="ACL02013.1"
FT                   /translation="MKKAALFLATLVIACLAAGGALADQTLKVVDISERTFQDAPAISV
FT                   IFSAPLDPKVRHDQHLRISDQKEILKGAWILSEDDRTLYYTAVEPETQYTVTVLDTLES
FT                   ADGAKLEKRVSQGVTTRKIVPAVSFAGDGLLLPPSLVQGLPVATVNVPAVDVEFFRLND
FT                   DATARYVDWSRPSKSLSTYWMGEILEESKVVFSGRFDLDPEPNRRVVRKIALDSIKALK
FT                   KPGVYLAVMRKPGQYTYNYDASFFIVTDIALQARLYKDMIYVTASSLKDGSSLPGVKLS
FT                   FLDWKDDKIRELAVGETNEDGMFWSAGDVRKKTEFVKAEFKDQISVLPMRLPALDLSEF
FT                   QYGSRPQKNQEIFAYGPRDLYRPGEKVIVSCLLRDYDGRPVPGAPIHATLIAPDGRKAG
FT                   TYTWAAEALSEDDVYYWQGEMNLSKNAVTGEWRCELRTIKDSKKPDQIYKFHVEEFLPE
FT                   RMKLELESKQETLDPKGLFQIDVKGMYLYGAPASGNRVESSVLVKAQRTFSGKYKEFLF
FT                   GKEDDENYSDFQEYNDFTLDAEGKGLITVDSMWTALESPAQVRVYAELFETGGRPVTRS
FT                   ISRTMWPAKTLIGLRPMFERDSVDQGKALFEVVRMAKDGAISPTSGLMVDVTKEDRDYY
FT                   WEYTENRGWVYRHTEKNYHYLSQVLDLQPDKPTPLALDLPYGRYLLSIKDPETGNTASY
FT                   RFYVGGWWWSSEQDKTARPDMVNLALDKPAYLPGDIIQVTVTPPHAGQAIIMVEGDKVL
FT                   WSKRLEVPKEGAVVEIPMAASWDSHDLYISATVLRPIDAKEKIASNRAVGLVHLPLDRT
FT                   QRTLKIKIDAPDKTEPNQKAEIGLHLDKAPKEPVFVTLAAVDVGILNITNFQTPDPVEH
FT                   FFGQRLYGVDIRDLYAKVAEFTDGKMIRPKWGGDADASPGGKKPESKVKLVALFHAPVN
FT                   FDHQGKATVALDLPDFNGTLRLMAVAFSENSYGSADKEMIVAAPVVTQLAMPRFLAPGD
FT                   QSQFTLDVHNLSGQAQNLSLKMTATKAVTLKDGARKVSLADQEKTTLVFPVTAKSEGAS
FT                   KIQLAVTGLKKPMNRDWQIGIRPGYPAVSRLSAGVLRPGETFTLKKDLVDDLVASTIEC
FT                   SFKISPYISLPVGDSMRGLIRYPYGCLEQTTSSSYPLLVASDEAIRRYGLKPISREERA
FT                   KRLEKSMALLADKQMTNGGFSLWDGGGSEEPWLTAHAANFLLEARDAGYPVPEDMLDKA
FT                   LKRLGEYLRYKPPVHSWGSRESHTQLRFSIRAYAAYVLAKTNRAPLGTLRTLFDNHAED
FT                   ARSCLPLVQIGLALDAMGDKTRAAKAFTMAADYKKTYEHYWGDYGSSIRDDALSLAILP
FT                   DEQFNSDKWTQKLLELNKTITNRKYYSTQEKYAILLLGLRLDSMSGKEWKGELSVGRDK
FT                   DSIDGIGAFTFNPSPDECLKGVSYTHRDGAVAFISVSVQGYTKTPPPKDDSMIFVRRTL
FT                   FDLHGKEITASNFKVGEVMLAELEMISETPLYDALVVDMLPAGFELENPAVSHGLKVQD
FT                   IVIDDKSVYQWRNGGSIQHEQFLDDRYVAAINLYSHNAMRLHYLVRAVSPGTYTFPPVM
FT                   VESMYQPEIRGVSETPKNITIENVGKTDKEAEAPPSK"
FT   sig_peptide     409941..410009
FT                   /locus_tag="Dalk_0304"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006001_SP"
FT   gene            415012..417465
FT                   /locus_tag="Dalk_0305"
FT   CDS_pept        415012..417465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0305"
FT                   /product="penicillin-binding protein 1C"
FT                   /note="TIGRFAM: penicillin-binding protein 1C; PFAM:
FT                   glycosyl transferase family 51; penicillin-binding protein
FT                   transpeptidase; Penicillin-binding domain protein; KEGG:
FT                   hch:HCH_01956 penicillin-binding protein 1C; IMG reference
FT                   gene:2503006002; PFAM: Penicillin-Binding Protein
FT                   C-terminus Family; Penicillin binding protein
FT                   transpeptidase domain; Transglycosylase; TIGRFAM:
FT                   penicillin-binding protein 1C; InterPro:Beta-lactamase-type
FT                   transpeptidase fold; InterPro:Glycosyl transferase, family
FT                   51; InterPro:Penicillin-binding protein 1C;
FT                   InterPro:Penicillin-binding protein, transpeptidase;
FT                   InterPro:Penicillin-binding, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02014"
FT                   /db_xref="GOA:B8F8Y2"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR009647"
FT                   /db_xref="InterPro:IPR011815"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y2"
FT                   /protein_id="ACL02014.1"
FT                   /translation="MAETGTQRFGEYLHVVKQHGTEMNNSNNKKHCSKTRRAGGLVLAC
FT                   AIAAPFVLTLAFLLADALFPLPLPGGDSRDFAVAVASADGAPLRVFPDEKGVWRYPVKP
FT                   DQVSPLYLEALITYEDKHFYEHPGVNPFSLIRAFWTTVTQKGVVVGGSTLTMQVGRILD
FT                   PHFKTIPGKCKQMFRALQLEWHFSKEEILTLYLNYAPFGGPVEGVQAASFTYLGKPAKE
FT                   LSHAEAALLAVLPQSPSRIRPDRHPDRARRARDKVLRRMVSQGVWPKQIAEEAMMEGVD
FT                   AGFAPRPMMAPLLARRLKENARPDAPVQTFIDPALQEALEAMAERFIASTPDGTSAAIL
FT                   VMENASLEVKAYVGSADFLDSSRFGHVDMIRAVRSPGSTLKPYLYAFAMEEGLIHSQSL
FT                   LVDAPFTFSGYRPGNFSDGFSGPVSAAQALQRSLNIPAVDLLDRIGPDFFDSRLRQGGL
FT                   NLVFPPHGKPNLSMILGGVGADLESMVGAFSAFDRGGLAGKPRLTTEDPVRERRLMKPG
FT                   AAFIIRDILSRQRRPGAPGGNPMAGWARSVAWKTGTSYGFRDSWSIGAYGGCTIGVWVG
FT                   RPDGTPSPGFYGRATAAPLMFSAFDCLPRRDFAPQPMPASVSRAEIGWPLGVAPEGEND
FT                   PLCAEKRTAWILDGVIPPTLPDRLDDQWTCNPITVMVNPDTGLRVDGDCPVSNAAAEKI
FT                   ALWPRAATPWLTPREKAMAAVPSMDPACGKAVSVTPSVIKIMDVQPDTVLRPAGASRAM
FT                   PVLELSALGGRGRLFWMLDRILIGSAGVGESITYEFTRTGAHQLTVLDMAGNSDSVNIQ
FT                   VMSSS"
FT   gene            complement(418310..418681)
FT                   /locus_tag="Dalk_0306"
FT   CDS_pept        complement(418310..418681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0306"
FT                   /product="Response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   sat:SYN_00173 response regulator receiver domain-containing
FT                   protein; IMG reference gene:2503006003; PFAM: Response
FT                   regulator receiver domain; InterPro:CheY-like superfamily;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02015"
FT                   /db_xref="GOA:B8F8Y3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y3"
FT                   /protein_id="ACL02015.1"
FT                   /translation="MARILVVDDDVNITSMLRRLFQRRGYDVDEAINGKQALQVMDQNL
FT                   PDLVITDIIMPEMEGAELIMEIRKRAPGVKIIAISGGGRIQPADYLDLAEKLGAECSFA
FT                   KPVKQSDMLAAVERLLETG"
FT   gene            complement(418712..419383)
FT                   /locus_tag="Dalk_0307"
FT   CDS_pept        complement(418712..419383)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0307"
FT                   /product="ATP-grasp domain-containing protein"
FT                   /note="KEGG: dol:Dole_0137 ATP-grasp domain-containing
FT                   protein; IMG reference gene:2503006004; PFAM: ATP-grasp
FT                   domain; InterPro:ATP-grasp fold; InterPro:ATP-grasp fold,
FT                   subdomain 1; InterPro:ATP-grasp fold, subdomain 2;
FT                   InterPro:ATP-grasp fold, succinyl-CoA synthetase-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02016"
FT                   /db_xref="GOA:B8F8Y4"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y4"
FT                   /protein_id="ACL02016.1"
FT                   /translation="MEIIEKALAAGRSTLSESESKQILNQYNIPITKEILATNAQELDQ
FT                   AVQEIGFPLVMKGCAADLAHKTESGLVKIDIRDAQEAREAFESMMAKMDSADKGVLVQE
FT                   MVKGKRELVVGLTRDPQFGPCVMFGLGGIFTEVLEDIAFRVAPITKADALDMMSEIKGK
FT                   KILEAIRGMEAADKDMLADILVAVGKLGEENQAVSEVDINPLILTGGKPVAVDALVVLA
FT                   N"
FT   gene            419791..420192
FT                   /locus_tag="Dalk_0308"
FT   CDS_pept        419791..420192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0308"
FT                   /product="Response regulator receiver domain protein
FT                   (CheY-like)"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   sat:SYN_00173 response regulator receiver domain-containing
FT                   protein; IMG reference gene:2503006005; PFAM: Response
FT                   regulator receiver domain; InterPro:CheY-like superfamily;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02017"
FT                   /db_xref="GOA:B8F8Y5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y5"
FT                   /protein_id="ACL02017.1"
FT                   /translation="MAFGNSAHRILVIDDERQVREMLTQTLEREGYLVETAENGEVAME
FT                   LLKRNPADLVIADMVMPKKEGIITITEIRRDFPELKIIAISGGGQQGRDGAASEYLSIA
FT                   ARCGALKTFKKPIPKNDLLTAIQELLKFP"
FT   gene            complement(420231..420935)
FT                   /locus_tag="Dalk_0309"
FT   CDS_pept        complement(420231..420935)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0309"
FT                   /product="hypothetical protein Dalk_0309"
FT                   /note="IMG reference gene:2503006006"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02018"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y6"
FT                   /protein_id="ACL02018.1"
FT                   /translation="MNRLFKTLKKKAAVAMVAAMAMGCLWAPPARSGEMAVDLSALIYE
FT                   TQKASRAMEDVLLAWWVPQELWLMFLSQSQSVSEEEKQKYLEIMDPYMVFLVVDGTIGE
FT                   DGRPHFQAREDVLNALVLEDAAGNKYKTLRGTEISQEAKDFLSRVFPSFARSLGPLGNN
FT                   LYYAVFTSKNSKGEPIANVFTEGAFVLHMAKRSFRWRTPLGALVPPKHCPITGEELNGG
FT                   WKYNPWNGAKLD"
FT   sig_peptide     complement(420840..420935)
FT                   /locus_tag="Dalk_0309"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006006_SP"
FT   gene            complement(420970..422115)
FT                   /locus_tag="Dalk_0310"
FT   CDS_pept        complement(420970..422115)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0310"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: von Willebrand factor type A; OmpA/MotB domain
FT                   protein; KEGG: sat:SYN_00198 outer membrane porin protein;
FT                   IMG reference gene:2503006007; PFAM: von Willebrand factor
FT                   type A domain; OmpA family; InterPro:Outer membrane
FT                   protein, bacterial; InterPro:Outer membrane protein,
FT                   OmpA-like, conserved site; InterPro:Outer membrane protein,
FT                   OmpA/MotB, C-terminal; InterPro:von Willebrand factor, type
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02019"
FT                   /db_xref="GOA:B8F8Y7"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR028974"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y7"
FT                   /protein_id="ACL02019.1"
FT                   /translation="MTRIRPVLFTCLAAVFIFAGCAGKSAEVFVPSDLNGSIRTGHLVQ
FT                   KADHFLVILDCSGSMAEMVDGEKKFVLAREAVRKMIAGIPEAEMNFEAGLRVFGLTMNP
FT                   FVESTTALVDMEPLDKAAYDKALDKVTFATGKSNLALAIAQSSDDLDKTTGEISLIIVT
FT                   DGKETDGEAARALEVVKNTYRDRLCVYTIQVGHDPAGEKLLERLSRKGQCGYSENLDNV
FT                   NSPKAMACFIARSLLKKGPDQDEDGAPDRIDLCPNTPAGASVDDSGCWQLTGLEFKTNK
FT                   ADIAKKYYPIMDKAICVLKKYPDLKVLIGGHTDSRGPDKFNQELSQDRAQAVMDYMVKK
FT                   GVAPERLSVRGFGAAKPIAANDSKEGRAQNRRVTLTPIAAE"
FT   sig_peptide     complement(422050..422115)
FT                   /locus_tag="Dalk_0310"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006007_SP"
FT   gene            422239..422694
FT                   /locus_tag="Dalk_0311"
FT   CDS_pept        422239..422694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2921 hypothetical protein; IMG
FT                   reference gene:2503006008; PFAM: Protein of unknown
FT                   function (DUF3015); InterPro:Protein of unknown function
FT                   DUF3015"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02020"
FT                   /db_xref="InterPro:IPR021383"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y8"
FT                   /protein_id="ACL02020.1"
FT                   /translation="MKKGLLAAALCIFLAISPVAFADQNNYGCGLGSMVIDNNESLVSQ
FT                   TFAATLNGCFANQLFGMSSGTSNCDKPDSIVYNEKINIFVADNMDNLASDIAKGQGEYL
FT                   DTLATLMEVPADQRPVLYSKLQNNFSAIYPSDQVTHTDVLRNIEAVL"
FT   sig_peptide     422239..422304
FT                   /locus_tag="Dalk_0311"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006008_SP"
FT   gene            422694..424637
FT                   /locus_tag="Dalk_0312"
FT   CDS_pept        422694..424637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0312"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gbm:Gbem_0538 hypothetical protein; IMG
FT                   reference gene:2503006009"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02021"
FT                   /db_xref="InterPro:IPR025178"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Y9"
FT                   /protein_id="ACL02021.1"
FT                   /translation="MGKSGLQNTKGEAPLVFRRGFSFFCCLIALLVLPGLCIAQSPTDL
FT                   ETIIDRALAEKLHQNPYWHVLLHYQKQGSGFKSRVDDPNFFLAPDGKTNPKAELLADVR
FT                   AFFQSWDEDAEKPHAVCRFPARFAWIASQIGCLASAFPVRECPRFEKIYAAMAPDSAVL
FT                   IFPSAHINSPASMFGHTLLAVEAKGQGRLLASAVNYSAVTGRTWGPIFAYKGLFGGYNG
FT                   YFSMLPYYDKIQEYSDVSHRDMWEYPLNLTPEELRRMLLHLYELDNIYSDYFFIDENCA
FT                   FNLLYLLDAARPGANLAGQCPYVAVPVDTIRLAEKGGFLDGPPAYRPSKMTRIEHLRNG
FT                   LSGKEKKQALEIAQGEAPPESAVDKIKTLEKQARVVDLAAETASYRYTRKVLSKEDYTQ
FT                   RYRSILAARSGLGRQDSPPVPEPAAPDSGHLSSKVWAGGGVNDGEAVCRLGWRPLFHGF
FT                   DDNPKGYEKGAQIKVLNASVDYFPEKGRVDLHQVDVLDIFSLAPRDAVFKPLSWRVETG
FT                   FRQMIDPDGSRGAAYVFNMGGGISKDLGPLGLCYALAEADFAATPGWDMGYGAGPGLRT
FT                   GLLADPAPWLRLRLEGKGTCYLLGDDHTALTGLMESVIATSQNTGFHAQALFQRSRDFA
FT                   NTELNLSFQIYF"
FT   sig_peptide     422694..422810
FT                   /locus_tag="Dalk_0312"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006009_SP"
FT   gene            complement(424661..426784)
FT                   /locus_tag="Dalk_0313"
FT   CDS_pept        complement(424661..426784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0313"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: sfu:Sfum_3614
FT                   ATP-binding region, ATPase domain protein domain protein;
FT                   IMG reference gene:2503006010; PFAM: Histidine kinase-, DNA
FT                   gyrase B-, and HSP90-like ATPase; His Kinase A
FT                   (phosphoacceptor) domain; InterPro:ATPase-like, ATP-binding
FT                   domain; InterPro:Signal transduction histidine kinase,
FT                   core; InterPro:Signal transduction histidine kinase,
FT                   homodimeric; InterPro:Signal transduction histidine kinase,
FT                   subgroup 1, dimerisation/phosphoacceptor domain;
FT                   InterPro:Signal transduction histidine kinase-related
FT                   protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02022"
FT                   /db_xref="GOA:B8F8Z0"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z0"
FT                   /protein_id="ACL02022.1"
FT                   /translation="MNINRLRIIIVLFCLALAAPSAYFIRHARMGMEQEERGALQFFAD
FT                   TILDYMEEDLARLVEREEGRAVDDYAASANGGLTMDSVEGFIVGYLQNNPDGSFTTPYG
FT                   DDPVLVRQLQSANGAFNKLRMERREVEDAEALTLITQVGDADKQPAPAPEPEAKPQISE
FT                   EKALQEKQEIAQVKKSFVERYLDPLISRQSKEQLGQKGRRVEEISIEQASNMSNKEMPS
FT                   RDVSAIQLKDEGSDSAVVYEDTALAVYKPETDDLKPAPSEESSWSKPKPKSSVSHIFSA
FT                   PGASALAESMDPAPKNELGRQSFLREDRFGLPASREAAQKKLKLTMDAQDKGKLRVEVD
FT                   PLQSMVLDHERILLFRRIVLDNRVYNQGMLIDTPAFLKYLNDVYFARQPMARYSTLTLS
FT                   VMDRGVETNTVTTGKTLPSLVYRAERVFPRPFSFLVAAIECHDLPKSAGRRTLNIMQGV
FT                   FWFVVLAGLFAIYRSAAAVMDYSRRRSQFVSSVTHELKTPLTNIRMYVEMLEMGIAKDT
FT                   EREQEYLQVLGSESSRLSRLITNVLQFARLENRKSILELQEGDLSEVLAEVRQVMGERL
FT                   RSEGFILEADKAAQRPFQYDREAMVQILVNLVENSVKFGKDARDKEVLITLKQEPGRTM
FT                   VKVSDKGPGIPKKALKKVFKDFFRVDNSLTRTTRGTGIGLALVRRFTESMGGRVTAENN
FT                   PGPGCTITLHLPS"
FT   sig_peptide     complement(426692..426784)
FT                   /locus_tag="Dalk_0313"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006010_SP"
FT   gene            complement(426781..427554)
FT                   /locus_tag="Dalk_0314"
FT   CDS_pept        complement(426781..427554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0314"
FT                   /product="ADP-ribosylation/Crystallin J1"
FT                   /note="PFAM: ADP-ribosylation/Crystallin J1; KEGG:
FT                   sat:SYN_02522 ADP-ribosylglycohydrolase; IMG reference
FT                   gene:2503006011; PFAM: ADP-ribosylglycohydrolase;
FT                   InterPro:ADP-ribosylation/Crystallin J1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02023"
FT                   /db_xref="InterPro:IPR005502"
FT                   /db_xref="InterPro:IPR036705"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z1"
FT                   /protein_id="ACL02023.1"
FT                   /translation="MIGAIAGDVIGSMYEAVNNKSLFFPLFSPYSRFTDDTVLTVAIAQ
FT                   AILKERPYLDCIREFGRKYPNAGFGGHFYDWLFAANPLPYNSWGNGSAMRVSPVGFAFD
FT                   DMDKVLEEAKKSAEVSHNHPEGIKGAQAVACAIFLARKGAGKEVIRGEIAARFGYNMDR
FT                   TVDEIRPHYAFDVSCQGSVPEAIIAFLDSENFEDAIRQAISLGGDSDTIGCMAGAVAQA
FT                   YYKGVPEEIAGEVRSRLPEEFLNIIDEFNKVYGLS"
FT   gene            complement(428124..428474)
FT                   /locus_tag="Dalk_0315"
FT   CDS_pept        complement(428124..428474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0315"
FT                   /product="protein of unknown function DUF559"
FT                   /note="PFAM: protein of unknown function DUF559; KEGG:
FT                   nmc:NMC0366 hypothetical protein; IMG reference
FT                   gene:2503006012; PFAM: Protein of unknown function
FT                   (DUF559); InterPro:Domain of unknown function DUF559;
FT                   InterPro:Restriction endonuclease, type II-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02024"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z2"
FT                   /protein_id="ACL02024.1"
FT                   /translation="MKPKAAQSMERAKALRSNMTEAEKKLWQRLRKRQVQGCKFRRQFS
FT                   IGAYIVDFVCLEKRLIVELDGGQHKQQASYDSVRTAWLEANNFCILRFWNNQVMQNTDE
FT                   VVQAIFNKLSQA"
FT   gene            complement(428701..429816)
FT                   /locus_tag="Dalk_0316"
FT   CDS_pept        complement(428701..429816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0316"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ecl:EcolC_3640 transposase IS4 family protein; IMG
FT                   reference gene:2503006013; PFAM: Transposase DDE domain;
FT                   InterPro:Ribonuclease H-like; InterPro:Transposase,
FT                   IS4-like; InterPro:Transposase, Tn5-like, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02025"
FT                   /db_xref="GOA:B8F8Z3"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z3"
FT                   /protein_id="ACL02025.1"
FT                   /translation="MENQILLSEGDDWQAILTFLPHGWEEKAKELGALSRRRNFDGPEA
FT                   LLRVLLIHLVQGCSLRVTAALSKAGGLASASDVALLKRLKASGEWMRWMAVELMKQWFG
FT                   KQPEKILGMGRTVRVVDGSTVSEPGSTGTTWKIHYSIQLPSLQCDEVYVTDPKTGEDLK
FT                   NFNVHPGDVFLADRGYYHRTGMLHVVKGGGDLIVRMIHQYKLYDINGQEFGLIKNLRSL
FT                   TVNQIGDWDAFIHHKKEVISGRVCAIKKSKEAAEKAKRAILRENSKKGHKTKPETLVAA
FT                   EYVFVFTTLSREWKASQVLEAYRGRWQVELAFKRLKSLIGLGHLKKTDFEGAKAWLHGK
FT                   IFAAFLVEAMIAACDSFSPWGYEIQAAAEAT"
FT   gene            complement(430032..430739)
FT                   /locus_tag="Dalk_0317"
FT   CDS_pept        complement(430032..430739)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0317"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: sfu:Sfum_3615 two component
FT                   transcriptional regulator, winged helix family; IMG
FT                   reference gene:2503006014; PFAM: Response regulator
FT                   receiver domain; Transcriptional regulatory protein, C
FT                   terminal; InterPro:CheY-like superfamily; InterPro:Signal
FT                   transduction response regulator, C-terminal;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain; InterPro:Winged helix-turn-helix transcription
FT                   repressor DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02026"
FT                   /db_xref="GOA:B8F8Z4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z4"
FT                   /protein_id="ACL02026.1"
FT                   /translation="MKEPRASILLVEDDPAISRGLLDVFVFNGFAAKGVEDGKQGLDEA
FT                   LSGQYDLVILDVMLPSLDGFSICRKLREAKPSQAIIMLTAKGSENDIVTGFSAGADDYV
FT                   SKPFSLKELMVRVEAVLRRSGKNLGTAKVSIGGIIFDEAQLKASYDDKTEELTRREMDI
FT                   VLYLHRQEGRIVPKRELLLEVWHYNDPDVETRTVDIHVLKLRKKITELAGEDKPLIVTV
FT                   RGEGYKLEIPMVI"
FT   gene            430991..432667
FT                   /locus_tag="Dalk_0318"
FT   CDS_pept        430991..432667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0318"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   cth:Cthe_3075 von Willebrand factor, type A; IMG reference
FT                   gene:2503006015; PFAM: von Willebrand factor type A domain;
FT                   von Willebrand factor; Domain of unknown function
FT                   (DUF3520); InterPro:Protein of unknown function DUF3520;
FT                   InterPro:Uncharacterised protein family YfbK, N-terminal;
FT                   InterPro:von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02027"
FT                   /db_xref="GOA:B8F8Z5"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR021908"
FT                   /db_xref="InterPro:IPR022156"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z5"
FT                   /protein_id="ACL02027.1"
FT                   /translation="MQSQKEQILRDVVTYALLIISIVCLAGSAAVSFTSCSPKTVNEDA
FT                   MTGYSGYTSKSTSAEPSMSAAKPCPAPKSEQRYAYYCRVPDYNTEEYAPIREGGFKSPL
FT                   YDPLSTFSIDVDTASYSNVRRFLSYGNMPPVDAVRIEEMINYFHYDYPQPKGQDPFSIT
FT                   MEMSQCPWNRDNMLVHVGLQGRCLDYKDVKPSNLVFLLDVSGSMNSENKLPLVKRSMEM
FT                   LVKELGAGDRVSIVTYAGSAGLVLPSTSARNKRKIITALDRLEAGGSTAGGEGIELAYR
FT                   VAWENLIPEGNNRVILCTDGDFNVGVSSTPELVRMIEEKRRAGIYLTICGFGMGNYKDE
FT                   KMEAISNAGNGNFYYIDSRREAHKVFVQDMRANMFTLAKDVKIQVEFNPGRVSQYRLVG
FT                   YENRLLAAEDFNNDLKDAGEIGPGHSVTALYEIVPAGLGMGAQRVDPLKYQESEPVPEL
FT                   RNSNEILTIKFRYKNPEENRSRLITRVLDESSMEFGDTSDDFRFSAAVAGWGMLLRNSS
FT                   YADRLTWGQIQSMAEESVGPDEMGYRAEFIKLVKTCRELNS"
FT   sig_peptide     430991..431068
FT                   /locus_tag="Dalk_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006015_SP"
FT   gene            432684..434126
FT                   /locus_tag="Dalk_0319"
FT   CDS_pept        432684..434126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0319"
FT                   /product="von Willebrand factor type A"
FT                   /note="PFAM: von Willebrand factor type A; KEGG:
FT                   sfu:Sfum_3616 von Willebrand factor, type A; IMG reference
FT                   gene:2503006016; PFAM: von Willebrand factor type A domain;
FT                   InterPro:von Willebrand factor, type A"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02028"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z6"
FT                   /protein_id="ACL02028.1"
FT                   /translation="MKAKALLLVGVLIAATFAAMAYANRSAGVVAPPPVAPAIPPVAIK
FT                   PVKNGIVTLTGELTQDKIHATGDRMFDLVLTMTADEVLAPEQTKTKPVDMVIVLDRSGS
FT                   MGGQKVRDAKAAVKGLVEGLRSQDRFSLVTYSNSVNGGDGLHYLTADKRNSLNWMVDSI
FT                   PAGGGTNLGGGLEKGVGVLRAYGAPDRMGKVILISDGQANQGVTDPNQLAAMAALRDDG
FT                   LVYSVTTVGIGQDFNEQLMATVADGGRGRYYYLENPGDFLAVFQEEANWTRAVAASALS
FT                   IHLPLPKGVTAVSANGYPVINKENGAFISPGALLSGQSRTLYIRLHANDDAAEILNFNG
FT                   VTATYVHEGRTLTAICPQSFEVQVTQNAMAALESVSREAWEEKVLNADWNVLKEEVAAD
FT                   IKAGDKDQAKHRIEEYRQSIQVQNSVVNSPSVESNLNEDCEALMDKVDETFTGDSSEVM
FT                   QKQRSVSKSMQYEGYKDRRGIR"
FT   sig_peptide     432684..432746
FT                   /locus_tag="Dalk_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006016_SP"
FT   gene            434494..434868
FT                   /locus_tag="Dalk_0320"
FT   CDS_pept        434494..434868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0320"
FT                   /product="phage shock protein A, PspA"
FT                   /note="KEGG: sfu:Sfum_3617 phage shock protein A, PspA; IMG
FT                   reference gene:2503006017; PFAM: PspA/IM30 family;
FT                   InterPro:PspA/IM30"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02029"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z7"
FT                   /protein_id="ACL02029.1"
FT                   /translation="MGIMTRLTRLCKADIHGVMDQIEDKGLVLAQCLREMEDAMSRERI
FT                   KLSRLSARRDNLKANLKAQEELAQKVDQDLYEAVKKEKDDIAKFLIRKHKTVTGVVQKL
FT                   DLQIQELNRDISRLQQDLEE"
FT   gene            434875..435036
FT                   /locus_tag="Dalk_0321"
FT   CDS_pept        434875..435036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0321"
FT                   /product="hypothetical protein Dalk_0321"
FT                   /note="IMG reference gene:2503006018"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02030"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z8"
FT                   /protein_id="ACL02030.1"
FT                   /translation="MHERLKVQADAFMAAKKNQEYSGVQGASFAGQDLSDEEIQWELEK
FT                   RKEALRHE"
FT   gene            435029..435640
FT                   /locus_tag="Dalk_0322"
FT   CDS_pept        435029..435640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3618 hypothetical protein; IMG
FT                   reference gene:2503006019"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02031"
FT                   /db_xref="GOA:B8F8Z9"
FT                   /db_xref="UniProtKB/TrEMBL:B8F8Z9"
FT                   /protein_id="ACL02031.1"
FT                   /translation="MNNNFAYLNDAPAQGLEREVRAMRSHFSGTIWYALACGLAFIPAY
FT                   FSLNLISGPYWAFRMTLWIFLAGYAWLLRRWSGAKFLTCLFPLFLLLALAFVGLPQTSF
FT                   LVAAIVILAWIRSGVCFAGKGARSLAVELGVSAGGAVLVNLLSPHSGLTWALAVWLFFL
FT                   VQSLFFVMGPDSAAQAWIDPYKPEPFEQARQRAERILSAD"
FT   gene            complement(435763..436926)
FT                   /locus_tag="Dalk_0323"
FT   CDS_pept        complement(435763..436926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0323"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: dol:Dole_2371
FT                   cyclic nucleotide-binding protein; IMG reference
FT                   gene:2503006020; PFAM: Cyclic nucleotide-binding domain;
FT                   InterPro:Cyclic nucleotide-binding domain; InterPro:Cyclic
FT                   nucleotide-binding-like; InterPro:RmlC-like jelly roll
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02032"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="UniProtKB/TrEMBL:B8F900"
FT                   /protein_id="ACL02032.1"
FT                   /translation="MKPSIALKGQLDFVSLAQVIQFLSSNSSNGALVLKSPYINQPGVI
FT                   CFNKGIITNAFCGDLQGIDAAYSLFGWTEGEFEFDVNRVETERVITQSLMEIIMEGARM
FT                   LDEGRIQELGAENQDIAKPFRPHLEEGVNFIPSPDVDYSYVVEEEIFSPGQNIVEEGNH
FT                   GNWICVILDGYADVIKDTKKGPFTLCRIGPGALIGDIAIVLKKENVRRASVISVDEVTL
FT                   GVLDLERIHRELALMSRSLRGVLLGLNRRLAEVNHNLSRLHVSDKTYDIKSLSGRDVFD
FT                   FNRSDKLFTITQGWASLVAKGSQGYVKVAEMEHGDFVGRVPFLDLGHEPSQAVLLPSED
FT                   FAVEELPTEDIVAEYENSSNMIQCIASYISNCVAATTMQIRGTGKND"
FT   gene            437108..438445
FT                   /locus_tag="Dalk_0324"
FT   CDS_pept        437108..438445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0324"
FT                   /product="response regulator receiver modulated serine
FT                   phosphatase"
FT                   /note="PFAM: response regulator receiver; Stage II
FT                   sporulation E family protein; SMART: protein phosphatase 2C
FT                   domain protein; KEGG: sil:SPO0022 response regulator; IMG
FT                   reference gene:2503006021; PFAM: Response regulator
FT                   receiver domain; Stage II sporulation protein E (SpoIIE);
FT                   InterPro:CheY-like superfamily; InterPro:Protein
FT                   phosphatase 2C-like; InterPro:Signal transduction response
FT                   regulator, receiver domain; InterPro:Sporulation stage II,
FT                   protein E C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02033"
FT                   /db_xref="GOA:B8F901"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B8F901"
FT                   /protein_id="ACL02033.1"
FT                   /translation="MISASWFRKIDSKGTQPKSRFYDQALTNGIKNLKEAGNFDHTAMK
FT                   ILVADDDRTVQIALKTLLSKWGYEVVTAQDGAQAWEILQDPKAPRLAVIDWMMPGMEGP
FT                   ALCKKIRQSSLSSYTYLILLTAKTSKSELMEGLEAGADDFISKPFNAGELKARITAAER
FT                   ILSLEKELKVKNEALSQSNINLSRSNDIITKDLQVAASVQQSLLPAQTGELNGFSFGSL
FT                   FMPCAIVGGDMFNFFPLGDNHIAFFILDISGHGVPAAMLSVTVSKTLTSLIWEEAMTTG
FT                   ISRNGSGTLLSPEDMAAKLNLLFQSSDTLQAYFTMILGITDVRTGRTILTQAGHPHPIR
FT                   VPSQGALETIGNGGFPVGLLENAEYSGYEFTLNPGDRLYLYSDGITECRDDQDNEFSQK
FT                   RLMQLLEDSRSQDLESVMRTTAEELFRFHGSGSFSDDISIMVLQRN"
FT   gene            438690..439514
FT                   /locus_tag="Dalk_0325"
FT   CDS_pept        438690..439514
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0325"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   lme:LEUM_1912 mRNA degradation ribonuclease J1/J2,
FT                   metallo-beta-lactamase superfamily enzyme; IMG reference
FT                   gene:2503006022; PFAM: Metallo-beta-lactamase superfamily;
FT                   InterPro:Beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02034"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8F902"
FT                   /protein_id="ACL02034.1"
FT                   /translation="MKKECKLTFLCEDQARMGFLDKKFSGQHGLSIFIQGEKNVLFDTG
FT                   PSEIVLYNAALAGVNLDSADLIVLSHGHWDHSDGLAPLSNAGIRKPLLLHPMAFRDRRK
FT                   PSGQFNGMAMSRDQIMERFDLIESSGPYKVSENMWFLGEIPRENDFESQSTSYYYMEDG
FT                   EKRPELLPDDTALAVTTPKGLVVITGCSHAGICNICEYAKKVTGQGCIRTVIGGFHLLD
FT                   DSKVVEKTIDYFRGQGVESLFPNHCTALPALSAFYQAFKINRLCVGDELEIS"
FT   gene            complement(439519..439977)
FT                   /locus_tag="Dalk_0326"
FT   CDS_pept        complement(439519..439977)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0326"
FT                   /product="hypothetical protein Dalk_0326"
FT                   /note="KEGG: dol:Dole_1744 hypothetical protein; IMG
FT                   reference gene:2503006023"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02035"
FT                   /db_xref="UniProtKB/TrEMBL:B8F903"
FT                   /protein_id="ACL02035.1"
FT                   /translation="MYSIKNDAAKNRLYVTIGVLKTRDSCNLVNAMLKRASKMRRGFTL
FT                   LLDLSTFKPTSELATQHICTGIDYLQKQGLGYIAKVSCPMEAMADIDVFCIPYGMECQT
FT                   AATAAEADKILDWWAAAQEAKGAMIEKGAAPAFQEYNPPDCVFLSPQD"
FT   gene            complement(440050..440904)
FT                   /locus_tag="Dalk_0327"
FT   CDS_pept        complement(440050..440904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0327"
FT                   /product="hypothetical protein Dalk_0327"
FT                   /note="KEGG: bwe:BcerKBAB4_1154 hypothetical protein; IMG
FT                   reference gene:2503006024"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02036"
FT                   /db_xref="GOA:B8F904"
FT                   /db_xref="UniProtKB/TrEMBL:B8F904"
FT                   /protein_id="ACL02036.1"
FT                   /translation="MLEILQNIGIFALDSLKTTGMILLMIMGPGMLFALIMNSVSTRLK
FT                   SELWNLLGRKLYLAAFGWLGVSVHELGHAVMCLLFGHKINKLQLFAPDQKSGTLGAVNH
FT                   SFNPRNPYQVVGNFFIALGPVILGVAVIWAAAHFLLPHGIASLDISVKWSDFRSLDSFL
FT                   RLAASSWGAAKDMLDDLFTKAVWSQWQTWVFTYILICVGSGISLSWSDISGGIEGFLAF
FT                   FVLLFIAVLIAAYLDSIPTQQIKALSRAIANVYPFMLFALALNAMLAVSVFLLNTLKES
FT                   IKS"
FT   sig_peptide     complement(440803..440904)
FT                   /locus_tag="Dalk_0327"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006024_SP"
FT   gene            complement(440931..441728)
FT                   /locus_tag="Dalk_0328"
FT   CDS_pept        complement(440931..441728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0328"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cpb:Cphamn1_1348 hypothetical protein; IMG reference
FT                   gene:2503006025; PFAM: Uncharacterised protein family
FT                   (UPF0014); TIGRFAM: TIGR00245 family protein;
FT                   InterPro:Conserved hypothetical protein CHP00245"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02037"
FT                   /db_xref="GOA:B8F905"
FT                   /db_xref="InterPro:IPR005226"
FT                   /db_xref="UniProtKB/TrEMBL:B8F905"
FT                   /protein_id="ACL02037.1"
FT                   /translation="MSQVVHISLWQLGLGTIFILIAGATSLIYKLGLEKDLFWGAVRTF
FT                   AQLFLMGYALTIIFTLNLGWMVLAIYAVMIGFAALTVRGRVKEKQVPILIPTFVSMLTS
FT                   YMLVSILITGVIVGVDPWWQPRYFLTLGGMVVGNSMTAVAISLERLFAELRQRSNEVEM
FT                   MLCLGADYKEASHPMLAEALKAGMIPSINSMMGAGIVFIPGMMTGQILAGADPLEAIRY
FT                   QIVVMLMLVGSTALGSLLITLLVRRKCFGAAQELRLTKTKGLS"
FT   gene            complement(441725..442396)
FT                   /locus_tag="Dalk_0329"
FT   CDS_pept        complement(441725..442396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0329"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cpc:Cpar_1003 ABC transporter related; IMG reference
FT                   gene:2503006026; PFAM: ABC transporter; InterPro:ABC
FT                   transporter, conserved site; InterPro:ABC transporter-like;
FT                   InterPro:ATPase, AAA+ type, core; InterPro:Phosphate
FT                   transport system permease protein 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02038"
FT                   /db_xref="GOA:B8F906"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8F906"
FT                   /protein_id="ACL02038.1"
FT                   /translation="MEDQTVLECRNLGFAYENNKDLFSEVNLKVPAGAFVQIQGASGTG
FT                   KSTFLRLLNRLALPTKGSILFKGKDLQELEAPELRTRIVYLQQTPTLVQGSVRHNLLLP
FT                   FRFAQNKKRQGPNNQELRMGLKRFMLDEISLEQTALDLSVGQRQRLCLLRAILLSPGVL
FT                   LLDEPTSALDRDSRQAVVDVVNKLRREDNITMFLVAHTEFSIESEKVIYCTLHNGKMEV
FT                   Q"
FT   gene            442524..443156
FT                   /locus_tag="Dalk_0330"
FT   CDS_pept        442524..443156
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0330"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   dol:Dole_0028 beta-lactamase domain-containing protein; IMG
FT                   reference gene:2503006027; PFAM: Metallo-beta-lactamase
FT                   superfamily; InterPro:Beta-lactamase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02039"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8F907"
FT                   /protein_id="ACL02039.1"
FT                   /translation="MIIRQILGGSMGVFCYVIQDPVTKNCALIDPAFDASTILGQVDEM
FT                   GGKVTHVINTHGHFDHICGNAGIISATGACLYIHNKDAKMLTSLFAAVACRMMGGRKSP
FT                   PADVLLEDGDRISIGETQLEVMHTPGHSPGGICLLGEGRLFSGDTLFAGSIGATWFPGA
FT                   SLKVLVKSIKERLYVLPEETVVLPGHDYGPVPTTTIGREKASNPFTR"
FT   gene            443359..444597
FT                   /locus_tag="Dalk_0331"
FT   CDS_pept        443359..444597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0331"
FT                   /product="hypothetical protein Dalk_0331"
FT                   /note="IMG reference gene:2503006028"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02040"
FT                   /db_xref="UniProtKB/TrEMBL:B8F908"
FT                   /protein_id="ACL02040.1"
FT                   /translation="MEKMLPEKARLLALLKQGNFNVPDFIYIPAEDFEKDSFKELEDFL
