(data stored in SCRATCH zone)

EMBL: CP001324

ID   CP001324; SV 1; linear; genomic DNA; STD; PLN; 1759951 BP.
XX
AC   CP001324; ACCO01000000;
XX
PR   Project:PRJNA15676;
XX
DT   11-APR-2009 (Rel. 100, Created)
DT   02-OCT-2014 (Rel. 122, Last updated, Version 3)
XX
DE   Micromonas sp. RCC299 chromosome 3, complete sequence.
XX
KW   .
XX
OS   Micromonas commoda
OC   Eukaryota; Viridiplantae; Chlorophyta; Mamiellophyceae; Mamiellales;
OC   Mamiellaceae; Micromonas.
XX
RN   [1]
RP   1-1759951
RX   DOI; 10.1126/science.1167222.
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L.,
RA   Allen A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E.,
RA   Grimwood J., Gundlach H., Henrissat B., Napoli C., McDonald S.M.,
RA   Parker M.S., Rombauts S., Salamov A., Von Dassow P., Badger J.H.,
RA   Coutinho P.M., Demir E., Dubchak I., Gentemann C., Eikrem W., Gready J.E.,
RA   John U., Lanier W., Lindquist E.A., Lucas S., Mayer K.F., Moreau H.,
RA   Not F., Otillar R., Panaud O., Pangilinan J., Paulsen I., Piegu B.,
RA   Poliakov A., Robbens S., Schmutz J., Toulza E., Wyss T., Zelensky A.,
RA   Zhou K., Armbrust E.V., Bhattacharya D., Goodenough U.W., Van de Peer Y.,
RA   Grigoriev I.V.;
RT   "Green evolution and dynamic adaptations revealed by genomes of the marine
RT   picoeukaryotes Micromonas";
RL   Science, e1252229 324(5924):268-272(2009).
XX
RN   [2]
RP   1-1759951
RG   Micromonas genome consortium
RA   Grigoriev I.V., Aerts A.L., Rombauts S., Van de Peer Y., Grimwood J.,
RA   Salamov A., Zhou K., Lucas S., Glavina del Rio T., Tice H., Bruce D.,
RA   Pitluck S., Lindquist E., Cuvelier M.L., Worden A.Z.;
RT   ;
RL   Submitted (23-DEC-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; e0044a674bdc0b143a9eeaa34ef3eaaf.
DR   BioSample; SAMN03081421.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF01855; Plant_SRP.
XX
CC   URL -- http://www.jgi.doe.gov/MicromonasRCC299
CC   JGI Project ID: 4000189
CC   Organism available from the Center for Culture of Marine
CC   Phytoplankton (CCMP) and the Roscoff Culture collection (RCC)
CC   Contacts: Alexandra Z. Worden (azworden@mbari.org)
CC             Igor Grigoriev (IVGrigoriev@lbl.gov)
CC   Annotation done by the Micromonas genome consortium as identified
CC   in the authorship as listed as reference 1 above.