FT                   GRFSDDFKVIARSAHPMEEYYKGGTFDSLETYADIGGIKYARKRIIKSARKAKKLAIMR
FT                   QQIFNNAPELKLDDMGVIVMPFISGASIMAKMVGDHWEFGYSMDRSHKVQRDPYITNTP
FT                   HDIKLLHMSQEIQAFLGFRCEIEFIVSTTGEVFVVQAKDISSIDTRAFKDSETRIKLDG
FT                   VRRIRRRRNYRERPLFVMDNNAFYLEVISKCEDIVLGREDGEKTTIEDLLSLIRGYERD
FT                   MEEFAIWHERYAVLRLSTRDPKELYQVANHYLDEYPEIHGQLAKALHTNLYQMDYFLAE
FT                   ADTLIAKDKFRINLCSHDAYGIDTLRNPVWSVYWNMDRHDEVIKSFFRLGFKTGDTIAV
FT                   EIDPDEKPSVHKL"
FT   gene            444602..445438
FT                   /locus_tag="Dalk_0332"
FT   CDS_pept        444602..445438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0332"
FT                   /product="metal-dependent phosphohydrolase HD sub domain
FT                   protein"
FT                   /note="PFAM: metal-dependent phosphohydrolase HD sub
FT                   domain; KEGG: pca:Pcar_1478 metal-dependent
FT                   phosphohydrolase, HD subdomain; IMG reference
FT                   gene:2503006029; PFAM: HD domain; InterPro:Metal-dependent
FT                   phosphohydrolase, HD domain; InterPro:Metal-dependent
FT                   phosphohydrolase, HD subdomain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02041"
FT                   /db_xref="GOA:B8F909"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="UniProtKB/TrEMBL:B8F909"
FT                   /protein_id="ACL02041.1"
FT                   /translation="MRPGQDISRYTAWFRNYASSFCGDDGQVWDACALKTRHTFRVMGE
FT                   IGVLGKSLFLSSREMRLARMMALLHDVGRFTQYARFKTFVDAVSVDHGDESAEIIAREN
FT                   LLDDFSECERRLILYCVKWHNKKEVPADASPEEEFFLRLLRDADKLDIWRVVCAHYNGK
FT                   MEAPKETVELGLPGDRSISQNVHKDIMAGGIVNSLDLKTAPDFMVLQMGWVFDLNIDKS
FT                   FVLLNKRAYLEKIARALPPCREAREIYQKVRSYLDERLQGKRETKAVSATGDANNG"
FT   gene            445431..445853
FT                   /locus_tag="Dalk_0333"
FT   CDS_pept        445431..445853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0333"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   cts:Ctha_2405 Rieske (2Fe-2S) domain protein; IMG reference
FT                   gene:2503006030; PFAM: Rieske [2Fe-2S] domain;
FT                   InterPro:Rieske [2Fe-2S] iron-sulphur domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02042"
FT                   /db_xref="GOA:B8F910"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B8F910"
FT                   /protein_id="ACL02042.1"
FT                   /translation="MGKQGLKRGFINRIFGVPATKTPQDSDCWSFRDGVITVDLGRAPE
FT                   LSKPGGSIRLEGGDLPERVLVFQGDDGTYRAVKNRCTHIGHRRLDPVPGQNCVQCCSVN
FT                   GSMYEYDGANLKGPAPHPIKTYQVVKEDNALIIKLA"
FT   gene            445952..446365
FT                   /locus_tag="Dalk_0334"
FT   CDS_pept        445952..446365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0334"
FT                   /product="hypothetical protein Dalk_0334"
FT                   /note="KEGG: dol:Dole_0863 hypothetical protein; IMG
FT                   reference gene:2503006031"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02043"
FT                   /db_xref="GOA:B8F911"
FT                   /db_xref="UniProtKB/TrEMBL:B8F911"
FT                   /protein_id="ACL02043.1"
FT                   /translation="MQRDLGPKLGWTLGGIGSFLWALILSGVLLAKGNYAGAFLGAGLF
FT                   CLAMVYLSVFSPWKYPDTPFRKLYLGLIGILTLTVIGLLYFWLPGGQALKTHFHLVFLI
FT                   APGALPVFTLGKKTWRELRTPPQFPQSSHDKRE"
FT   sig_peptide     445952..446044
FT                   /locus_tag="Dalk_0334"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006031_SP"
FT   gene            446398..446655
FT                   /locus_tag="Dalk_0335"
FT   CDS_pept        446398..446655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0335"
FT                   /product="TfoX domain protein"
FT                   /note="KEGG: cpb:Cphamn1_2250 TfoX domain protein; IMG
FT                   reference gene:2503006032; PFAM: TfoX C-terminal domain;
FT                   InterPro:TfoX, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02044"
FT                   /db_xref="InterPro:IPR007077"
FT                   /db_xref="UniProtKB/TrEMBL:B8F912"
FT                   /protein_id="ACL02044.1"
FT                   /translation="MSQKVEELQNIGNTIAKRLNHIGVYTEDDLRAIGPVEAHRKIRDA
FT                   YPGARLPLCYYLFSFEGALQGKRWDGIGDKRKEELKELLG"
FT   gene            complement(447124..447435)
FT                   /locus_tag="Dalk_0336"
FT   CDS_pept        complement(447124..447435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0336"
FT                   /product="hypothetical protein Dalk_0336"
FT                   /note="IMG reference gene:2503006033"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02045"
FT                   /db_xref="UniProtKB/TrEMBL:B8F913"
FT                   /protein_id="ACL02045.1"
FT                   /translation="MMELAAGMTTMAIIGLLAGSAMAWNCFDRENGRRRMEYAFACSKY
FT                   TGENQEACNNLLKEIIEQKELMSMKAEAAGVAGPLAGRGCGYGHYGRGFRTGGGYCRR"
FT   sig_peptide     complement(447367..447435)
FT                   /locus_tag="Dalk_0336"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006033_SP"
FT   gene            complement(447991..448158)
FT                   /locus_tag="Dalk_0337"
FT   CDS_pept        complement(447991..448158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0337"
FT                   /product="hypothetical protein Dalk_0337"
FT                   /note="IMG reference gene:2503006034"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02046"
FT                   /db_xref="UniProtKB/TrEMBL:B8F914"
FT                   /protein_id="ACL02046.1"
FT                   /translation="MRKLSESIANKPMVGLHKALQLCARLTQQDTPDPLPAMTLAWEVR
FT                   GRKGCGGGQR"
FT   gene            complement(448896..449288)
FT                   /locus_tag="Dalk_0338"
FT   CDS_pept        complement(448896..449288)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0338"
FT                   /product="zinc-resistance associated protein"
FT                   /note="KEGG: dol:Dole_0425 zinc-resistance associated
FT                   protein; IMG reference gene:2503006035"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02047"
FT                   /db_xref="UniProtKB/TrEMBL:B8F915"
FT                   /protein_id="ACL02047.1"
FT                   /translation="MKKLATGVVTLVMVGLLAGSALAWECWGGGRGYGANYNNYNAESL
FT                   EARNKFLSETADLRKDLAAKRTQLDAVMSSANPDAEAAGKISREIFDIKEQLRVKADAA
FT                   GIAGPLAGNGYGCKGQGRRGGGNCWR"
FT   sig_peptide     complement(449220..449288)
FT                   /locus_tag="Dalk_0338"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006035_SP"
FT   gene            449606..451417
FT                   /locus_tag="Dalk_0339"
FT   CDS_pept        449606..451417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0339"
FT                   /product="PAS/PAC sensor signal transduction histidine
FT                   kinase"
FT                   /note="TIGRFAM: PAS sensor protein; PFAM: ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: dol:Dole_0426 signal transduction histidine
FT                   kinase, nitrogen specific, NtrB; IMG reference
FT                   gene:2503006036; PFAM: Histidine kinase-, DNA gyrase B-,
FT                   and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; PAS fold; TIGRFAM: PAS domain S-box;
FT                   InterPro:ATPase-like, ATP-binding domain; InterPro:PAS;
FT                   InterPro:PAS fold; InterPro:Signal transduction histidine
FT                   kinase, core; InterPro:Signal transduction histidine
FT                   kinase, homodimeric; InterPro:Signal transduction histidine
FT                   kinase, subgroup 1, dimerisation/phosphoacceptor domain;
FT                   InterPro:Signal transduction histidine kinase-related
FT                   protein, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02048"
FT                   /db_xref="GOA:B8F916"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8F916"
FT                   /protein_id="ACL02048.1"
FT                   /translation="MLFRKKSRDMDEWAPMPPLVVASASLILLAAVVAMTVRDINRQRH
FT                   HMSYILSEKGAAIIRAVEAGARTGLMGMRWGGNQVQTLLEEAAGHPDILYIGIVDKDGK
FT                   ILAHSNSSKIGQTVPNRFSRDALKTTTSGLWRIVGVEKKVKAFEVYRAFCPLAGQGKIR
FT                   GRGMTMHVDPNTGQARMDWCFSSKGDSSDQIIFVGLNMAPFENERSVDMRNTLLMAGLI
FT                   CLMGLGGFLALYWAQSYQVARRMLQDTSAFAKEVVTSLPVGLIAMDAAGRVAFFNHSAE
FT                   IITGLSRMKTLGRDAKKIFSEHMEGLVYLLEPGISVTEQEIECEIKGKGVFPLSVSSSD
FT                   ILGEQGHYVSRIVILRDLREVRDLQEQVRRQEKLSAIGELAAGVAHEIRNPLSSIKGLA
FT                   TYFSQKFDKGSDDEEIAQGMAREVDRLNRVVSQLLDFARPSDLNLRPMDINELIPHSLK
FT                   LVKQDALTRNINIISQPGGKPAFAMADADRLTQCLLNLYLNAMAAMNKGGVLTVRTAVE
FT                   DSGDVRVEVEDTGKGIPSQDLNRIFDPYYTTKASGTGLGLAIVHKILEGHHARIKVESR
FT                   PGQGTLVSMFIPGAKNAQDPKAQSGRE"
FT   sig_peptide     449606..449695
FT                   /locus_tag="Dalk_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006036_SP"
FT   gene            451428..452804
FT                   /locus_tag="Dalk_0340"
FT   CDS_pept        451428..452804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0340"
FT                   /product="Two-component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: dol:Dole_0427
FT                   two component, sigma54 specific, Fis family transcriptional
FT                   regulator; IMG reference gene:2503006037; PFAM: Response
FT                   regulator receiver domain; Bacterial regulatory protein,
FT                   Fis family; Sigma-54 interaction domain; InterPro:ATPase,
FT                   AAA+ type, core; InterPro:CheY-like superfamily;
FT                   InterPro:Helix-turn-helix, Fis; InterPro:Helix-turn-helix,
FT                   Fis-type; InterPro:Homeodomain-like; InterPro:RNA
FT                   polymerase sigma factor 54, interaction; InterPro:Signal
FT                   transduction response regulator, receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02049"
FT                   /db_xref="GOA:B8F917"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8F917"
FT                   /protein_id="ACL02049.1"
FT                   /translation="MNLENNADILVVDDDEGHRKTLYTVIKSWGYNVKTAEDGSIAVDM
FT                   VREGPYDVILMDVRMAEMDGIQALKLIKEYNPSIPVLIMTAYSSVESAIEAMKTGAYDY
FT                   LTKPLDFEDLRLTIERAREYAGLREENKELKQALGFRAGLRDIIGKSSVMKELTDMVSM
FT                   IAPTEATVLITGESGTGKELVARSIHEGSQRKDGPLVVLNCAALTETLLESELFGHEKG
FT                   AFTGADKKRDGRFVQADQGTLFLDEIGEMPLTMQAKLLRAIQEKEVQRVGSDATVTVDV
FT                   RIIAATNRDLEQEVAEGKFREDLFYRLNVVTLRIPPLRERDGDIHLLAQYFLEKFAERN
FT                   RKHVKGITPQAMDMLLKHPWPGNVRELENAMERAVILLTGDFITEKELPLSICGPVCDD
FT                   EPMEQIEQEPILQSLEEVEKKAILATLKAVDGNKSEAARRLGITRKTLHSKLAKYDYTD
FT                   "
FT   gene            complement(452883..454523)
FT                   /locus_tag="Dalk_0341"
FT   CDS_pept        complement(452883..454523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0341"
FT                   /product="hypothetical protein Dalk_0341"
FT                   /note="KEGG: mmq:MmarC5_0829 hypothetical protein; IMG
FT                   reference gene:2503006038; InterPro:Peptidase S8/S53,
FT                   subtilisin, active site; InterPro:Terpenoid cylases/protein
FT                   prenyltransferase alpha-alpha toroid"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02050"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="UniProtKB/TrEMBL:B8F918"
FT                   /protein_id="ACL02050.1"
FT                   /translation="MKKRLAMYGIVFLACFFLSSPAGFGAVISSTELIEGGQAYLLSQQ
FT                   AGDGSWTDDYQGEPTTSTALALAALIDTGVSKDHEAIKKGVDYLLTRFNGEYFDASSSS
FT                   HFTYCNGAVVMALSMYAADNPVTRTVVMSATQSLLNTQYINPSSNGHGGWYYYNYPSSN
FT                   GDLSNTQFAAMGLYYAEQYLGAIQDAAEESWKDALYTYLTKDYNSTTGASGYRPGSTSY
FT                   IPAMTGASLWCMSLIGHETDPIAVGSVVSGSETPGNVGWFENNYDWEDPYGAPQYYYLY
FT                   AWAKALTAAIGTENKVGEHDWVDDMVTVLASLAIPVARKDETPIYYWDSNDSLDGGNII
FT                   ATSWAMMSMAFADINVESPEKRVSDVPEAEGEIDYPIRGLLTLKTEGGVTITGAKRRLA
FT                   DLFRWRGKSTLKLPVGAVEFVLHHVPVGGQAKLTIKLPRDAVRNDVADSFVDENGDPKP
FT                   YLNWFKIQNGEWKGVTPIEVDPVAETITVWLTDGGPEDADGVANGEIVDPGAPGITDGP
FT                   LVEEAAAEAAEVEFGTESSDSICFVKALK"
FT   sig_peptide     complement(454449..454523)
FT                   /locus_tag="Dalk_0341"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006038_SP"
FT   gene            complement(454808..456850)
FT                   /locus_tag="Dalk_0342"
FT   CDS_pept        complement(454808..456850)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0342"
FT                   /product="TonB-dependent receptor"
FT                   /note="PFAM: TonB-dependent receptor; TonB-dependent
FT                   receptor plug; KEGG: rru:Rru_A1458 TonB-dependent receptor;
FT                   IMG reference gene:2503006039; PFAM: TonB dependent
FT                   receptor; TonB-dependent Receptor Plug Domain;
FT                   InterPro:TonB-dependent receptor, beta-barrel;
FT                   InterPro:TonB-dependent receptor, plug"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02051"
FT                   /db_xref="GOA:B8F919"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B8F919"
FT                   /protein_id="ACL02051.1"
FT                   /translation="MMRTLLCMLVLALIMSSAPAAFCQDVELEPVVATAEKWEENPQKT
FT                   PISMTYLSEGQIEDGGVRDAREMSRFIPNAYMGATGTENVLTIRGISSFDTALFSPAGF
FT                   FVDGVSMPLHYMYNMDLLDVERVETLRGPQGTLYGRNNESGLIHVITQKPSDQLRAKVY
FT                   GEYGSFNSYRVGGNVSGPIVKEKFQAGLALQQRNSDGFMENLYNNDDETAKKDSFTGRI
FT                   ALRAQPAPAWDINLNADLMETDDGLGVYRYMTGPNATDFNKINQDADLYSEQSGNGQTL
FT                   SIDFKNEYVHVTSLTGLRDYEHDFATDNDFSPMPFASADFSYQDDSFSQELRLASPDRH
FT                   GPLKWLAGAYFFSEDTEVDYNRAANWHLVTNMETTGAAGFGQAVWSITDFLRLTGGIRF
FT                   DSQDMDGAMHDLSKKTTFSESMDHEEWLPKISFSCDVAESAMIYASAVKGFLAGGYNYG
FT                   MSRTASSFTYGPEYTWNYEAGLKATMFNGKCDFSLAGFYIDIDDKQVFDVDPAIFATEI
FT                   RNAASAHSSGFEAEARVRPIHGLDIFGNIGWAESRFDDWTATEFNSTYTGLIKYDYEDK
FT                   KLPNAPKYTGLLGAMYRHNSGLFLRGDVMFTGEFYADAKNTARQGAYELVNLRTGYEAD
FT                   HFDVVLWCENLFDQEYEKIKYAWGVNELAIDGAPRTVGVLIRLRV"
FT   sig_peptide     complement(456788..456850)
FT                   /locus_tag="Dalk_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006039_SP"
FT   gene            456971..457693
FT                   /locus_tag="Dalk_0343"
FT   CDS_pept        456971..457693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0343"
FT                   /product="hypothetical protein Dalk_0343"
FT                   /note="KEGG: gbm:Gbem_1821 hypothetical protein; IMG
FT                   reference gene:2503006040"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02052"
FT                   /db_xref="UniProtKB/TrEMBL:B8F920"
FT                   /protein_id="ACL02052.1"
FT                   /translation="MQLSSKKWRRVGLFFSVLLALLLIHGIGLSSSDTGADPGPEKTAE
FT                   NFIQMGPLTINKRSKQATIKVRTAIDQGVLEYLMVDDHGKAYESAFKVDNLLPSKLNFT
FT                   LLLLGIEPLDYNKLLELARNESGREALLAQHKNSLVRISLARGEKILRLDEFIHDREKD
FT                   KGELLWVFTGSRFTKDGRFVGDISLSHIAMWPDDSAVVNLFSDRGNPYRGELGFVMNPK
FT                   NKELKKDQEFELVFEAYK"
FT   sig_peptide     456971..457066
FT                   /locus_tag="Dalk_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006040_SP"
FT   gene            457740..458921
FT                   /locus_tag="Dalk_0344"
FT   CDS_pept        457740..458921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0344"
FT                   /product="cycloartenol synthase-like protein"
FT                   /note="KEGG: amu:Amuc_0525 cycloartenol synthase-like
FT                   protein; IMG reference gene:2503006041; InterPro:Terpenoid
FT                   cylases/protein prenyltransferase alpha-alpha toroid"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02053"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B8F921"
FT                   /protein_id="ACL02053.1"
FT                   /translation="MKSKCLVMGLIIFFVFGVGLGLCSGQSVKMPSGGISPVSVSLEKS
FT                   AAHSLQTATEFLVGSQEEDGSWSKDPAITALVVYSLLLSPGYDPDGRTETSIAKGLDYI
FT                   TQFVQPDGGIYRKEYRNYVTAVCLMALTRTQDKKYAKAITGAKDFLIQFQLDEGEGIQQ
FT                   SNPYYGGIGYGGDTRPDMSNTQLALEAIRAAEGFEKQFSGVLLAQAGNIESDEQELGLH
FT                   WKKALMFVNRCQNLQSVNDMPYAGKDGGFIYETGTYKQDRSHSYGSMTYAGVKSLLYAN
FT                   VDKNDERVQKAVEWIKNNYTLDFNPGFGTYSIFYYYMTFSKCMAALGEETLTDALGQEH
FT                   HWREDLVSKLVSIQKPEGYWQNPSNRYWENVKPLATAYSVIAMKFALESDQGF"
FT   sig_peptide     457740..457826
FT                   /locus_tag="Dalk_0344"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006041_SP"
FT   gene            459721..460098
FT                   /locus_tag="Dalk_0345"
FT   CDS_pept        459721..460098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0345"
FT                   /product="hypothetical protein Dalk_0345"
FT                   /note="IMG reference gene:2503006042"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02054"
FT                   /db_xref="UniProtKB/TrEMBL:B8F922"
FT                   /protein_id="ACL02054.1"
FT                   /translation="MLINFYNPHRSPLLGLYQVAFKHVIIFQGESRNDAGSRLAVDPEK
FT                   RIALAGMTAFCAWRKSGGRLSPFRQDKGASKTFWLLKPPLSVIPVEGGAGMIAFLNHPG
FT                   ALPETGTQCPVERRLDMDKKS"
FT   gene            complement(460139..460357)
FT                   /locus_tag="Dalk_0346"
FT   CDS_pept        complement(460139..460357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0346"
FT                   /product="hypothetical protein Dalk_0346"
FT                   /note="IMG reference gene:2503006043"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02055"
FT                   /db_xref="GOA:B8F923"
FT                   /db_xref="UniProtKB/TrEMBL:B8F923"
FT                   /protein_id="ACL02055.1"
FT                   /translation="MEASKTKLGVKILCIILIMPTFVFLNVALFDAVHQILVNDNVLMH
FT                   RGYFAIMTLVWGVHSLGIANLFAKGKG"
FT   gene            complement(460641..461711)
FT                   /locus_tag="Dalk_0347"
FT   CDS_pept        complement(460641..461711)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0347"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: ter:Tery_0529
FT                   tetratricopeptide TPR_2; IMG reference gene:2503006044;
FT                   InterPro:Tetratricopeptide repeat;
FT                   InterPro:Tetratricopeptide repeat-containing;
FT                   InterPro:Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02056"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8F924"
FT                   /protein_id="ACL02056.1"
FT                   /translation="MKPDIDIRTMEEAVKSGAADLDSLFALGDLYFAQGRHYDLLDLCN
FT                   RMALMPLTQLDLATVLSYKGVTHVCLSHWEAATDAFLQSLDALEDVPENLEEVVSLKGM
FT                   NYYDLSLYCQDLDKADDYGELALKYLTILAHHYPDYPHMPKVYAHIADLHHSMGELDEA
FT                   MVYYGLFYEASHETEDKVWAMTGMATVYGFLGKIDKALDMYNEALAIADTKALKAKVFY
FT                   DMGEMHYRLENYKEAKSALETAMQYRGQDPALRQNQEFEVSILWRLGAIAFDQEEDDEM
FT                   VPLLERVLDLVDPAHTYYADANLRLGHYYLQQCRYSTASGYYNQVLLSPAASAEETLIA
FT                   KDSLAGIPLKKPAMLH"
FT   gene            461912..463108
FT                   /locus_tag="Dalk_0348"
FT   CDS_pept        461912..463108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0348"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   dol:Dole_1431 permease YjgP/YjgQ family protein; IMG
FT                   reference gene:2503006045; PFAM: Predicted permease
FT                   YjgP/YjgQ family; InterPro:Permease YjgP/YjgQ, predicted"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02057"
FT                   /db_xref="GOA:B8F925"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030922"
FT                   /db_xref="UniProtKB/TrEMBL:B8F925"
FT                   /protein_id="ACL02057.1"
FT                   /translation="MRKKHIVFKYMLGEMLPPFGVTLLVFALIFLMTRMLQLTDYVVNF
FT                   RVGLGHVMMLLMYSMPFFLIFVIPMSTMMAVLLTFLRMSSDNEITALKAAGWSLYSLLP
FT                   PVLAFCTAAALLTASMSFIGLPWGRMAAKELLIDVARQNVEIGLKERSFERTFKNVVLY
FT                   VGSVDVESRTLHHVFIEDRRDKQLSSTIMASTGRIIPSDGDDIWQLRLNDGVIVRADRK
FT                   KSSMFTVNFDSYDFNLNLGTALGARDGEKDEEEMYFKELLTFVKRYNKKDDRYYLALLE
FT                   VHKKFSIPFSCIVLGLAAVPLGIVSRSARRSFGVALGLGLFLLYYLLLSAGWVFGEAGK
FT                   YPPMIGMWVPNLVIGAMGGFSLVRMAKDRPVALFAWFQNKARILSGKWGGGKEAAAKS"
FT   gene            463105..464166
FT                   /locus_tag="Dalk_0349"
FT   CDS_pept        463105..464166
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0349"
FT                   /product="permease YjgP/YjgQ family protein"
FT                   /note="PFAM: permease YjgP/YjgQ family protein; KEGG:
FT                   dol:Dole_1432 permease YjgP/YjgQ family protein; IMG
FT                   reference gene:2503006046; PFAM: Predicted permease
FT                   YjgP/YjgQ family; InterPro:Permease YjgP/YjgQ, predicted"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02058"
FT                   /db_xref="GOA:B8F926"
FT                   /db_xref="InterPro:IPR005495"
FT                   /db_xref="InterPro:IPR030923"
FT                   /db_xref="UniProtKB/TrEMBL:B8F926"
FT                   /protein_id="ACL02058.1"
FT                   /translation="MKIISKYIARALFKNLLTILFAVVVIYVAVDFFEKIDDFMAAKIP
FT                   LLTVGYFFLLRIPYVAAQVLPVGVLLSAMVVIGLMARHNEIIAYASGGGSSFSLLKPIA
FT                   VMGVIASLFLFAFNEIIVPAAAAEANQIWYQDVRKEGDVGTRTTWFHRNGLIGRVDKYI
FT                   PETHTARDITLNYYDPSFKLIKRIDADDATISGTVWTLRNAMESVSGRASDIRQHKELK
FT                   VEMDFTADQLHDRVKRSDEMSLVQLKEHIHKIESEGYKAVRFRVDLASKISFPLVCLIM
FT                   SVLGGAMALRGKRGEGLAVNIVMGMGLAFAYWVVHSLCLSLGYAGMYSPIFSAWTANAV
FT                   FAVLAAVFIYELA"
FT   gene            464183..465436
FT                   /locus_tag="Dalk_0350"
FT   CDS_pept        464183..465436
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0350"
FT                   /product="Three-deoxy-D-manno-octulosonic-acid transferase
FT                   domain protein"
FT                   /note="PFAM: Three-deoxy-D-manno-octulosonic-acid
FT                   transferase domain protein; KEGG: dol:Dole_1433
FT                   tetraacyldisaccharide 4'-kinase; IMG reference
FT                   gene:2503006047; PFAM: 3-Deoxy-D-manno-octulosonic-acid
FT                   transferase (kdotransferase);
FT                   InterPro:Three-deoxy-D-manno-octulosonic-acid transferase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02059"
FT                   /db_xref="GOA:B8F927"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:B8F927"
FT                   /protein_id="ACL02059.1"
FT                   /translation="MVKAVYNLALCLGAILFLPIGLMLAALKEKRRATMGPRLGFQAYP
FT                   KCRKPIWVHGLSVGEINAAVPLVLALARAYPEKDIIVSASTKTGYENARAQLQGSVAGV
FT                   VYYPYDLPWCVSKALDQVDPCMFILVESDLWPNFIFQCKQRGVPLILANGRLSDSSYKG
FT                   YRNLGFLMKPVFRCFDKVGAQSKEEGERFLEVGVRPETMAVAGNLKFDRPSAPDLSPLE
FT                   MLPDFSGPVMVAGSTHPGEEEILSGLLKAWKKEHGLAMIIAPRDPKRAGEVRDIFSRKG
FT                   LDAALYSQQPEKADAVVVDQMGVLAALYSRGDICFVGGSLLPFGGHNPLEPAVFGKPVL
FT                   FGPDMGDFPDMTVRLLNQGGAIQVKDSQELAQTVDALLNDPARGVKIGANALEVIRRNR
FT                   GALQRNLDLVREFIEEHE"
FT   sig_peptide     464183..464254
FT                   /locus_tag="Dalk_0350"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006047_SP"
FT   gene            465429..466535
FT                   /locus_tag="Dalk_0351"
FT   CDS_pept        465429..466535
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0351"
FT                   /product="tetraacyldisaccharide 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="KEGG: dol:Dole_1433 tetraacyldisaccharide 4'-kinase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase; PFAM:
FT                   Tetraacyldisaccharide-1-P 4'-kinase; IMG reference
FT                   gene:2503006048; PFAM: Tetraacyldisaccharide-1-P 4'-kinase;
FT                   TIGRFAM: tetraacyldisaccharide 4'-kinase;
FT                   InterPro:Tetraacyldisaccharide 4'-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02060"
FT                   /db_xref="GOA:B8F928"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8F928"
FT                   /protein_id="ACL02060.1"
FT                   /translation="MSSLRRRIETVMRSGPDENMGLTGAVLRLVSLVYGLVMRLRYKLY
FT                   QKGFFKTGKAPCMVVSVGNITVGGTGKTPMAIYLARLFNDWGLNVAIASRGYGGTMQKQ
FT                   GGAASDGKDILLTPAEAGDEPWLMAVKLPGVPVVVGGDRVKSANLCASQFGTRILILDD
FT                   AFSRLAIDRDLNLLLVDSQAPFGNGHVFPRGLLREPAEFASRADAVIRTRADRGAGQAA
FT                   LPQGKPVFSCTHKPKGFLEYFPQKGTSGPKIVRHSLDDLKGKKVAAFAGIADNQGFFDG
FT                   LSSLGVAVLDRLSFPDHHAYTLRDRNIIVETAIKADVKALITTEKDLVRLTGWDAHGLD
FT                   LYALEIALEFEQAQKFEDFLKSKLQIGE"
FT   gene            466535..467914
FT                   /locus_tag="Dalk_0352"
FT   CDS_pept        466535..467914
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0352"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: iho:Igni_1108 geranylgeranyl
FT                   reductase; IMG reference gene:2503006049; PFAM: Pyridine
FT                   nucleotide-disulphide oxidoreductase;
FT                   InterPro:FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02061"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR039649"
FT                   /db_xref="UniProtKB/TrEMBL:B8F929"
FT                   /protein_id="ACL02061.1"
FT                   /translation="MNPDTVVIGAGTGGLIAALKMAQEGLGVLVLEKNPEDCHGNTWLN
FT                   DLDLHPFDKYDLPKPLPEELAFPVHRNMRANSSNGDATIVMENIPNYALKVSLYQKRLV
FT                   RLCREAGVEFQFGATIIDFLNNGKAVTGVIVETDGAFKEISAKVTVAACGAFSPILEKI
FT                   PAFCDFNFVCRPDDRVHAIQELWKIKPGPARKMVDEGILTPNEMVFYVGVPGGGSFSTF
FT                   MYQLDLDQEIMALLAGCKSQNPDVLSPRELIDDFKDNRLGFCTERIYGGGRAIPMRNPL
FT                   DNLVDNGIAIVGDAAFMASPANGSGTTPSMVAGAQCGWTIAKALNAGLEPTKEHLWGYN
FT                   AAFQTGLGAIFAGYYVAHRVLTTFTEQEVQELVRRKLIDPRQFKNVHDARPFSVAPLQG
FT                   LGLFMKALPVLGTLIGFVKHGAKIPIITRHYKNFPKTYDPEAFEEWRRRAEKILSRLDV
FT                   S"
FT   gene            468000..468518
FT                   /locus_tag="Dalk_0353"
FT   CDS_pept        468000..468518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0353"
FT                   /product="hypothetical protein Dalk_0353"
FT                   /note="IMG reference gene:2503006050"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02062"
FT                   /db_xref="UniProtKB/TrEMBL:B8F930"
FT                   /protein_id="ACL02062.1"
FT                   /translation="MRTSRRLFQIVLFVSLFVASQALAGQPALPFKINKSLSMANMPLS
FT                   LEILSFTAKDQDGQWYWYLTFQNTDPNRSLTRGRMEIRVYQIGLPAHTQYQTSAIPFES
FT                   NLGSGRSHSVSIRFNKRRDATSLRLVLFDLENNREVVTQKIPLEDNMGVSLQQTLPQAV
FT                   QRGAVRDNP"
FT   sig_peptide     468000..468071
FT                   /locus_tag="Dalk_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006050_SP"
FT   gene            468496..468684
FT                   /locus_tag="Dalk_0354"
FT   CDS_pept        468496..468684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0354"
FT                   /product="hypothetical protein Dalk_0354"
FT                   /note="IMG reference gene:2503006051"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02063"
FT                   /db_xref="UniProtKB/TrEMBL:B8F931"
FT                   /protein_id="ACL02063.1"
FT                   /translation="MRCEIIHKIDDYLNQATINEFINLNWQVETELVMDGDEKCVIEGV
FT                   LDRDVASLLPYYRKERD"
FT   gene            468775..469737
FT                   /locus_tag="Dalk_0355"
FT   CDS_pept        468775..469737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0355"
FT                   /product="protein of unknown function DUF1022"
FT                   /note="PFAM: protein of unknown function DUF1022; KEGG:
FT                   sat:SYN_00129 nucleoside-diphosphate-sugar epimerase; IMG
FT                   reference gene:2503006052; PFAM: Protein of unknown
FT                   function (DUF1022); InterPro:Protein of unknown function
FT                   DUF1022"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02064"
FT                   /db_xref="InterPro:IPR009367"
FT                   /db_xref="UniProtKB/TrEMBL:B8F932"
FT                   /protein_id="ACL02064.1"
FT                   /translation="MHKLRITAFLDDRPGHLKQTRGILEALDTIADIMVTEVNVPIPGI
FT                   PSQAGQWASWFAGRSRIPDECRSSVYPPDLIIGTGTHTHLPMLQYKRACQAPAATCMTP
FT                   SSLLVKHFDLCFVPAHDNPSDKPNLFETLGPPNTARDLGGHEPDKGLLAIGGVDEKNHV
FT                   WNSDDVLAKATEIIKAYPDIHWTVTSSFRTPEDMLAKLLQMQDVMPNCTFFNARDTGPG
FT                   WIEEQYNQADMCWVTADSVSMTYEALSAGCKVGVIPVTWKNPSGKIARGLDRLYKEKWV
FT                   LCFDDFFHDKQTWEKRQALDEAGRAAREILKRWRPDLLL"
FT   gene            469713..470861
FT                   /locus_tag="Dalk_0356"
FT   CDS_pept        469713..470861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0356"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sat:SYN_00130 glycosyltransferase; IMG reference
FT                   gene:2503006053; PFAM: Glycosyl transferases group 1;
FT                   InterPro:Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02065"
FT                   /db_xref="GOA:B8F933"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8F933"
FT                   /protein_id="ACL02065.1"
FT                   /translation="MASGSLTIVQMLPELEAGGVERGTLETGAYLVSQGHRSIVISGGG
FT                   RLVPQLVEAGTEHVEMRVGDKNPSLLKYLAPVRSLLLKEKVDVLHLRSRVPAWVGYLAA
FT                   KSIPKARRPAVITTFHGFYSVHFFSGIMARGERVIAISNFIADHIKENYGTDPSKIRVI
FT                   HRGFDPDYFNPEAVSRDRADALKKSWGLDKTNAPVILLPARITGWKGHKLFIEALSLVK
FT                   DQDFVAVCVGDVEDNPVYSQTLFDEVKERGLEGKVLFPGHCSDMPAALMNADIAVSASL
FT                   EPEAFGRVAVEAQAMGLPVIATAHGGSLETVLPGETGWLVSHESPEQMAQAVKDALANS
FT                   ELRREMGARAKSWVWDNFTATKMCSRTLEVYRELLEEKGRGL"
FT   gene            470858..471886
FT                   /locus_tag="Dalk_0357"
FT   CDS_pept        470858..471886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0357"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   noc:Noc_0576 glycosyl transferase family protein; IMG
FT                   reference gene:2503006054; PFAM: Glycosyltransferase family
FT                   9 (heptosyltransferase); InterPro:Glycosyl transferase,
FT                   family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02066"
FT                   /db_xref="GOA:B8F934"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B8F934"
FT                   /protein_id="ACL02066.1"
FT                   /translation="MSRILVIKMTALGDVVAALPHMEQICRTYAGGEIWLLTSPEAKTL
FT                   FRHHPFFRVRTINRDSFFGKEGVLPTIQWVRSMGFDRIFDLQGNKVSYRICKWSKSPER
FT                   IGTQPNPAYTKSAPGKWVRTIKQNVSQRLNKTLEAGGVRPATQPGPLYTSAEDIQAAER
FT                   FMSLHELEEKRFAVVHAGSSPEWLSKRWPRENFAQLVEMFELFGIPCVVTGSHVEQDLN
FT                   RYITENAGVNATGVLSLRQLYILAREALFAVSNDSAPMHLFSQAGIPVFAFFGPTNYRW
FT                   SHGFGQIANVIKSDLECSQCFKPQCPPGKKHACMRSLTPELVLGKIIERLGESGKIVKN
FT                   GE"
FT   gene            471902..472966
FT                   /locus_tag="Dalk_0358"
FT   CDS_pept        471902..472966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0358"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   sat:SYN_00131 glycosyltransferase; IMG reference
FT                   gene:2503006055; PFAM: Glycosyl transferases group 1;
FT                   InterPro:Glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02067"
FT                   /db_xref="GOA:B8F935"
FT                   /db_xref="UniProtKB/TrEMBL:B8F935"
FT                   /protein_id="ACL02067.1"
FT                   /translation="MPTVLWWGRGDKNYSRNRTIARLFGELGWGCEYFYPAVGSELGLI
FT                   QAYFAKLKKPDLIWLPCFRQRDMASAIHFGKKWNVPVVSDPLTSSYQKQVYERGKFSAD
FT                   SRRAQRLLKWEAGLFKQADLIVLENSAYADFVRDEMDVPEDKLGVLYNGAYTKFFTPQP
FT                   PPEPGPPFEVGFVGSFQPSMGTDVIVKAARLCQDLPVKWTLIGEGDDKPEAEQLAKGLN
FT                   NIEFTGWVKYETLPERMGNMHILLGIFGVTRKTDFVIPNKIFEAMAVARPLITQQAAAY
FT                   ADNLGQSPVVGWVERGNEQALADKVREWIAEPQDLPERGLKTRELFDRYFGDDKMRDML
FT                   RIILDRVLPGGTKK"
FT   gene            472975..474201
FT                   /locus_tag="Dalk_0359"
FT   CDS_pept        472975..474201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0359"
FT                   /product="O-antigen polymerase"
FT                   /note="PFAM: O-antigen polymerase; KEGG: sat:SYN_00132
FT                   O-antigen polymerase; IMG reference gene:2503006056; PFAM:
FT                   O-Antigen ligase; InterPro:O-antigen ligase-related"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02068"
FT                   /db_xref="GOA:B8FGY0"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY0"
FT                   /protein_id="ACL02068.1"
FT                   /translation="MDALREKFENGCDFVCLWAGALVPVGIVIGNVGFEAFVALAGAAW
FT                   ILRSIVARDKTMERVADNPLTAPWMFWFGAILISLMVNGAGSKGIMHDIAFVRFFLFGL
FT                   AMLDVSNRRPVGPYLIAGLAAGVLFAAFNTILAYTIGVDMFARSLERYTGKLKEAARYS
FT                   GLCAYACVFFAGWALGDKNILQNKKRAAILLLIAAIAFGQIVQTQVRTVVLAVLAGCVF
FT                   IVFYGQGRKFGFKKVGLIAAGIFSLLGVAFYLGEWWNMESMYDRWVIWQVAVEIWKEHP
FT                   VVGAGVGSFQDAFARISASGLVPPWEAPDGRVYFNVEQTHAHNLFLMIGACTGILGLAA
FT                   FSWLMVRACRLIYANPKGWRNGLPAWPIVLLVIGLTGFNIYHSWYHALFAFFLVLSGAK
FT                   ECPNNKNAS"
FT   gene            474237..475187
FT                   /locus_tag="Dalk_0360"
FT   CDS_pept        474237..475187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0360"
FT                   /product="lipid A biosynthesis acyltransferase"
FT                   /note="PFAM: lipid A biosynthesis acyltransferase; KEGG:
FT                   sfu:Sfum_0376 lipid A biosynthesis acyltransferase; IMG
FT                   reference gene:2503006057; PFAM: Bacterial lipid A
FT                   biosynthesis acyltransferase; InterPro:Bacterial lipid A
FT                   biosynthesis acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02069"
FT                   /db_xref="GOA:B8FGY1"
FT                   /db_xref="InterPro:IPR004960"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY1"
FT                   /protein_id="ACL02069.1"
FT                   /translation="MKEREFHPAIDNLIYTLIKIIVRFLALMPRPWIKPVSRALGRLWF
FT                   KLDKRHRDIAMDNLTQAYGKEKSTEEIRQIGQDTFVHLASVMLELPHLFKLDSTNLKSF
FT                   VRFSGLNHVYKALRQDKSLVFLTAHYGNWELMAISAAQRVGIPIHVMVRPLDLAPADRV
FT                   LTEMRSHTGNVVLDKDKSANAVAGLLKNKQAVGILLDQNASWYEGVYVPFYDRISCTNK
FT                   GLAIFAIRHGATVIPAFSRKQPDGLYEVEFLPALTLIRTGNIGKDVEANTAMFNKVMED
FT                   AIRKDPTQWLWVHRRWRIKDIPERARKKMGGLPEL"
FT   gene            complement(475266..475886)
FT                   /locus_tag="Dalk_0361"
FT   CDS_pept        complement(475266..475886)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cch:Cag_0427 hypothetical protein; IMG
FT                   reference gene:2503006058"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02070"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY2"
FT                   /protein_id="ACL02070.1"
FT                   /translation="MENSEFNKNVFINCPFDNDFRLLLIGIIFTVVYFEFKPRLALESA
FT                   DSGETRISKILKLINDSKFGIHDLSRILSSQENEYFRMNMPFELGIDYGCKRLKEGIWS
FT                   GKKILILEKERYRFQKSISDLSGSDIKSHNDEVSKVVFAVRDWFITEELKRGDSGKRVW
FT                   DEYNDFQAYLYDQVVEKDGHTTIDEVQIIEIIHYINEWFGVSH"
FT   gene            complement(475911..476129)
FT                   /locus_tag="Dalk_0362"
FT   CDS_pept        complement(475911..476129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sag:SAG0550 hypothetical protein; IMG
FT                   reference gene:2503006059; PFAM: Uncharacterized protein
FT                   conserved in bacteria (DUF2188); InterPro:Protein of
FT                   unknown function DUF2188"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02071"
FT                   /db_xref="InterPro:IPR018691"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY3"
FT                   /protein_id="ACL02071.1"
FT                   /translation="MNSKSQHIVKNPSGGWAVKRSGSSRVTKVYLNKKEAIERGRAIAK
FT                   NQKSELYIHGVDGKVLEKDSYIMDAEK"
FT   gene            complement(476267..477220)
FT                   /locus_tag="Dalk_0363"
FT   CDS_pept        complement(476267..477220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0363"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   nis:NIS_1446 lipopolysaccharide heptosyltransferase; IMG
FT                   reference gene:2503006060; PFAM: Glycosyltransferase family
FT                   9 (heptosyltransferase); InterPro:Glycosyl transferase,
FT                   family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02072"
FT                   /db_xref="GOA:B8FGY4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY4"
FT                   /protein_id="ACL02072.1"
FT                   /translation="MAPHYFIIRWSGMGDIVMSLPALAFLKEKQPDCRITYLTDVPFLA
FT                   IPLMSGLVDHVAPLDRRGFAKPGRISGALGGAVSIISQLRKDKPDIAFDLQGFGETAVL
FT                   AWLSGAPIRVGRIKKSGPRKWIYTQNIDADWGTDHRSAFFVKAAAQGLGLPAPIHFDGP
FT                   RLEIPGLEQKKGLVCLNMGASTESRRWSEKNFIALGKSLSQKGYAIRLLIGPQETHILD
FT                   AAKGAAGEFGWELAMPESMEDLAKACGEASLMVSNDTGPGHLAAALGVSVITLYSTGDP
FT                   DNVGPQAPRTAWFRDREDINRIAPGGVELACLNFLE"
FT   sig_peptide     complement(477149..477220)
FT                   /locus_tag="Dalk_0363"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006060_SP"
FT   gene            477374..477559
FT                   /locus_tag="Dalk_0364"
FT   CDS_pept        477374..477559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0364"
FT                   /product="protein of unknown function DUF343"
FT                   /note="PFAM: protein of unknown function DUF343; KEGG:
FT                   sfu:Sfum_3635 protein of unknown function DUF343; IMG
FT                   reference gene:2503006061; PFAM: Trm112p-like protein;
FT                   InterPro:Uncharacterised protein family UPF0434/Trm112"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02073"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="InterPro:IPR038053"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY5"
FT                   /protein_id="ACL02073.1"
FT                   /translation="MPVKKDFLEILACPKCKGKLELNEQENGLICRPCKLVYEIRDEIP
FT                   IMLISEAKALEESVAP"
FT   gene            477556..478107
FT                   /locus_tag="Dalk_0365"
FT   CDS_pept        477556..478107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0365"
FT                   /product="GTP-binding protein"
FT                   /note="KEGG: dol:Dole_1913 GTP-binding protein; IMG
FT                   reference gene:2503006062"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02074"
FT                   /db_xref="InterPro:IPR025529"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY6"
FT                   /protein_id="ACL02074.1"
FT                   /translation="MSKPSLPSRAKLVIGIFTADKSLADPILKELTDRFGPVDMMSPWF
FT                   SFHHTGYYEPEMGGPLYRRMFAFAGLIAQDDLPEIKLATNKIEAAFAENDSRKVNIDPG
FT                   YLVMERFILATGKNFTHRVYLAWGIYADLTLIYTKGDFQSLPWTYPDYAEPEMHDFLKA
FT                   VRKKYSACLKDPLLCSAVQS"
FT   sig_peptide     477556..477627
FT                   /locus_tag="Dalk_0365"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006062_SP"
FT   gene            478457..480586
FT                   /locus_tag="Dalk_0366"
FT   CDS_pept        478457..480586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0366"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; ATP-grasp domain
FT                   protein; KEGG: rca:Rcas_0076 acetyl coenzyme A synthetase
FT                   subunit alpha; IMG reference gene:2503006063; PFAM: CoA
FT                   binding domain; ATP-grasp domain; InterPro:ATP-grasp fold;
FT                   InterPro:ATP-grasp fold, subdomain 1; InterPro:ATP-grasp
FT                   fold, succinyl-CoA synthetase-type; InterPro:CoA-binding;
FT                   InterPro:NAD(P)-binding domain; InterPro:Succinyl-CoA
FT                   synthetase, beta subunit; InterPro:Succinyl-CoA
FT                   synthetase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02075"
FT                   /db_xref="GOA:B8FGY7"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY7"
FT                   /protein_id="ACL02075.1"
FT                   /translation="MNTSRNPLHTIMAPKSVAIVGASANPMKMGSMQFLNILHCGFPGT
FT                   AIPVHPKHEEIFGVKAYPSISSLPDTPELAVLVVPTGLVINMLDEFGKLGTKHAIIISA
FT                   GFREMGADGKILEKQLLETADKHGIRFLGPNCMGVFNSQYPFNATVTPFQDKPGFLSIA
FT                   SQSGTYLAQTLTYLKYRGVRLNQAMSVGNEANINIVDCLEYLGEDPKTKAIGLYIEALS
FT                   DPGRFLEVAREVSRVKPIVAQYVGGSKAGAKSGLSHTGSIAGPDFLYNGLFEQAGVIRV
FT                   HSIEDVYKVGHVLATQPGIKGNRVAVLTHSGGPGSGMCDTADRQGLVVEELPDDVQDKI
FT                   RAVIPPTASPKNPVDLTFIVDSKPLSQIIPQILLECDEVDGLLIHGIMDTGWAKVTAGT
FT                   LGKALGVSEEDMVKLTKSDLTSFLQLKEKYGKPVLVGSFMGDEDNARNVMMDNFIPVFS
FT                   SPEKAAFSMGCLYKHHLIKTRPYSKAEKPQGLGKNTASILAQAKGPLDEFQAKRILADY
FT                   GIPVSPESLASSRDDAVQAAESLGYPVVIKACSPDILHKTEKGLVKLNLGNPQEAAEAY
FT                   DAIQEGAPGVPVIVGKMLPVQREFMAGITRFEGYPPCVLFGMGGVLAEALKDFSLRLAP
FT                   MTQAEALAMIDSLKSSVLLDDFRNMGAVDREALASMLVNLGYLAMDFPEIKEIDLNPIL
FT                   IMDGKPVAADALIVL"
FT   gene            complement(480640..481035)
FT                   /locus_tag="Dalk_0367"
FT   CDS_pept        complement(480640..481035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0367"
FT                   /product="hypothetical protein Dalk_0367"
FT                   /note="KEGG: nmu:Nmul_A2707 kinesin light chain; IMG
FT                   reference gene:2503006064; PFAM: Tetratricopeptide repeat;
FT                   InterPro:Tetratricopeptide repeat;
FT                   InterPro:Tetratricopeptide TPR-1;
FT                   InterPro:Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02076"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY8"
FT                   /protein_id="ACL02076.1"
FT                   /translation="MFKKFKEKFGAPKADKSMVWKESNQELVDLIKNRKAEEALDVGQK
FT                   LVDFVDRKFPKDAPEKATTYNNVGMALLLNSDFSLAEECFREALAMRIRIFGEEHREVA
FT                   VVYMNLAQMYKVRAQQILSKFHEKTTA"
FT   gene            complement(481098..481640)
FT                   /locus_tag="Dalk_0368"
FT   CDS_pept        complement(481098..481640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0368"
FT                   /product="hypothetical protein Dalk_0368"
FT                   /note="KEGG: GM22915 gene product from transcript
FT                   GM22915-RA; IMG reference gene:2503006065"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02077"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGY9"
FT                   /protein_id="ACL02077.1"
FT                   /translation="MTENGKPLENPPDPDSKSSSEIAEGPVQSPLNMVTPVTVHQNWEE
FT                   AYRIDQEQDPKHIDFKEYADGRVVISKESMEVIQRKLNAAAKLKKRHLKVLKVHEQLLA
FT                   EHEGLLHAQEQAPAAPTSETANLPVPVSAPAAMEKAIVRMDKILLAMARCKWYEFQRRK
FT                   DLLIAMKKTLNYMKRRI"
FT   gene            complement(481679..482173)
FT                   /locus_tag="Dalk_0369"
FT   CDS_pept        complement(481679..482173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0369"
FT                   /product="hypothetical protein Dalk_0369"
FT                   /note="KEGG: hypothetical protein; IMG reference
FT                   gene:2503006066"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02078"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ0"
FT                   /protein_id="ACL02078.1"
FT                   /translation="MTRHFPNATTAVLILLCLISGMGTAQAKSGKGSSVYLTDTFRKWQ
FT                   AGHQKVCDLMGQYKFEEALKESKPLLGYLAELKLTDGKEMFETCNNLGAIHLHLKDFQE
FT                   AHNLFWTAMKIGTQVYGSDSIQVGFVFKNLSMLYGERADLIFLKHRDELGGSQNQAPQK
FT                   K"
FT   sig_peptide     complement(482093..482173)
FT                   /locus_tag="Dalk_0369"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006066_SP"
FT   gene            complement(482170..482721)
FT                   /locus_tag="Dalk_0370"
FT   CDS_pept        complement(482170..482721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0370"
FT                   /product="hypothetical protein Dalk_0370"
FT                   /note="IMG reference gene:2503006067"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02079"
FT                   /db_xref="GOA:B8FGZ1"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ1"
FT                   /protein_id="ACL02079.1"
FT                   /translation="MFCAIEIRMRTTPPETIFSKKGSLVQIDCPRCQAPIDVNDLEENA
FT                   YCKNCGAALAIEMGGAGFALVSSGKEEEDVPIIPEEEQEPDPIHDRVLSDHTKWRVGAV
FT                   FTALFGLTVLGCAVYSAIREYSEKGMWGLTRGNEAVFLWVIIAISAFMLVGAGIVYLIS
FT                   RSETKKYLKTLEAKKMGAKS"
FT   gene            483471..485228
FT                   /locus_tag="Dalk_0371"
FT   CDS_pept        483471..485228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0371"
FT                   /product="Polypeptide-transport-associated domain protein
FT                   ShlB-type"
FT                   /note="PFAM: surface antigen variable number repeat
FT                   protein; Polypeptide-transport-associated domain protein
FT                   ShlB-type; KEGG: par:Psyc_1782 putative heme-hemopexin
FT                   utilization protein B; IMG reference gene:2503006068; PFAM:
FT                   Surface antigen; POTRA domain, ShlB-type;
FT                   InterPro:Bacterial surface antigen (D15);
FT                   InterPro:Polypeptide-transport-associated, ShlB-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02080"
FT                   /db_xref="InterPro:IPR005565"
FT                   /db_xref="InterPro:IPR013686"
FT                   /db_xref="InterPro:IPR034746"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ2"
FT                   /protein_id="ACL02080.1"
FT                   /translation="MRKTVKHTIILGQVILWLAMAAVTWAGQEPEESVVPDSGMPGAVE
FT                   RSLKEREIPAHSRLPEISVQDEQSAVFKGGEGVTFRLSKIRFEGQRVFADQDLQEVVAP
FT                   YVGQTMEVSALKEVTDEVTRFYKENGYFLSRAYVPPQCIKEGEVLIKVREGRLGEIIIR
FT                   GNKRYSRELLRNTLKVIRGEGAVRTADVERGLLLLTDIPGLNVKATFKPGERPGTSDIV
FT                   LDVTEDRMFSIGADFNNYGSEYVSGERYGVNAQARNLMGFGDLLSVRGVTGNEGLDGLF
FT                   YGRAEYSMALGSKGLRAGIHYEHLKYELGEELTILNFAGHVRQGGVFLSYPIIRSRYLN
FT                   WNVQGGLTGKNVKNEIDDQMTGKDKLRYGHLGTSVQWLDTWGGSNFVSLTGYQNFPSVL
FT                   GGMPEGYQNTVRFDTETVYSKLEVDAQRIQQIPFGGLVLMLYGHGQYSADRVPSSEQIF
FT                   LGGAGSVRGYDQAEFSGDTGYYVTTELRIPIPGTRNLHWFGSRKTVWETLQIAGFMDYG
FT                   YASINDPYPSEMSEDNTDMCGAGAGLRFTYSPYVRFKLDWAKSIGGDTPKDRDVEDDGV
FT                   WYVQVALQY"
FT   sig_peptide     483471..483548
FT                   /locus_tag="Dalk_0371"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006068_SP"
FT   gene            485292..531341
FT                   /locus_tag="Dalk_0372"
FT   CDS_pept        485292..531341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0372"
FT                   /product="filamentous hemagglutinin family outer membrane
FT                   protein"
FT                   /note="TIGRFAM: filamentous haemagglutinin family outer
FT                   membrane protein; PFAM: transferase hexapeptide repeat
FT                   containing protein; Haemagluttinin repeat-containing
FT                   protein; filamentous haemagglutinin domain protein; KEGG:
FT                   cch:Cag_0614 parallel beta-helix repeat; IMG reference
FT                   gene:2503006069; InterPro:Adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; InterPro:Armadillo-type fold;
FT                   InterPro:Filamentous haemagglutinin, N-terminal, bacterial;
FT                   InterPro:Parallel beta-helix repeat; InterPro:Pectin lyase
FT                   fold/virulence factor; InterPro:Signal transduction
FT                   histidine kinase, HWE region"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02081"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR008638"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ3"
FT                   /protein_id="ACL02081.1"
FT                   /translation="MASLSRKIKRARMRKERFTAAGGAGYRSLDRSLLRARRLGIGLGG
FT                   TLVMVSAAPALAGQGFTVNVDGNTTTYNQTDQNVYNRVESYNIAADETHRYNQPNSDAI
FT                   FVQRVVGQDPSSILGNLIANGQVWVMNPSGVLIGADATVNTAGFMATSLVMEEDDFFAG
FT                   NYTFKQDGDGGYVVNRGTIIVQNGGYAVLAGASVVNTGVIQADLGSVVLASGTQATVDF
FT                   DGDGLINFALGDGQAAQVTGPDGEALTTAVLNAGQVRANGGRVLMTAQAAGNILDSVVN
FT                   NQGVIEANSVVERNGEIILLGGDEGLVVNEGTLNVDGDDAGESAGSVYASGDKVYENGT
FT                   ISANAGAGGDAGQVTLTSTTLTLAGAESTITANGAGANSNGGDVILWSDGDTWFKGEIQ
FT                   ANGGDVSGDGGFVEVSGVNNLAFRGDVQASAVDGNAGTLLLDPTNIYIIDGSGGGRDAE
FT                   LGDGKILAGSGTGTWTISETGLEGIAGNVDIILEATNNITVENLSDDTLSLQTTGAKSL
FT                   TMTADADNDGGGAITFIGAASDTVVTQGGDMNFNAGDGMVLASLDTNGGDVTANMNNAG
FT                   TGVANLDLNDITTDGGDVNVTNAHGVAGTAVGNLLVRGNIDTSGGSVNLSATNDLTQIE
FT                   GATIVTGGGDVTMAADSDGDTNGVLTIAGKLGVDNIDTRGALSDGDLDVSAAQFGMNAG
FT                   SIQLGAGTMTILSSSQGTIGVGSGAGDLNVGGNDLQRINADTIVIGSLAGGAVDVDSTA
FT                   DLSGQDIEVYSNANITVGDIRLGATGVATLQSQSGAVVDDGGIGGGGTYIQAGSLNITA
FT                   NSVGGDGTANAALDIDIASGANVVNVTANTGGIYLRDVGAGNVALTNFNLTATGSGQNV
FT                   SITAASGSILANSAAFDTNIGDDNIYLTTENAGSAKNIVFSALLDVSVDSGNVYLTATG
FT                   DVRDSGALTLLKANYLEIDATNGVGSSGTGTGSPFNVNVNSLQAKSENAIYIREENGLD
FT                   VIGLETTDNSGDIWLSSGTGGAVTIVAAGSGGSGVTADKAGTIVIISEDNILVNNDVVS
FT                   GNGDITLTADDAIIMEARITTAQTGAVDADVYLTADADNDNNGNIVWFGGWITADYLRA
FT                   SAGHGIMVLTVVNTVDADNHGSSGVIAIFNYSNNLTVGSTAAIANKSGSIYIDTNGSMT
FT                   IAKDVLAGANGDVRLETQGADGSVTINDGVTVQGGVGGNGGVTIISDGFSFGTGAQTGQ
FT                   IKANGSGDIHIYPQTTTYNMGVNDAVFGTNNGGASVFNVTSAMAANNFVLGTGELIIGD
FT                   ASITGDMSVGADGSFSINANLALINSGSFEFNALSGVTDIDAGANDVRIVTGDLSEGQS
FT                   AGTAADVIAQNLYMTSTSGIGAAGSGAIDIDVDYVDATAINGNIYLQDANGTGGLEVDA
FT                   KTSGVGQIDVRGSSETITLNDVQTTNGAITAVNDGNDIIATNVVSGNNGTITLAATGAA
FT                   GDIYLDYVDAGLGLVDIDAGTGGTAGAVLVADADATAEIVAGTIQLNAVDGVGAGTGVA
FT                   AIQFDAGSIDVYNETGNVWLEAVGTGGASMNVSVGSASGNIDIRTATEDLTLVDVDTVN
FT                   GTINILVTAGDRAIVATDVQTGSNNNIAIDNSVGSGNVTIDLVNAGSGSVDIDVGGSAR
FT                   NADVDGSADITGGNVFIDAGVRISGAAGIAALDVDATVLDMATVNGSINVDTVGTGGVS
FT                   VDADAGGSGGIWVHGDSLETLTANDIVSNSGDIKVTTNYNQNMIVDQIVAGGSGTVTVD
FT                   SDGNIREANVMGSVEITTDGITRIWADAGGVGTALDGIETNIDDTVGSVDGTGDWVINE
FT                   ADGITLLGVDTTTGDIIVTYGNTGAGTADIVDARAVGGSVSITGLGDLNAYLVYANSDG
FT                   ESVTLQATSGDIYARDVQALGTGASDITITTVNAGDITLGDVTAGRDAIITAHTNVNDD
FT                   DDSISGYTEVSAGNNITITAGTAGTPGYIGRSASIDMTDPIQLAEAVDINPGAGTVTLT
FT                   AQSGNIQVYQDGSMSVNALPTINGAGGNQILLAAGSALTVTGGFTDNNANSIALGALSG
FT                   DLIINAGQTVQATTGSVYLYSAIGNVNLIGDIVAGADATVWAGGQITDGGGDAIADITA
FT                   AAGNVSLTAYSGIGTGSNVNAALDIITPVLDAVNGIDGSIGAGGIFLNMLGGTAAGIGA
FT                   VNINSAHSNAIDPGPALPVWINSNASGGLTLTDVDTDEGNITVTEAAGDITVISVESDT
FT                   HVAGTNDVTITTVNGDILFQQTGAIGIQSDDLVTLTAGNGSIVGDAGTASTDVIASRLV
FT                   MTASGDIGASGTGYLQTQVSNVEALFGAGGPATAGIWLDNNGALTIGGATAGTAVVGIQ
FT                   GSSVTNSTISVSADSVTVAESVFARDKNGVGPAAAVAGAASVTITADKAAGIMINAGQA
FT                   VGATGAAGATVTLSTTGTGADAGDVTINGSAKATAASGEAFIDIDAEGSVSVGSAAIVK
FT                   ADAAGGKGSISMLVGGTVTVDGSLLAVSTTHKAEVNISVGGDIDVNAKIAGTGAGTAEN
FT                   SEVALVATGGDITIDAAVSIENSEGNAIVVVRSDSGSVTLDGTGDLTAVGGSSGWAVVR
FT                   ILADANVNIDTQVKAETTSHTGNSAWVFIGKSDDRIGGSVTLGSNADIMAYGGEGAARI
FT                   EIRSSGDITVDDAVTIQADAGLIATGGNNAEIYITSYTGAVTIEAGTGAGSIKAVAGDN
FT                   FFNFGSATVNIQAATDVTLNNDVIATAHALTGEIEILAGGNVTVDALLDASVAVSTGTG
FT                   HDAVVNIGTSGSPVVTITLGSNADIQAAAGGALNNAIVGLYANGNIGVDGAVKILADTD
FT                   TGNGADASITILSNSGGVTIGAGTGSIKADGDDNATVTIDAATSATMGAVTADAESGES
FT                   FIDIDAGGSVSVGGVVTADAVGGKGSISMLVGGTVTVDGSLLAVSTTDKAEVNISVGGD
FT                   IDVNAAITGTGAGTGSNSEVALVADGDITIDAAVSIENSEGNAIVVVRSDSGSVTLDGT
FT                   GDLTAVGGSSGWAIVRILADANVNIDTQVKAETTSHTGNSAWVYIGNTVDRIGGSVTLG
FT                   SNADIMAYGGQGAARIEIRSSGDITVDDAVTIQADAGLIATGGNNAEIYIRSYTGAVTT
FT                   LAGTGAGSIKAVAGDNFINFGSAAVNIQAATDVTLNNDVIATAHALTAEIEILAGGNVT
FT                   VDALLDASIAVSTGTGHDAVVNIGTSGSPVGGTITLGSNADIQAVAVGALNNAIVGLYA
FT                   NGNIGVDGAVKILADTDTGNGADASITILSNSGGVTVGAGTGSILADGEEDAKVTIDAA
FT                   TSISVGSSATVKAEAGGAIGDTATVNIYAGSNVLLNNATVTAAGGASGASVVNIGGPGA
FT                   NRIGGNVDIIGGGGVVANSGSNGSSDLNIFAAGNVNVNQASVQSVAGSQARLDIGSSAA
FT                   SGLIGGSVDIEGALVMVGGTGAISQANIYADHDISLGASLLTSFNAVGQSANVIISGED
FT                   VFLGGSASVLNYQAKGLSGVASTTVSATGSTGIVVGVGGVIQNTGLNSSKVTLNTTVNG
FT                   GDIAMYGRTFAFGGNTAVITLNSADNVTVDKVGALGGSMLANAANFGSVDINAGGDVVI
FT                   GSAGTSKVQAVSNTGAATVHIDSTGGTSGVSVGAPGSVLGTGATGALVEVHTDKNVVVD
FT                   GVVTADSASGAAQLAIGTFGSAIGGSVVIKKGATVEASGSDSAATMLHVAAGGAITIDA
FT                   PVSVTNAIGAAAMRIRSNSGAITINDDPGAGTDTSGEITASNTGGTGATGNASIVIETM
FT                   GAGASAGNVSLVGDVGVIADAGSSSGSASVTISSQSGSVLIDQAGSAGAAGKIQALGGS
FT                   SANATVAISAGADVVINSDVTARQGQSGNAGITITAGDDIIIGDGAGADYQAIINADGS
FT                   FNSGSISTVTITAGTGAGIDTGSVILGQQADVYATGSGSFTGSAAITITGDIVDIAGPV
FT                   IIESSALADATVSITSTVGAISVDGSGTGAGYIKAFAGSSGSTVEVTLDAATSLTVNNS
FT                   IDVDGSGSADATITLNARSGDITIGSSAGSKNTAAITADASGSYGTANADIEIIILGAN
FT                   PDNDIILGTGADISAEGFAADVDIIGDNVTISGQTDIDATAGSGSGSADVFIRATEGDI
FT                   FVDKSLNTAGTAYEATGAATIRAIGGSSGSAGVTLKANDEIVLNASVTAFAGSFSTADI
FT                   DLIAGGNVRIGSGNTGNYAAAIHANASLGSMGIVNIGEPAPGNAIGGTIYFGAGADVKA
FT                   QGSRGSGTVTIVGDSIESEDGVAIQASGSSGTSLILIQNTDAASGEILLGNGAITSSAS
FT                   GTGNATVTITGVGAGTNQVVIGGPVTSSADSGDAEVTINAQGQGFGGSALWAVHVVGDI
FT                   TAQNGSGSAANVTINSQGAAGAVVIDGAILASSSGHGVIDIDSNRGTMELNGAITGNFG
FT                   SYGQVDIDTNVGNGASIYLNDAISLNESTAGATSYISLKAGDHIYMADSGDIIVNASAG
FT                   TGNVAVSLLADQTAGNNGRITMTDGAVVDAGSGLITMSAAGNITLGQVITTLTGGVAVD
FT                   IDSTDLGLYDAGDAAGPNGWTEDIIANGAGAIVSITTAQSQGSSGNAIETWITTLDSYL
FT                   GSEGNIFIVETDGLTLRNVENAGTAFGAITITSAAGDILVDSVKSTNGDITLAALAGSI
FT                   LETNADVDYDIITANGTATLSATGSIGASGAAIETQIAVLNADSSVAGNIYLDEYDGID
FT                   YANVDTASGDIFLTYGNGATGTATATAVDAQDGFAAITGAGDLIAAHVYALQSAVVGSY
FT                   DVTLTSTTGNITLGDVKADYDVTILASGTPAAAGTGNVIDDGDGVNGASYTQVEAGHDI
FT                   SITASGASGFIGSSTDINPTIANNHWKAVDVLPGNELNLVSNGNIQVYQQGDLGSLKIN
FT                   TLTSGGGSDDQIFVGAGGSLTIAGSFSENDDNITLAAMGSAAGTGDDLTINPVFSVTGS
FT                   DGSVWLYAGTGDVNLNGLVFAGANAAGSKSVTVNADAGSINASMDLTEITAASGASGIV
FT                   VLTAHSGIGSTGVGFLRIDATTVNAHTDNGGIYIETAGQGGVGISAEDDGAGNIFLNGG
FT                   NETMTLTDIDANNGSITVTRSGVLGDAIVIVSVESDTFTGAGTGTGTGSHDITITNNTG
FT                   DINFGGTAAPSGVGHITGDDDIFLTATSGSIVSAAGTAAIDITSLSSADTGYLYMEADG
FT                   NIGTQANMIMTHVDLLEGQFGKSNAAATFYLQNDQTLSIDGPNTGVFGGAGVAPGAATG
FT                   NQKISIVATALNVNDDVIVQTSGATGKVVLVTTTGDIDFGASVDVKAQAANTALVGMLA
FT                   SRDLLLDANAGTINAAASAGNAQVNAQAVRNLLVTGTGATITATGAGTATATGSVKLDA
FT                   FAGSVDIDHGSAVAATGVASATVDINAVTGVTITGKQAVEASSSSGAANVDIKASAGGV
FT                   SIQGGNVAGAADAAVHATGNAAVSVLIEAGTDVALQANTGAGTYAIYVSSVTNNGAIDI
FT                   KAGTAAAASGSVVVSSIAHANGAGDAAVNIDAAGGTGGTSGADVIVNAGGSVLATAGSG
FT                   AGDDGRITITADDGVSIAGTIAASAGGASGDDAYVNIGTAGDHVGGDVVVSGSVTATGG
FT                   KTGADTAGVNVYVDGSLTVDGGAVQATVGTGAGHAQVNLGTGANKIGGDITILGGGLVT
FT                   ATGGVGASDYVKAYANGAIQLGVNTSGSGKINVASATGTATLSGSSVVIGSGTAVGSVK
FT                   ASGSVAALVGITATAAAGDGIVVGGSGVVQAISSGDAYIGFSADSSNVVVDGSILADAE
FT                   TNGGSTAVVSIGSAWGGVPVIGGSVIGGSIDINTGASVQALGGSTGSAWVSLGAAGDIA
FT                   IDAPILAQGSGSAVQVGVTSYSGNVAIGPVTNGTGAIVETLHAIAGNGLGAGYAQVGVF
FT                   ALGSGSALDTGNVTINGLIRADSRTNGGSLAAVGIGYSAWPTGFATVPVAGDVSLGSQA
FT                   DITATGGSGDAWIDILSAGDVDIHGDVNIVADGSTGGSKSTYVYIVSESASVSIDAANS
FT                   GTGTIQALGGPDSTGSVTLEASGGNLIVYNDVFASSAAGGSGGAKIGLFASGDLHLDAQ
FT                   VIADASASSGFVAAGWINGSVGGNITVYGSSDIQALAGIGSTAFAGVDLHASGDVTIEG
FT                   NVSILADSAAGGGNEAYVDIFASGNLTIESGTGTIAASGYGSGFAGTSLPDGYATPGSG
FT                   SPWADFVAIGADGSVDIGANSGISVMNNGSGDSVIYIAAGTGNLTVEADLTSTASGGSA
FT                   YVTILGGGISSKQVVVDGSVTAASLSGAAQIDIISLGTGAGALQVGGDVSAEGSGGDFM
FT                   VYIDSRGTGGSVIIDGAIMAGNGNGMSGASGSVLIQSTQGDITVNGSININPVDDAATA
FT                   LVSQGAVSAIIDTQGGADANVVFSGPMTVDAASGSVSILAGNNVTMGANGDITVSHAGA
FT                   SASGSVNVTISADTELDGDGTLTMFQNNVGEARVSAGTGTITLTAGGNIEISQIVTFHT
FT                   GGTAVTITSTDGALVEILTGDHGNPDIVANKTGAITVIDTATGIGRFTGTMAIETMVTE
FT                   LDAKVTGNGDIFITEYDGLTLLDVETAGAATGDIKIISNAGDIQLAALAQGTVYSHAGD
FT                   VYLKATTGSILETTADAVLDVRAESGLATLIAGGSIGSNTGLGAIDTQVETLIASSTST
FT                   GDINIREVDDITLQSVVTNSGDIFVDANDGDITVMTVTAGGAPLGEFGNVTIYALGADK
FT                   SVFDDGNTATVISGGGANSGPGSAGATLDIQAGMHVGGTAADPSPIDVKDSADAVRALD
FT                   VDVSSFNTVTVSSAQNLSGLNGSNGHIQLYDSDAFDLSGALTLNLGTDGNQVYLGAGTS
FT                   MNLNVPFTAGSNDLALALYNPAGTLTIGANGQAAASGGYKVEVYSSGDVSLGGTAVGGG
FT                   AINTTGIVNVWAKGDIIDAGSDNVLDISAGTLNIYAGYDSGKGEIGVGAAGMSAAIEVR
FT                   SSVITAQSRGSAGSAQDILLNDVSTGDVSLTAYAELKGDVWFNGTMAHDSDTITLVDVK
FT                   TDSGAVTIQVTGPNTDVKVQSVVSDALLAATNDVSILARSGDILFDGGNATTGAIVSLG
FT                   DVYLTAGTGTGNGTISSKAGTGNLDVQAAGLVITARESVGAAGTGVLETKVSALEANFG
FT                   TGNATAGFYLDNSGALTIGGITAMDGVFAGAAAGSSTGNLTIDITADSLLVQESIQAIT
FT                   TGANADVTLNADAGGITIRPTTADAVVLASGAATVDVSVTATQDILLQAANTFDALIRA
FT                   DASGPGNDADLTVTSTGGGITMDGATNGGSATIKAYAGDAAGSGSTIDLTVDAQGGDLR
FT                   ILSSAGEFAGVYSATYGDNAVTNVDVDAQNILMDADQGGSAIIYAVGKASTAHTGGAVT
FT                   LTVNANAASGTIDALGGGATGRIWIVGFEGNDGATVDMDIVANGDITFDDESGALSVST
FT                   ATYANDVANVSTYVQSVNGNVTVTGGNLSAFGGVGHTNADMTVKAANYVTVNDDGAIDA
FT                   TAGSLGTGVTGTTGAKITIEAGNVLVDEKGKIYAEGGAGFKDIVSITAASGVVTVTGSG
FT                   SIAAHSQTGSVTIDAGTVAIGVTGAGLVEASGSVKALVTINATGANGVTVGASGVVQAL
FT                   GGSISEIYIDTDGSTTLGDVTINGSVLAGIAGVTSRRAAVYIGAGSGSGGVAGDIIIDG
FT                   GANIQAVTDTALDNEARVRLATLGNVSIGETGQAVITVSGGQTATVNYDSDITIVGANI
FT                   NIGATDAQLTVSDAEASVSIAAMTGTGNVNINGNAEIKAYSYDADASVTVMAAGNVKVD
FT                   GSMLADAVTNGGTYAGVGIQANSIDVNAGASIQALGQAAAGDATSVGLIAAGDITIDAP
FT                   ILARNTNGSGSAGITIMSMSGDITIESAGASSGALTAQAGDGFGSGSANIIIGGFGSSA
FT                   PVSGSVTINGQVTADADTNDGSNANVYIKSYIVGPGGSGPIAESVTLGALADVSALAGW
FT                   GNAEVEINANDDISIDGSANVWATGSEEAYVAIVSSSGNVSVGSGAGSIKAIGGGSGLA
FT                   GTSLPNGYATPGSGVYVAIAAAGSVDIGSNSGVTAWNVGTGDSVVYIQAGSGSLIVDTD
FT                   IDSASSGGSAYVTILGGGTGSSEVVVDGSVTAAGGFASQIDVIANGTRTGALQINGSLS
FT                   AIGSGTDFMVYLDSKGAGGDITVNGGIEAGTGSGTGLASGSVQIRSNGGDITVNGSISV
FT                   NPAGKGSGHGSVLLDTDTAVGGSIFLNGGISLNGSSGQVTVQAHGDVTMSSGADIIVNN
FT                   GLGAGTGTGNVPVTVIAMNGSITMDADSLIDAGAGRIYLYGWNGIDLGVLSTSNPTNIN
FT                   PGFIATGAIVIESYGDITDAGAGEVDIIAPNAGVVVTDPTAFGSTGSPIETTVGSILAT
FT                   VSGTGDFVMVETDDILVDYVSNTSGDIYLTATKGAINDLSGGDSAADFIATGGTATLIA
FT                   RDEIGTLANSIDTELGALIAHTTGTGLNGGPIVVDEADGIILEDVDTQNGAIVVTYGNT
FT                   TSGTAVATAVDARDGSVSITGVGDLNAKHVYATDSGTTGTYNVLLQNNPGNITVGDIFG
FT                   DYDVTITAVNGYVEDDGDGGTAMTAYTKVQATHDLTITAGSASGYIGTAAYIDPRTDPV
FT                   NEAVDVLLTGMSGTATFNSNDNIQIYQKGSLSLSATFDSKGGAGDQILAIAEKGLTVTG
FT                   GITENDDNVWLAAMSGDLTIAAGQQVQAVLGSVDLYASEGTGATGNVILTGSASAGTTV
FT                   QVEAKGGAIIDGDGGAGVDITAGTSVDLEADLGIGSGSGVNGAIDIIAPVVDADNLTSG
FT                   GIHLNMLGGAGVGTGAVNIDAAHSLGAGNIWINSGTTGGITLTDVDTESGHITVTQSAA
FT                   GNVTIINVESDTGTGLGSHGVYISTANGDILFNGHLTSEDQAFLTASGGSIISTVGTGA
FT                   TDVTATSLVMFASDSIGASANNLITQVSDLEAIYSGDNTGNEGFWLDNTGMDLTIGGIT
FT                   AMDGVTSGMGIGTANGALVQLSITADSITVNENMDAYTQGASALVTLNAVAGGIAVNGG
FT                   GGIAGSTNVYAGAADNAVGNITAQGDILLTGAAAGGAYITALTQASGAAALNVTSTGGG
FT                   VTVDANSGGAIISVRAGSNAGSGSVATLTVNANGGDITVLGGSAGGTGVIQSWTYGDSA
FT                   VQTLNATANNNILIDAEQGQLAEIWLYGKGSANGSADINVSAANGSIKVLGGSAGLGTG
FT                   YDAWLGGYLEGDSASVNVDVTARGDIIVEQRGGGQAAIGGSAFSGSNSTVEVDVESTSG
FT                   NISVSGDSGSIYAWGSGTGIPVDLSVTAAGDVSVSNSGAIAAGTSGPIGGLPAGTTGAK
FT                   TTINAANVSVTTNGAIYAEGGAGYKDIVDVNATSDVLVDASGSIYAHSKTGSVDISGAD
FT                   IVIGSLGIGNVNASGSVKALVTITSTGGTAGITVGGSGSITANGADASTISLFSDANVV
FT                   NQGNIKAESTSGDATVNVTASGATGILVSGEITAQNAAGSANTGLISLDSNGAGGDVIV
FT                   TGTVHAGNSGNGVAKVNIDSADGVAVNQGGSVKAMGVNYGSVNILASGDVAVGASGTGS
FT                   VKASAVSGTALAFISAKDIVIGGDAPANAGTVTASGSKNVRATLISTAGGAGLTIGASG
FT                   DVNANLTTADNSQSAVVDMDVFSGALTINGGVSATANTGNAKVIADVWNGTGGVTVGSQ
FT                   AEIKTQGGSTSTIQINVNGDATGEVHIDGSLYADGGSALIDVNSLNTGSHALVIDSNAS
FT                   LFADGRWYSLVELDSNGVSGDVVINGAVQAGSSASGYWTGEVRVYSEDDVTMGSNASIQ
FT                   ALAYAGRAMITVDAGGDVVLDNLVKSQVVGEGSAHVEVHAGGSVGITIRDNNGTGQEEV
FT                   QALSMFNTWIWLDSTGAGADVTIYGDLLAGSGVNDASVYINSADQVIMRDGASITVQAG
FT                   STGQVVIDASGTVLIGQTGSADIDVYSSGWWGYSVVDIDAWGAAGITLGESGHINSSFT
FT                   GSGYALVTLNGSSLIRDTNGTNIDSFGTGAGPVYIDGDIQAVQSGATGTGSAFIDIHSN
FT                   NTGTQAIVIDTNGSLFADADFIGSIYLDSNGLGGDIINRGAIQAGAGVVGSALIDIEAN
FT                   DGDITQTASGTIIGSAATTVSITLNTGANTGSIDLQGRISVNGGSAITGSVALAAAENV
FT                   FMGVDGDIIVNNGSGKGDINVNVIADFKAGSNLGGITMVDGALIDAGSGVITMLADGDI
FT                   LLSALVTAGTGGVVVDITSNSKGILDNGDAYTDITATGSGAWVSLQASDFIGRVKDDEV
FT                   IEDPEAFTGAIGRPETHANGDAIETSIRNLIAVTKEEGGEIAIDNTSNYALTLGKLGSA
FT                   NLVMPSLNLDASMWIRNDADITVNAWKLDGNDNVALIATAGSVTIPDSGFTADTALDAN
FT                   FVLDDSKVDISVGTGTVRLEATAGTGVVRDSAGGALTVIAHNLIVKSNSLSSEFITDAS
FT                   RFGSGSYAYNQTYDPGATLTPLPNATAFNIVARLVEDSSNEVGRVDAEIRGSGEGFSLL
FT                   QTNDASGSALDLTVADIDGDGNSIVIQGDNGGVAGAGGMVLVYVANGYDNNTDGSTLSV
FT                   EGAIHANNGDIVLWVDATNGQRDGEINLNGSSSITTDTSGDELGALYIYGNTEISGTTL
FT                   QANKHDMIILSSTANHIIIDDAQVGAGTVVLNPGGSNEWDIVITQNGSLTVNGGDLFIQ
FT                   NADEFRMESGPNGAAEVTVNGGSVNIDDVNVFLMQDGTKINADKNINVGQNTGSVFAMY
FT                   MAPTATMNAGGGITISVGGDILLGNLNSDIDGTGDEDIYVNAYKGPDPHPHYINPTGTG
FT                   TGYNMSWGSERNGSSGSPMASQSGTVTVGGIINPNGNDVTLISAADGIVDGDGQVVNTN
FT                   IFTASASKSIGAAADPITIDALVVDGTTTGTGSIYIYNTPSGDVRADFNTNGGNIIYSQ
FT                   QGGDLLLIDDAAWGGADGDTDAIFTNNGDATIDPPNDVTISSAVNLGTGTLVLEANGFI
FT                   TQNATGNITAKNAYLIADLNNDNGADGFGSNFIQSGTGAALTITASGDVDIRAAGFQLD
FT                   SITAASGRIDLTANYGNIVEFGAGDAGADLAAQTINLVADGGSIGAANSLEVDATVSLD
FT                   ADTSQAGGNIDLTHAGAGDMLIDVVNAGAGTVNLNGGGKSLVDINGTNANVTANVLTVT
FT                   NAKNIDLDTSVGSVNLTATGDVTIDETDGLNGVYISATGTGNQIVVNANGTVDLGIDNH
FT                   RIEAGSGGAITVTTSSGDITSTHATGFIGATGGGPVDVTLEANGNVTLTHGIAAQGGDV
FT                   DIEGLNGNVTLTALSGNNIFLLAGNNIIHTGVINATGDVAYIAGNNITIDGAVTAGGDV
FT                   LADAGVLLTVATGDTVAAGTGVDFSATTADINAAVTSAAGDIIINTVGGGVDADANITA
FT                   DTGDVIITGDQIDLFGVSANQNLILTATQTSVAATDLLHAGTDVLINAVTSVAVEEVTA
FT                   TGDIEITAGTTFVNSAAMTAGVDLTVTSDGTLTTDGTVTGGTVTLKSISADLDLNNTVN
FT                   STAGDVTLLADTKVVATGAITSVGGDVNIAANLGSVSVAGVTSAANVNINAATGITING
FT                   AVNALLAEMNTQAGNITTAGTGVVTAGNLLAQAWAGSINIDTDVITMEAVARGDITVDE
FT                   ADGITLASVISGTGDIVVNGAQTVGGLLNAQYVEAQAGDVTLTTANSASIQAGAVNAVG
FT                   NNVVLNAAGSITDGAGDVVANDLDATAVNNITLTSQVNSASLTFNAGGAAILSNMAASL
FT                   QLDNTTGGTLDVTNTGAITDGGGNNVDTLSLETVDGAITYVDGDDLIVLDVRAGGTGNN
FT                   VTLTAGGSMDVRYVEASDDTVSLTASGDIADSLGTGTLDVLAGTLVLNAGSTGDINLDT
FT                   EVDVLHLSGANAAQNVTIREVSEVTIGANGIDTANNGAVSITAGGTINLPAGRLIDADG
FT                   AGTLTLNAGDNLIIGGTLNSNNALIDLDATNDVLISGTINTGVGTTGNLQVDAGQAVTQ
FT                   TAGTITANSARITAVVGGVDIYQGGNDFELITVSAGGPVWIQDADDLTIGSYDKQAGVV
FT                   TSNDNITITTSGSLTLNAPVTAGTADVDIDVNTGALLGSGLITADLVDAKAQTSITMNT
FT                   DVNTIIADALGGNVVITEADGVFLERVTAPAGTVDITTKAVGDVVVGRIAGSTSVDLTL
FT                   GGKGDVLDDGDDATWIAGTVLTIDGPSAGAVSGSVTVRTDVDSVDIEATGDVTITEANA
FT                   ITLTQVTGDDVEVTAGGNVTIGSVDATGASGRAAIEAVGNINGGTITAPLAALEAGGSV
FT                   GGATAITLDNAGVTLAVAAGGNVEIDGTSGDLTVGAVDGVDQGLSGVIAGGNVDLDAAA
FT                   NLNVNADITAGGGTADLSANGGNITTVDAAIVTAATVLADAAGNIDLNTDAVDLTAVFG
FT                   KTGTATIDELNGLRILNTTGQTLDVTIEQDGAITDGGGNKVDNLYLETQNGAITFSNLQ
FT                   TLNVMDVRAGGTGNDVTLTSVNGMNVDYVEAAGDTVFLTTGRDITDLNGAGTAQANLNV
FT                   LARELVLDAEGSVGSFVTDVGSIDLDTEVTIAHLSGADQATNVTLREWTDITVGANGFD
FT                   TQGNGFVSITTTDGPIAVEGVIDADGAGTILLAANGANNNITLNANLIGNSGIIMLHAA
FT                   GSVNQLAGTVTADTGVEVTAGGPVSLAQAGNAMTMVAVTADGDVAIDDDAAGGLTVGTV
FT                   NGVNGITSNNNDIRVNSAGDLTLAQFVNAGSLGDVTLVSAGAIAGSGMVTGFLVDAAAA
FT                   AGIDMDTTADVINATTAAGNIVIEETDGVYLQNVTAPAGTVSVSTLNTGDVKVGTITAS
FT                   GTVTLDVEDGSVVNDGDPATRISGTVLTISDGGAAITGLVDVDTNVDSVDIQAAGDVTV
FT                   MEVGSITLTNVVSGDEAEITAGGDVVIGSVDATTRAAIEAGGNITSGTITAPAVALEAV
FT                   GGITNVDLVGGAVTLAAQAGGSVELDANGSLTVGLVDGVDQGLSGVIAGGNVTLDAGKS
FT                   LAVNADITAGGGTADLSALSGDITTVAGAVVTAGSVNVDATGAIDLNTNAGTLEASFGA
FT                   GSTATIDEADALMIRNTTGGTLNVTLLEAGDLTDGGGNNVTNLIAETQNGNITYTDADD
FT                   LNVVSVIAGGSANTVFLTAGSAMAVTYIQAEGDVTLRSNGAITDVGGAAVNVYSGGTLD
FT                   IQSGDNTVDLDTEVVSLIAANVSDINIDEVDAIEILGIDTNTGGNVDVETTDGDILVSG
FT                   PIDADAAGTILLTAGGTERAIILGANVAGNSGSIMLHATDDVEQTGGAVTTGVGVEVTA
FT                   GGEVDLTQAGNAMTVIAVDANGDVFIDDDDAAGGLTVGTVNGVSGIDSNNNDIRVNSAG
FT                   DLTLAQFVNAGSVGDVTLVSAGAIAGSGMVTGFLVDAAAATGIDMDTTADVINATTPAG
FT                   NIIIEETDDVYLFSVTAPAGTVDVTTKGAGGVTVGTITAATTVDLTLGGKGDVLDDGDP
FT                   STLITGTVLTVDGPSAGAVSGDVTVQTNVGSVDIEAAGDVTVTEVGSITLTNVVSGDEA
FT                   EITAGGDVVIGSVDATARAAIEAGGNITSGTITAPAVALEAVGGITNVDLVGGAVTLAA
FT                   QAGGSVELDANGSLTVGLVDGVDQGLSGVIAGGDVTLDAGKSLNVNADITAGGGTADLS
FT                   ALSGDITTVAGAVVTAGSVNVDATGAIDLNTNAGTLEASFGAGSTATIDEADALMIRNT
FT                   TGGTLNVTLLEAGDLTDGGGNNVTNLIAETQNGNITYTDADDLNVVSVIAGGSSNTVFL
FT                   TAGSAMAVTYIQAEGDVTLRSNGAITDVGGAAVNVYSGGTLDIQSGDNTVDLDTEVVSL
FT                   IAANVSDINIDEVDAIEILGIDTNAGGNVDVETTDGDILVSGAIDADAAGTILLTAGGT
FT                   ERAIILGANVAGNSGSIMLHATDDVEQTGGAVTTGVGVEVTAGGEVDLTQAGNAMTVIA
FT                   VDANGDVFIDDDAAGGLTVGTVNGVSGIDSNNNDIRVNSAGDLTLAQFVNAGSVGDVTL
FT                   VSAGAIAGSGMVTGFLVDAAAATGIDMDTTADVINATTPAGNIIIEETNDVYLFSVTAP
FT                   AGTVDVTTKGAGDVTVGTITAATTVDLTLGGAGDVLDDGDPGTLITGTLLTVDGPSAGA
FT                   VSGDVTVETTVGSVDIEAAGDVTVRETDGVTLTNVVSGGDAEITAGTNVTVVSVDATNR
FT                   AAIEAGGNITGGVITSPEVALEAAGSVTNIDLDNNGVTLAVLAGGDIEIDGTSGDLTVG
FT                   AVDGVDQGLSGVITAKGDVTLDAAANLHVNADITAGGGTADLSALGGSITTVDGAVVTA
FT                   GFVNVDATKSIDLNTDAGTVEAFFSATGVATIDEADTVTIQNTTGGTLDVTILEDGDIL
FT                   DGGGNNVDTLYAETQNGDITYVDADNLIAMDVRAQGTGQNVTLTAGGSLDVRYVEAAGD
FT                   TVNLNASGDIWDSTGTGTRDVFAGILVVDTSANGDVNLDTEVHTAHAAGANVVNNVTIR
FT                   EETDLTVGANGFDTANSGSIVITTTDGDILTVGVLDADGPGTITLTTNGPDRSIILGNN
FT                   VTGNSGSIMLHASGGVNQTGGTVTTDVGVEVTAGGAVSLAQAGNAMTEIAVDNTGTVAI
FT                   DDDAATGLTVGTVNGVSGIDSNGYNIDIDTAGNLSVDQFINAGSLGDVTINTIGWVVGS
FT                   GLITGDIIDVTSTTGIDIDTKGDIIDADGGTGNVVIEEFDGVTLRDIDAGKSVDVTLLN
FT                   AGDIIVNEIDAGSNVSLHLPNGSVQNDGDSTTDIAAGSALIIDNDAGGAITGYANVDTT
FT                   VKSADIQAVGDVTIHETDSIILTRVTSQDDVYVQNGLDGDILVNVVTGLTSVTIDSDGN
FT                   INGSGKALITTPTVNLDADTGIGDTAAINLATTTSVDADTDTGAIDLNNSAAGFVTVNS
FT                   LTTALGDINYDSTAAGDLLVTLARTDNGDITITNTKGDITLGVVSAIGNDVTITAAGSG
FT                   AINDVTDELDADIFAANVDLNAVDGIGNTEAIEMEITNTIAADTVTGAIDLDNEASTPA
FT                   MVTITSLTTGSGDINFDQYSKEGYTGTTDLTVELATAGGAATGDGNITITNTTPNGDIL
FT                   IGTAAGGITALGDTVSITAAGFIDDLQAEPDALLDIDITATTMDLNAGLGIGMNAPLET
FT                   EADFITADTTIGDIILWNEADSRVVVNSLTTGDGNITFIQQGLGTYPDPVDIDFVVVKA
FT                   DHGLAPNPNNGNVYLENIDPTPLDNVYGNAFVGDVRGSETVRIITSGSILNLDVDTTTV
FT                   ISAPWAYLQATNGTIGVFELPIDVDVTGALFIEAGGLDDGWLSANLQGRDVYALYPDER
FT                   IPGLVLFNSEEPGAAPGVGGVVDGVNQFTDWYFQGIAQNQAVIGNEIWPYVLQLDVFGD
FT                   SVFAPFDDLFVIEGKGITPEDDE"
FT   sig_peptide     485292..485462
FT                   /locus_tag="Dalk_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006069_SP"
FT   gene            531759..533201
FT                   /locus_tag="Dalk_0373"
FT   CDS_pept        531759..533201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0373"
FT                   /product="PBS lyase HEAT domain protein repeat-containing
FT                   protein"
FT                   /note="PFAM: PBS lyase HEAT domain protein
FT                   repeat-containing protein; KEGG: psp:PSPPH_1397
FT                   hypothetical protein; IMG reference gene:2503006070; PFAM:
FT                   PBS lyase HEAT-like repeat; InterPro:Armadillo-like
FT                   helical; InterPro:Armadillo-type fold; InterPro:PBS lyase
FT                   HEAT-like repeat"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02082"
FT                   /db_xref="GOA:B8FGZ4"
FT                   /db_xref="InterPro:IPR004155"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ4"
FT                   /protein_id="ACL02082.1"
FT                   /translation="MANKKINVEKLIADLNPPKWKIWITPKVRREAALSLGRMKKAEAF
FT                   EPLLTALEDPKVQDSAMEALSSLPVPGKQAARTLKAILAYRQGLKVRFIEEFFNENRNS
FT                   TTMKMVGDMPMTTMKAEPESFLGAALSIWSQLNPDREEDLDAAARQGLAPYSRKKFRKN
FT                   IYILARNEIFPTWPELDVINNLFEAADEMIVSIAGQEAVPDYEPRKEGDDNNDASKRKD
FT                   AEMGKELSDEALHDFVVKALGAKSAITTPMLQIPLIMEGFFKELKGRYALLDSQEIFKL
FT                   LSGAVRLNCHTCGPLATEYTQGLLGKVEESFESGTPLDLGELTNASAGSFAKGHNPGCK
FT                   GFGVELTFDPSGIEAPAKAIEARREAAEGKPVKEEKEAAPAPAQAAPEPVQAELEIPLE
FT                   KPAPAPSAYNVLYKGELIEGKTPDEVKQGIAKLYKVDVSKVEGFFSGKPRVVKKGVNRE
FT                   TAEKMVAAFQRAGAKAYWEEVS"
FT   gene            533324..533827
FT                   /locus_tag="Dalk_0374"
FT   CDS_pept        533324..533827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0374"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; KEGG: abo:ABO_0537
FT                   cyclic nucleotide-binding protein; IMG reference
FT                   gene:2503006071; PFAM: Cyclic nucleotide-binding domain;
FT                   InterPro:cAMP/cGMP-dependent protein kinase;
FT                   InterPro:Cyclic nucleotide-binding domain; InterPro:Cyclic
FT                   nucleotide-binding, conserved site; InterPro:Cyclic
FT                   nucleotide-binding-like; InterPro:RmlC-like jelly roll
FT                   fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02083"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ5"
FT                   /protein_id="ACL02083.1"
FT                   /translation="MQNNDFGAGFNSMASQDILACLSVIPMFEDLTHEQMLAVSKQTLL
FT                   LTVEAGETVFREGDKGDFVCFVAEGLLAVVKCLEGDKFAELTSLPQGSSIGEMAVIDDF
FT                   PRSATVIARKPSQLITMTRSQFHRVVTENPEIGIKLLKGIARVLSMNLRKTSANLVQHM
FT                   LPLL"
FT   gene            complement(534434..534688)
FT                   /locus_tag="Dalk_0375"
FT   CDS_pept        complement(534434..534688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0375"
FT                   /product="hypothetical protein Dalk_0375"
FT                   /note="IMG reference gene:2503006072"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02084"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ6"
FT                   /protein_id="ACL02084.1"
FT                   /translation="MRNLDCPYYNTCLTSAAKHNLPDWDCGPCPNRDVKCEREEPDMVA
FT                   YHILLRAIFDPEQYAMYLGSKPMHKPRQKAVASQQMASM"
FT   gene            535164..536102
FT                   /locus_tag="Dalk_0376"
FT   CDS_pept        535164..536102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0376"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin protein ligase domain protein; biotin/lipoate A/B
FT                   protein ligase; Helix-turn-helix type 11 domain protein;
FT                   KEGG: dol:Dole_0391 biotin--acetyl-CoA-carboxylase ligase;
FT                   IMG reference gene:2503006073; PFAM: HTH domain; Biotin
FT                   protein ligase C terminal domain; Biotin/lipoate A/B
FT                   protein ligase family; TIGRFAM: BirA biotin operon
FT                   repressor domain; birA, biotin-[acetyl-CoA-carboxylase]
FT                   ligase region; InterPro:Biotin protein ligase, C-terminal;
FT                   InterPro:Biotin--acetyl-CoA-carboxylase ligase;
FT                   InterPro:Biotin/lipoate A/B protein ligase;
FT                   InterPro:Helix-turn-helix, type 11;
FT                   InterPro:Transcriptional repressor, C-terminal;
FT                   InterPro:Winged helix-turn-helix transcription repressor
FT                   DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02085"
FT                   /db_xref="GOA:B8FGZ7"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ7"
FT                   /protein_id="ACL02085.1"
FT                   /translation="MKAKIVGLLKEATTPLSGEKISQDLGVSRVSVHKHINGLRERGYS
FT                   ITAGSTGYTLEDEGDFLYPWEFGERDPLIHFYEEATSTMTIARDLAESDCPHMTTVVAQ
FT                   RQTKGRGRLNRVWDSQDGGLYFTVILRPSLPINQVYKVLFTASVSLALVVRNLTGINAT
FT                   VKWPNDILVGEKKLNGMLSEMATQDEFVQYVNLGIGVNVNNNPSKAEPNAVSIRDLLGQ
FT                   EFPRRKILTGFLDSMEERLKNKDEDVIAQWKQYTSTIGRPVRIQTTRDVLEGRAVDVNS
FT                   QGSLIVELADGRLEEVFHGDCFYQSGEAQES"
FT   gene            536144..536752
FT                   /locus_tag="Dalk_0377"
FT   CDS_pept        536144..536752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0377"
FT                   /product="BioY protein"
FT                   /note="PFAM: BioY protein; KEGG: sfu:Sfum_1749 BioY
FT                   protein; IMG reference gene:2503006074; PFAM: BioY family;
FT                   InterPro:BioY protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02086"
FT                   /db_xref="GOA:B8FGZ8"
FT                   /db_xref="InterPro:IPR003784"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ8"
FT                   /protein_id="ACL02086.1"
FT                   /translation="MNENIGEENAFSFTQIRNMVLGALMAALMAVGAYIAIPIGPVPIV
FT                   LQNMFVMLAGLILGPWWGAASVGIYMLAGILGMPVFSGGGAGLVQFMGPTGGYLFAYLP
FT                   AVVLIGLISGLGKKYHHNPAAGAVTKAMVYDVLAMVLGSALVYAIGVSRLKSMAGFSWG
FT                   KAWAVGMAPFLLGDVIKIAANASLIVGIRNMLRRFKSDE"
FT   gene            536754..537509
FT                   /locus_tag="Dalk_0378"
FT   CDS_pept        536754..537509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0378"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: sfu:Sfum_1750 cobalt ABC transporter, ATPase subunit;
FT                   IMG reference gene:2503006075; PFAM: ABC transporter;
FT                   InterPro:ABC transporter-like; InterPro:ATPase, AAA+ type,
FT                   core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02087"
FT                   /db_xref="GOA:B8FGZ9"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FGZ9"
FT                   /protein_id="ACL02087.1"
FT                   /translation="MADSVLEFKNVSHTFSGGIMGLSGVSFRAAPGEFIILCGKNGSGK
FT                   TTLLRHMNALSLPSEGEVLVAGVSTKKNPVQARQVVGMVFSDVRNQIVGETVADDVAFG
FT                   PENLGLPEEEINKRVKASLEAVGMGHMGDRRPYLLSGGEKQRTAVAGVLAMESRVIVFD
FT                   EPFSNLDYPGVKQVLQQMVNLHGLGKTIIVATHDIEKVAAHAGRILVMDKGRLALDCSL
FT                   DEAAPDLEKFGVRRPCASLFGREVDSWLE"
FT   gene            537497..538255
FT                   /locus_tag="Dalk_0379"
FT   CDS_pept        537497..538255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0379"
FT                   /product="cobalt transport protein"
FT                   /note="PFAM: cobalt transport protein; KEGG: mac:MA4343
FT                   cobalt transport family protein; IMG reference
FT                   gene:2503006076; PFAM: Cobalt transport protein;
FT                   InterPro:Cobalt transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02088"
FT                   /db_xref="GOA:B8FH00"
FT                   /db_xref="InterPro:IPR003339"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH00"
FT                   /protein_id="ACL02088.1"
FT                   /translation="MAGVNLFVYTPGATAVHRMDPRFKLAALVVLSLATVQCGPYAALG
FT                   LFFIAAFTAIAGKVPAFTMIRNAQVFLLFLVGIILVRGAVTPGPAVFNGAIPWFSVNGL
FT                   EDGLLISWRLFVVLIASAVFTGATRTSGVFSAVRWYFKPIPFMDGARAAMMLTLMMRFI
FT                   PIILEEADSIKEAQRSRGLENRKNPVYRITRLVPPLMERTFTRAQDLTLALVSRNFGPN
FT                   PTSRGLHAQKTDWLYFLLFFSLCAGLRVLD"
FT   gene            538319..539683
FT                   /locus_tag="Dalk_0380"
FT   CDS_pept        538319..539683
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0380"
FT                   /product="TrkA-N domain protein"
FT                   /note="involved in potassium uptake; found to be
FT                   peripherally associated with the inner membrane in
FT                   Escherichia coli; contains an NAD-binding domain; IMG
FT                   reference gene:2503006077; PFAM: TrkA-N domain; TrkA-C
FT                   domain; InterPro:NAD(P)-binding domain; InterPro:Potassium
FT                   uptake protein TrkA; InterPro:Regulator of K+ conductance,
FT                   C-terminal; InterPro:Regulator of K+ conductance,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02089"
FT                   /db_xref="GOA:B8FH01"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR006036"
FT                   /db_xref="InterPro:IPR006037"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036721"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH01"
FT                   /protein_id="ACL02089.1"
FT                   /translation="MKILIVGAGEVGFHIASRLATENKDVVVIDKDPKALKRVSEQLDV
FT                   QVFEGSGSSPEVLREAGISQSDILLAVTDSDETNLVSCLVCDLLSPATRKLIRIRDSDY
FT                   TDFTDRLRDDPPHIDTVINPEVELVRTVQRLLEVPGAEDVAEFSGGAIKLIGVRLDELS
FT                   PLSNMRLTKLREVTGDFHLLIAAIVRDEELIIPTGRDSLVPGDLVYFVTDDANLHTALK
FT                   LFGKESRPVKRAFIVGGGRIGMRLARALAQNGVYVKIVEDDPQRCNRLAEALNNVVVLN
FT                   GDGTDQGLLAEENIEDMDVVITVTGDEETNILTSLLAKRMGVPIAVTRINKFGYFPLTT
FT                   AIGIEHVISSRLSAINTILGHVRRGKVLSSVSLKGERAEVLEAEALETAEIVGKPLKSI
FT                   SFPKGALVISIIRDNEVIIPKGDSVIQPADRIILLCSQQAIPKIEKAMAVKLEFF"
FT   gene            539741..541189
FT                   /locus_tag="Dalk_0381"
FT   CDS_pept        539741..541189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0381"
FT                   /product="potassium uptake protein, TrkH family"
FT                   /note="TIGRFAM: potassium uptake protein, TrkH family;
FT                   PFAM: cation transporter; KEGG: dol:Dole_3217 TrkH family
FT                   potassium uptake protein; IMG reference gene:2503006078;
FT                   PFAM: Cation transport protein; TIGRFAM: potassium uptake
FT                   protein, TrkH family; InterPro:Cation transporter;
FT                   InterPro:Potassium uptake protein TrkH"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02090"
FT                   /db_xref="GOA:B8FH02"
FT                   /db_xref="InterPro:IPR003445"
FT                   /db_xref="InterPro:IPR004772"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH02"
FT                   /protein_id="ACL02090.1"
FT                   /translation="MRWGHTFSVVGILLVFCGLAMALPMLVGLYYQDQSIIPLAKGMGI
FT                   TLLVGAMVYLAAPTKKQETLSHREGMAIVALGWAAVGVAGALPFYFSTSFLGFTDAVFE
FT                   SVSGFTTTGSSVLSDIEGVSKGLLMWRSMIQWLGGMGIIVLSVAILPFLGVGGMQLYKA
FT                   EVPTPVPDKLKPRIRDTAVILWQVYALFTVLEAVLLFVGGMSVFDAVCHAFTTMPTGGF
FT                   STLNTSVGQYHSPYFEWVIIFFMIVAGINFSLHFQLLRGKPMALWKDPECRFFLGLVLV
FT                   LVAVITLDIHGKVFSSLNESIRASAFQVSSIITTTGYATADYELWPALSQLLIMFCMVV
FT                   GASAGSTGGGIKCLRVMLLFKYCYRELFRMIHPRAVIPVKLGGRVVPEEVLHSVCAFFV
FT                   LYMGLFAISALGLAAMGVDLVTSMAAVAATIGNIGPGIGGVGPMDNFANIPLAGKWLLV
FT                   WCMLLGRLEIYTVIILFVPEFWRK"
FT   sig_peptide     539741..539806
FT                   /locus_tag="Dalk_0381"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006078_SP"
FT   gene            complement(541227..542063)
FT                   /locus_tag="Dalk_0382"
FT   CDS_pept        complement(541227..542063)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0382"
FT                   /product="Short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: LOC581999; hypothetical LOC581999;
FT                   IMG reference gene:2503006079; PFAM: short chain
FT                   dehydrogenase; InterPro:Glucose/ribitol dehydrogenase;
FT                   InterPro:NAD(P)-binding domain; InterPro:Short-chain
FT                   dehydrogenase/reductase SDR; InterPro:Short-chain
FT                   dehydrogenase/reductase, conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02091"
FT                   /db_xref="GOA:B8FH03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH03"
FT                   /protein_id="ACL02091.1"
FT                   /translation="MTQLSGSKAVITGGAMGIGLATAKRLLDEGCQVAIWDINKEALMQ
FT                   AEKELKEEGDRVLFCQCDVSDEEQVYHYAQVVQNAMGQVDILINNAGMVVPGRFCQYKP
FT                   SVREKETRVNLLAMYYTIYAFLPGMYERNCGHIVNISSGAGLVGMPDLAAYCASKWAVY
FT                   GLTESLRFEAIVDGKTGVHFSSVHPGILKKGMFEGSKLNLLGEIMIPRVNDHDSIAGVI
FT                   VNRALKKNRYIVKFPKSLHMGPLARGLMPDRMMNSIMLLAGIGDSMKNWTGSGRDQ"
FT   gene            complement(542041..542472)
FT                   /locus_tag="Dalk_0383"
FT   CDS_pept        complement(542041..542472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0383"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vfm:VFMJ11_A0633 hypothetical protein; IMG
FT                   reference gene:2503006080"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02092"
FT                   /db_xref="GOA:B8FH04"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH04"
FT                   /protein_id="ACL02092.1"
FT                   /translation="MKNRLTGFGFLLAGSVNIAGILLFSKLFTNDLMQSLDPAVFSNVG
FT                   IASIILWGMAYLSVRDRFQAAPQIVGVFMVEKFFYAAVWGQWIFHHWKDLGNVYQEDLI
FT                   TGLFFSVYGLNDFLFGVFFLIVFISCTRKGESDDPVVRI"
FT   sig_peptide     complement(542416..542472)
FT                   /locus_tag="Dalk_0383"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006080_SP"
FT   gene            542654..543670
FT                   /locus_tag="Dalk_0384"
FT   CDS_pept        542654..543670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0384"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: pfo:Pfl01_0206 AraC family transcriptional
FT                   regulator; IMG reference gene:2503006081; PFAM: Bacterial
FT                   regulatory helix-turn-helix proteins, AraC family;
FT                   InterPro:Helix-turn-helix, AraC; InterPro:Helix-turn-helix,
FT                   AraC type, DNA binding domain; InterPro:Homeodomain-like;
FT                   InterPro:Homeodomain-related; InterPro:HTH transcriptional
FT                   regulator, AraC"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02093"
FT                   /db_xref="GOA:B8FH05"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH05"
FT                   /protein_id="ACL02093.1"
FT                   /translation="MNQFLATHPTTISSWAVVIARTCAFYGLNSKELLKKAAIDEKVLG
FT                   QPGQRIEIDKIARLWNLAVEQSRDPCLGLRVIRHIHPVTFHALGPALLASRDLREALER
FT                   LCRVYQIISDEVEVRIDSRDDGDALCFTPFAGRPLPVGASVDAFMAAAVFYARMLYDAS
FT                   LNPVKVEFMHEKWGEGREYERLFQAPVYFAMQDNAIVFSPQDAHKTLLTANAEIAMQND
FT                   KLVFDYLARCKTERLDQQVRSRLLKSLPLGEPSIETTAQSMGISPRSLQRHLRNQGTSF
FT                   TEILDETRKHLAENLIRYPHLSVTDVAFQLGYSDSSNFSRAFRRWFGKSPNMYKRFL"
FT   gene            complement(543830..544825)
FT                   /locus_tag="Dalk_0385"
FT   CDS_pept        complement(543830..544825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0385"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: afu:AF0627 iron-sulfur cluster binding
FT                   protein; IMG reference gene:2503006082; InterPro:4Fe-4S
FT                   ferredoxin, iron-sulphur binding, conserved site;
FT                   InterPro:4Fe-4S ferredoxin, iron-sulpur binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02094"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH06"
FT                   /protein_id="ACL02094.1"
FT                   /translation="MGKTVYEQFAEKIMIPGSGIVPQLIAMMTTEQEAEMLLSMPATAQ
FT                   ELADKFSMDLSDVEDKMVDFFKKGLVFKSYKPQGIVYRMPREVMQFHDATILWHGATRE
FT                   YHDLWQKFMEEEWPEYTKMVEKFMPRPFSRIIPVEQSLNPKSQILAYESCKDLIDDSED
FT                   IAVTKCTCRVIAHKCDSPVEVCLQLGKSARYALERETGRKVSKQEALDIIKQSEEAGLI
FT                   HVTMNRAENMHFICNCCGCCCMAMPMMVEYGRAMNDPSRFCAVIDEDACEECELCLERC
FT                   VFKAIEMDEGIGAAVVNADKCMGCGVCQVTCPADAIVLDEVREKEFIPMT"
FT   gene            complement(544957..545625)
FT                   /locus_tag="Dalk_0386"
FT   CDS_pept        complement(544957..545625)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0386"
FT                   /product="Hydrogenase nickel incorporation protein HypB"
FT                   /note="TIGRFAM: hydrogenase accessory protein HypB; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: dol:Dole_0298
FT                   hydrogenase accessory protein HypB; IMG reference
FT                   gene:2503006083; PFAM: CobW/HypB/UreG, nucleotide-binding
FT                   domain; TIGRFAM: hydrogenase accessory protein HypB;
FT                   InterPro:[NiFe]-hydrogenase/urease maturation factor,
FT                   Ni(2+)-binding GTPase; InterPro:Cobalamin (vitamin B12)
FT                   biosynthesis CobW-like; InterPro:Hydrogenase accessory
FT                   protein HypB"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02095"
FT                   /db_xref="GOA:B8FH07"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004392"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH07"
FT                   /protein_id="ACL02095.1"
FT                   /translation="MEIPVVRKVLDVNDTMAQENRDYFTQQGVYVFNLMSSPGSGKTTL
FT                   LTKVLQKLAPEIKAAVIVGDVCTTNDADRLSVTGAPVVQITTDDFGGDCHLAAHVIRSA
FT                   AKELDLTDIDLLIVENIGNLVCPAEFEIGEDSRGVVLSITEGEDKPLKYPLMFRVCNVA
FT                   ILNKMDLVPYLEVDADLAVKNMLTVHPEMPVFKTSATKDTGLDAFVDWLKGEVNKKFGK
FT                   "
FT   gene            complement(545640..546032)
FT                   /locus_tag="Dalk_0387"
FT   CDS_pept        complement(545640..546032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0387"
FT                   /product="Hydrogenase nickel insertion protein HypA"
FT                   /note="TIGRFAM: hydrogenase nickel insertion protein HypA;
FT                   PFAM: hydrogenase expression/synthesis HypA; KEGG:
FT                   dol:Dole_1517 hydrogenase nickel insertion protein HypA;
FT                   IMG reference gene:2503006084; PFAM: Hydrogenase
FT                   expression/synthesis hypA family; TIGRFAM: hydrogenase
FT                   nickel insertion protein HypA; InterPro:Hydrogenase nickel
FT                   incorporation protein HypA/HybF; InterPro:Hydrogenase
FT                   nickel incorporation protein HypA/HybF, conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02096"
FT                   /db_xref="GOA:B8FH08"
FT                   /db_xref="InterPro:IPR000688"
FT                   /db_xref="InterPro:IPR020538"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FH08"
FT                   /protein_id="ACL02096.1"
FT                   /translation="MHEMGIALQIAEIAKSAIPKTPADLKVKAVNLRVGKLTAIVPDSL
FT                   RFCFEIVAKDTPLAEAELNIEEIPIVAVCKECYTETIITDADFSCEKCKSGKLDIISGR
FT                   ELTVSSIEVADPEEMKQAQKKSKKEK"
FT   gene            complement(546243..547229)
FT                   /locus_tag="Dalk_0388"
FT   CDS_pept        complement(546243..547229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0388"
FT                   /product="dihydrouridine synthase DuS"
FT                   /note="PFAM: dihydrouridine synthase DuS; KEGG:
FT                   dde:Dde_3089 dihydrouridine synthase family protein; IMG
FT                   reference gene:2503006085; PFAM: Dihydrouridine synthase
FT                   (Dus); TIGRFAM: putative TIM-barrel protein, nifR3 family;
FT                   InterPro:Aldolase-type TIM barrel;
FT                   InterPro:tRNA-dihydrouridine synthase;
FT                   InterPro:tRNA-dihydrouridine synthase, conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02097"
FT                   /db_xref="GOA:B8FH09"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR004652"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH09"
FT                   /protein_id="ACL02097.1"
FT                   /translation="MAIGGKTIANRLILAPMAGLTHIAFREVMALYGGYGLLYTGMAGA
FT                   KSVPHENPKVSTVFSWREKELDHTVCQIFGSVPETMAKAAERIEAEGFFGVDINCGCSA
FT                   RAICRFDSGAALLAKPDLAAQVVRAVRKAVNIPVIVKFRTGWKDDPAHAVSMARLFCDE
FT                   GADALIFHPRVAPDLRTRPPKWEYIGLVKDAVKVPVFGNGNVISLDDAAKMLSMSGCDG
FT                   VALGRIALAQPWIMAQWSQGMKPALEDYKTAGAAMASFCAKRFEPRTAFLRFMKFSPYY
FT                   CANFQFGHALHKRLFAAKEIDNIIPVLENFFQSDPPLNKRPTPGLFV"
FT   gene            complement(547383..548447)
FT                   /locus_tag="Dalk_0389"
FT   CDS_pept        complement(547383..548447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0389"
FT                   /product="branched-chain amino acid aminotransferase"
FT                   /EC_number="2.6.1.42"
FT                   /note="TIGRFAM: branched-chain amino acid aminotransferase;
FT                   PFAM: aminotransferase class IV; KEGG: dol:Dole_2663
FT                   branched-chain amino acid aminotransferase; IMG reference
FT                   gene:2503006086; PFAM: Aminotransferase class IV; TIGRFAM:
FT                   branched-chain amino acid aminotransferase, group II;
FT                   InterPro:Aminotransferase, class IV;
FT                   InterPro:Aminotransferase, class IV, conserved site;
FT                   InterPro:Branched-chain amino acid aminotransferase II"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02098"
FT                   /db_xref="GOA:B8FH10"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR005786"
FT                   /db_xref="InterPro:IPR018300"
FT                   /db_xref="InterPro:IPR033939"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH10"
FT                   /protein_id="ACL02098.1"
FT                   /translation="MAIKVTKASNLKPHPADDKLGFGKIFTDHMFNMDYAEGKGWFDPR
FT                   IEPYAALSCDPAMLVFHYGQAIFEGLKAYRTPKGNVQLFRPQANFARFNRSASMLCIPN
FT                   FDEAEALDHLRQLISVEKDWVPSSPGTSLYIRPTIIATDNYLGVAASQTYRFFTILSPV
FT                   GAYYAEGFAPIKILVTTEHVRASRQGIGEAKTAANYAASLLAGHKAAKAGYTQVLWLDA
FT                   VERKYVEEVGSMNIFFVIDGEVVTPELNGSILPGITRDSVLTMARHWGLPVSERHISIE
FT                   EIFEANENGKLEECFGTGTAAVISPVGELRYDERVITIRNNEVGPLSQKLYDAITGIQF
FT                   GEKEDPFGWIVPVD"
FT   gene            548664..549080
FT                   /locus_tag="Dalk_0390"
FT   CDS_pept        548664..549080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0390"
FT                   /product="Nucleoside-diphosphate kinase"
FT                   /EC_number="2.7.4.6"
FT                   /note="PFAM: nucleoside diphosphate kinase; KEGG:
FT                   fph:Fphi_0549 nucleoside-diphosphate kinase; IMG reference
FT                   gene:2503006087; PFAM: Nucleoside diphosphate kinase;
FT                   InterPro:Nucleoside diphosphate kinase; InterPro:Nucleoside
FT                   diphosphate kinase, active site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02099"
FT                   /db_xref="GOA:B8FH11"
FT                   /db_xref="InterPro:IPR001564"
FT                   /db_xref="InterPro:IPR023005"
FT                   /db_xref="InterPro:IPR034907"
FT                   /db_xref="InterPro:IPR036850"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FH11"
FT                   /protein_id="ACL02099.1"
FT                   /translation="MEKTLSIIKPDAVERNLIGNIVKRFEDAGIKIVAMKLLKLSKAQA
FT                   EAFYAVHKERPFYGELTDYMSSGPCVPMILEGEGVILKNREIMGATDPKEAAAGTIRAD
FT                   LAIDKEKNSVHGSDAPETAAQEIAFFFTEYELAG"
FT   gene            549080..549835
FT                   /locus_tag="Dalk_0391"
FT   CDS_pept        549080..549835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0391"
FT                   /product="RNA methyltransferase, TrmH family, group 1"
FT                   /note="TIGRFAM: RNA methyltransferase, TrmH family, group
FT                   1; PFAM: tRNA/rRNA methyltransferase (SpoU); KEGG:
FT                   dol:Dole_2624 RNA methyltransferase; IMG reference
FT                   gene:2503006088; PFAM: SpoU rRNA Methylase family; TIGRFAM:
FT                   RNA methyltransferase, TrmH family, group 1; InterPro:RNA
FT                   methyltransferase TrmH, group 1; InterPro:tRNA/rRNA
FT                   methyltransferase, SpoU"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02100"
FT                   /db_xref="GOA:B8FH12"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR004384"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH12"
FT                   /protein_id="ACL02100.1"
FT                   /translation="MPHSVDFKKIAIVLCEPQIPENIGGTARAMANMGLERLIVVKPKS
FT                   LAQEKIYPMATAGARHLIDSMEVVDDLKTALKEFNWVVGTTARLGSHRKAMTVENMAAK
FT                   LISMTGENRVALVFGREDRGLSTEDVRLCHQLVNIRTAGFSSLNLAQAVLLVCYELFKA
FT                   GSDKPRESTPKLANKFDLEAMYDQLSELLVRIDFINPENPEHWMDNIRRFFTRHPLTAR
FT                   DVKIVRGICRQVDWYTERRFKKMEAKKKD"
FT   gene            complement(550157..551989)
FT                   /locus_tag="Dalk_0392"
FT   CDS_pept        complement(550157..551989)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0392"
FT                   /product="TPR repeat-containing protein"
FT                   /note="PFAM: TPR repeat-containing protein; peptidase M48
FT                   Ste24p; Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: dps:DP0525
FT                   hypothetical protein; IMG reference gene:2503006089; PFAM:
FT                   Peptidase family M48; Tetratricopeptide repeat;
FT                   InterPro:Peptidase M48; InterPro:Tetratricopeptide repeat;
FT                   InterPro:Tetratricopeptide repeat-containing;
FT                   InterPro:Tetratricopeptide TPR-1;
FT                   InterPro:Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02101"
FT                   /db_xref="GOA:B8FH13"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH13"
FT                   /protein_id="ACL02101.1"
FT                   /translation="MFTNLILIIVVLVSYDYAPESRDLLLSQGKTWHIFYLAALFLVVA
FT                   RARFKNFARRIPQRSKNKNLSVLDKLAVQQMLMAVVFFVTCLFLTPLKPFLLEIPLISK
FT                   IPTLSALLALFMFLAFLIAVWHMAHPMYAKLGQTMVSRREYVRQQVMLVAPILIPWTGF
FT                   YGVQDILLLIPSASWHAALMSAPGQLIYLFVMMTALVLLGPRIVLYFWGCAPVPPSPER
FT                   DRMEALCRKANFTCAEILRWPLFGGHILTAAVFGIASRFRYILMTDAMLRMATPDELDA
FT                   VLSHEIGHAKKKHMLLFLLIVAAMAPAGYLVWSALEIPVLYLSTRFVPMSMKAEQYAWF
FT                   LNLAQGLFLVTFAVLYLRFVFGYFLRNFERQADLYVYEVLPSALPLVTMFRKIAFFSGR
FT                   SADEPNWHHFGLNQRIDYILKCESNRLWIDRHNAKVKKSLLILVAVFVGTLVAQGALAW
FT                   NGFHNRVRLGVTLAALEARPDGMEELDKAPSLLGDMYLAANDIENAIDAYEKALQIHPD
FT                   DAMALNNLAWTYATCEKEELRNPERALELALRAVEISPRPHILDTLAESYYVNSMYDKA
FT                   VETQTRAIKAGPPSEELNDYQKHLDKYIQARDGN"
FT   gene            complement(551999..552550)
FT                   /locus_tag="Dalk_0393"
FT   CDS_pept        complement(551999..552550)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0393"
FT                   /product="protein of unknown function DUF208"
FT                   /note="PFAM: protein of unknown function DUF208; KEGG:
FT                   dol:Dole_1180 hypothetical protein; IMG reference
FT                   gene:2503006090; PFAM: Uncharacterized BCR, COG1636;
FT                   InterPro:Protein of unknown function DUF208;
FT                   InterPro:Rossmann-like alpha/beta/alpha sandwich fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02102"
FT                   /db_xref="GOA:B8FH14"
FT                   /db_xref="InterPro:IPR003828"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH14"
FT                   /protein_id="ACL02102.1"
FT                   /translation="MKILLNICCGPCSIYCLKVLREQGHDVMGTFYRHNIHPFTECMKR
FT                   EYTLREYAAAQDLRMVWQQGYEIEEFLRNAAFRETERCRYCYHSRLKAAAMIAKKGKFD
FT                   AFTTTLLYSKFQKHELIREIGEALGKQYSVPFYYHDFREGWKYGIEESKRLGMYRQQYC
FT                   GCIYSEKDRYYNAKKDQEAR"
FT   gene            complement(552565..553266)
FT                   /locus_tag="Dalk_0394"
FT   CDS_pept        complement(552565..553266)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0394"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   dol:Dole_1179 alanine racemase domain-containing protein;
FT                   IMG reference gene:2503006091; PFAM: Alanine racemase,
FT                   N-terminal domain; TIGRFAM: pyridoxal phosphate enzyme,
FT                   YggS family; InterPro:Alanine racemase, N-terminal;
FT                   InterPro:Predicted pyridoxal phosphate-dependent enzyme,
FT                   YBL036C type"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02103"
FT                   /db_xref="GOA:B8FH15"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH15"
FT                   /protein_id="ACL02103.1"
FT                   /translation="MDNTISKNLQEIQERIQKAAEECGRDPQSIRLVAVSKTKPAEMLR
FT                   QAAAAGATIFGENYIQEAREKIAELESLDVEWHFIGHLQSNKAKYAVPLFSLIHSVDSF
FT                   KLAGEIDKQAAKAGKIQDILVQVNISGEETKSGTADEEAATLVKEISALENVRVKGLMT
FT                   MPPFFDDPDRARPFFRRLRELAQAIQNKGFKNVSMEELSMGMTGDFEAAIEEGATLVRV
FT                   GTAIFGARNYN"
FT   gene            complement(553259..553882)
FT                   /locus_tag="Dalk_0395"
FT   CDS_pept        complement(553259..553882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0395"
FT                   /product="maf protein"
FT                   /note="TIGRFAM: maf protein; PFAM: Maf family protein;
FT                   KEGG: dol:Dole_1177 maf protein; IMG reference
FT                   gene:2503006092; PFAM: Maf-like protein; TIGRFAM: MAF
FT                   protein; InterPro:Maf-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02104"
FT                   /db_xref="GOA:B8FH16"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH16"
FT                   /protein_id="ACL02104.1"
FT                   /translation="METVIPHKCTNEPLILASASPRRSYLLEQAGLEFQVIVSDADETC
FT                   PADASPRECAAMLSEKKALAVAESHPAHWVLGADTIVVTDGRILGKPSGMEEARDMITM
FT                   LGGRTHQVLTGFSIFHVDKGVRHTEVISTQVTFKSLSPDEIEWYLSTGEPFDKAGAYAI
FT                   QGIGTFLVKSISGSYTNVVGLPVCEVIEFFMAQGVIIRTSGNHG"
FT   gene            554013..555719
FT                   /locus_tag="Dalk_0396"
FT   CDS_pept        554013..555719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0396"
FT                   /product="carbon starvation protein CstA"
FT                   /note="PFAM: carbon starvation protein CstA; KEGG:
FT                   pvi:Cvib_1268 carbon starvation protein CstA; IMG reference
FT                   gene:2503006093; PFAM: Carbon starvation protein CstA;
FT                   InterPro:Carbon starvation protein CstA"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02105"
FT                   /db_xref="GOA:B8FH17"
FT                   /db_xref="InterPro:IPR003706"
FT                   /db_xref="InterPro:IPR025299"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH17"
FT                   /protein_id="ACL02105.1"
FT                   /translation="MNAFVVMAIVLAWFYLGYRFYGTWVEKNLVKPDDSRPTPAYEFED
FT                   GIDYSPAKVSFLWGHHFSSIAGAGPIIGPILATAWFGWASAILWIAIGCVFIGAVHDYL
FT                   SLMLSVRHQGRGISEVAGDTLGNVTRFSFGILIWITLVFIIAVFAVSAANALANMPELV
FT                   IPTFGVCFVAVLLGLAVYKLKINAVLASVGAVFLAYFLIYVGYNYPVALDGWEHQSKVM
FT                   LYLNLLMAYCLIASMLPVWVLLQPRDFISSVKLFVGLFLGLLGIVAARPDFTAPAFITG
FT                   SDKPMWPIMFITLACGAVSGFHCLVGTGTTSKQLDKESHGKVVGYGGMIMEGVLAALVV
FT                   VVVGAGLKWGNAPAGEAAGLYFASSLEQGWIVAFSNGFGAIVGDAGLPFLSAAVAALLG
FT                   GVMVKTFVMTSLDTSTRLGRFIFMETLFSNVKFLRHTFVATMGTLAPAYYLAATGNWKN
FT                   IWKLFGASNQLIAAISLLVITAWLAQRRRAIAPVIFPALFMVATTIGALGWSVFNKNGY
FT                   LGSGPGHDLMLGVISLALIGLALVIACSAAFSLLKDKGADKRHEGDSGAPA"
FT   gene            555799..557250
FT                   /locus_tag="Dalk_0397"
FT   CDS_pept        555799..557250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0397"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: protein of unknown function DUF147; YbbR
FT                   family protein; KEGG: sfu:Sfum_3455 protein of unknown
FT                   function DUF147; IMG reference gene:2503006094; PFAM: DisA
FT                   bacterial checkpoint controller nucleotide-binding;
FT                   TIGRFAM: TIGR00159 family protein; InterPro:DNA integrity
FT                   scanning protein, DisA, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02106"
FT                   /db_xref="GOA:B8FH18"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH18"
FT                   /protein_id="ACL02106.1"
FT                   /translation="MISNFLQTVLGWRALTDITLIALGMFFVYHTLRRLGTWKMFLGLV
FT                   MAMLAYVGANILGLEGITWIFSNLSHVALIGIIIIFQPEIRKMLESSVSPARREPEGPE
FT                   HEGLPMMIADALFSLAKIPCGAIFVFPGRDPLERFLTGGVPLNADPSPELILSLFDTHS
FT                   PGHDGALLVRDGRLAGYGFRLPISKSSHLPREMGTRHHAGMGLSEITDALVFVVSEERG
FT                   LVSFFKNGKLSRVPGRKEAVEAITDHWKAAASFLPQPEKGAKKWTTAVELVTAFMLTIL
FT                   LWSSVVIGRMEIVEKSVETPIVYVSLPANIALSGAKPTGTRIHMAGPKSQLDSLTADNL
FT                   RVRIDLSKAQPGKQTFFVSRESLNLPKKVDLLDADPSEINLSLEETVDMEVPVTPQLVG
FT                   QPRQGWTVVSVAVKPQKVRVVMKKGEGEQQAPAVTTTPIYLDSLGSGATIRCKIIAPPD
FT                   AQPSDKPWPDVEVQIRLIPVEAKTE"
FT   gene            complement(557408..558706)
FT                   /locus_tag="Dalk_0398"
FT   CDS_pept        complement(557408..558706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0398"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mem:Memar_1475 hypothetical protein; IMG
FT                   reference gene:2503006095"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02107"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH19"
FT                   /protein_id="ACL02107.1"
FT                   /translation="MPYQGGSRLPFERASKLGHLQVIKSDLVNQLINCFEDPEPACVKS
FT                   SAAWEEVPLGGDPLRLIFAVDGSNQTVRSEFKPYKEVSFVKTALLRLDQHAIAKLDPEA
FT                   PHPMAMRDIMADSAMYHSTVFPLKGVSIQGKNNYDAVRQIVYDSLRDHSLGEEPYKTLK
FT                   WLAYQKWTSKRQKSLGFQCPHCGNELDGLPFDTDEGPCPVCKGHLFLTDMIGFHLEMAE
FT                   DSVPESVSNAYMLVYETLLLFTGIRHFWERKKYNTLKKSLFLKDGPLTLRSQYSKLVIP
FT                   IRAFLEYTKRQGVPIHIAGQEKTGSFVDHLEIINKEVPEGSIFIPNDKYIRREIQHRPD
FT                   RSEPYGSRTNYGNKVFVKSGNQHYVVLSIPTGDYKDSNSIDDFIGAREIIATLPKIISH
FT                   RHECALVPIELANGVASLSSYPSAAILKLFADI"
FT   gene            complement(558734..560728)
FT                   /locus_tag="Dalk_0399"
FT   CDS_pept        complement(558734..560728)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0399"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: lsp:Bsph_0493 hypothetical protein; IMG
FT                   reference gene:2503006096; PFAM: Domain of unknown function
FT                   DUF87; InterPro:Domain of unknown function DUF87"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02108"
FT                   /db_xref="InterPro:IPR002789"
FT                   /db_xref="InterPro:IPR008571"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH20"
FT                   /protein_id="ACL02108.1"
FT                   /translation="MNNKASNFFNKAEHQDNPLRALVDFLKAEESNESAQNYDKMRFVG
FT                   YVLDIGFDQATIITCDPFKQAVGGVPRGSFLIMAPANFNGMPPHFSLLRVSATAPTPLS
FT                   REVQQTYFELHKKSMPELDVWTKGELQWGALSTKVLGMFFPDKDDSDKVQFSGDVNNVV
FT                   SAHRYKVFSPNMEILDIIINSMVRPENRFPIGNLRVTECSLPFANITQPDLEVNVSTDD
FT                   FKGFRTAMFGKTRLGKSNVVKIIAQSLIETTEDDKSVGQLIFDINGEYANDNPQDNNMS
FT                   LRSANKERCCVYALTKRPDTDSQPLRLNFYEQPDSTISILKSMLERDNRGSMYITNFAN
FT                   VELPGINNISSMSDDISKQRRSIRKIQMYWAILHKAGYPANENKLKKIGLKGSGYHSPN
FT                   NFDPAYNKDFRQAVFNEDFRPNNLNELVNYFETIERFRVDDPNNAIFTSSSGKPVFDAD
FT                   DLFLLGFLVPKQGSGASVISAYREFHDPLADNFAKSILKHLDNGSTVILDLGNAADVIR
FT                   QYFSDLLSKEVFRHQEQKFTANKLGNHYIQLYFEEAHNLFPRDNKDLTGVYSRFAKEGA
FT                   KFHIGMVYSTQSPSTISKELLAQTENFFVAHMSSQDEANALAKLQVQYDGLQHDILHTR
FT                   TPGYMRILTFSHRFVVPVQINKFEAVNKP"
FT   gene            complement(560721..561617)
FT                   /locus_tag="Dalk_0400"
FT   CDS_pept        complement(560721..561617)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0400"
FT                   /product="DNA adenine methylase"
FT                   /EC_number="2.1.1.72"
FT                   /note="KEGG: lsp:Bsph_0494 modification methylase DpnIIA;
FT                   TIGRFAM: DNA adenine methylase; PFAM: D12 class N6
FT                   adenine-specific DNA methyltransferase; IMG reference
FT                   gene:2503006097; PFAM: D12 class N6 adenine-specific DNA
FT                   methyltransferase; TIGRFAM: DNA adenine methylase (dam);
FT                   InterPro:Adenine-specific methyltransferase, domain 2;
FT                   InterPro:D12 class N6 adenine-specific DNA
FT                   methyltransferase; InterPro:DNA methylase, N-6
FT                   adenine-specific, conserved site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02109"
FT                   /db_xref="GOA:B8FH21"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR012263"
FT                   /db_xref="InterPro:IPR012327"
FT                   /db_xref="InterPro:IPR023095"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH21"
FT                   /protein_id="ACL02109.1"
FT                   /translation="MYKSHIENLQWFKSDNQKHNKHMMTSNNGIVSPFLKWAGGKRWFV
FT                   AKHADLLPRTFNRYFEPFLGSGAVYFHLQPENAYLGDSNKDLIDTYIAIQKNWKLVLRH
FT                   LKEHKKAHCREYYYRVRAQTPRSLQAKAARFIYLNRTCWNGLYRVNLQGKFNVPIGTRN
FT                   SVIFDTDDFEKVSQALQGAFLLSGDFEELVNMAEENDLLFVDPPYTVRHNNNGFLKYNE
FT                   TLFSWEDQKRLFRSLDRARDRGASIVATNACSQCVMDLYTDAFSTKEVSRNSLISPNLD
FT                   SRKKFKELVIYTESRDE"
FT   gene            561925..562251
FT                   /locus_tag="Dalk_0401"
FT   CDS_pept        561925..562251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0401"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_0463 hypothetical protein; IMG
FT                   reference gene:2503006098; PFAM: Rho termination factor,
FT                   N-terminal domain; InterPro:Rho termination factor,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02110"
FT                   /db_xref="GOA:B8FH22"
FT                   /db_xref="InterPro:IPR011112"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH22"
FT                   /protein_id="ACL02110.1"
FT                   /translation="MGGKKKEAKEKPLDKMTAKELREVAKEIPGIVGVHSMNKIELLSE
FT                   IKEARGIVDDGPKKDTGLIRGLKKQINELKEKRDAAIEAKDKDQMTILRRKISKLKKKT
FT                   RRAA"
FT   gene            562313..562891
FT                   /locus_tag="Dalk_0402"
FT   CDS_pept        562313..562891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0402"
FT                   /product="Haloacid dehalogenase domain protein hydrolase"
FT                   /note="PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: sfu:Sfum_1279 hypothetical protein; IMG
FT                   reference gene:2503006099; PFAM: 5' nucleotidase, deoxy
FT                   (Pyrimidine), cytosolic type C protein (NT5C);
FT                   InterPro:5'(3')-deoxyribonucleotidase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02111"
FT                   /db_xref="GOA:B8FH23"
FT                   /db_xref="InterPro:IPR010708"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH23"
FT                   /protein_id="ACL02111.1"
FT                   /translation="MDKIDPAALAFDIDGVVADAMKLFLDIARSKHGVSGITKEDITSY
FT                   MLEDCLDMSDEVILDVIKDIIDGTYKEVLQPIEGAVDSLRRIRALGAPLLFVTARPRKS
FT                   PVEQWLRSNLGIDNGDMHIEATGSFEAKIDVLAHHGRNWFVEDRLETCFLLADAGINPV
FT                   LFRQPWNRRPHPFKEVGSWEELLPCIMGI"
FT   gene            562873..563820
FT                   /locus_tag="Dalk_0403"
FT   CDS_pept        562873..563820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0403"
FT                   /product="tyrosine recombinase XerC"
FT                   /note="TIGRFAM: tyrosine recombinase XerC; PFAM: integrase
FT                   family protein; integrase domain protein SAM domain
FT                   protein; KEGG: dol:Dole_2497 integrase family protein; IMG
FT                   reference gene:2503006100; PFAM: Phage integrase,
FT                   N-terminal SAM-like domain; Phage integrase family;
FT                   TIGRFAM: tyrosine recombinase XerC; InterPro:DNA
FT                   breaking-rejoining enzyme, catalytic core;
FT                   InterPro:Integrase, catalytic core, phage;
FT                   InterPro:Integrase, Lambda-type, N-terminal;
FT                   InterPro:Integrase, N-terminal SAM-like, phage;
FT                   InterPro:Integrase-like, catalytic core, phage;
FT                   InterPro:Integrase/recombinase, N-terminal;
FT                   InterPro:Tyrosine recombinase XerC"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02112"
FT                   /db_xref="GOA:B8FH24"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH24"
FT                   /protein_id="ACL02112.1"
FT                   /translation="MHHGDIDDQGAFFWIDSFLESLAAERRYSPATCLAYGKDLREFFS
FT                   YVAESGLQGEISPENADVERVDNLAIRGYLGFLHKKNEKSTMARKLSSLRSFYRFLEKR
FT                   GRVAVNPAQSVVTPKRKKTVAAHLTVDEAFALLDSILDDSLAGARDRAMFECLYSTGIR
FT                   VSELAGLNMGRVNFSGKTLRVLGKGDKERIVPVGAKALEHIKAYRDRLAVEGPKNPDPE
FT                   AVFLNKNGGRLTTRSIRRILEKIVRDMGLNRPLSPHGLRHTFATHMLDNGADLRSVQEL
FT                   LGHASISTTGRYTHVSIDRLMAAYDKAHPRGEKS"
FT   gene            563852..564394
FT                   /locus_tag="Dalk_0404"
FT   CDS_pept        563852..564394
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0404"
FT                   /product="20S proteasome A and B subunits"
FT                   /note="heat shock protein involved in degradation of
FT                   misfolded proteins; IMG reference gene:2503006101; PFAM:
FT                   Proteasome subunit; TIGRFAM: ATP-dependent protease HslVU,
FT                   peptidase subunit; InterPro:ATP-dependent protease, HslV
FT                   subunit; InterPro:Proteasome, subunit alpha/beta"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02113"
FT                   /db_xref="GOA:B8FH25"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022281"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH25"
FT                   /protein_id="ACL02113.1"
FT                   /translation="MSNPLDFRGTTILAVRKDGKTAIAGDGQVTLGNTVVKHTAQKVRK
FT                   IYHDKIVVGFAGATADALNLFDKFEGKLEQYNGNLTRAAVELARDWRTDKYLRKLEAMM
FT                   IAVDDQRMFLISGNGDIIEPDEGVIGIGSGGAFAQAAATGLIRHSDLDASAIAKAAMDV
FT                   AASICIYTNQVVTLHEI"
FT   gene            564402..565775
FT                   /locus_tag="Dalk_0405"
FT   CDS_pept        564402..565775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0405"
FT                   /product="heat shock protein HslVU, ATPase subunit HslU"
FT                   /note="heat shock protein involved in degradation of
FT                   misfolded proteins; IMG reference gene:2503006102; PFAM:
FT                   AAA domain (Cdc48 subfamily); C-terminal, D2-small domain,
FT                   of ClpB protein; ATPase family associated with various
FT                   cellular activities (AAA); TIGRFAM: ATP-dependent protease
FT                   HslVU, ATPase subunit; InterPro:ATPase, AAA+ type, core;
FT                   InterPro:ATPase, AAA-2; InterPro:ATPase, AAA-type, core;
FT                   InterPro:Clp ATPase, C-terminal; InterPro:Heat shock
FT                   protein HslU"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02114"
FT                   /db_xref="GOA:B8FH26"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004491"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FH26"
FT                   /protein_id="ACL02114.1"
FT                   /translation="MEDLKPREIVQELDKYIIGQDHAKRFVAIALRNRWRRRQVPQDLR
FT                   DEIAPKNIILIGPTGVGKTEISRRLAKLADVPFLKVEATKFTEVGYVGRDVESMIRDLV
FT                   EVTVNMVREKEEDEVALPAMKAAEERILDILLPPRRETQPFADAEGETTLEIVTRGDSN
FT                   QDSTREKLRKMLHSGKFDDRYVDLEINERNTPVVEIFSNMGMEEVGFNFKDMLGGLMPK
FT                   NTKKRKVKVSEAMEILTQQEAQGLIDMEKVVKKALSRVEESGIIFLDEIDKIAVGGGKG
FT                   QGPDVSREGVQRDLLPIVEGTTVNTKYGMVKTDHILFIASGAFHMTKPSDLTPELQGRF
FT                   PIRVELDSLTEHDFMRILTEPKNAIMLQYQELLKTEGVELVFTQDSVAEIASIAKEVND
FT                   RTENIGARRLHTVMECLLEDILYDAPEVPEKKITIGAEMVRAKLESIKEDEDLSRYIL"
FT   gene            565812..566687
FT                   /locus_tag="Dalk_0406"
FT   CDS_pept        565812..566687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0406"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="KEGG: dol:Dole_2494 acetylglutamate kinase; TIGRFAM:
FT                   acetylglutamate kinase; PFAM: aspartate/glutamate/uridylate
FT                   kinase; IMG reference gene:2503006103; PFAM: Amino acid
FT                   kinase family; TIGRFAM: acetylglutamate kinase;
FT                   InterPro:Acetylglutamate kinase;
FT                   InterPro:Aspartate/glutamate/uridylate kinase;
FT                   InterPro:Glutamate/acetylglutamate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02115"
FT                   /db_xref="GOA:B8FH27"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH27"
FT                   /protein_id="ACL02115.1"
FT                   /translation="MEKTVADILVEALPYIREFSGMTIVIKYGGHAMVDEDLKDAFARD
FT                   ITLLKLVGANPVVVHGGGPQINKVLDQMGICSTFVKGMRITDQPTMDVVEMVLGGKVNK
FT                   SIVAQINQAGGRAVGLSGKDGELIKARKMTIMHKETADSPPEIIDPGLVGEVTAVNPRI
FT                   INTLTREGFIPIIAPVGTGDNGETFNINADLVASHVATALKAGRLIMVTDVDGVKDQED
FT                   NLLSSLNAHAAATLIDEGVIAGGMIPKVNCALDAISWGVNKVHIINGRRRHALLLELLT
FT                   DKGIGTEFKA"
FT   gene            566713..567900
FT                   /locus_tag="Dalk_0407"
FT   CDS_pept        566713..567900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0407"
FT                   /product="acetylornithine and succinylornithine
FT                   aminotransferase"
FT                   /EC_number="2.6.1.11"
FT                   /note="TIGRFAM: acetylornithine and succinylornithine
FT                   aminotransferase; PFAM: aminotransferase class-III; KEGG:
FT                   dol:Dole_2493 acetylornithine and succinylornithine
FT                   aminotransferase; IMG reference gene:2503006104; PFAM:
FT                   Aminotransferase class-III; TIGRFAM: acetylornithine and
FT                   succinylornithine aminotransferases;
FT                   InterPro:Acetylornithine/succinylornithine
FT                   aminotransferase; InterPro:Aminotransferase class-III;
FT                   InterPro:Pyridoxal phosphate-dependent transferase, major
FT                   domain; InterPro:Pyridoxal phosphate-dependent transferase,
FT                   major region, subdomain 1; InterPro:Pyridoxal
FT                   phosphate-dependent transferase, major region, subdomain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02116"
FT                   /db_xref="GOA:B8FH28"
FT                   /db_xref="InterPro:IPR004636"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH28"
FT                   /protein_id="ACL02116.1"
FT                   /translation="MNNTKQLADQVIANTYARNPICLVKGQGVKLWDEDGKEYTDFLAG
FT                   IAVCILGHAHPAVTQAVSEQAAKLVHVSNLFYTEPQTLLADQLINSCFADRVFFCNSGA
FT                   EANEAAIKMARKYFSEKGQPDKYRVIAMEKSFHGRTFATMAATGQDAIKKGFEPMMDGF
FT                   DHVPFNDLEAVEKAITDETCAVLTEPIQAEGGVMVPFPGYLPGLRELCDKKGILLIFDE
FT                   VQTGMGRTGALFAHQQMGATPDIMTLAKGLANGLPIGAALATEEVASAFTPGAHATTFG
FT                   GTPLVTAAARAVMITLMDQDLLEMSISVGDYFKNQLLLLKEKFDCVEEVRGMGLLLGLK
FT                   LNMPGGPIAAKAMEMGYIFNVTQGDVLRFVPPLIITRKDVDGLIETLDKILADCR"
FT   gene            567940..568860
FT                   /locus_tag="Dalk_0408"
FT   CDS_pept        567940..568860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0408"
FT                   /product="Ornithine transcarbamylase"
FT                   /EC_number="2.1.3.3"
FT                   /note="TIGRFAM: ornithine carbamoyltransferase; PFAM:
FT                   aspartate/ornithine carbamoyltransferase Asp/Orn-binding
FT                   region; aspartate/ornithine carbamoyltransferase
FT                   carbamoyl-P binding domain; KEGG: dol:Dole_2492 ornithine
FT                   carbamoyltransferase; IMG reference gene:2503006105; PFAM:
FT                   Aspartate/ornithine carbamoyltransferase, carbamoyl-P
FT                   binding domain; Aspartate/ornithine carbamoyltransferase,
FT                   Asp/Orn binding domain; TIGRFAM: ornithine
FT                   carbamoyltransferase; InterPro:Aspartate/ornithine
FT                   carbamoyltransferase; InterPro:Aspartate/ornithine
FT                   carbamoyltransferase, Asp/Orn-binding domain;
FT                   InterPro:Aspartate/ornithine carbamoyltransferase,
FT                   carbamoyl-P binding; InterPro:Ornithine
FT                   carbamoyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02117"
FT                   /db_xref="GOA:B8FH29"
FT                   /db_xref="InterPro:IPR002292"
FT                   /db_xref="InterPro:IPR006130"
FT                   /db_xref="InterPro:IPR006131"
FT                   /db_xref="InterPro:IPR006132"
FT                   /db_xref="InterPro:IPR024904"
FT                   /db_xref="InterPro:IPR036901"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH29"
FT                   /protein_id="ACL02117.1"
FT                   /translation="MKVDITTLSDLSKEQIDQLFANARDGKKKHKQGVYEPVLQGKTAG
FT                   LVFDKPSTRTRVSFEAAMIQLGGVPMYIQSGDTQIKRQEPVEDTARVLSRYLDALVVRT
FT                   FSQEFVEDLAREASIPIINALTDVYHPCQVLSDILTVIELKGGYEGVKIAWIGDGNNVA
FT                   HSWISAAAILGLDLVLACPDDHLPEQTILDKVKESSAGSVKVVSDPKEAAVGADVLYTD
FT                   VWASMGQEEESDERMKSFEGYVVDQALVNLAAKDVSVMHCLPAHRGEEITAGVLEGPNS
FT                   VVWDQAENKLHMHKAILDALIRLWK"
FT   gene            568871..570073
FT                   /locus_tag="Dalk_0409"
FT   CDS_pept        568871..570073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0409"
FT                   /product="Argininosuccinate synthetase"
FT                   /EC_number="6.3.4.5"
FT                   /note="catalyzes the formation of
FT                   2-N(omega)-(L-arginino)succinate from L-citrulline and
FT                   L-aspartate in arginine biosynthesis, AMP-forming; IMG
FT                   reference gene:2503006106; PFAM: Arginosuccinate synthase;
FT                   TIGRFAM: argininosuccinate synthase;
FT                   InterPro:Argininosuccinate synthase;
FT                   InterPro:Argininosuccinate synthase, conserved site;
FT                   InterPro:Rossmann-like alpha/beta/alpha sandwich fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02118"
FT                   /db_xref="GOA:B8FH30"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FH30"
FT                   /protein_id="ACL02118.1"
FT                   /translation="MGKDIKKVVLAYSGGLDTSVILKWLVETYQCEVVAFSADIGQGEE
FT                   LEPVRGKAEASGACAVYIDDLREEFVKDYVFPAFRANAIYEGQYLLGTSLARPLISKRQ
FT                   MEIAKLEGADAVSHGATGKGNDQVRFELSYLAIDPAIKIIAPWREWDLNSRTKLMAYAE
FT                   KHGIPVPTTQAKPYSSDRNLLHISFEGGVLEDPWAPPEEDMFVMSVSPQQAPDQPEEVL
FT                   IQFEQGNPVAVNGEKLSPANLLAKLNELGGKHGVGRMDIVENRFVGMKSRGVYETPGGT
FT                   ILRIAHMNMETLTMDREVAHLRDSLIPKYAELVYNGFWFSPEMKLLQTTIDATQENVCG
FT                   EVLLELYKGNCRVLGRRSDKSLYRMDFATFEEDEVYRQKDAEGFIRLNSLRLRIQSMMN
FT                   K"
FT   gene            570084..571481
FT                   /locus_tag="Dalk_0410"
FT   CDS_pept        570084..571481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0410"
FT                   /product="Argininosuccinate lyase"
FT                   /EC_number="4.3.2.1"
FT                   /note="TIGRFAM: argininosuccinate lyase; PFAM: fumarate
FT                   lyase; KEGG: dol:Dole_2490 argininosuccinate lyase; IMG
FT                   reference gene:2503006107; PFAM: Lyase; TIGRFAM:
FT                   argininosuccinate lyase; InterPro:Argininosuccinate lyase;
FT                   InterPro:Delta crystallin; InterPro:Fumarate lyase;
FT                   InterPro:Fumarate lyase, conserved site;
FT                   InterPro:L-Aspartase-like; InterPro:Lyase 1, N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02119"
FT                   /db_xref="GOA:B8FH31"
FT                   /db_xref="InterPro:IPR000362"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR009049"
FT                   /db_xref="InterPro:IPR020557"
FT                   /db_xref="InterPro:IPR022761"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="InterPro:IPR029419"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FH31"
FT                   /protein_id="ACL02119.1"
FT                   /translation="MAEHKPWDGRFAEKTDDMVEAFTSSIQVDKRLYAHDITGSIAHAR
FT                   TLAEAGVITSDEADAMEKGLRQVKGEIEAGNFKYDDSLEDIHMHIESRLTEILGPTAAK
FT                   LHTGRSRNDQIALDNRLYLRDETRRIIAMLHELRQAIVDSAQAHLDYFVPGYTHLQRAQ
FT                   PVLLSHHLMAYYEMFTRDSDRFTDALYRINVMPLGSAALAGTTFPLDREYTASLLGFEG
FT                   VTQNSMDAVSDRDFIMEFLSDASICMVHLSRMSEELVLWSSSEFAFLNMPDAFATGSSI
FT                   MPQKKNPDVPELVRGKTGRVVGSLMAILTTMKSLPMAYNRDMQEDKPPLFDAVDTLKAC
FT                   VAMFARMVPKLEFNRRNMFDASNQGFLNATDMADYLVEKGVPFREAHGIVGRAVAYALD
FT                   RGRELHEISLNDLRKFSDKLEKDLYEALTVEHVVERRRTIGGTASVNVIAAIGRAQTQL
FT                   QAETSGD"
FT   gene            571490..571948
FT                   /locus_tag="Dalk_0411"
FT   CDS_pept        571490..571948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0411"
FT                   /product="hypothetical protein Dalk_0411"
FT                   /note="KEGG: dps:DP0434 hypothetical protein; IMG reference
FT                   gene:2503006108; InterPro:Fibronectin type III domain;
FT                   InterPro:Fibronectin, type III;
FT                   InterPro:Immunoglobulin-like fold"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02120"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH32"
FT                   /protein_id="ACL02120.1"
FT                   /translation="MPGMRQYFICTLALILAFSIGCGKKGPPRAPHTQPPAPACGLEAE
FT                   MLEDSRVRLTWNQAGCVAGGKVDGFAVFMAREKLDKEACKNCPMNFQRIATVHVGKFNP
FT                   WQTQSDKAVHMTPVLEGFRYIFKVTAFGPGGEAQDSERVSVEAIPAAP"
FT   gene            571993..573246
FT                   /locus_tag="Dalk_0412"
FT   CDS_pept        571993..573246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0412"
FT                   /product="diaminopimelate decarboxylase"
FT                   /EC_number="4.1.1.20"
FT                   /note="TIGRFAM: diaminopimelate decarboxylase; PFAM:
FT                   Orn/DAP/Arg decarboxylase 2; KEGG: sfu:Sfum_0058
FT                   diaminopimelate decarboxylase; IMG reference
FT                   gene:2503006109; PFAM: Pyridoxal-dependent decarboxylase,
FT                   C-terminal sheet domain; Pyridoxal-dependent decarboxylase,
FT                   pyridoxal binding domain; TIGRFAM: diaminopimelate
FT                   decarboxylase; InterPro:Alanine racemase/group IV
FT                   decarboxylase, C-terminal; InterPro:Diaminopimelate
FT                   decarboxylase; InterPro:Orn/DAP/Arg decarboxylase 2,
FT                   C-terminal; InterPro:Orn/DAP/Arg decarboxylase 2,
FT                   N-terminal; InterPro:Ornithine/DAP/Arg decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02121"
FT                   /db_xref="GOA:B8FH33"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002986"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH33"
FT                   /protein_id="ACL02121.1"
FT                   /translation="MHHFQYQNNALYCEDVPVADIAANLGTPLFIYSHATLTRHFQAFD
FT                   KAFGDVDHIICYSAKANTNGAILKMFADMGTGLDVVSGGELHRGLKAGIPANKIAYAGV
FT                   GKTQDEIDLALNSGILMFNVESFEELQAINARAKALGKKAPISLRVNPNVDAKTHPYIS
FT                   TGMKKNKFGIAKEAVVEAYKAAHELDSTEVVGIDFHIGSQITQVGPFVEAMESVKSLAA
FT                   ELKGMGIGINYLDVGGGLGINYDDEEPPEPDEYAKAICKVIADFPITVVLEPGRAMVGN
FT                   AGIMVTRFLYLKEGATKNFIIVDAGMNDLIRPSIYGAFHLIQPVNKREGDPLTGDVVGP
FT                   ICESTDFLAKDREIGAVVPGDLLAVMSAGAYGFAMSSNYNSRPRACEVMVKGNAFEVIR
FT                   QRENYEDLTRGEVIPTFL"
FT   gene            573258..574094
FT                   /locus_tag="Dalk_0413"
FT   CDS_pept        573258..574094
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0413"
FT                   /product="Diaminopimelate epimerase"
FT                   /EC_number="5.1.1.7"
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: sat:SYN_00169
FT                   diaminopimelate epimerase; IMG reference gene:2503006110;
FT                   PFAM: Diaminopimelate epimerase; TIGRFAM: diaminopimelate
FT                   epimerase; InterPro:Diaminopimelate epimerase;
FT                   InterPro:Diaminopimelate epimerase, active site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02122"
FT                   /db_xref="GOA:B8FH34"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH34"
FT                   /protein_id="ACL02122.1"
FT                   /translation="MTGLQFYKMSGSGNDFIIADNRDGKIAKDDMPGLAKALCARKISI
FT                   GADGLVLVENSDQCDFKWQFYNSDGSEAEMCGNASRCVARFAYLNKIAGEKMTFETLAG
FT                   VIHAEVLGETVKAGLTDPTDVKYFYALDVDGTTCNVTSMNTGVPHVVLLVGNIEKPDVE
FT                   ELGRKIRYHEAFAPAGTNVNFVEFRRGELAVRTYERGVEGETLACGTGAVAAALARVAA
FT                   DAALSPVKVLTRSGGYLYVHYKRVPGGYGNIFLEGDANIIYTGEIGPDALKLAQKK"
FT   gene            574111..575277
FT                   /locus_tag="Dalk_0414"
FT   CDS_pept        574111..575277
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0414"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   sfu:Sfum_0054 aminotransferase, class I and II; IMG
FT                   reference gene:2503006111; PFAM: Aminotransferase class I
FT                   and II; TIGRFAM: LL-diaminopimelate aminotransferase;
FT                   InterPro:Aminotransferase, class I/classII;
FT                   InterPro:Aminotransferases, class-I,
FT                   pyridoxal-phosphate-binding site;
FT                   InterPro:LL-diaminopimelate aminotransferase;
FT                   InterPro:Pyridoxal phosphate-dependent transferase, major
FT                   domain; InterPro:Pyridoxal phosphate-dependent transferase,
FT                   major region, subdomain 1; InterPro:Pyridoxal
FT                   phosphate-dependent transferase, major region, subdomain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02123"
FT                   /db_xref="GOA:B8FH35"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019881"
FT                   /db_xref="InterPro:IPR019942"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH35"
FT                   /protein_id="ACL02123.1"
FT                   /translation="MDQFEKADRLKQLPPYLFAEIDRKKEEVRAKGVDIIDLGVGDPDL
FT                   PTPDHIIKALNEAAKDPRYHRYPSYSGMGAFNKAVARFYDKRFGVNLELSEIITLIGSK
FT                   EGIAHIPLAYINPGDVALVPSPAYPVYQIGVEFCGGSCHIMPLLKENGFLPDLDAIPED
FT                   VASKAKLMFINYPNNPTAAVADEAFFKKVIEFAKKYKIIVCHDAAYTEMSFDGYAPMSF
FT                   MEVDGAKEVGIEFHSLSKTYNMTGWRLGFAVGNAEVIGALGKVKSNIDSGAFDAVQMAG
FT                   IEALDGDQQCVADNSKIYQERRDLLMEGLNAMGLKCTPPKATFYMWVEVPEGYSSADFC
FT                   TKLLTEAGIVATPGNGFGAPGEGYFRMALTQNKDRMAEAVKRMQELKL"
FT   gene            575290..575805
FT                   /locus_tag="Dalk_0415"
FT   CDS_pept        575290..575805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0415"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: dol:Dole_2488
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK;
FT                   IMG reference gene:2503006112; PFAM:
FT                   7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase (HPPK);
FT                   TIGRFAM: 2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; InterPro:7,
FT                   8-Dihydro-6-hydroxymethylpterin-pyrophosphokinase, HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02124"
FT                   /db_xref="GOA:B8FH36"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH36"
FT                   /protein_id="ACL02124.1"
FT                   /translation="MEHTVYIGFGSNMGDLKKNCQWAMDSLGRSGVCMVEKISRLYDTE
FT                   PLDYEAQDRFMNGAARIRTSLAPRDLLALLKSLEKEAGRTNAGPRFGPRVLDMDILFFG
FT                   ELVMESGDLEIPHPRLHKRRFVLAPLCDIAPELQHPVLKKTVSALLDKLDDGGKDVMVL
FT                   EDVLATTA"
FT   gene            575849..576100
FT                   /locus_tag="Dalk_0416"
FT   CDS_pept        575849..576100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0416"
FT                   /product="TRASH domain protein"
FT                   /note="SMART: TRASH domain protein; KEGG: sfu:Sfum_0052
FT                   TRASH domain protein; IMG reference gene:2503006113; PFAM:
FT                   MYM-type Zinc finger with FCS sequence motif; InterPro:Zinc
FT                   finger, MYM-type"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02125"
FT                   /db_xref="GOA:B8FH37"
FT                   /db_xref="InterPro:IPR010507"
FT                   /db_xref="InterPro:IPR011017"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH37"
FT                   /protein_id="ACL02125.1"
FT                   /translation="MWLKFLIFAGLGYMVYKALAGPGPEKNRPRMDRQDVRQIDDVMVQ
FT                   DPVCKVYFPKREGVAAKVDGQLMYFCSEECMKKYLNQK"
FT   sig_peptide     575849..575908
FT                   /locus_tag="Dalk_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006113_SP"
FT   gene            576141..576785
FT                   /locus_tag="Dalk_0417"
FT   CDS_pept        576141..576785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0417"
FT                   /product="Transaldolase"
FT                   /EC_number="2.2.1.2"
FT                   /note="KEGG: dol:Dole_2486 putative transaldolase; TIGRFAM:
FT                   transaldolase; PFAM: Transaldolase; IMG reference
FT                   gene:2503006114; PFAM: Transaldolase; TIGRFAM:
FT                   fructose-6-phosphate aldolase, TalC/MipB family;
FT                   InterPro:Aldolase-type TIM barrel; InterPro:Transaldolase;
FT                   InterPro:Transaldolase 3A/3B; InterPro:Transaldolase,
FT                   active site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02126"
FT                   /db_xref="GOA:B8FH38"
FT                   /db_xref="InterPro:IPR001585"
FT                   /db_xref="InterPro:IPR004731"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018225"
FT                   /db_xref="InterPro:IPR022999"
FT                   /db_xref="InterPro:IPR033919"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8FH38"
FT                   /protein_id="ACL02126.1"
FT                   /translation="MKFFIDTANIDEIKEANSMGMVDGVTTNPSLIAKEGRPFEDIIKD
FT                   ICAEVDGPISAEVISTEAKSMIEEGKKLAAIHKNIVIKIPMIPDGMIATRALSSEGIPV
FT                   NVTLVFSPLQALVAAKAGAAFVSPFVGRLDDLANEGMLLIEQMVTIYNNYAFDTEVLVA
FT                   SVRNPLHVLEAAMMGADVATIPFGVIKKMMGHPLTDKGLAAFLADYEKSKK"
FT   gene            576815..577402
FT                   /locus_tag="Dalk_0418"
FT   CDS_pept        576815..577402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0418"
FT                   /product="CDP-diacylglycerol/glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol/glycerol-3-phosphate
FT                   3-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: dol:Dole_2485
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; IMG reference gene:2503006115;
FT                   PFAM: CDP-alcohol phosphatidyltransferase; TIGRFAM:
FT                   CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase; InterPro:CDP-alcohol
FT                   phosphatidyltransferase;
FT                   InterPro:CDP-diacylglycerol--glycerol-3-phosphate
FT                   3-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02127"
FT                   /db_xref="GOA:B8FH39"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004570"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH39"
FT                   /protein_id="ACL02127.1"
FT                   /translation="MASGRSFKDIVLHPNTLTLFRVVTIPGIVILLLPQEPGKLFCFIA
FT                   AVLFSLAAISDGLDGYYARSLGLVSNFGKFMDPLADKLLVMSTLTMLTWHQWIPGWIAC
FT                   VIVGRELAVTGLRGIAAEQGKVIAAEKLGKYKMGFQIGAIIPLLLHHKYYFTESFFLDF
FT                   GQVGYWVLWIALVFTIWSGAEYFRNYSKVIRS"
FT   gene            577473..577547
FT                   /locus_tag="Dalk_R0003"
FT   tRNA            577473..577547
FT                   /locus_tag="Dalk_R0003"
FT                   /product="tRNA-Gly"
FT                   /note="IMG reference gene:2503006116"
FT   gene            577557..577631
FT                   /locus_tag="Dalk_R0004"
FT   tRNA            577557..577631
FT                   /locus_tag="Dalk_R0004"
FT                   /product="tRNA-Cys"
FT                   /note="IMG reference gene:2503006117"
FT   gene            577793..578799
FT                   /pseudo
FT                   /locus_tag="Dalk_0419"
FT   gene            complement(578929..579498)
FT                   /locus_tag="Dalk_0420"
FT   CDS_pept        complement(578929..579498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0420"
FT                   /product="protein of unknown function UPF0157"
FT                   /note="PFAM: protein of unknown function UPF0157; KEGG:
FT                   ppd:Ppro_1483 hypothetical protein; IMG reference
FT                   gene:2503006119; PFAM: Uncharacterised protein family
FT                   (UPF0157); InterPro:Uncharacterised protein family UPF0157"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02128"
FT                   /db_xref="InterPro:IPR007344"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH40"
FT                   /protein_id="ACL02128.1"
FT                   /translation="MAEKSLEQRIKEAVAEKIDMAPYNPARPEMFRQEAEFLQNRFPAP
FT                   LIRRVEHFGSTAVPELTAKPIIDMLVEISSEEDAAREIVPVLKSLGYDYFWRPELDKPP
FT                   MYHWFIKRNKAGERTHHIHMVEADSKLWERLYFRDYLIQFPEAAREYAALKQKLALAHP
FT                   NDRIAYTRAKGEFIAEIMEKARAFFA"
FT   gene            complement(580024..580650)
FT                   /locus_tag="Dalk_0421"
FT   CDS_pept        complement(580024..580650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0421"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: dol:Dole_2190
FT                   TetR family transcriptional regulator; IMG reference
FT                   gene:2503006120; InterPro:Homeodomain-like;
FT                   InterPro:Tetracycline transcriptional regulator, TetR-like,
FT                   C-terminal; InterPro:Tetracycline transcriptional
FT                   regulator, TetR-related, C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02129"
FT                   /db_xref="GOA:B8FH41"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025996"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH41"
FT                   /protein_id="ACL02129.1"
FT                   /translation="MNEAFINEDEARIIKGRILGEAVQIMFKGAFPGLSIDKLAVALDM
FT                   TEEEIHAQFNNKDEIYLEIQKRGFELLGDLFSQVAAQNISPREKIRRMAVVYVSFGLEN
FT                   SAYYEVMFNRQGPKYADYKETPMEPNALAEKMAALQVLVNVETAVREVLSETPNAADAD
FT                   IWERVIRGWMLLHGYISLINNRTLQELEAQPTDLLEGILDSLTSI"
FT   gene            580834..581805
FT                   /locus_tag="Dalk_0422"
FT   CDS_pept        580834..581805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0422"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: lic:LIC13077
FT                   hypothetical protein; IMG reference gene:2503006121; PFAM:
FT                   alpha/beta hydrolase fold; InterPro:AB-hydrolase YheT,
FT                   putative; InterPro:Alpha/beta hydrolase fold-1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02130"
FT                   /db_xref="GOA:B8FH42"
FT                   /db_xref="InterPro:IPR012020"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH42"
FT                   /protein_id="ACL02130.1"
FT                   /translation="MNDLFLPIRPLRGAYIQTLMASSRYRALGKNPMASASREVILHCE
FT                   DRVRLQGFYSPQADGVSKGLVIMLHGWEGSVNSSYILSSGRRLYNLGYDVFRLNFRDHG
FT                   ESHHLNRGIFLSILLDEVFQGVHQAAGFSGGKPVFLVGFSLGGNFALRIAAKESGHRIP
FT                   NLKQVAAVSPVISPNRACDAIDADPLIQWYFMRKWKKSLAIKNRLFPSLGLDRVLAETN
FT                   LRDMTQALLDIYEAGYKKAHDYFDAYAVNNGWLKDVIIPTLIVTAEDDPVIPVQDFFGL
FT                   ETSAACRMIIHQYGGHNAFIETFTRTSWVDHKLQEVFASHLN"
FT   sig_peptide     580834..580914
FT                   /locus_tag="Dalk_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006121_SP"
FT   gene            582289..582825
FT                   /locus_tag="Dalk_0423"
FT   CDS_pept        582289..582825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0423"
FT                   /product="NusG antitermination factor"
FT                   /note="PFAM: NGN domain protein; KEGG: sfu:Sfum_1699 NusG
FT                   antitermination factor; IMG reference gene:2503006122;
FT                   PFAM: Transcription termination factor nusG;
FT                   InterPro:Transcription antitermination protein, NusG,
FT                   N-terminal; InterPro:Translation protein SH3-like;
FT                   InterPro:Translation protein SH3-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02131"
FT                   /db_xref="GOA:B8FH43"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH43"
FT                   /protein_id="ACL02131.1"
FT                   /translation="MNATPNLNTKQWYALYTKSRHEACVNNYLAARSIESFYPQMRILS
FT                   RRKDRRKMIDVPMFPGYLFVRAALRSRQHLSILKAPGAVTLIGNTRGAIAIPEDTISSL
FT                   RIVSQKEALETGPCYHAGDLVLIVSGPFAGVTGVFMRNKGGGKILVNIDALGQSVAVEM
FT                   GGADVQLMQSYRKAG"
FT   gene            complement(582914..584461)
FT                   /locus_tag="Dalk_0424"
FT   CDS_pept        complement(582914..584461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0424"
FT                   /product="Tetratricopeptide TPR_2 repeat protein"
FT                   /note="PFAM: TPR repeat-containing protein;
FT                   Tetratricopeptide TPR_2 repeat protein; SMART:
FT                   Tetratricopeptide domain protein; KEGG: dps:DPPB83
FT                   hypothetical protein; IMG reference gene:2503006123; PFAM:
FT                   Tetratricopeptide repeat; InterPro:Tetratricopeptide
FT                   repeat; InterPro:Tetratricopeptide repeat-containing;
FT                   InterPro:Tetratricopeptide TPR2;
FT                   InterPro:Tetratricopeptide-like helical"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02132"
FT                   /db_xref="GOA:B8FH44"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH44"
FT                   /protein_id="ACL02132.1"
FT                   /translation="MARPHNHDFSKAPHGAFFSTRLLAAAAVLVVFVGGTYILGHKLTA
FT                   QVYFEKAKNQTKAGHYGLALQAIEKAYHHDPHNAKILAAYGNACLDASFATISIKPKQE
FT                   RAALALSVYETAVEENPLDAACWFGLGRAQALVEELHPEKGKSCSYLDSFRKTVSLRPN
FT                   GITYNMHLARCLAYCGQEQELSQVVKHIARIYPPSVYHLTKENYWTPELEPELKAGLAE
FT                   AIGQSNLPRQAYQAMASLFEREGDYAQAINYYKQSLNYLSFENTGWNYIHLGSLMLKNN
FT                   QPEKASEEFLYGLSRSEYLEKDVERIFHIYRREKQLAFFAAFYKKVVEIFFVSSRLKIL
FT                   IGRAYFEQEDLEDAQGIFEEAAYKEENAEAFYWLARIADKNKDWPAMELSIQKATVLEP
FT                   DNSRYHLLFSQVLSRLKKYERSEKQASLAISTADKPSPWLHNHRAYVLWRLGDYKNALE
FT                   DWRKAIELMPERASFYAQAGRSAEKLGLQDLAREYFQKSLQLEPNNPTYQKLADGAP"
FT   gene            complement(584500..585738)
FT                   /locus_tag="Dalk_0425"
FT   CDS_pept        complement(584500..585738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0425"
FT                   /product="ATPase involved in chromosome partitioning-like
FT                   protein"
FT                   /note="KEGG: drm:Dred_3000 exopolysaccharide
FT                   tyrosine-protein kinase; IMG reference gene:2503006124;
FT                   PFAM: CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   TIGRFAM: capsular exopolysaccharide family;
FT                   InterPro:Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02133"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR025497"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH45"
FT                   /protein_id="ACL02133.1"
FT                   /translation="MKPKKLSTKKRTKDLISLFLANYKGKSRFAESYRTLRTNIDLSFL
FT                   ESELKCLLVTSAGEAEGKTLTVANYAFNLAEAGRSVLMVDADLRKPSLSKLLVNNEVIG
FT                   LTGLLSRVMGTPVTEGGLGKISVGDLIRLLQQQRRTGRLQLSSQTENKLINMDFLAGDL
FT                   VDCTWVNCPEERSLASHLVQLGLITSQQAQQALKRAKDTGQKLPMVLVNAGLLKKKQVR
FT                   GPLKNQLAQNLRLALDMNDGKYEFKPATDMKAESKTVFAINLAEIYERAAADEEPLPYI
FT                   NAGIKAAMLKTPQPGLFLLPSGVLPPNPSELLGSKRMLFLLSRFKDLFDVVILDSPPIL
FT                   PASDALTLAPHVDGVVFVVKAGGVNRDLVRKAVDQLKNARANVVGAVLNQVDVHREGYY
FT                   KYYEKYYSSYYGT"
FT   gene            complement(585778..587265)
FT                   /locus_tag="Dalk_0426"
FT   CDS_pept        complement(585778..587265)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0426"
FT                   /product="lipopolysaccharide biosynthesis protein"
FT                   /note="PFAM: lipopolysaccharide biosynthesis protein; KEGG:
FT                   dps:DPPB85 related to exopolysaccharide biosynthesis
FT                   protein (GumC protein); IMG reference gene:2503006125;
FT                   PFAM: Chain length determinant protein;
FT                   InterPro:Lipopolysaccharide biosynthesis"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02134"
FT                   /db_xref="GOA:B8FH46"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH46"
FT                   /protein_id="ACL02134.1"
FT                   /translation="MEAPQQQEIAPHLADYYHVILKHKWTTFFVLIAVVILTALFTIYT
FT                   EPVYQSTATLVIEQEQTASPLTGERMDFESFASQTLTFNTHFKLIKSRPVLEKVIKKLK
FT                   LDRPEYSKDMEISPIRQILAQVKNNIKLLLSKEEPPKTPDEVLLELTEALKMKISIEQV
FT                   RDTRLLKISVEDRDPKQARDIANTLAESYIEFNTANRMAASRNTLAWIADQSYAMKQNL
FT                   EAAEQDFVEYKQNHLLFSVEGKIDLITQKIEEFNSAYLETRNKRQELDAKLNKLREMLQ
FT                   SGNSGVEVRSLIDSPIISTLYSKLLSLDTELSTLSQTYKSKHPKIVQAKSALEETKLKF
FT                   RDEIKKELTSMEAERSVLIAKENALQKNISDFEKDALETSKKELEYGILRRNVDTNQKL
FT                   YDTLLEKLKEADVVEDVDTSNIRVAEPAFSAVNPIRPKKRLNMMLSVVLGLMAGLGLSF
FT                   LQEYLDQTFRTEDEVLRYLEVPVLTVVPVGDPKKSKQ"
FT   gene            complement(587306..588217)
FT                   /locus_tag="Dalk_0427"
FT   CDS_pept        complement(587306..588217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0427"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   dps:DPPB86 related to capsular polysaccharide export
FT                   protein; IMG reference gene:2503006126; PFAM:
FT                   Polysaccharide biosynthesis/export protein; SLBB domain;
FT                   InterPro:Polysaccharide export protein; InterPro:Soluble
FT                   ligand binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02135"
FT                   /db_xref="GOA:B8FH47"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH47"
FT                   /protein_id="ACL02135.1"
FT                   /translation="MNKQCKLSSLTVAICLTVCVLLRLGLPGACFAQRDEYRIGATDVL
FT                   SVKVYAGGEQQIDMELTVSVQGTISVPMVGQVMALDRTVPQLEESIRIPLEKDYFVDPQ
FT                   VHIVITEYHSIHYYISGAVKNPGSYESTSRLSLMELIAKAGGALPERGNVAYLLRSAAT
FT                   EVEANTDMNTLVKAKDPEKIDLRRLLDQGDLNNDVILEAGDVVYIPFQKSLSLASSKIY
FT                   VDGQVASPGVYDYQPGLTALNACVMAGGFGKFAAPDKAAIIRVENGEQRVIKINLVAVR
FT                   KGKIIDPELEPGDRIHVPETWF"
FT   sig_peptide     complement(588122..588217)
FT                   /locus_tag="Dalk_0427"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006126_SP"
FT   gene            complement(588297..589520)
FT                   /locus_tag="Dalk_0428"
FT   CDS_pept        complement(588297..589520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0428"
FT                   /product="hypothetical protein Dalk_0428"
FT                   /note="KEGG: dps:DPPB88 hypothetical protein; IMG reference
FT                   gene:2503006127; PFAM: Uncharacterized protein conserved in
FT                   bacteria (DUF2320); InterPro:Protein of unknown function
FT                   DUF2320"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02136"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH48"
FT                   /protein_id="ACL02136.1"
FT                   /translation="MGKIRAITGLTILITFVLTAFVWAGPALLITPKLGLGYRYDSNYY
FT                   NSANNSAGVHTYLVEPGINVQFSTAKSMISFDYTASPTFYDDADDLKPGQIKASKADYV
FT                   GHDLALNAMTQPNERLELALSETYSLTRDPDKLDQYSNETGKDKYYINTFSPRVLYSFT
FT                   DRFSGQATYRNTLTNYDDPNGEDNQENRGIFDIIYNLNSKSSLDLEYQIWARDYDMLTS
FT                   DYTSHQGKLIYRQQFHYFQVEAGAGYQSREFDVVGIKDIETFTYRVALEGQNPPDDGDP
FT                   RSYVRAAFSSNFNDAGSGNEYYKGPELSLSGGHRFLEKIYLDVWTSYRKSDYETTYGLN
FT                   SSNVLVLREDDTYEIGARLGYKIIEPIVISIEGGYKNRDSNVAAYSYDNTYVMGRIDTA
FT                   LEFGRRAN"
FT   sig_peptide     complement(589449..589520)
FT                   /locus_tag="Dalk_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006127_SP"
FT   gene            complement(589571..590170)
FT                   /locus_tag="Dalk_0429"
FT   CDS_pept        complement(589571..590170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0429"
FT                   /product="hypothetical protein Dalk_0429"
FT                   /note="KEGG: GL25297 gene product from transcript
FT                   GL25297-RA; IMG reference gene:2503006128"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02137"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH49"
FT                   /protein_id="ACL02137.1"
FT                   /translation="MKGVVKPRLAKTGPAMVLLMAVAAFLWCTSAYAAGNVDALVDSSF
FT                   NAAQAAQESGDPIALENAMSAAEEALDALAAAAEGAAPDEAQAILNAYVVMQGVLDSIA
FT                   SAANAIGADNIISQAAAAQASLTTPMDSLIAAGADLAAAQEQALAYQPPSAPSTPATPA
FT                   APTSLAPGAVAGSGGGGGGGGSGFNDNNPASPTGAQ"
FT   sig_peptide     complement(590072..590170)
FT                   /locus_tag="Dalk_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006128_SP"
FT   gene            complement(590336..591064)
FT                   /locus_tag="Dalk_0430"
FT   CDS_pept        complement(590336..591064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0430"
FT                   /product="Protein-tyrosine-phosphatase"
FT                   /EC_number="3.1.3.48"
FT                   /note="PFAM: PHP domain protein; KEGG: bha:BH3667 capsular
FT                   polysaccharide biosynthesis; IMG reference gene:2503006129;
FT                   PFAM: PHP domain; InterPro:Capsular polysaccharide
FT                   synthesis, CpsB/CapC; InterPro:PHP, C-terminal;
FT                   InterPro:Polymerase/histidinol phosphatase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02138"
FT                   /db_xref="GOA:B8FH50"
FT                   /db_xref="InterPro:IPR016195"
FT                   /db_xref="InterPro:IPR016667"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH50"
FT                   /protein_id="ACL02138.1"
FT                   /translation="MIDLHSHILPGLDDGPTTLKMALEMARAAVDDGVTVMVATPHTLN
FT                   GSYHNPRERILEAHRVFSEALVKENIPLKVLPGCEAHLCSELLKEIQSGDVLSFADKGR
FT                   YLLLELPHPFLLQGVIAFINRLNVMGLTPVIAHGERLPLVQQKPSIMEDIVNAGALCQV
FT                   TAQSLEGSLGRRAKKCCQELNSLGLIHLLASDAHDLANRRPGLSKACKILGGMMDERDA
FT                   HHILSTNPSLIIGAGENYVR"
FT   gene            complement(591057..591638)
FT                   /locus_tag="Dalk_0431"
FT   CDS_pept        complement(591057..591638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0431"
FT                   /product="hypothetical protein Dalk_0431"
FT                   /note="IMG reference gene:2503006130"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02139"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH51"
FT                   /protein_id="ACL02139.1"
FT                   /translation="MGWKRSCPKIACFVWAVVQVLGLASPALAAQSDDWSILETQYTRI
FT                   QYLSREDLRRFNASIDYGPGRWSAKRVLQAKPSTSMEDGLANKVDALFERVQEILDMHP
FT                   QMGKVRILLLHDKKHLAAEYHRLFKAPCHIRSWYLHIGSTIYINCKDVRVGILAHEMGH
FT                   AVSEHFLVFSPPRVSAEVWSVYVEAHLFDD"
FT   sig_peptide     complement(591552..591638)
FT                   /locus_tag="Dalk_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006130_SP"
FT   gene            complement(591657..592220)
FT                   /locus_tag="Dalk_0432"
FT   CDS_pept        complement(591657..592220)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0432"
FT                   /product="Putative uncharacterized protein with partial
FT                   methyl-accepting chemotaxis sensory transducer domain"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   KEGG: bld:BLi03295 hypothetical protein; IMG reference
FT                   gene:2503006131; PFAM: HAMP domain; InterPro:HAMP linker
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02140"
FT                   /db_xref="GOA:B8FH52"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH52"
FT                   /protein_id="ACL02140.1"
FT                   /translation="MSEKAIMPRRRQYFVKRDFQGAFILKFCLVVLLGAVASTLLIFYF
FT                   SGDTLTSDFSNSRLVIKSTSQAILPAVIMTNLITLGISALAVLVLTLLISHKIAGPLFR
FT                   LEKELEKIGGGNLKTEVILRNKDQVEALAQSINSMAGQLHTKVFDIRDSLDQMARRMEH
FT                   EDATGKWAESIEDVKKRIDAHFQL"
FT   gene            complement(592295..592873)
FT                   /locus_tag="Dalk_0433"
FT   CDS_pept        complement(592295..592873)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0433"
FT                   /product="hypothetical protein Dalk_0433"
FT                   /note="KEGG: amt:Amet_0798 hypothetical protein; IMG
FT                   reference gene:2503006132"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02141"
FT                   /db_xref="InterPro:IPR027304"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH53"
FT                   /protein_id="ACL02141.1"
FT                   /translation="MKKVLLCLITAAVCIYVVSCASEEQPDQGPVVLRVNDYCLCQKEF
FT                   RDLLAQEMRLDEHYKLTLDAQKQFLGDLVARQVLIQEAKRLELDSRPGFVLSVQRFWES
FT                   TLIRDLMDMKAREIEANTLVTQEEVLDLYRKQKQDDPYLPAFEDMRDELFDRVMEEKKT
FT                   RLLSEWIKGLEAGSDVEISERSLFGQSGA"
FT   sig_peptide     complement(592811..592873)
FT                   /locus_tag="Dalk_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006132_SP"
FT   gene            592941..593555
FT                   /locus_tag="Dalk_0434"
FT   CDS_pept        592941..593555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0434"
FT                   /product="hypothetical protein Dalk_0434"
FT                   /note="IMG reference gene:2503006133"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02142"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH54"
FT                   /protein_id="ACL02142.1"
FT                   /translation="MLGFVTKMFSFTAYKKLTVLGTFIGVLIFYGAAAAAPQGDWRTLE
FT                   TKYMVVYYQNPDDLRLLGSRVKYDTGGWTLFNRSISWGSSDNITKKVDSLFDRVQILLD
FT                   MKKRTPKIVLYLFPDDVQFRIAYENALNERPSGGVNARYIPQDKAVYAVPSEIDEASLA
FT                   REMAHAVANHYLIIKPSRKATDILAKYVGKHLMDPNAPQTY"
FT   sig_peptide     592941..593045
FT                   /locus_tag="Dalk_0434"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006133_SP"
FT   gene            complement(593578..594066)
FT                   /locus_tag="Dalk_0435"
FT   CDS_pept        complement(593578..594066)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0435"
FT                   /product="Protein with response regulator receiver domain"
FT                   /note="PFAM: response regulator receiver; KEGG: scl:sce1649
FT                   sigma-54 dependent DNA-binding response regulator; IMG
FT                   reference gene:2503006134; PFAM: Response regulator
FT                   receiver domain; InterPro:CheY-like superfamily;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02143"
FT                   /db_xref="GOA:B8FH55"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH55"
FT                   /protein_id="ACL02143.1"
FT                   /translation="MGQPEFAERILVIDDNKDFADTLVEQLDDLGYSAQAVYDGAQGME
FT                   AYSKGEYALVITDLSMPGLDGMDVLEGILAQDSKATILMVTGYGTIETAVQAIKLGAFD
FT                   FIPKPFKLAELEAIIRRAFGRKDLEKQFSIFRGLAWGLAICIPIWIALGYFLYKFFIK"
FT   gene            complement(594216..594698)
FT                   /locus_tag="Dalk_0436"
FT   CDS_pept        complement(594216..594698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0436"
FT                   /product="Protein with response regulator receiver domain"
FT                   /note="PFAM: response regulator receiver; KEGG: sth:STH2087
FT                   sigma-54-dependent transcriptional regulator; IMG reference
FT                   gene:2503006135; PFAM: Response regulator receiver domain;
FT                   InterPro:CheY-like superfamily; InterPro:Signal
FT                   transduction response regulator, receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02144"
FT                   /db_xref="GOA:B8FH56"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH56"
FT                   /protein_id="ACL02144.1"
FT                   /translation="MVNQDAAKILVMEKDGECSHLLAGRLGQLGYRTDIAGSCDEARAA
FT                   LERSEYAVVIACSEMPDWGGPKGMAGLRFSRRKPAMLVTCDQECRDEALKCLSKGAYDY
FT                   LPRQCEKSRLEVTVERALTERALAQKTRRCKKAALGLVLSTPAWIGIGMVLAYLTV"
FT   gene            complement(594733..595182)
FT                   /pseudo
FT                   /locus_tag="Dalk_0437"
FT   gene            complement(596461..596536)
FT                   /locus_tag="Dalk_R0005"
FT   tRNA            complement(596461..596536)
FT                   /locus_tag="Dalk_R0005"
FT                   /product="tRNA-Thr"
FT                   /note="IMG reference gene:2503006137"
FT   gene            596935..597567
FT                   /locus_tag="Dalk_0438"
FT   CDS_pept        596935..597567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0438"
FT                   /product="isochorismatase hydrolase"
FT                   /note="PFAM: isochorismatase hydrolase; KEGG: cbf:CLI_0330
FT                   isochorismate family protein; IMG reference
FT                   gene:2503006138; PFAM: Isochorismatase family;
FT                   InterPro:Isochorismatase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02145"
FT                   /db_xref="GOA:B8FH57"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH57"
FT                   /protein_id="ACL02145.1"
FT                   /translation="MQRFLSYALIFLFLFTGLAQAESIDALWGEVKQPPAPELKQVAPK
FT                   PATTALLVLDIEELTCNAERRPRCLETVPRIAALIDKARAAGMPVVYSLTPRGTLETIL
FT                   PPVKPLPGEPIVSSSVDKFWNTDLEKILKEKGVDTVIVTGTAAHGAVLHTATAAGFRKL
FT                   KIILPVDCLSSADLYIEQASVHLLLTGPGTRRAITLTRSDMIGFPEK"
FT   sig_peptide     596935..596997
FT                   /locus_tag="Dalk_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006138_SP"
FT   gene            598306..599622
FT                   /locus_tag="Dalk_0439"
FT   CDS_pept        598306..599622
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0439"
FT                   /product="thiamine biosynthesis protein ThiC"
FT                   /note="required for the synthesis of the
FT                   hydromethylpyrimidine moiety of thiamine; IMG reference
FT                   gene:2503006139; PFAM: ThiC family; TIGRFAM: thiamine
FT                   biosynthesis protein ThiC; InterPro:Thiamine biosynthesis
FT                   protein ThiC"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02146"
FT                   /db_xref="GOA:B8FH58"
FT                   /db_xref="InterPro:IPR002817"
FT                   /db_xref="InterPro:IPR038521"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH58"
FT                   /protein_id="ACL02146.1"
FT                   /translation="MEKTQVQWAVEGRVTPVMEEIAAKEGVAASEIREHFAQGRIVCPQ
FT                   NANRPCRNVGIGMGLSTKINASIGTSTDISNIDVEVAKAKAAQEAGADTLMELSVGGDL
FT                   DKVRREVLAAVDLPVGNVPLYQAFCEAAEKYGDPNKLDSDMLFDIIEKQCADGISFMAV
FT                   HCGINLYTIERLEKQGYRYGGLVSKGGASMVAWMKTNKRENPLYEEFDRVAAILKKYDV
FT                   VLSLGNGLRAGAVADSFDRAMVQELLINCELAELGRKMGCQMMVEGPGHVPMDEIEANI
FT                   ILQKRMSNNAPYYMLGPLPTDAGAGYDHVVAAIGASQSARYGADLICYITPAEHLALPN
FT                   VDDVVEGVKVARLAVHIGDMGKLPEKTRMRDMDMSRARRDMDWEGQYANALFPEDARRI
FT                   RDDRSPSCDDKVCTMCGEFCANRASGKLFSEALNSGVKA"
FT   gene            600158..601030
FT                   /locus_tag="Dalk_0440"
FT   CDS_pept        600158..601030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0440"
FT                   /product="anaerobic cobalt chelatase"
FT                   /note="PFAM: anaerobic cobalt chelatase; KEGG:
FT                   dvl:Dvul_2310 anaerobic cobalt chelatase; IMG reference
FT                   gene:2503006140; PFAM: Cobalt chelatase (CbiK);
FT                   InterPro:Anaerobic cobalt chelatase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02147"
FT                   /db_xref="GOA:B8FH59"
FT                   /db_xref="InterPro:IPR010388"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH59"
FT                   /protein_id="ACL02147.1"
FT                   /translation="MKKILSAALVLALVLCAFNAYAGHGEAKDVKKGILLVAFGTSEES
FT                   AKVSFKNIEKNVVEAFPGVDVRWAYTSHIIRHKLAKQGEVILSPAEALAKMMGEGYTHV
FT                   AVQSLHTIPGEEYHALVQTVNGFQAMPEGFERLTLGYPMLGAQNTVAKAVDAIIATIPK
FT                   ARKANEAVVLMGHGTHHPGNIYYSALNWQLQQRDSNIIMGTVEGYPELDDVIDYLKTNK
FT                   IKKVWIMPFMSVAGDHAKNDMAGPEDDSWKSVLTKAGFKCETVLKGTAEYDEFVDIWVG
FT                   QLTKAFAHL"
FT   sig_peptide     600158..600223
FT                   /locus_tag="Dalk_0440"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006140_SP"
FT   gene            601063..602097
FT                   /locus_tag="Dalk_0441"
FT   CDS_pept        601063..602097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0441"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   dps:DP0215 Fe(III) ABC-transporter, permease protein; IMG
FT                   reference gene:2503006141; PFAM: FecCD transport family;
FT                   InterPro:ABC transporter permease protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02148"
FT                   /db_xref="GOA:B8FH60"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH60"
FT                   /protein_id="ACL02148.1"
FT                   /translation="MPVKMDKVKSPVLIIAVLAAVLGCVVIASAGMGFLSVPYKQVLAV
FT                   IWARIAGDAGGDPLISAVVWDVRLPRIFTAAIVGAGLSLSGVVFQGILKNPLADPYTLG
FT                   ISAGAAFGACIAFLFNMIHFQGLSVGMCAFAGALITLAVVLYLSNSVGGYSSNNLILSG
FT                   IIVAAILSAGISFLKYVADERVSVIIFWLMGSFASKTWADAGMVLCFVSAGALICLCFG
FT                   RDLNLMALGDRAAASLGVDVKKSRLILLAAASLIAAVCVSVSGIIGFVGLLVPHMMRGI
FT                   LGADNQRLMPASLLAGAILLLCADTFTRAVLPSELPIGVLTALIGGPFFCYVFKRGFSQ
FT                   KAGF"
FT   sig_peptide     601063..601152
FT                   /locus_tag="Dalk_0441"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006141_SP"
FT   gene            602102..602872
FT                   /locus_tag="Dalk_0442"
FT   CDS_pept        602102..602872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0442"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: dps:DP0216 Fe(III) ABC transporter, ATP-binding
FT                   protein; IMG reference gene:2503006142; PFAM: ABC
FT                   transporter; InterPro:ABC transporter, conserved site;
FT                   InterPro:ABC transporter-like; InterPro:ATPase, AAA+ type,
FT                   core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02149"
FT                   /db_xref="GOA:B8FH61"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH61"
FT                   /protein_id="ACL02149.1"
FT                   /translation="MGHELQDIWFSYDDRSVLSGVSLELESGLFHGVLGPNGSGKTTLL
FT                   DLISGHLKPNKGRVLLEGQAVDKAARKELARKCALVPQDFRVNFPFTAAQVVMMGRYPH
FT                   IGRFGAPSQEDWDMVEQAMESTGIRDFAQRNVTELSGGERQRVVFARALAQNAETLILD
FT                   EATSNLDVRHTLALMRLAADKVRKAGLTVISVMQDINLAARFCQSLLFLKNGRAAAHGP
FT                   VDEILTESVIQEVFEVKSKVYFDETINRKQVVFL"
FT   gene            602872..603804
FT                   /locus_tag="Dalk_0443"
FT   CDS_pept        602872..603804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0443"
FT                   /product="periplasmic binding protein"
FT                   /note="PFAM: periplasmic binding protein; KEGG: dps:DP0217
FT                   Fe(III) ABC transporter, periplasmic substrate-binding
FT                   protein; IMG reference gene:2503006143; PFAM: Periplasmic
FT                   binding protein; InterPro:Periplasmic binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02150"
FT                   /db_xref="InterPro:IPR002491"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH62"
FT                   /protein_id="ACL02150.1"
FT                   /translation="MIRFFFNTAILIVCLVFSAGFVQAGENGKILVVQDHTGASIQVKA
FT                   PFTRIISLYGAHTDNLRNLGLDEEIIGVSPSDHWQGKAVFSYHDGLEKFLAYKPDLVFT
FT                   RPMINHGYPRLIEGLEKAGIAVASFQPSTVDEMFEYWVSLGRLTGKNVEAQEMVSHFKE
FT                   EIARIRKISAALPNKKRVYFEAIHGRMRTFTPGSMAIYALEAAGGVNAAADATSVRGTN
FT                   IAYYGKERILSKANEIDVFLSQDGAMNQPTIPMIVNEPGFEIIKAVREGQVYIVEERLV
FT                   SRPTAALLDGVRIIGEILYPEAFGKGGVQ"
FT   sig_peptide     602872..602943
FT                   /locus_tag="Dalk_0443"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006143_SP"
FT   gene            603801..605183
FT                   /locus_tag="Dalk_0444"
FT   CDS_pept        603801..605183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0444"
FT                   /product="cobyrinic acid a,c-diamide synthase"
FT                   /note="TIGRFAM: cobyrinic acid a,c-diamide synthase; PFAM:
FT                   Cobyrinic acid ac-diamide synthase; CobB/CobQ domain
FT                   protein glutamine amidotransferase; KEGG: sfu:Sfum_1740
FT                   cobyrinic acid a,c-diamide synthase; IMG reference
FT                   gene:2503006144; PFAM: CobQ/CobB/MinD/ParA nucleotide
FT                   binding domain; CobB/CobQ-like glutamine amidotransferase
FT                   domain; TIGRFAM: cobyrinic acid a,c-diamide synthase;
FT                   InterPro:CobB/CobQ glutamine amidotransferase;
FT                   InterPro:CobB/CobQ-like glutamine amidotransferase;
FT                   InterPro:Cobyrinic acid a,c-diamide synthase;
FT                   InterPro:Cobyrinic acid a,c-diamide synthase CbiA"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02151"
FT                   /db_xref="GOA:B8FH63"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004484"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH63"
FT                   /protein_id="ACL02151.1"
FT                   /translation="MKGIVIAGVHSGCGKTTVTLGLMAALRRRGLNVEPFKVGPDFIDP
FT                   GHHTAITGVQSRNLDGWMLPRECSLDIYRRNAANADIAVVEGVMGLFDGYDGRTEAGST
FT                   AQMAKWLGLPVLLVVDARSMARSAAAVVQGFENFDPDLQFAGVLFNKVGSQTHLRYLEE
FT                   ALEGNVAMPCLGGVIRNEGISIPSRHLGLVTSEDHGLSSDIQNALADLVEYNLDLDDLL
FT                   ASLPDIALNPTLQMKKAPPRVRIAAARDQAFCFYYSENLELLESCGAEIVAFSPLKDSG
FT                   LPEDVDGLYLGGGYPELYAEALSKNTALKDEIFQACQEGMPIYGECGGFMVLCKTLEDL
FT                   EGREHAMIGCFDLTCRMSSRLRALGYREITLNQKTVLGEAGLCARGHEFHYSQLDEHGR
FT                   ESVYEAVDRSGGARSVDGFQVNRCLGSYLHLHFMSQPQAPKAFVQACMDYQKERKTADA
FT                   AP"
FT   gene            605170..605787
FT                   /locus_tag="Dalk_0445"
FT   CDS_pept        605170..605787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0445"
FT                   /product="Precorrin-8X methylmutase CbiC/CobH"
FT                   /note="PFAM: Precorrin-8X methylmutase CbiC/CobH; KEGG:
FT                   gme:Gmet_0477 precorrin-8X methylmutase; IMG reference
FT                   gene:2503006145; PFAM: Precorrin-8X methylmutase;
FT                   InterPro:Cobalamin (vitamin B12) biosynthesis CobH/CbiC,
FT                   precorrin-8X methylmutase, core"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02152"
FT                   /db_xref="GOA:B8FH64"
FT                   /db_xref="InterPro:IPR003722"
FT                   /db_xref="InterPro:IPR036588"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH64"
FT                   /protein_id="ACL02152.1"
FT                   /translation="MLPHEIEEKSFEIIDEEAGSHGFGPDEWKIVRRMIHTSADFEYID
FT                   MVRIHPKAIEAGVKAIQSGCAIVTDTNMARVGIRKDNLAPFGCTVACLMTDPEVGKEAK
FT                   EKGLTRAHVAAEKGAAMVENGIYAVGNAPTALLHLLDLIESGAAKPALVVGLPVGFVNA
FT                   AESKEALIKTDTPYISNLSRKGGSNVAVSVINALALIARERT"
FT   gene            605789..606526
FT                   /locus_tag="Dalk_0446"
FT   CDS_pept        605789..606526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0446"
FT                   /product="precorrin-2 C20-methyltransferase"
FT                   /note="TIGRFAM: precorrin-2 C20-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: sfu:Sfum_2135 precorrin-2
FT                   C20-methyltransferase; IMG reference gene:2503006146; PFAM:
FT                   Tetrapyrrole (Corrin/Porphyrin) Methylases; TIGRFAM:
FT                   precorrin-2 C20-methyltransferase; InterPro:Cobalamin
FT                   (vitamin B12) biosynthesis CobI/CbiL, precorrin-2
FT                   C20-methyltransferase; InterPro:Cobalamin (vitamin B12)
FT                   biosynthesis CobI/CbiL, precorrin-2 C20-methyltransferase,
FT                   core; InterPro:Tetrapyrrole methylase;
FT                   InterPro:Tetrapyrrole methylase, subdomain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02153"
FT                   /db_xref="GOA:B8FH65"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006364"
FT                   /db_xref="InterPro:IPR012382"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH65"
FT                   /protein_id="ACL02153.1"
FT                   /translation="MNPGTLYGIGVGPGDPDLITLKAARILGQVDVVFAASSTKNSHSQ
FT                   AVEIAKPHLKESVPIRMIPFPMTKNKDAMEKAWEKNAQDIIDVLEDGKSAAFITLGDCM
FT                   TYSTFGYVLQNIQRLAPHIAVVSVPGITSYQAAASRLNTPLVEGEESLTLLSGVNGGGR
FT                   FREISDHADNVVFLKAYKNAGDIAQALGEGGMDGNSVGVVKCGLEDEQIITDINVFREK
FT                   APNYWTLIISKKSKNFVAQKKEQ"
FT   gene            606501..607559
FT                   /locus_tag="Dalk_0447"
FT   CDS_pept        606501..607559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0447"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   dde:Dde_3102 hypothetical protein; IMG reference
FT                   gene:2503006147"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02154"
FT                   /db_xref="GOA:B8FH66"
FT                   /db_xref="InterPro:IPR038880"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH66"
FT                   /protein_id="ACL02154.1"
FT                   /translation="MSRRKKNNNPRALAIGLLITIAALGVGLMAVDGLEAAKLPSKLLL
FT                   PLARLLLFVSIGLVAAQAIDSTNWTEKLGFLAAPMFRFANLGAHCSAAFTAAFFSGVSA
FT                   NAMLLDFYKEERITKRQLFLTNFINQFPAYFLHLPVTFFIVVPLTKTAGLLYFLLTFLA
FT                   TCLRTALFASYGHIFMKPKNSGEQNFEGQAKKPASRKKKKPFWEGLKAKVPSRFVRVVA
FT                   FVVPTYTVVYVLTAAGAFDALETFMTRFAVQAFIPVESLSVVVLSFASEFTAGFAAAGA
FT                   LMDAGSITVKQTVIALLLGNIIAFPIRAIRHQLPRYMGIFSPGMGLQMLLMGQGFRVAS
FT                   IILAGAVYWFVG"
FT   sig_peptide     606501..606590
FT                   /locus_tag="Dalk_0447"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006147_SP"
FT   gene            607549..608655
FT                   /locus_tag="Dalk_0448"
FT   CDS_pept        607549..608655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0448"
FT                   /product="cobalamin biosynthesis protein CbiD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CbiD; PFAM:
FT                   cobalamin (vitamin B12) biosynthesis CbiD protein; KEGG:
FT                   nmr:Nmar_0083 cobalamin biosynthesis protein CbiD; IMG
FT                   reference gene:2503006148; PFAM: CbiD; TIGRFAM: cobalamin
FT                   biosynthesis protein CbiD; InterPro:Cobalamin (vitamin B12)
FT                   biosynthesis CbiD"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02155"
FT                   /db_xref="GOA:B8FH67"
FT                   /db_xref="InterPro:IPR002748"
FT                   /db_xref="InterPro:IPR036074"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH67"
FT                   /protein_id="ACL02155.1"
FT                   /translation="MSAKEKKKLRQGFTTGTAAAAASKAALLYLLTRETPGFVEVDLLN
FT                   GQSMQIPVDSVSVEDGQAEAVVIKDAGDDPDITHKARIGAKVCLIKEPGEVKITGGQGV
FT                   GVVTKPGLEIPPGEPAINLGPRQMITQSVEQALAFCEGVLGVSVEIFVENGEELAKKTL
FT                   NHRLGIEGGLSILGTTGLVKPLSHEAYIATIESALSVAKACGSNHVVLTTGRRTEKHAQ
FT                   AFFSELPEEAFIQIGDFFQMSMQGVAKNHFAQTTLAVFFGKALKMAQGIPHTHASKSSL
FT                   TMDWLAGHVKEIVGDETLAQEIARANTARHAFGMVYPEHPKVLERVGEHMIRSASNFCD
FT                   GKSRIRAIIFDFEGNIAFDSMEGSQTHE"
FT   sig_peptide     607549..607623
FT                   /locus_tag="Dalk_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006148_SP"
FT   gene            608648..609865
FT                   /locus_tag="Dalk_0449"
FT   CDS_pept        608648..609865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0449"
FT                   /product="precorrin-6y C5,15-methyltransferase
FT                   (decarboxylating), CbiE subunit"
FT                   /EC_number="2.1.1.132"
FT                   /note="KEGG: dde:Dde_0803 precorrin-6Y
FT                   C5,15-methyltransferase (decarboxylating); TIGRFAM:
FT                   precorrin-6y C5,15-methyltransferase (decarboxylating),
FT                   CbiE subunit; precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; PFAM: Uroporphyrin-III
FT                   C/tetrapyrrole (Corrin/Porphyrin) methyltransferase;
FT                   putative methyltransferase; methyltransferase small;
FT                   Protein of unknown function methylase putative; IMG
FT                   reference gene:2503006149; PFAM:
FT                   Protein-L-isoaspartate(D-aspartate) O-methyltransferase
FT                   (PCMT); Tetrapyrrole (Corrin/Porphyrin) Methylases;
FT                   TIGRFAM: precorrin-6Y C5,15-methyltransferase
FT                   (decarboxylating), CbiT subunit; precorrin-6y
FT                   C5,15-methyltransferase (decarboxylating), CbiE subunit;
FT                   InterPro:Cobalamin (vitamin B12) biosynthesis CbiE,
FT                   precorrin-6Y methyltransferase, core; InterPro:Cobalamin
FT                   (vitamin B12) biosynthesis CbiT, precorrin-6Y
FT                   methyltransferase-core; InterPro:Cobalamin (vitamin B12)
FT                   biosynthesis CobL, precorrin-6Y C5,15-methyltransferase;
FT                   InterPro:Protein-L-isoaspartate(D-aspartate)
FT                   O-methyltransferase; InterPro:Tetrapyrrole methylase;
FT                   InterPro:Tetrapyrrole methylase, subdomain 1"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02156"
FT                   /db_xref="GOA:B8FH68"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006365"
FT                   /db_xref="InterPro:IPR012818"
FT                   /db_xref="InterPro:IPR014008"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH68"
FT                   /protein_id="ACL02156.1"
FT                   /translation="MSNRVQVIGMGLSPRDLTQAHLEIIQQAQVLVGGKRHLESFESVD
FT                   AVKREIASPISEVLDFIQESMADKRVVVLASGDPLFFGIGKTLINRLGAENVVVHPNVT
FT                   SMAAAFARLNLPWQEAYWVSLHGKKGLSPLKKAMEEHDLLCVLTDPANNPEVIAEVVKE
FT                   HDYSWNMRVLEKLGDPEERVLEIDPFASAFAAFAQPNVVVLQKGDLADPPGPLRLGTPD
FT                   HWFIHEKGLITKAPVRTLSLSMLQLESSSILWDLGAGSGSVGLEASLFLPQGFVFAVEK
FT                   NAARVEQIQANAERFNVQNLSVTRGEAPEGLDDLPRPDRVFIGGGGKGLPEVLETAMQA
FT                   LKPHGKIVVNTVLLETLNQAVSLLEEKGFAVSLTQAQISQSKTMPWGRRMEALNPVWII
FT                   LGEKGK"
FT   gene            609867..610631
FT                   /locus_tag="Dalk_0450"
FT   CDS_pept        609867..610631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0450"
FT                   /product="precorrin-4 C11-methyltransferase"
FT                   /note="TIGRFAM: precorrin-4 C11-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: hmo:HM1_2389 precorrin-4
FT                   C11-methyltransferase; IMG reference gene:2503006150; PFAM:
FT                   Tetrapyrrole (Corrin/Porphyrin) Methylases; TIGRFAM:
FT                   precorrin-4 C11-methyltransferase; InterPro:Cobalamin
FT                   (vitamin B12) biosynthesis CobM/CbiF, precorrin-4
FT                   C11-methyltransferase, core; InterPro:Tetrapyrrole
FT                   methylase; InterPro:Tetrapyrrole methylase, subdomain 1;
FT                   InterPro:Tetrapyrrole methylase, subdomain 2;
FT                   InterPro:Uroporphiryn-III C-methyltransferase, conserved
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02157"
FT                   /db_xref="GOA:B8FH69"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR003043"
FT                   /db_xref="InterPro:IPR006362"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH69"
FT                   /protein_id="ACL02157.1"
FT                   /translation="MEKHPVIFTGAGPGAPDLITVRGMKALENADYILYAGSLVPEAVL
FT                   QWAKSGSEVETSAGMHLDEMASKMAEAWNEGKRVVRLHTGDPSLYGAVREQMAKLDEKE
FT                   IPYEVIPGVTAAFAAAAELKAEYTVPNISQTLIFTRISGRTPVPEKESLLSLAEHKASL
FT                   AIYLSASMADEVADILSKTYGEQASCAIAYKVSHPEQNIILTTVDKMAGIMEDNKINRL
FT                   ALIIVGPFLDAKGNAQSLLYNKSFSHGYREEA"
FT   gene            610628..611671
FT                   /locus_tag="Dalk_0451"
FT   CDS_pept        610628..611671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0451"
FT                   /product="cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein"
FT                   /note="PFAM: cobalamin (vitamin B12) biosynthesis CbiG
FT                   protein; KEGG: tex:Teth514_0314 cobalamin biosynthesis
FT                   protein CbiG; IMG reference gene:2503006151; PFAM:
FT                   Cobalamin synthesis G C-terminus; Cobalamin synthesis G
FT                   N-terminal; InterPro:Cobalamin (vitamin B12) biosynthesis
FT                   CbiG, core; InterPro:Cobalamin synthesis G N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02158"
FT                   /db_xref="GOA:B8FH70"
FT                   /db_xref="InterPro:IPR002750"
FT                   /db_xref="InterPro:IPR021744"
FT                   /db_xref="InterPro:IPR036518"
FT                   /db_xref="InterPro:IPR038029"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH70"
FT                   /protein_id="ACL02158.1"
FT                   /translation="MTDWSEKKLAVWAMTPNAAELAQRVKDAWPGVDLFFSSKLKIDGA
FT                   DAEFTSFSRTLGEAWSQYDGHYFIMATGIVVRVIANLMEDKTKDPAVICGDEAGHFVIS
FT                   LVSGHIGGANELARELASILDAQPVITTSTDVNHAPSIDVIASDHGLHIENKRAIKHVS
FT                   MAYIKGQALPMHDPYNLVKPHIPRELIEEPAMFTPTRSGVFVDYEVRDLPGLVLVLRPK
FT                   CLVAGIGCRRGVSKQELEAHVREVFKAQGLSIHSLARIVSVDLKADEPGLLQLAEDLDV
FT                   PIHFYSTDELDQVKMVPNPSPLVDKHIGVKSVCEAAAILATGRRNLITPKQASKTATVA
FT                   IAAMPFT"
FT   gene            611671..612429
FT                   /locus_tag="Dalk_0452"
FT   CDS_pept        611671..612429
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0452"
FT                   /product="precorrin-3B C17-methyltransferase"
FT                   /note="TIGRFAM: precorrin-3B C17-methyltransferase; PFAM:
FT                   Uroporphyrin-III C/tetrapyrrole (Corrin/Porphyrin)
FT                   methyltransferase; KEGG: dps:DP0224 precorrin-3B
FT                   C17-methyltransferase (CobJ); IMG reference
FT                   gene:2503006152; PFAM: Tetrapyrrole (Corrin/Porphyrin)
FT                   Methylases; TIGRFAM: precorrin-3B C17-methyltransferase;
FT                   InterPro:Cobalamin (vitamin B12) biosynthesis CobJ/CibH,
FT                   precorrin-3B C17-methyltransferase, core;
FT                   InterPro:Tetrapyrrole methylase; InterPro:Tetrapyrrole
FT                   methylase, subdomain 1; InterPro:Tetrapyrrole methylase,
FT                   subdomain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02159"
FT                   /db_xref="GOA:B8FH71"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR006363"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH71"
FT                   /protein_id="ACL02159.1"
FT                   /translation="MGTGPGNEFHMSGRAREVLGFVDIVVGYKTYLEIIEPVIQGKKTL
FT                   ATGMTKEVDRVEAAIDAALNGQSCALVSGGDPGVYAMAGLVLEILATRKIACNSCDAGA
FT                   EGGLSVEVVPGIPALCAGAALLGAPLTHDFAAISLSDLLTPWDLIEKRIAAAASADFVI
FT                   AIYNPKSKKRDWQLNRAREIILEHRGGTTPVGVVTGAMRENQRIQLSSLQDLDKADVGM
FT                   QSIVFIGNSSTFIYGDLMITPRGYSKKYDI"
FT   gene            612426..613946
FT                   /locus_tag="Dalk_0453"
FT   CDS_pept        612426..613946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0453"
FT                   /product="cobyric acid synthase CobQ"
FT                   /note="catalyzes amidations at positions B, D, E, and G on
FT                   adenosylcobyrinic A,C-diamide. NH(2) groups are provided by
FT                   glutamine, and one molecule of ATP is hydrogenolyzed for
FT                   each amidation; IMG reference gene:2503006153; PFAM:
FT                   CobQ/CobB/MinD/ParA nucleotide binding domain;
FT                   CobB/CobQ-like glutamine amidotransferase domain; TIGRFAM:
FT                   cobyric acid synthase CobQ; InterPro:CobB/CobQ glutamine
FT                   amidotransferase; InterPro:CobB/CobQ-like glutamine
FT                   amidotransferase; InterPro:Cobyric acid synthase CobQ;
FT                   InterPro:Cobyrinic acid a,c-diamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02160"
FT                   /db_xref="GOA:B8FH72"
FT                   /db_xref="InterPro:IPR002586"
FT                   /db_xref="InterPro:IPR004459"
FT                   /db_xref="InterPro:IPR011698"
FT                   /db_xref="InterPro:IPR017929"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033949"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH72"
FT                   /protein_id="ACL02160.1"
FT                   /translation="MKPKAKKAKCLAAFGTGSDVGKSIIATALCRIFSDKGYAVSPYKA
FT                   QNMSNNSGVTPEGLEMGRAQIVQAEAARIPPHVDMNPVLLKPVTQIGSQVVLLGKVLQD
FT                   YSAVQYHQEKTRLFDTACQALDRLRAENDVVVMEGAGSCAEVNLMARDIVNLKMAAYAD
FT                   APVILTADIDRGGVFAQIVGTLACLEKKQQDQIAGFIINRFRGDITLFKDGVDWIEKKT
FT                   GKRVFGVLPWFDHFHIQSEDSVVIEHPEAKTDPSQTPTVLVVRIPHISNFTDFDPLFQV
FT                   KGVAVDFVERVQDLSPYKAVILPGSKSTRNDLDWLEQTGWTAKIREYAQNGGHVLGVCG
FT                   GYQMLGKEVQDPGGLEGKPGATEGLGLLPLVTILKAPKTTTLSNFEWDGVPGAGYEIHM
FT                   GQTASLEDLNSGKVRSQGLFKVLDRNQQPCRDYDGAMSDNGRVMGTYMHGLFDSPAVLK
FT                   KWLKSLGLEGLEIAEESGMQARDRQYDLLARHFEKHVDVEALIKEAME"
FT   gene            613946..614467
FT                   /locus_tag="Dalk_0454"
FT   CDS_pept        613946..614467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0454"
FT                   /product="Adenosylcobinamide-phosphate guanylyltransferase"
FT                   /EC_number="2.7.7.62"
FT                   /note="PFAM: cobalbumin biosynthesis protein; KEGG:
FT                   dol:Dole_1229 adenosylcobinamide-phosphate
FT                   guanylyltransferase; IMG reference gene:2503006154; PFAM:
FT                   Cobinamide kinase / cobinamide phosphate guanyltransferase;
FT                   InterPro:Cobinamide kinase/cobinamide phosphate
FT                   guanyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02161"
FT                   /db_xref="GOA:B8FH73"
FT                   /db_xref="InterPro:IPR003203"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH73"
FT                   /protein_id="ACL02161.1"
FT                   /translation="MKSVFVIGGCRSGKSSIALDLANGQDVSEKIFIATCQPLDDEMQD
FT                   RVARHQADRGYDWRTVEEPLALTQAIGDNAKPGRVILVDCLTLWISNLVLADKTQDQIA
FT                   DKARELAEVIQKAPCPVILVSNEVGAGIVPENALSRLFRDAAGKVNQIMASACDQVQWV
FT                   VAGIPVIIKG"
FT   gene            614479..615246
FT                   /locus_tag="Dalk_0455"
FT   CDS_pept        614479..615246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0455"
FT                   /product="cobalamin 5'-phosphate synthase"
FT                   /note="TIGRFAM: cobalamin 5'-phosphate synthase; PFAM:
FT                   cobalamin-5-phosphate synthase CobS; KEGG: dol:Dole_1230
FT                   cobalamin 5'-phosphate synthase; IMG reference
FT                   gene:2503006155; PFAM: Cobalamin-5-phosphate synthase;
FT                   TIGRFAM: cobalamin 5'-phosphate synthase/cobalamin
FT                   synthase; InterPro:Cobalamin (vitamin B12) biosynthesis
FT                   CobS, cobalamin-5-phosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02162"
FT                   /db_xref="GOA:B8FH74"
FT                   /db_xref="InterPro:IPR003805"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH74"
FT                   /protein_id="ACL02162.1"
FT                   /translation="MDLKKLVANSRFMERLRGLRGAMQFLTTLPAGEVENFDASVMVAW
FT                   FPVVGLILGFITACFDFLALNIWAPSTVAVLDVVLLAALSGALHLDGLSDAADGLFSHR
FT                   PRERALEIMKDSRIGVMGLVAVAACLGIKWGGLSGLEHHRFLAIMAAPALARGGMLFGM
FT                   KFLPYGRPSGTGGSFFEKPLPMKAFFPLAIPVCLCLGMGAAGVMTIAAFTVSTFALLAF
FT                   YKAKMGCITGDMLGAMNEVNEALALLMLSGAWT"
FT   gene            615243..616343
FT                   /locus_tag="Dalk_0456"
FT   CDS_pept        615243..616343
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0456"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   dol:Dole_1231 aminotransferase class I and II; IMG
FT                   reference gene:2503006156; PFAM: Aminotransferase class I
FT                   and II; InterPro:Aminotransferase, class I/classII;
FT                   InterPro:Pyridoxal phosphate-dependent transferase, major
FT                   domain; InterPro:Pyridoxal phosphate-dependent transferase,
FT                   major region, subdomain 1; InterPro:Pyridoxal
FT                   phosphate-dependent transferase, major region, subdomain 2"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02163"
FT                   /db_xref="GOA:B8FH75"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH75"
FT                   /protein_id="ACL02163.1"
FT                   /translation="MIAGHGGNIAEAAAKMGLKPSDIMDMSSNTNPLGPMPGMLEHLKN
FT                   SMDCSVNLPEADAGSTTRAFADLHGLDPAKVLAAGGTTQFIYSLPRIFPTGKALILGPT
FT                   YSDYADACLMNNMPFARGFTEPGDSFKHDPADIASAAKDSQLVFLCNPNNPTGDLYTPD
FT                   EIRWTSEKRPETVFVVDESYLPFVRDYADYSLANDGQSNVIVLSSFSKIFKVPGLRIGF
FT                   AVAPTRLKEKLASYQLPWSVGSLAQKAVSFAADNYEDALAYVEKTAGYTAREHKIMEGR
FT                   AASAKGLTAYPGAAPFVLFKLPERLDAQAVWKGMLENRLLIRNCSNFQGLGPAYVRISL
FT                   KDPQSNAKAADLLASLANDFIEKESA"
FT   gene            616340..617299
FT                   /locus_tag="Dalk_0457"
FT   CDS_pept        616340..617299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0457"
FT                   /product="cobalamin biosynthesis protein CobD"
FT                   /note="TIGRFAM: cobalamin biosynthesis protein CobD; PFAM:
FT                   cobalamin biosynthesis protein CbiB; KEGG: dol:Dole_1233
FT                   cobalamin biosynthesis protein CobD; IMG reference
FT                   gene:2503006157; PFAM: CobD/Cbib protein; TIGRFAM:
FT                   cobalamin biosynthesis protein CobD; InterPro:Cobalamin
FT                   biosynthesis CobD/CbiB"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02164"
FT                   /db_xref="GOA:B8FH76"
FT                   /db_xref="InterPro:IPR004485"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH76"
FT                   /protein_id="ACL02164.1"
FT                   /translation="MTPELPLPLWQALIIAFILDMILGDPQGMPHPIRLMGRLIEGWEP
FT                   RFRRLPIPTVWAGALFTLCLVALVWISAWIVLAAGAAMHPWLGAGLEIIILYFSIAPRC
FT                   LDKAAYAVEKPLRQGDAEKARAELSMIVGRETKDLTPTQMSRAAVETVAENFVDGVLSP
FT                   LFWIAVGGAPAAMAFKMASTLDSMVGYKNEQYILFGKASARLDDVANFIPARLSIPIIA
FT                   LAARLLGLSHKAAFKTAVLEGKNHKSPNAGYPEAAFAGALEIRLNGPAVYHGELLDKPF
FT                   LGEKFGDPGAEHITKARRLMLASSFLGLLFAVLAAAVF"
FT   gene            617320..618402
FT                   /locus_tag="Dalk_0458"
FT   CDS_pept        617320..618402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0458"
FT                   /product="nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase"
FT                   /EC_number="2.4.2.21"
FT                   /note="KEGG: mta:Moth_1721
FT                   nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; TIGRFAM:
FT                   nicotinate-nucleotide/dimethylbenzimidazole
FT                   phosphoribosyltransferase; PFAM:
FT                   Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase; IMG reference gene:2503006158;
FT                   PFAM: Phosphoribosyltransferase; TIGRFAM:
FT                   nicotinate-nucleotide--dimethylbenzimidazole
FT                   phosphoribosyltransferase;
FT                   InterPro:Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase, N-terminal;
FT                   InterPro:Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase, prokaryotic;
FT                   InterPro:Nicotinate-nucleotide-dimethylbenzimidazole
FT                   phosphoribosyltransferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02165"
FT                   /db_xref="GOA:B8FH77"
FT                   /db_xref="InterPro:IPR003200"
FT                   /db_xref="InterPro:IPR017846"
FT                   /db_xref="InterPro:IPR023195"
FT                   /db_xref="InterPro:IPR036087"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH77"
FT                   /protein_id="ACL02165.1"
FT                   /translation="METNIKNLQDVLDNIQPIDESMVEQAKEHTAKLAVPPRALGRLHD
FT                   IGEKLCGIMGSQDPDVASKAVIVMAGDHGIVDEGVSAFPQEVTGEMVKNFLAGGAGINC
FT                   LCRHVGAKVIVVDMGMKVDPMALGLETGDIFFSHKIAPGTENFAKGPAMTKEQAEKAIL
FT                   CGFERASALINEGVQVLGTGDMGIGNTTPSAAIGAVLTGASLDDMTGRGTGVDDEGLQR
FT                   KKAAIQKGIDVNQPDPKDGLDVLAKVGGYEIAGIAGIVLAAAYHKKPVVIDGFISTAGA
FT                   LIAHALCPLAGQYMFAGHCSEEPGHKLMLDHLGLKPILDLGLRLGEGTGGALAMNILEA
FT                   SVKVFKEVLTFEQAGVTNKE"
FT   gene            complement(618447..619262)
FT                   /locus_tag="Dalk_0459"
FT   CDS_pept        complement(618447..619262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0459"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: cpb:Cphamn1_1499 xylose isomerase domain protein TIM
FT                   barrel; IMG reference gene:2503006159; PFAM: Xylose
FT                   isomerase-like TIM barrel; InterPro:Xylose isomerase, TIM
FT                   barrel domain; InterPro:Xylose isomerase-like, TIM barrel
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02166"
FT                   /db_xref="GOA:B8FH78"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH78"
FT                   /protein_id="ACL02166.1"
FT                   /translation="MSYADAKNTSLKKAFEFRLGTTSYIIPDDVLPNIAFLADKIDDVE
FT                   LVLFESDELSNIPTPDQVRELKTMAQDNDLTYTVHLPLDTWTGSADESVRKSSVEKIKR
FT                   VIDRMAPCDPFAYVCHLHGDRRGQNPVDDPALWVDQHVKSLTEILALAAPHDICIETLD
FT                   YPFSMVESVVWDLDLSVCLDIGHLIIGGYNVEEHLDKYLHKARILHLHGVREGHDHTDI
FT                   SHAVPALLDDLMNRINRPGQPERVLTLEIFTQRHLERSLEVLRPYANKA"
FT   gene            619538..619831
FT                   /locus_tag="Dalk_0460"
FT   CDS_pept        619538..619831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0460"
FT                   /product="hypothetical protein Dalk_0460"
FT                   /note="KEGG: gsu:GSU2516 rhodanese-like domain-containing
FT                   protein; IMG reference gene:2503006160; PFAM:
FT                   Rhodanese-like domain; InterPro:Rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02167"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH79"
FT                   /protein_id="ACL02167.1"
FT                   /translation="MQRLVWLLVFLSLFVSFPAFGMERFKIVTTEEMRTMLQQREEGKI
FT                   DFLLVNTLDKLLFDNESIPGSINVPWASVDKTMHRLGTDKDHPIILYCKGYR"
FT   sig_peptide     619538..619600
FT                   /locus_tag="Dalk_0460"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006160_SP"
FT   gene            619904..620347
FT                   /locus_tag="Dalk_0461"
FT   CDS_pept        619904..620347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0461"
FT                   /product="hypothetical protein Dalk_0461"
FT                   /note="KEGG: pph:Ppha_0112 rhodanese domain protein; IMG
FT                   reference gene:2503006161; InterPro:Rhodanese-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02168"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH80"
FT                   /protein_id="ACL02168.1"
FT                   /translation="MKDWEKSGYEIEVRNPLPEYDGKYMDAQELAALISRAETQGCKDP
FT                   DGNPLFTLLDYRTELANNSGENMQVIKTNCPKLIMHLDDFADPVQRGLIPRKGLVVLVC
FT                   ETGNRDPFAMRYLHSHGYDNVAGLRFGMRAWIKEDYAVEEYQY"
FT   gene            620381..621775
FT                   /locus_tag="Dalk_0462"
FT   CDS_pept        620381..621775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0462"
FT                   /product="putative PAS/PAC sensor protein"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   KEGG: dau:Daud_0138 diguanylate cyclase with PAS/PAC
FT                   sensor; IMG reference gene:2503006162; InterPro:PAS"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02169"
FT                   /db_xref="GOA:B8FH81"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH81"
FT                   /protein_id="ACL02169.1"
FT                   /translation="MAENSEKSLKRALWTGISVIFVIFFLLAANYWLTTQSNKSFEDLY
FT                   NISGAKDSFYALTLSEDIALGDPSHHKDVDSKLTTLEAQCMQCHDSRHQNVLLKREKLF
FT                   QELYDVTRKSENSYFLVRERFMDLLASVKYIHQHHIVYLRNMVEKGESSPGYGVEDDFK
FT                   RSSAHSASEVDILDAASAIRTSLFDAFGIFHALEQGRQVFEVEKAFKSRIEAFYASVNT
FT                   FEDYSLDAQDGILVEELLQMGRGFEDSFGNLLLMESRKRELQQRLEVESLSIKQLLGDL
FT                   ASHFAQRYEDSKKNTRLLQLAALGIAFVFVFLNFLIGRRITRETHRIAMETIRIGQDIS
FT                   YQIPLGDKTFQEFDIVLRTLNSMAGRLHSNLLRLEKSREHLEEAVEERTRELKLANAHL
FT                   IDEMADRRKAQVALAESEERLKNVVDHISAGIIIIDADTYRVVSANPFAQNLLAPEGES
FT                   LVGRNW"
FT   sig_peptide     620381..620464
FT                   /locus_tag="Dalk_0462"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006162_SP"
FT   gene            621782..623140
FT                   /locus_tag="Dalk_0463"
FT   CDS_pept        621782..623140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0463"
FT                   /product="histidine kinase"
FT                   /note="PFAM: response regulator receiver; ATP-binding
FT                   region ATPase domain protein; histidine kinase A domain
FT                   protein; KEGG: sat:SYN_02576 signal transduction histidine
FT                   kinase; IMG reference gene:2503006163; PFAM: Response
FT                   regulator receiver domain; Histidine kinase-, DNA gyrase
FT                   B-, and HSP90-like ATPase; His Kinase A (phosphoacceptor)
FT                   domain; InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:CheY-like superfamily; InterPro:Signal
FT                   transduction histidine kinase, core; InterPro:Signal
FT                   transduction histidine kinase, homodimeric; InterPro:Signal
FT                   transduction histidine kinase, subgroup 1,
FT                   dimerisation/phosphoacceptor domain; InterPro:Signal
FT                   transduction histidine kinase-related protein, C-terminal;
FT                   InterPro:Signal transduction response regulator, receiver
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02170"
FT                   /db_xref="GOA:B8FH82"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH82"
FT                   /protein_id="ACL02170.1"
FT                   /translation="MDASDASPSPGNRTRIGGYEKTLLDMQNKPVHVLSTVIPLVLDRK
FT                   NHLLESFIDIRQLREAQEKRRDLETQLERSRKMEAIGTLAGGIAHDFNNILAAIIGYSE
FT                   LAAFDLPEDHPSHAHIQEVLKASERAKRIIKQILAFSRRSEPEQSLIRLEEILDEVLTL
FT                   IRASFPSSIEIRKKIFCENDRIMGDSTQLHQVFMNLLTNARHAVSEETGVVEVAVESVD
FT                   VTDHAWATKHSIIPGPFLKISITDNGHGMDEVTLQRIFDPYFTTKEKGKGTGMGLAVVE
FT                   GVVTSHFGTITVDSKPGRGATFAIWLPAIEKGEETAIHGDETIQTGAESVLFVDDEEML
FT                   VKFGERMLSVLGYKVQAFTDPLAALEAFQENPKGFDLVVTDLTMPGLSGDKLASEILKI
FT                   RPDIPIILATGYPRSFTQKRALEIGIRSVFLKPLLATEFSQAIRKVLDGQPDA"
FT   gene            complement(623502..623780)
FT                   /locus_tag="Dalk_0464"
FT   CDS_pept        complement(623502..623780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0464"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: noc:Noc_2433 hypothetical protein; IMG
FT                   reference gene:2503006164"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02171"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH83"
FT                   /protein_id="ACL02171.1"
FT                   /translation="MTGLRENNPDPALVEQAKKKAPRAESIQTGSGAYDMACFCALEKD
FT                   YDGCRKRLKVLIRAGALPSCKHISTDRDLDNVRDQVWFQDFMKSGCP"
FT   gene            623861..624805
FT                   /locus_tag="Dalk_0465"
FT   CDS_pept        623861..624805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0465"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: vvy:VVA0153 hypothetical protein; IMG
FT                   reference gene:2503006165"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02172"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH84"
FT                   /protein_id="ACL02172.1"
FT                   /translation="MAGKNGRKNTIILIHGRGLKPPRQDLEAAWKDALHFIIKRDHPSR
FT                   LPLLEKAHIDFVYYGHYSNNFLNGSKPVPLNPRDRNEVLERLTRYRANEFTEANFKVLP
FT                   GYPPRGDRFSHGLGSFAQKLHLGTRLVELAARDIREYWDDNVRFGKKVRFKLMDPIREA
FT                   MDRGDRIMVMAHSLGTIIAYDAFWLLSRCEKYANTRYAHSKIDFWLTMGSPLAEDTAMQ
FT                   HLQGADAEGLDRYPSNVRKWLNLCAYEDYICGRRCMAEKFQPMVESGLSESIEQKRIYN
FT                   LAIREGKCSPHNPMGYLIHPETSHALSRWLSGD"
FT   gene            624919..625527
FT                   /locus_tag="Dalk_0466"
FT   CDS_pept        624919..625527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0466"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sfu:Sfum_3297 hypothetical protein; IMG
FT                   reference gene:2503006166"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02173"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH85"
FT                   /protein_id="ACL02173.1"
FT                   /translation="MSSYNEEQAVTLEIIRQYFSGPGDRKQALLEIIRPYLEFRKRTDL
FT                   FLEEHFADLCTAKCYQSNLSACCSKEGIVAFFADAAVNAAVSSEQSLDRITSVTSRPNT
FT                   GMKCVFLTPEGCLWKVKPIVCQMFLCAAAEKQVFGGNPDLQEEWNRLEAEKKTFTWPDK
FT                   PVLFDELEKIFMDQGYQSPLMYCHNSPGLMMVKKKAGLL"
FT   gene            complement(625556..626377)
FT                   /locus_tag="Dalk_0467"
FT   CDS_pept        complement(625556..626377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_1250 hypothetical protein; IMG
FT                   reference gene:2503006167"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02174"
FT                   /db_xref="GOA:B8FH86"
FT                   /db_xref="InterPro:IPR025517"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH86"
FT                   /protein_id="ACL02174.1"
FT                   /translation="MRRITSLTSLLAFLFTVLTSIILYIVPQGRVAYWSNWKLWGLTKE
FT                   QWGAIHINLGFLFLIFLCLHIYYNWKPLTAYMKDKTRKLKIFTKEFNIALIIVLVTALG
FT                   TWMEIPPFSTVLDIGEGFKDRAAVKYGEPPYGHAELSPLKGFAQKMGMDADKALEALRQ
FT                   AGLSAENSSQTLKEIGEANDLTPQQVYEAMKSATPAVEPGQGLPPSPPPGTGNMSIKDI
FT                   CAQYSLDRMAVVQHLRNKGLEIKGSMTLKEAAEANNMGPLDLYDLMKEAAK"
FT   sig_peptide     complement(626282..626377)
FT                   /locus_tag="Dalk_0467"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006167_SP"
FT   gene            complement(626500..627471)
FT                   /locus_tag="Dalk_0468"
FT   CDS_pept        complement(626500..627471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0468"
FT                   /product="Selenophosphate synthase (Selenide, water
FT                   dikinase)"
FT                   /EC_number="2.7.9.3"
FT                   /note="KEGG: sfu:Sfum_3401 selenide, water dikinase;
FT                   TIGRFAM: selenide, water dikinase; PFAM: AIR synthase
FT                   related protein; AIR synthase related protein domain
FT                   protein; IMG reference gene:2503006168; PFAM: AIR synthase
FT                   related protein, N-terminal domain; AIR synthase related
FT                   protein, C-terminal domain; TIGRFAM: selenium donor
FT                   protein; InterPro:AIR synthase-related protein;
FT                   InterPro:AIR synthase-related protein, C-terminal;
FT                   InterPro:PurM, N-terminal-like; InterPro:Selenide water
FT                   dikinase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02175"
FT                   /db_xref="GOA:B8FH87"
FT                   /db_xref="InterPro:IPR004536"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR023061"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH87"
FT                   /protein_id="ACL02175.1"
FT                   /translation="MAGLPDQKHPDLLVGTSTSDDAGVFRLTPDIALVQTLDFFTPIVD
FT                   SPYHFGQIAAANSLSDVYAMGGRPLTAMNIVCFPVCDLPNSVLTETLRGGLDKMTEAGV
FT                   ALAGGHSVDDKEFKYGLSVTGVVHPSKILTNANVKKGDLLVLTKPIGTGVLATAVKGQV
FT                   DFQESESLLIEISGTLNRRAGEIMHTFEPHACTDVTGFGLAGHALEMSKGSNLSVTLFA
FT                   HEAMFIPKALELASMGLLPAGTYANRQFCENYTKVHPSVEQVQADLVFDPQTSGGLLVS
FT                   MTPAMARDYVSAMNDQGLFAVIAGEVGGRCTAGSLEIVSNKA"
FT   gene            627719..628450
FT                   /locus_tag="Dalk_0469"
FT   CDS_pept        627719..628450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0469"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   sfu:Sfum_1539 transglutaminase domain protein; IMG
FT                   reference gene:2503006169; PFAM: Transglutaminase-like
FT                   superfamily; InterPro:Transglutaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02176"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH88"
FT                   /protein_id="ACL02176.1"
FT                   /translation="MSSVFTLAGLEPIALKDLDSMDEKYLKPTAILDSDHPLVQQYARE
FT                   TVRDETDPVKKAVLLFNKVRDHIVYDPYTPFHRPQDYQASNLIERGRGYCVCKACLLCA
FT                   LGRAAGIPTRLGFATIRNQGATQAVIDMLGSDLFVYHGFAEFFLNGKWLKATPAFDQPV
FT                   CDKHNIDLPQFDGEHDCVFPPKNRAGEPYVDYVEDFGSDHDLPLDKLIKAWEKIYGRER
FT                   MDLWIQALESPEGIESWRPRH"
FT   gene            complement(629570..630079)
FT                   /locus_tag="Dalk_0470"
FT   CDS_pept        complement(629570..630079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0470"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   dol:Dole_3003 CMP/dCMP deaminase zinc-binding; IMG
FT                   reference gene:2503006170; PFAM: Cytidine and
FT                   deoxycytidylate deaminase zinc-binding region;
FT                   InterPro:APOBEC/CMP deaminase, zinc-binding;
FT                   InterPro:CMP/dCMP deaminase, zinc-binding;
FT                   InterPro:Cytidine deaminase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02177"
FT                   /db_xref="GOA:B8FH89"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH89"
FT                   /protein_id="ACL02177.1"
FT                   /translation="MDHMQFMNKALELARQALEAGEFPVGCILVHDGRVIAQGARVGVA
FT                   GGGTGELEHAEMVAMARFENMENAPPPSEVTIYCTMEPCLMCFGALMIHGITKIVYAYE
FT                   DAMGGGTALDRSTLPPLYRDAEVEITPHVGRSQSLALFKAFFSRPDNHYWKHSLLAQYT
FT                   LEQEAE"
FT   gene            complement(630100..631377)
FT                   /locus_tag="Dalk_0471"
FT   CDS_pept        complement(630100..631377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0471"
FT                   /product="TRAP-type C4-dicarboxylate transport system, DctM
FT                   subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: dvl:Dvul_2954 TRAP
FT                   dicarboxylate transporter, DctM subunit; IMG reference
FT                   gene:2503006171; PFAM: DctM-like transporters; TIGRFAM:
FT                   TRAP transporter, DctM subunit; InterPro:TRAP
FT                   C4-dicarboxylate transport system permease DctM subunit;
FT                   InterPro:TRAP dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02178"
FT                   /db_xref="GOA:B8FH90"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH90"
FT                   /protein_id="ACL02178.1"
FT                   /translation="MTAEILIITMLALFALEAPIAVAIMAASVLAILVQGGFPLMVVVQ
FT                   KMFGGVNSFPLMAVPLFMFAGVIMEKGDSSKRIIDFANALVGWLPGGLAAVTIVSAMFF
FT                   AGISGSAAADAAAVGAVLIPAMKKSGYDSDFAAAVQASGGSIGVIIPPSIPMIIFGFLT
FT                   GASVGKLFAGGIIPGVLIGASLIIVASFISKKNGYGAAKVFSWAEVWETFKKAFLALGT
FT                   PIIILGGILFGVFTATESAAVAVAYSLFLGMAVYRKIGPKDLPQLFIRAAITSSLVMFI
FT                   ISTASAFSWIAAMENIPAKLAGGLLSVSSNPVILLLCVNLVLLIAGAFVETTAALILLV
FT                   PTIVAMQPALGIDLVHLGVIIVTNLAIGMLTPPMGICLIVSGSISNDPIMTVSRRVLPF
FT                   LAVLIIDLLLISFYSPLTMRMAALIK"
FT   sig_peptide     complement(631300..631377)
FT                   /locus_tag="Dalk_0471"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006171_SP"
FT   gene            complement(631367..631867)
FT                   /locus_tag="Dalk_0472"
FT   CDS_pept        complement(631367..631867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0472"
FT                   /product="TRAP-type C4-dicarboxylate transport system, DctQ
FT                   subunit"
FT                   /note="PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; KEGG: dvl:Dvul_2953 tripartite
FT                   ATP-independent periplasmic transporter DctQ; IMG reference
FT                   gene:2503006172; PFAM: Tripartite ATP-independent
FT                   periplasmic transporters, DctQ component;
FT                   InterPro:Tripartite ATP-independent periplasmic
FT                   transporter, DctQ component"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02179"
FT                   /db_xref="GOA:B8FH91"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH91"
FT                   /protein_id="ACL02179.1"
FT                   /translation="MAAKFLRVYQGLSLGLNRAVEGVLFALGLTMAIIVCTQVFFRYVV
FT                   NDSLFWSEEAARYLLVWLTFLGATSAYYRGVHPKIESLAKLAPPRVHLAARVLVHLISL
FT                   ALFAVLIVYGVKFSYFVRFQISPALNIPKWTVTAVIPVSGVIFCIHNLRLLLEEFTGGA
FT                   NDR"
FT   gene            complement(631870..632847)
FT                   /locus_tag="Dalk_0473"
FT   CDS_pept        complement(631870..632847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0473"
FT                   /product="TRAP-type C4-dicarboxylate transport system, DctP
FT                   subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: dvl:Dvul_2952 TRAP dicarboxylate
FT                   transporter, DctP subunit; IMG reference gene:2503006173;
FT                   PFAM: Bacterial extracellular solute-binding protein,
FT                   family 7; TIGRFAM: tripartite ATP-independent periplasmic
FT                   transporter solute receptor, DctP family;
FT                   InterPro:Extracellular solute-binding protein, family 7,
FT                   bacteria; InterPro:TRAP dicarboxylate transporter, DctP
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02180"
FT                   /db_xref="GOA:B8FH92"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH92"
FT                   /protein_id="ACL02180.1"
FT                   /translation="MKARIVLLAAVLTIGFCLPLQAAENIKLGVVTKPGSAQNVVADKF
FT                   KELLEAKSNGDWTVTIYDSGVLGNETEMLQQIQMNTLHIGIITGGPFDTFTPIVRVINY
FT                   PFLFKDNAQADEILDGPLGQEILDGLEPMGFKGLCFSENGFRNLTNSKRAVKTPEDLKG
FT                   LKIRVMNSALHKTIWRALGANPTPMAWPIYTELQQGVIDGQENPLWVMEVYKFYEIQKY
FT                   MTMTRHVYSPHIDVASLKWWRNLDAKDQALIAECMKGAAKFQRKDNRDKDAARIKLLQE
FT                   KGMQIEMHPDVDAFRQKVASLAGSDMFKDPAVHDLLVKMLEAVK"
FT   sig_peptide     complement(632782..632847)
FT                   /locus_tag="Dalk_0473"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006173_SP"
FT   gene            633354..635225
FT                   /locus_tag="Dalk_0474"
FT   CDS_pept        633354..635225
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0474"
FT                   /product="Putative methyl-accepting chemotaxis sensory
FT                   transducer with Cache sensor and HAMP domain"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; Cache type 2 domain protein;
FT                   KEGG: dps:DP0987 methyl-accepting chemotaxis protein; IMG
FT                   reference gene:2503006174; PFAM: Cache domain; HAMP domain;
FT                   Methyl-accepting chemotaxis protein (MCP) signaling domain;
FT                   InterPro:Cache, type 2; InterPro:Chemotaxis
FT                   methyl-accepting receptor, signalling; InterPro:HAMP linker
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02181"
FT                   /db_xref="GOA:B8FH93"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR033480"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH93"
FT                   /protein_id="ACL02181.1"
FT                   /translation="MPRAGVFFIIQKIKAFNLYKKGRTVDISRKINFLFAAGLIAMAVM
FT                   AWWLSSHFLMQAKNSEIQTIHGLLLNERQKQAENLVNNAFCVIETADFYETARNALREM
FT                   RYGPKTLNVEASKGSEGAEGAEAKGSDYFFVVDVDGMFWVNPMHPELEETVALDLKDAS
FT                   GREYIKEIIETAKNSEDGTGALIYTEGVEGSDRVQTKKGFFKLYKDWGWILCTGVPIDD
FT                   IDVIAAGIDSNVEASFSGKKRSQVIYMALMGLLIIVLSRTLVWWKIVSPIKRATAMMRE
FT                   IARGEADLTKRLKVESKDEIGQWAMSFNTFVENTQAMIREIMAHARNLQNASGEMRVVS
FT                   DSLAAGTDQTSTETHWVANSVNDMNINLGDAAVSLNETAHTVRQIAANSNKMNKSLAAI
FT                   EKKTEDAMAVTKKAVVQAVDASEKILHLGRMAAFIGEVNEAIAEVTDQVNMLSINAAIE
FT                   AAKAGEAGKGFQVVAREMKALSAQTAEASANIRSQIRQIQDTSHQAIDEVENITMVIKG
FT                   IDGFVEDIVKATREQAGHTSSIAHDIQETSRALDRVNDNVSSCSESTSLIVRKISEVNT
FT                   TAGDMAQGNQNLIANASMLTSMADQLQNMVFRFKIIDEGPPARAIMH"
FT   sig_peptide     633354..633491
FT                   /locus_tag="Dalk_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006174_SP"
FT   gene            complement(635289..636356)
FT                   /locus_tag="Dalk_0475"
FT   CDS_pept        complement(635289..636356)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0475"
FT                   /product="dTDP-glucose 4,6-dehydratase"
FT                   /EC_number="4.2.1.46"
FT                   /note="TIGRFAM: dTDP-glucose 4,6-dehydratase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: pca:Pcar_2593 dTDP-glucose
FT                   4,6-dehydratase; IMG reference gene:2503006175; PFAM: NAD
FT                   dependent epimerase/dehydratase family; TIGRFAM:
FT                   dTDP-glucose 4,6-dehydratase; InterPro:dTDP-glucose
FT                   4,6-dehydratase; InterPro:NAD(P)-binding domain;
FT                   InterPro:NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02182"
FT                   /db_xref="GOA:B8FH94"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH94"
FT                   /protein_id="ACL02182.1"
FT                   /translation="MNRRKILLTGGAGFIGSNFILQALREDPHCGICNLDALTYAGSPR
FT                   NFQGLPRDQASRHKLVHGNICDAALLERLFLEEDFDAVVHFAAESHVDRSIKDALCFAS
FT                   TNVMGTCTLLEAARQNWESRGRPRDFLFIHVSTDEVFGSLGPEGSFSQASPYDPSSPYS
FT                   ASKAASDHFVRAYHRTYGLPCVVSNCSNNYGPYQFPEKLIPLMLMQILDQKPLPVYGDG
FT                   QNVRDWLFVEDHCRALMHILEKGAAGETYIIGGGEEKTNLEVVHLLCELADRKLNRPAS
FT                   EDSKRLISMVKDRPGHDRRYAMDFSETTARLGWKPAHTFRQGLEATVDWYLSNRTWVEQ
FT                   VRSGEYRNWVESHYK"
FT   sig_peptide     complement(636288..636356)
FT                   /locus_tag="Dalk_0475"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006175_SP"
FT   gene            636788..636985
FT                   /locus_tag="Dalk_0476"
FT   CDS_pept        636788..636985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0476"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   gbm:Gbem_1545 transcriptional regulator, XRE family; IMG
FT                   reference gene:2503006176; PFAM: Helix-turn-helix;
FT                   InterPro:Helix-turn-helix type 3; InterPro:Lambda
FT                   repressor-like, DNA-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02183"
FT                   /db_xref="GOA:B8FH95"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH95"
FT                   /protein_id="ACL02183.1"
FT                   /translation="MAKNCLKEIRESALLSKAELARKAGISPITVDRIEKGYPCRMETQ
FT                   RKILEALGYQPKDKVRVFGE"
FT   gene            636991..638046
FT                   /locus_tag="Dalk_0477"
FT   CDS_pept        636991..638046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0477"
FT                   /product="Type IV pilus assembly protein PilM"
FT                   /note="TIGRFAM: type IV pilus assembly protein PilM; KEGG:
FT                   dol:Dole_0333 type IV pilus assembly protein PilM; IMG
FT                   reference gene:2503006177; PFAM: Competence protein A; Cell
FT                   division protein FtsA; TIGRFAM: type IV pilus assembly
FT                   protein PilM; InterPro:Cell division protein FtsA domain;
FT                   InterPro:Type IV pilus assembly protein PilM"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02184"
FT                   /db_xref="GOA:B8FH96"
FT                   /db_xref="InterPro:IPR003494"
FT                   /db_xref="InterPro:IPR005883"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH96"
FT                   /protein_id="ACL02184.1"
FT                   /translation="MALFKKQEGLVGLDIGSAAIKIAEIEERKQSRVLAKFGLMELSEG
FT                   AIEDGVIKDHEKVAETIKDLCRAFNIKQLNAAISIAGYSVIIKNITVKTMTEEEMQESI
FT                   SVEAEQYLPFDIQDVYLDFHIVGNSSERDGHMDVVLVAAKKDLVDEYVSVVEMAGLHPV
FT                   VMDVDAFAVQNIYELLSDVDDEIVALVDVGASKTSVNIIKNRNSVLIRDVAMGGAQITQ
FT                   EIMKRGGCSYDEAEQWKADPEHAKMDKEELNDIIALATARWCEEIRPAFDFFYSMNDER
FT                   LSKIVMSGGSSGIIGFKETLAAETGIDVFLLDPFAAMDVSDEQFDPGYLKRIGPQATIA
FT                   LGLALRRAGDK"
FT   gene            638043..638738
FT                   /locus_tag="Dalk_0478"
FT   CDS_pept        638043..638738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0478"
FT                   /product="Putative fimbrial assembly membrane protein PilN"
FT                   /note="PFAM: Fimbrial assembly family protein; KEGG:
FT                   dol:Dole_0332 fimbrial assembly family protein; IMG
FT                   reference gene:2503006178; PFAM: Fimbrial assembly protein
FT                   (PilN); InterPro:Fimbrial assembly"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02185"
FT                   /db_xref="GOA:B8FH97"
FT                   /db_xref="InterPro:IPR007813"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH97"
FT                   /protein_id="ACL02185.1"
FT                   /translation="MIRVNLLPFRAARKSENVKRQVVVFLAAIVLFIFGCAFYAVFLMG
FT                   QVADLETELAQAEADLVKYKKQAAEVDAILAEIAMLEKREATIEGLRRSRFDAVKLLDH
FT                   LTQLISPPSSGVLAAKDQRVWLVALKSKTAERKQDLDIEGVAVDTKDVAAFMDRLENFT
FT                   ESPSGPSLAMAGDGAQPEIPYFSDVTLRKLSASDDSALLNFKQFNIHCQRIMPGAEDED
FT                   TAKKAPKKK"
FT   sig_peptide     638043..638177
FT                   /locus_tag="Dalk_0478"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006178_SP"
FT   gene            638788..639435
FT                   /locus_tag="Dalk_0479"
FT   CDS_pept        638788..639435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0479"
FT                   /product="Pilus assembly protein PilO"
FT                   /note="PFAM: Pilus assembly protein PilO; KEGG:
FT                   gme:Gmet_0973 pilus assembly protein, PilO; IMG reference
FT                   gene:2503006179; PFAM: Pilus assembly protein, PilO;
FT                   InterPro:Translation elongation factor EF1B/ribosomal
FT                   protein S6"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02186"
FT                   /db_xref="GOA:B8FH98"
FT                   /db_xref="InterPro:IPR007445"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH98"
FT                   /protein_id="ACL02186.1"
FT                   /translation="MAKSKDAPSQLTVFVDKIGQLSRPQRILIFVAAFLVIGALFTFLL
FT                   FKPYWTQKSELTTKLENKLNEVRVSQAKAAKLPKVREQRKKAEERLAKSAESLPKKKEV
FT                   PELLDRMSLSGKEAGLEWTLFQPRSEVEYPEDSYVEMPVEMIVEGDYHGIASFFDKVAH
FT                   LPRIVNINKYDIVPNNEQNGGWRRLVCTCQAVTYRFLEPEATDANKKKTNKK"
FT   gene            639464..640456
FT                   /locus_tag="Dalk_0480"
FT   CDS_pept        639464..640456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0480"
FT                   /product="hypothetical protein Dalk_0480"
FT                   /note="KEGG: dol:Dole_0330 hypothetical protein; IMG
FT                   reference gene:2503006180; PFAM: Pilus assembly protein,
FT                   PilP; InterPro:Pilus assembly protein PilP"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02187"
FT                   /db_xref="InterPro:IPR007446"
FT                   /db_xref="UniProtKB/TrEMBL:B8FH99"
FT                   /protein_id="ACL02187.1"
FT                   /translation="MAPGAAALAAGAVLLFTPVYAATPEFTPGPASVSMKVEARPDLAS
FT                   QPLASAVSVNAVEEQSGVSMKVSKPPVQSAPSGVSMKVARPSGTLPEAQPEQNGVSIKV
FT                   SPRPPAAKQPAPVEPPQESPAPPEEPVAAAPEQPVTPPPVAQQEKTPPAEQPIAMPEIK
FT                   IGAEDVGAEPESEEEEGVDVATALENYRYVRGAKLNPFRPLTDKPEKEPAPAIVDTPDE
FT                   GAQAAVKRPPIKRPRAPITPIERYPLNSLDLVAIMRMKREALALVQIPDGAKGFIIRKG
FT                   TYIGNEGGTVSEIDLQNNKVVVDVEEEDMFGNIIINKRQLSLQKSAGDF"
FT   sig_peptide     639464..639526
FT                   /locus_tag="Dalk_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006180_SP"
FT   gene            640458..642992
FT                   /locus_tag="Dalk_0481"
FT   CDS_pept        640458..642992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0481"
FT                   /product="Type IV pilus secretin PilQ"
FT                   /note="TIGRFAM: type IV pilus secretin PilQ; PFAM: type II
FT                   and III secretion system protein; NolW domain protein;
FT                   KEGG: dol:Dole_0329 type IV pilus secretin PilQ; IMG
FT                   reference gene:2503006181; PFAM: Bacterial type II/III
FT                   secretion system short domain; Secretin and TonB N terminus
FT                   short domain; Localisation of periplasmic protein
FT                   complexes; Bacterial type II and III secretion system
FT                   protein; TIGRFAM: type IV pilus secretin (or competence
FT                   protein) PilQ; InterPro:Bacterial general secretion pathway
FT                   protein D; InterPro:Localisation of periplasmic protein
FT                   complexes; InterPro:NolW-like; InterPro:Secretin/TonB,
FT                   short N-terminal; InterPro:Type II/III secretion system;
FT                   InterPro:Type IV pilus secretin PilQ"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02188"
FT                   /db_xref="GOA:B8FHA0"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA0"
FT                   /protein_id="ACL02188.1"
FT                   /translation="MGRRRFKQLVVGALVAALLIPGVYGCSVKQDQVKPQEPEVAAPVE
FT                   ETAAVPEAQREITGISVGGDENVASVLIRGNANLMYTAVKSPFNNGVVLYFPETALAAN
FT                   LPATLQPASPLVKNVMATQADGQMISARVEISLSRELPYEIKKEDGALYVLLGREEPVE
FT                   EDVLPASEPAAVQTAGASEDAAASQTMEETFRGAGAEDSPEEVAESKEVVSAPVPAPTG
FT                   PVWLTGVNFLQEPAGRSSIKIEVSQPVQYKVTRPAEKRLVVELPGVQVPKEQQRPLITT
FT                   RFESAADRIVPYARGPKDTAVSVELRQMVAYHVEQTDQGILLHLEASDIPPRPLAQAAL
FT                   PRWESIMRQEEPLPGPGEAAAMAGDDMMGGDLADYEGFEEGAGPKQSLDFMDAISQELR
FT                   TGSAKTEIVYTGEKIALDFYKTDIKNVFRILKEVSGLNFAIDRDVEGEVTLTLEKPVPW
FT                   DQVLHLVLKMNQLGMQKIKDVIRIAPQSVLDEEAAAERAREQANIDRIKTLTETKNQQM
FT                   QNELQQQALEPMVTEFIPVNYTDASDLIKHVEAVKSPDRGSVDVDIRTNTIIMIDIKDR
FT                   IKRARDIVSRLDRVTAQVQIEARVVEAQTTFSRSIGLAWNGESGIQPGDSREGVGPQRG
FT                   YDVLGGTYGYNWSVNYPTETDDYGNNTFGFNFSRLLGLTPLSLNATLNAAESRGEIKIV
FT                   SSPKIRTLDNKPATIKQGIDYPIKQFDGDGNTVIVYKAVDLQLEVTPHVTQDRRVSMKM
FT                   TVEKNDVGAVISEEQSFNTKEVDTELLVNDGDTVVIGGIIKTTFRDDVDGWPGLIDVPV
FT                   LGWLFKDSTKSEEREELLVFITPTIVELEEIQ"
FT   sig_peptide     640458..640532
FT                   /locus_tag="Dalk_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006181_SP"
FT   gene            642995..654121
FT                   /locus_tag="Dalk_0482"
FT   CDS_pept        642995..654121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0482"
FT                   /product="Ig domain protein group 1 domain protein"
FT                   /note="PFAM: Ig domain protein group 1 domain protein;
FT                   KEGG: yps:YPTB3789 Ig-like domain-containing protein; IMG
FT                   reference gene:2503006182; PFAM: Bacterial Ig-like domain
FT                   (group 1); InterPro:Bacterial Ig-like, group 1;
FT                   InterPro:Invasin/intimin cell-adhesion"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02189"
FT                   /db_xref="GOA:B8FHA1"
FT                   /db_xref="InterPro:IPR003344"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR015217"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA1"
FT                   /protein_id="ACL02189.1"
FT                   /translation="MKSRDHVMAHSNDANLQDIQGHCQGLEVHEGIHQSECEDTPMKKF
FT                   NLRSALLLMLGIIFLFFTACGPGGSGESDSSGGGGDDDGGGGTTVTNPTVAGAFYGATG
FT                   ADITNSTALLFSNPVEADGSDGSFETEDLKAGDHTIVVATTNDAYGTSYKNFTVGSSDM
FT                   ELFLFMPSATLPYVEHLATEAFTLNSNTVNGEFATLTMVAQTSGLYRLLGASGLASVNK
FT                   ADFRVENYDVNAPLPCDLPNVDNRATGLNATLGVQAPYVLVHVSPAMLRSLGNPGTLAL
FT                   PNPANWTTEKVLYFNPESHTWTDTNYTISDSVAGNMPITKGGLYGVFDESGVKPGTLRV
FT                   NLDDINASSGDLILVGDQVIEVGSQDPITIYNVPQPVDGNPLQVVVLDPNGNTADATTV
FT                   TVLPSGSYSWIDPITGATSGVTLSASASSVEVGGNTITLTVEVTDEYNKPVVGATVNFT
FT                   TDAGTLSAASALTDADGEAQVTLSSSNQTVPTVTVGADCNGVDATDLTLSFVPGSPFQL
FT                   ALSSDTITLDSYGTDNADLTLVVKDQFGNIVEDGATVYFTVLDSSNATVTPSPITSDSL
FT                   QTADGVVEATFSSALDPDVYSILGKYSETIVSNQVDITVVAAQAANISLQASKTTMTAS
FT                   GLDTCLITATVTDKYGNFVPQGTTVNFTAFSGTLSNGGVATVNSNGEASVTLTSSLYVG
FT                   TETVEATVNSISEDINLTYIPGPPAHIAFERTSITAYQGSGAEIAIRCSVTDNYGPAAI
FT                   GHNPVADGTTIYFYALDPNNASIGTVLSSSSATTNNGMASVNFSVPSDNPGSYTVQATY
FT                   QSVEGDTPVTINVLQTEPANVSVAAASDSIVADGASHTTITATVYDQYDNLMGDGVAVT
FT                   FTTTSGTLDATVGNGGTATYNTVTSGGIATVRLYSAQLVGSTTVRADVGGVTGTVDVDF
FT                   VAGAPASVTVSLSTSNMVADGESTANVTALVLDANANPVPDTTVQFSVEAGGGRVVPVS
FT                   DTTDENGYVTVTYIASSTGGTYLITATCGQGITGNKTMVLQDLVISSLILTAYIDGAQV
FT                   TGDVPELVADGTSNISLWAELTDNAGNPVEDGTVVTFVTTQGDLTYIGAGSGGGNSVTA
FT                   ETYNGIAKATLTSSTTAGTTAFITATSSSLVDSMTVAFVPGAPYRIDAYANPSSIPSYT
FT                   YYCPGDTARVYATVYDRTNNLVADGTEVVFSIDRGWIWDDYPLCPEDGYYTVVASKTEV
FT                   TANGVAKIGVLGNNTGTIETGTVNVCVDGLCYEDPTRPAPDNRGVQISYGSTGASSGLP
FT                   TRIVLSVDTDDLFIAGSGKAESCIITAVVYDETGDPIQDNYSAGDGLISATERTFQSAS
FT                   ATFITSGYDAGDYLVISSGEYAGSYEIVSVDNEHQVTLNTGANPFGSTETGVSFTAYIL
FT                   NNIEFKILNGPNNQENIDGNEGVGATSLKSTSSGIAYATFNSGYSPGPVSIQVTCTQGG
FT                   QSAVATYSDIVIGAGNPSVVNLYPHNEINSSSGANSMRQLDAVVTDKFGSPVPNGTAVY
FT                   FGLLDEITVSGAGFTVSDSGARSQVVVAEDVSNVNAGDTFYVGDEASDYNGGYTIYSVS
FT                   PPNTIVLDKQIDAGVSADNYIIGYAEYGNISGSQITGNGGVSGVAVNTILFPTYTAGNK
FT                   MVYIYALAYGADSSGNSVPVYDTWSGYYSPSRTIGSVLVSAGSTSLIANGTAETMITAE
FT                   IFDSTGAAVADGVTVTFTSQSGTLSDATADTVNGEATVTLTSPTTAGVDNITACVQGVC
FT                   GDLDVTYVAGQVSTLSLSLTPSNLTADGESTSVVEVVARDANFNLVDGVTVSFTADYGT
FT                   LSSGAAQTDSQGYATVTFTAPSSVPAGSQAVVTAKTSNGTTATGNIALVAASVETVELT
FT                   SGVSEIVANGASSALVTATVLDNNENAVPDGTIVTFTTSAGTLNDSTSTTPVANQTSYD
FT                   VTTVNGVAKVLLYSATNLGTATVNAVAGGIGDSISIAFIPGPPAKVSVSATPSSLTADG
FT                   ASQSLIKATVLDANDNPVADGETITFSVTQDGGSLDSLTRQTVGGIASVTYTAPASVPG
FT                   AQVRVYASSTSGDSGNVIIELTGPSIASVSLEVDPTSLPADGSSTATIFATITLSGGGA
FT                   APDGTTVNFEIFSGGGQLSATSATTSGGIAQVELTADSNAGTAVIKAECGGRTAEVDVE
FT                   YEPGSVSVSVEQNSLLGTGEETTEIRVLLAKADGSVITVPQTVTFTLSDLSMGHLSHTT
FT                   GNTSAPDFDEFNSCIFTGGTKGGTVEVIAKWTTSGVEVTGSAIIDIQPPPAFLQLASGY
FT                   PLPASINIKGTGGQTTSQLVFNVLDSVGDLVADGYIIDFAIGDGAGGGEQVIPTTALTS
FT                   SGQVGTILQSGWASGTVNVKATYHHDRTVNISASKVTITNGPPVGEGLNMSPEYNNISG
FT                   IKITQLEDLMQVTANDKYNNRIPEGSAIFFATYGTGGMLASGSAFTDGEGKASDTLIST
FT                   ASAPTQGWVSVTAEATNGGRTTQVTSMAFSPTSPDTNMYIGTNGGGVYKSNDGGASWTN
FT                   VSIPSGISTRQRAWLDPYVNDVCVDPDDANTVFAATGYNGDGALYRSLSGGNEWNSNNS
FT                   EEVFGCFNKNSEVTSVLCDGGGSDWVWVGTQSNGLWYTLDGSAEPNITWAQAGLSSALK
FT                   SFSADDGVTANGSDILTSASATFQTNEFGAGDTVVISSGDDAGTYTVASVVSETEIQLN
FT                   TALNHDTSAGAVTTGGASVQAGSAVLVDGEATFDASGFEAGDTITVFGGKDAGTYTIQN
FT                   VDSETQLTLNADFTTTVGDVMDGSDGQQVSGQVVFTSATAKFVDEGFAANDRLIITSGD
FT                   DIGMYMINTVVDNNTVYLDKAFTSTYADPVTGNDAQTAAGSATITLPNTDLYDLIEAGY
FT                   YVALTSGADLGAYTVNSLASASSLVLNSNMTTAANDVDYMLFYGKANPDQNNNGIYRKN
FT                   GSNQVVFYSDTASFLTDGFKANDILLIESGTHTGAYYILGVLSEKTLLLQENVAGAVGE
FT                   ETGLNYTLFHNENSVSYKTYHRQSGYSTGSDNSYWSNVTNGFSVYGSAVINSSGSTFVT
FT                   DGYEVGDIVTINSGSDAGVYTIVELTESSITLDRELTQVCGPVFTAEDLQTTKDSAIVR
FT                   SSDATFVSDGFDVGDAFIIASGADLGTYSIVEVIDQTQVRLDADMTTTALDGNITYRVY
FT                   HACDSVDFNLYHVGLTSITYVANHLSTLVSFTVTSSDVSGTDAGPQVRDGKWVRDIIKV
FT                   DGSGSTAVIYAGTQTGVYRSANGGQTWNFLKDSFEGSTIKTLDGTKIGNDEIVYAGTED
FT                   AGLWIYVYDTVAKTGTWHNYTDGLDRALLVTSPEADVDNVGNGTLSDMSVTDDSETEFW
FT                   TLTCKTANAGAGIFSLVGTVSGAQPDVDISAGAYTCPYLKLTLNPGAIDFEVGDTFTFN
FT                   TVRDDGSSVTDIVVDMDNELLYAATIYYEGSDVYHEVGNLKVVDIDPLTGLPVGDWRDA
FT                   TTGLAQFDPPDDETLFAIHTIALSNDPNTGTPQAIFAGGQGIHLYKATDGVTTSGTTDL
FT                   STGDVYWGASENGLDNTIMTRRVILFSGEVGFQAYNEASETLYFIGGASIITPTTTSDW
FT                   AEVLATGDSGRTVEFTFYVQDINGNPPIVGTTVMLRTYKLEEGDYKEIDTITLKTYGDD
FT                   LISGGTWRDPTNEDTNVPFIYTINFGDPIVKVEFILTQSASCNSEPVESPGCNGGNETL
FT                   TYTYR"
FT   sig_peptide     642995..643042
FT                   /locus_tag="Dalk_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006182_SP"
FT   gene            654213..655274
FT                   /locus_tag="Dalk_0483"
FT   CDS_pept        654213..655274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0483"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   dol:Dole_0537 peptidoglycan-binding LysM; IMG reference
FT                   gene:2503006183; PFAM: LysM domain;
FT                   InterPro:Peptidoglycan-binding lysin domain;
FT                   InterPro:Peptidoglycan-binding Lysin subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02190"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA2"
FT                   /protein_id="ACL02190.1"
FT                   /translation="MSINPTKIGVVVILACVLAFCGQAFSQDEGEYIGWRQGLEYTVQE
FT                   GDTLWDISEKFFDTPAMWPEVWKQNPHIKNPHWIEPGTVINIYVEDGMTYIPKEEPPPP
FT                   EPEPEPEPVVEEPPPPPPAYWYPAIEKAGFIRKPELDSLGEIRKTQDGREMAGTGAAIY
FT                   VSLNTDDQYAEGDRFTIWRPLDKVKDPFNGKFRKATIGTQHWILGEAVCTHISNGTMKA
FT                   VIEKTYRSIMVGDQLMPYRNLPSNIVIQPGVPGMEGRIVMEENNSGIFGAGDVVFVNKG
FT                   TDDGLKEGQMYSLYHDQNVKSDLFEDDGLFQESLGKIIVLIAQNNNSTVLITESKEDFN
FT                   VGTVFRTQQLIDR"
FT   sig_peptide     654213..654290
FT                   /locus_tag="Dalk_0483"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006183_SP"
FT   gene            655364..656191
FT                   /locus_tag="Dalk_0484"
FT   CDS_pept        655364..656191
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0484"
FT                   /product="Ankyrin"
FT                   /note="PFAM: Ankyrin; KEGG: hypothetical protein; IMG
FT                   reference gene:2503006184; PFAM: Ankyrin repeat;
FT                   InterPro:Ankyrin repeat; InterPro:Ankyrin repeat-containing
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02191"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA3"
FT                   /protein_id="ACL02191.1"
FT                   /translation="MKTNLTIILYSLILITAALAPVLACGDDMDAAIRNGDLQGVFRLL
FT                   ESGCNIESPNEAGDSPLLQACLADQEEIALALIDKGANVNVQPQRHGLTPLMIASVKGM
FT                   EQAAQSLISSGAAVNAQGLRGQTPLYFSVFSKDPRIVQLLLQAGADPNLNDQLNQAPLF
FT                   FAANAGQVEMVKMLLEHGADVNNRGGGLEQDALMAAAIQGNYEIAKLLLEKDAKFHIPD
FT                   KQGMTALKFASQLGHTDIVNLFLARYAHPLLPPFVESMKEKQSAVEERKAKQE"
FT   sig_peptide     655364..655435
FT                   /locus_tag="Dalk_0484"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006184_SP"
FT   gene            complement(656206..657003)
FT                   /locus_tag="Dalk_0485"
FT   CDS_pept        complement(656206..657003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0485"
FT                   /product="DNA repair protein RadC"
FT                   /note="PFAM: DNA repair protein RadC; KEGG: dol:Dole_0675
FT                   DNA repair protein RadC; IMG reference gene:2503006185;
FT                   PFAM: Protein of unknown function (DUF2466); TIGRFAM: DNA
FT                   repair protein radc; InterPro:RuvA domain 2-like;
FT                   InterPro:Uncharacterised protein family UPF0758;
FT                   InterPro:Uncharacterised protein family UPF0758, conserved
FT                   site"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02192"
FT                   /db_xref="GOA:B8FHA4"
FT                   /db_xref="InterPro:IPR001405"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR020891"
FT                   /db_xref="InterPro:IPR025657"
FT                   /db_xref="InterPro:IPR037518"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA4"
FT                   /protein_id="ACL02192.1"
FT                   /translation="MAKWEQEGSPPETLNEAVPKLRTVNPGEGHRGRLRERFLQNGLDG
FT                   FLDYEVVELLLTLATPRKDCKQQAKAAVDHFGSLKAVLAADKDDLQKVKGLGPANILGI
FT                   LLMRAVAKKHLESEAVLASLQEAVSSSEELYNLLNFQFENKKNECFFIVYLDVQNRILN
FT                   METPFEGSLNASHVYTRELIDKALKTGASAVLLAHNHPSGNTKPSKNDIQLTYTLFTAF
FT                   RSVEIHLLEHLIIGKQGEYYSFADHGYLECFAREYDASRKKFT"
FT   gene            complement(656996..658042)
FT                   /locus_tag="Dalk_0486"
FT   CDS_pept        complement(656996..658042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0486"
FT                   /product="Glycerol-3-phosphate dehydrogenase (NAD(P)(+))"
FT                   /EC_number="1.1.1.94"
FT                   /note="PFAM: NADP oxidoreductase coenzyme F420-dependent;
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; KEGG: dol:Dole_0674 glycerol-3-phosphate
FT                   dehydrogenase (NAD(P)(+)); IMG reference gene:2503006186;
FT                   PFAM: NAD-dependent glycerol-3-phosphate dehydrogenase
FT                   C-terminus; NAD-dependent glycerol-3-phosphate
FT                   dehydrogenase N-terminus; TIGRFAM: glycerol-3-phosphate
FT                   dehydrogenase (NAD(+)); InterPro:6-phosphogluconate
FT                   dehydrogenase, C-terminal-like; InterPro:Dehydrogenase,
FT                   multihelical; InterPro:Glycerol-3-phosphate dehydrogenase,
FT                   NAD-dependent; InterPro:Glycerol-3-phosphate dehydrogenase,
FT                   NAD-dependent, C-terminal; InterPro:Glycerol-3-phosphate
FT                   dehydrogenase, NAD-dependent, N-terminal;
FT                   InterPro:NAD(P)-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02193"
FT                   /db_xref="GOA:B8FHA5"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA5"
FT                   /protein_id="ACL02193.1"
FT                   /translation="MAYTLNKSIDELQVAVVGGGSWGTALAQLLASKGYKTSLWVLEEE
FT                   VAESIAKERENKVFLPDIKLSENITPTLDLEEALKDKDMIVSVVPSEWLRETALKMKPF
FT                   IKPETLVVSATKGIEIGTRLTMSGILRETLTHVPQENICVISGPSFAKEVARGMPTVVT
FT                   VAASDPDVALTVQEAFATPYFRVYTNTDLLGVEVGGAVKNVMAIASGICEGLGFGANTR
FT                   AALITRGLNEMRRLGRAMGAKQKTFSGLAGVGDLVLTCTADLSRNYTFGKKIGQGMKRE
FT                   EILSKMRMVAEGVRSSKSVYNLSIELDVEMPIVEQTYKVLYEDEDPAKALFNLMTRKLR
FT                   DEHDDQYG"
FT   sig_peptide     complement(657962..658042)
FT                   /locus_tag="Dalk_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006186_SP"
FT   gene            complement(658050..660485)
FT                   /locus_tag="Dalk_0487"
FT   CDS_pept        complement(658050..660485)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0487"
FT                   /product="DNA gyrase, A subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: dol:Dole_0673 DNA gyrase, A subunit; TIGRFAM:
FT                   DNA gyrase, A subunit; PFAM: DNA gyrase/topoisomerase IV
FT                   subunit A; DNA gyrase repeat beta-propeller; IMG reference
FT                   gene:2503006187; PFAM: DNA gyrase/topoisomerase IV, subunit
FT                   A; DNA gyrase C-terminal domain, beta-propeller; TIGRFAM:
FT                   DNA gyrase, A subunit; InterPro:Arginine repressor,
FT                   C-terminal; InterPro:DNA gyrase, subunit A; InterPro:DNA
FT                   gyrase/topoisomerase IV, subunit A, C-terminal
FT                   beta-pinwheel; InterPro:DNA topoisomerase, type IIA,
FT                   central; InterPro:DNA topoisomerase, type IIA, subunit A,
FT                   alpha-helical; InterPro:DNA topoisomerase, type IIA,
FT                   subunit A/ C-terminal, alpha-beta; InterPro:DNA
FT                   topoisomerase, type IIA, subunit A/C-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02194"
FT                   /db_xref="GOA:B8FHA6"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA6"
FT                   /protein_id="ACL02194.1"
FT                   /translation="MDLGENMLEISIESEMKKSYLDYAMSVIIGRALPDVRDGLKPVHR
FT                   RVLFTMHELKNDYNKPYKKSARVVGDVMGKYHPHGDAAIYDTMVRMAQDFSLRYPLVDG
FT                   QGNFGSIDGDPAAAMRYTEVRMQKMAHAILEDLDKETVDFIPNYDETIQEPTVLPTRIP
FT                   NLLVNGSAGIAVGMATNIPPHNLGEITDALCALIENPKLMPEELLQYVPGPDFPTGGII
FT                   YGRAGIHSAYSTGRGIIKIRARIMVEKDNRTGKETLVVTELPYQVNKARVIEKIAHLMK
FT                   DKVIEGLAFVRDESDREGMRIAMGLKKDEMASIIINKLYKHTQLENSFGIILLSIVNNR
FT                   PELLNLKETLQYFIAHRKVVVIRRTKYELAKAEARAHILEGYKIAIDNLDEVVKLIRAS
FT                   STPLEAREGLMARFDLTQIQAQAILDMRLQKLTGLEIEKVEEEYRELIKAIARYKEILA
FT                   SDQLVLEIVRDELLEVRTEYVDERRTEIVDDEGEITIEDMIVEEDMVVTISHRGYIKRN
FT                   PLTLYHSQRRGGKGKIGMGTGDEDFVSRLFVASTHNTLLFFTNLGRVYWRKVYEIPQAG
FT                   RAAKGKFISNLLNLAPDEQLATVLDVKEFEPGYNIIMATKDGIIKKTDLLAYSNPRSNG
FT                   IIALSLGEGDQLIAARISDGTQNVFLGSAFGKSIRFHESDVRAMGRVSRGVKGMTLAAG
FT                   DHLVGMEVLTHGKTLFSCTENGFGKRTSLDEYPLQKRGGKGVITIRTHERNGAVVSILV
FT                   VSNDDDLMLMTDAGKIIRMPMGDISVISRNTMGVRLMGMEPGEKLIGAQRLAEKDEEK"
FT   gene            complement(660746..661261)
FT                   /locus_tag="Dalk_0488"
FT   CDS_pept        complement(660746..661261)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0488"
FT                   /product="hypothetical protein Dalk_0488"
FT                   /note="IMG reference gene:2503006188"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02195"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA7"
FT                   /protein_id="ACL02195.1"
FT                   /translation="MEPDSLKEMRGAGPVTVFKFNLSRCLHIVAAPPCGRLLKRAKRVL
FT                   GQARGPVTTFQFMRTMLGWPRQGNFCLDPSGQKVRPRWSFKTNELGRKTAIFKAQKNFP
FT                   RRHTPARRSGFPISFGGAPFVATQPRQDTALRGYPNKYTGQAVTPLGAEILCILGLFSD
FT                   SLKYYPGR"
FT   gene            complement(661334..662404)
FT                   /locus_tag="Dalk_0489"
FT   CDS_pept        complement(661334..662404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0489"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   dps:DP0193 hypothetical protein; IMG reference
FT                   gene:2503006189; PFAM: Domain of unknown function DUF20;
FT                   InterPro:Uncharacterised protein family UPF0118"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02196"
FT                   /db_xref="GOA:B8FHA8"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA8"
FT                   /protein_id="ACL02196.1"
FT                   /translation="MEQDRKSHQMILIFFLALYIISIGFMGWLLRPFFSILVLAFVVTG
FT                   VFTPIYRLLLKKMKPGAASGLTCVIIFLVLFIPTLLFAGIVVSEAVGFLDMVNKAALPD
FT                   QIRTFINNSTLLETINQHIDDYGIVISGAEITQAASQIGQFVGGFLLDSGKAVVSNVLS
FT                   FVLNFLFMVLIIFFILIDGGKLVDYLVDMSPLPQDQDEKLVAKFKDMSGAVILGNGVCG
FT                   LAQGILGGAVFALFGLPSPFLWGVVMGILAFLPIVGIGVVFLPAAIIMFIQGKIATGVF
FT                   FIIFYSILSFSVEYVIKPKLVGDRVQMHPLLVFLAIMGGLKIFGILGVIYGPLIVTFFL
FT                   TLADIYRASYKAIVEA"
FT   gene            complement(662409..663122)
FT                   /locus_tag="Dalk_0490"
FT   CDS_pept        complement(662409..663122)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0490"
FT                   /product="conserved hypothetical protein-like protein"
FT                   /note="KEGG: chu:CHU_1410 hypothetical protein; IMG
FT                   reference gene:2503006190; PFAM: MORN repeat variant;
FT                   InterPro:MORN variant"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02197"
FT                   /db_xref="GOA:B8FHA9"
FT                   /db_xref="InterPro:IPR011652"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHA9"
FT                   /protein_id="ACL02197.1"
FT                   /translation="MIMMNSYEKIIRWPLSFRFWETGREYAKGRIEDGLRQGMWTFWYR
FT                   SGAKQMEGEYKDGVQVGLWIKWWPNGQVATQGAFKDGWMHGEWNDWFDNGQKAMLSHWD
FT                   MGRKTGVTTIWDRFGNEVKSQKHRAGREPRNYYPLMSNRDASFALATAQKMGMRNAWTR
FT                   MVGKKVAAYLEPWQCTVWLMLFLPGYALLKPKMGLIAIPVSLVGAALISIGVVLATAYH
FT                   DSITRPDIGLGKPKD"
FT   gene            complement(663283..663483)
FT                   /locus_tag="Dalk_0491"
FT   CDS_pept        complement(663283..663483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0491"
FT                   /product="hypothetical protein Dalk_0491"
FT                   /note="IMG reference gene:2503006191"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02198"
FT                   /db_xref="GOA:B8FHB0"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHB0"
FT                   /protein_id="ACL02198.1"
FT                   /translation="MKKNFFERVTRPRALGILIFTGVPAIIGGGLIWWATGHSYNLVVP
FT                   YEIALYAISLTIASKAPDLEH"
FT   gene            complement(663551..664837)
FT                   /locus_tag="Dalk_0492"
FT   CDS_pept        complement(663551..664837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0492"
FT                   /product="Acetyl-CoA acetyltransferase (thiolase II-like)"
FT                   /EC_number="2.3.1.9"
FT                   /note="KEGG: dol:Dole_0671 acetyl-CoA acetyltransferase;
FT                   TIGRFAM: acetyl-CoA acetyltransferase; PFAM: Thiolase; IMG
FT                   reference gene:2503006192; PFAM: Thiolase, C-terminal
FT                   domain; Thiolase, N-terminal domain; TIGRFAM: acetyl-CoA
FT                   acetyltransferases; InterPro:Thiolase; InterPro:Thiolase,
FT                   active site; InterPro:Thiolase, acyl-enzyme intermediate
FT                   active site; InterPro:Thiolase, C-terminal;
FT                   InterPro:Thiolase, N-terminal; InterPro:Thiolase-like;
FT                   InterPro:Thiolase-like, subgroup"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02199"
FT                   /db_xref="GOA:B8FHB1"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHB1"
FT                   /protein_id="ACL02199.1"
FT                   /translation="MKEAVIVSGARTAIGSFGGVLKSVPVIQLGSTVMKETLKRVNLRP
FT                   VVSEAMLSAAPDALKDQGVIELEEKGMDWDDSAQPVAIDEVIMGNVLTSGQGQNPARQA
FT                   MVQAGICKETPAFTINKVCASGLKAIALGAASIMTGQADVILAGGQESMSNVPMALPLA
FT                   RWGYRMAISGKGEIDDLMVLDGLYEIFYGYHMGVTAENIASKYGITREEQDALGVLSHN
FT                   RARKAITEGLFKDEIVPVSFMERRKEVVVDTDERPMDTSMEKMAKLRPAFIKDGTVTAG
FT                   NASGINDGAASVLLMSAEKAQELGLEPLAKIKAFASAGMDPAYMGLGPIPAVRKVLKAT
FT                   GMSIDDLQMLEVNEAFASQAIACLRELGIDTEKPNELGSGISLGHPIGCTGARQMVTAI
FT                   HHMERKGYNTGLITMCIGGGMGMAMIIEK"
FT   gene            complement(665188..666984)
FT                   /locus_tag="Dalk_0493"
FT   CDS_pept        complement(665188..666984)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0493"
FT                   /product="PAS/PAC sensor hybrid histidine kinase"
FT                   /note="KEGG: dol:Dole_3267 PAS/PAC sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; PAS fold-4 domain protein; PAS fold domain
FT                   protein; SMART: PAS domain containing protein; IMG
FT                   reference gene:2503006193; PFAM: Response regulator
FT                   receiver domain; Histidine kinase-, DNA gyrase B-, and
FT                   HSP90-like ATPase; PAS fold; TIGRFAM: PAS domain S-box;
FT                   InterPro:ATPase-like, ATP-binding domain;
FT                   InterPro:CheY-like superfamily; InterPro:PAC motif;
FT                   InterPro:PAS; InterPro:PAS fold-4; InterPro:PAS-associated,
FT                   C-terminal; InterPro:Signal transduction histidine kinase,
FT                   core; InterPro:Signal transduction histidine kinase,
FT                   homodimeric; InterPro:Signal transduction histidine kinase,
FT                   subgroup 1, dimerisation/phosphoacceptor domain;
FT                   InterPro:Signal transduction histidine kinase-related
FT                   protein, C-terminal; InterPro:Signal transduction response
FT                   regulator, receiver domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02200"
FT                   /db_xref="GOA:B8FHB2"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHB2"
FT                   /protein_id="ACL02200.1"
FT                   /translation="MNRITKSYIKVLFAAIIIGLLFWIIDGIFEYIFFHKNLSFLVLEG
FT                   PETLLESLVLQVPPHSLFVRASFLIACFISGCIVAAFLARRLKAEESLRENEAMFKALI
FT                   RTIPDLVWLKDPDGRYIACNTRFEKFFGAKEEEIIGKTDHDFLSGELAAFFRHYDQLAI
FT                   EKGSPSVNEEEITFADDGHKELLETIKTPMYQDDGRFVGVLGIGRNITERVQMQAQISQ
FT                   AQKMESLGRLAGGIAHDYNNVSSVIVGYSELALEDLNPADPVYAYLLEIHKAAQRAANF
FT                   TKQLLAFARRQTAAPVVIDLNDAIEKMLTMLQRLIGEHITLSWRPGTEIWPLKIDPSQI
FT                   DQILANLCINARDAIADTGRIAISTENTACDVNTCAENTDLVPGDYVALTVSDDGQGIA
FT                   PDTLDKIFDPFFTTKEVGKGSGLGLSTVYGIVKQYNGFICVDSELQQGTAIKIYLPRSV
FT                   EETPLAKDKNEPASDLPLGRGERILFVEDDGPILELGKKILTSLGYEVVSSPSPLQALE
FT                   LAKSRGEEIALLVTDVIMPKMNGRELAETLQDMFPNLKVLFISGYTADIIAQKGVVEEG
FT                   VHFLPKPFTKAELAAKVREALE"
FT   gene            complement(667004..668158)
FT                   /locus_tag="Dalk_0494"
FT   CDS_pept        complement(667004..668158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0494"
FT                   /product="ABC-type uncharacterized transport system,
FT                   periplasmic component"
FT                   /note="KEGG: hch:HCH_03644 ABC-type uncharacterized
FT                   transport system, periplasmic component; IMG reference
FT                   gene:2503006194; PFAM: ABC transporter substrate binding
FT                   protein; InterPro:ABC transporter substrate binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02201"
FT                   /db_xref="InterPro:IPR007487"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHB3"
FT                   /protein_id="ACL02201.1"
FT                   /translation="MQKVKLPSTGLIAVLMISALLLPSPAALAGTAPKTNDGVKWRIGY
FT                   FEGGPWPDYYENLLETAIGLSELGWMEKFQPPKRGKPDDARALWQWLARNVKSPYLEFA
FT                   EDAFWSSNWEDDARETNRLACIKALQERKVDLMIAMGTWAGLDLANNKHSVPTLVMSTT
FT                   DPIQAGIIKSAKDSGFDHVTVECDPTRYLRQIRLFHDIIQFKRLGYVCEDSPEAKAYSN
FT                   EEDLKKVAKERGFKLVECYTQDTNIPEEEAVQGYLKCLERIAPDIDAFYFSAHQGAAPE
FT                   NMHKVLAPLMEHKIPTWSNWGMVCVKTGALMSVGRKNFKEYGAFYAKDIALILNGAKPR
FT                   DLDQIMKEELSLAINLETARIIGYTPPKNLLKIAEFVFTDIETP"
FT   sig_peptide     complement(668072..668158)
FT                   /locus_tag="Dalk_0494"
FT                   /note="Signal predicted by SignalP 3.0 HMM; IMG reference
FT                   gene:2503006194_SP"
FT   gene            complement(668316..670373)
FT                   /locus_tag="Dalk_0495"
FT   CDS_pept        complement(668316..670373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0495"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dol:Dole_3026 hypothetical protein; IMG
FT                   reference gene:2503006195; PFAM: Protein kinase domain;
FT                   InterPro:Calcium/calmodulin-dependent protein kinase-like;
FT                   InterPro:Serine/threonine-protein kinase-like domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02202"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHB4"
FT                   /protein_id="ACL02202.1"
FT                   /translation="MFQVEKTKTIILEEDNNTSSPKQSDKPRPETTKLDVVNFFLNLYR
FT                   KQIGAPPSCMGKYTVLDSDAHGPESLYELKVRIGEDVHTRRMTITPLGEDTGSRSKCFF
FT                   VIYDVHMVLKIPPMEQNNLQEYIESIRRDAKIVDRLAPRECIVPKVSVILKMIRTFDDT
FT                   EDLSPMQLEEVYIKWLMEDPRTQEFLKINGSFVYFMDLAKYYFLGGIVAKMQGDKDKNA
FT                   QEILGHHDLIWEIDDFEGRYGYQFASLCEDLQHLYGKCRAAASAVLIRHKLANAVQDYR
FT                   IRNWFLIHLAGRTVKAEDADGNTKILDDLNKALKELMEEEASTVNAYRKMIKEYIREKM
FT                   FFRNKPQMETIIINLLELLAWLRTSKVSIRDLKPDNLLVAGNPDNYPYFLTNAGEYNIG
FT                   LIDVETAADFSGGEPGSMEQPLLGGTPNYATPSHLFANEIIALAWGDVGRMLHYQDWQA
FT                   TLGMIYRVATGKTLFPKTGKILPKLPKMFSQAPKGKTPLDLIKETSKLFWQSAMAEFDA
FT                   KRQQKEEALRTLKVTLDETAVVMLQEELAIESEVVLGALKTRILNQKIYTSKDAKKKLF
FT                   AASAKSLNQQKVRLANTPDGNAAQTRVKRQALKLFGDLERMKNHLARLAWAQKQLAKPT
FT                   PTFSVFEIMGILFDALIVTMHKPDWPDLTGGDVGAFGLTGKDATYQHATI"
FT   gene            complement(670459..671349)
FT                   /locus_tag="Dalk_0496"
FT   CDS_pept        complement(670459..671349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0496"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number="2.4.2.19"
FT                   /note="KEGG: dol:Dole_1728 nicotinate-nucleotide
FT                   pyrophosphorylase; TIGRFAM: nicotinate-nucleotide
FT                   pyrophosphorylase; PFAM: Quinolinate phosphoribosyl
FT                   transferase; IMG reference gene:2503006196; PFAM:
FT                   Quinolinate phosphoribosyl transferase, C-terminal domain;
FT                   Quinolinate phosphoribosyl transferase, N-terminal domain;
FT                   TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   InterPro:Aldolase-type TIM barrel;
FT                   InterPro:Nicotinate-nucleotide pyrophosphorylase;
FT                   InterPro:Quinolinate phosphoribosyl transferase, C-terminal
FT                   domain; InterPro:Quinolinate phosphoribosyl transferase,
FT                   N-terminal"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02203"
FT                   /db_xref="GOA:B8FHB5"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B8FHB5"
FT                   /protein_id="ACL02203.1"
FT                   /translation="MATKDNNSAPAPDAWRPGLEVSGIVKRLVALALEEDLATGDITTD
FT                   PIVPPDRKGEAVIKAKEDLLVAGMDMVRIVFDAVDPKIRIDVLTPDGARAKPGDIMARL
FT                   SGRLRPLLWGERTALNFLQRLCGIATHTHAHVQEAKGRDVKLVDTRKTTPGWRLLEKYA
FT                   VRVGGASNHRMGLFDGVLIKDNHIVAAGGITQAVGLARKGAPHMVRIEVEAASMNEVQE
FT                   ALDAKADVIMLDNMNPDQISQAVQLIAGKALVEVSGGIKKETIRTMARTGVNILSCGAL
FT                   THGARSVDISMKITV"
FT   gene            complement(671333..673999)
FT                   /locus_tag="Dalk_0497"
FT   CDS_pept        complement(671333..673999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Dalk_0497"
FT                   /product="Valyl-tRNA synthetase"
FT                   /EC_number="6.1.1.9"
FT                   /note="TIGRFAM: valyl-tRNA synthetase; KEGG: dol:Dole_1729
FT                   valyl-tRNA synthetase; IMG reference gene:2503006197; PFAM:
FT                   tRNA synthetases class I (I, L, M and V); Anticodon-binding
FT                   domain; Valyl tRNA synthetase tRNA binding arm; TIGRFAM:
FT                   valyl-tRNA synthetase; InterPro:Aminoacyl-tRNA synthetase,
FT                   class 1a, anticodon-binding; InterPro:Aminoacyl-tRNA
FT                   synthetase, class I, conserved site;
FT                   InterPro:Aminoacyl-tRNA synthetase, class Ia;
FT                   InterPro:Rossmann-like alpha/beta/alpha sandwich fold;
FT                   InterPro:tRNA-binding arm; InterPro:Valyl-tRNA synthetase;
FT                   InterPro:Valyl-tRNA synthetase, class Ia, tRNA-binding arm;
FT                   InterPro:Valyl/Leucyl/Isoleucyl-tRNA synthetase, class I,
FT                   anticodon-binding; InterPro:Valyl/Leucyl/Isoleucyl-tRNA
FT                   synthetase, class Ia, editing domain"
FT                   /db_xref="EnsemblGenomes-Gn:Dalk_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL02204"
FT                   /db_xref="GOA:B8FHB6"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002303"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR019499"
FT                   /db