CC   This organism was isolated from South Pacific surface waters in
CC   1998 by S.Boulben. This strain was rendered clonal and axenic in
CC   the Worden Lab through plating and a series of antibiotic
CC   treatments. Subsequently, the axenic strain was deposited at the
CC   CCMP (CCMP2709) and RCC (RCC827). RCC299 is also referred to as
CC   strain NOUM17.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. We welcome collaborative interaction on the project.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1759951
FT                   /organism="Micromonas commoda"
FT                   /chromosome="3"
FT                   /strain="RCC299"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:296587"
FT   gene            complement(<482..>1486)
FT                   /locus_tag="MICPUN_99220"
FT   mRNA            complement(join(<482..1239,1474..>1486))
FT                   /locus_tag="MICPUN_99220"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(482..1239,1474..1486))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99220"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M8"
FT                   /protein_id="ACO62028.1"
FT                   /translation="MARRTDELADGDRAAHLAENQLTSVPAEIGHLTSLERLELNHNEL
FT                   TRVPAEIGLLTSLRALSLSSNKLTSVPVEIGQLTSLTALFLGDNLLTRVPAEVGQLASL
FT                   EGLFLGDNRLTSVLAEIGQLTSLTELSLGNNQLTSLPAEIGRLTSLTALLLYDNQLTSV
FT                   PAEIGQLTSLVKLSLTENQLTSLPAEIGQLTSLTELYLYGNQLTSVPAEIGQLTSLVRL
FT                   YLGDNRLTSVPAAIRELRAAGCNVRMDNGVTVDE"
FT   gene            complement(1998..3527)
FT                   /locus_tag="MICPUN_107844"
FT   mRNA            complement(1998..3527)
FT                   /locus_tag="MICPUN_107844"
FT                   /product="predicted protein"
FT   CDS_pept        complement(2196..3374)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107844"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0M9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0M9"
FT                   /protein_id="ACO62029.1"
FT                   /translation="MVDSGNQWKTRGYLPGVNTWGSRVDTWRVKDFVTTVETSLREAAS
FT                   SVFARCQYGQVGESLKQLASVCSGLSFAERTKILDAASKLLNNLTAFNGTDMTLGNAGD
FT                   TNLQPDANSTDGDASYSVDTAIVRVPTDNETLAAACMGTVVSNSADSSVAPVTSRRRTS
FT                   RRRLSQAEADAATLQDAGCWSRVRNSNDALVGMLLGECIQVSLGAGQQLLDGVKACLKT
FT                   KPDRAINVDYTQDIFVKRTTVNGVEKYTPMSTITVERVGTQICGKVTDVGSFFCPARVA
FT                   PNWATATTDIGSTECPIVDVIGAAKLAAIETIRNRNKASGEKDGPLPGLDQASGIAVLA
FT                   VMCLFICGCCVGCRWLVVRRRRRQQAAAGKAMVVHNTLIHSQTQVVQSTAQP"
FT   gene            complement(<9334..>13197)
FT                   /locus_tag="MICPUN_56574"
FT   mRNA            complement(<9334..>13197)
FT                   /locus_tag="MICPUN_56574"
FT                   /product="predicted protein"
FT   CDS_pept        complement(9334..13197)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56574"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0N0"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR021133"
FT                   /db_xref="InterPro:IPR022577"
FT                   /db_xref="InterPro:IPR033162"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N0"
FT                   /protein_id="ACO62030.1"
FT                   /translation="MDPPTEEGFDDENELTFVKEAPEVNGLVEQIKDALEGRDPADGTS
FT                   TISKTVFHKIQEIVERYQEYPTLLDPHLEGWILPLTSVIRREAHKGSEADMVLVQRASR
FT                   VLHALASVRGYKTVVKFFPHEAKDFEPVVALLVRSHDVGSLATNMEEADELGSAWETRA
FT                   TLILWLSILVLIPFDLVTVDSQVTTNTGVDGAAMAKSGGQQEAPPVVLRILALCQDSYL
FT                   RDPGIVRDRAAFLLAKLLTRPDMPLALQKFLVWATDALGGQSEYSEQEKMFIVPGIVRA
FT                   LAATFKLGKRSELLEVAERLWTNARDLADSPAAKASTLTRKLACKLTQRIGLLFLKPRV
FT                   VSWRYERGARSLEDNLKRAMIISQGGDADAEDRKKAEEAAAKEQEEDEDWDIPEEIEEV
FT                   IEALLTALRDKDTVVRWSAAKGLGRITARLPAELGDEVVGSILDCFLPTENDNTWHGAC
FT                   LALAELSRRGLLLPVRLPDAVPHVASALAYDVRRGPHSVGAHVRDAASYVCWAFARAYA
FT                   PEVLAPHADALAPSLLIAACFDREVNCRRAASAAFQESVGRLGAFPHGIDIIQVADYFS
FT                   LGSRTKAYTVVADHICGYDEYRRRMLNHLCDVKLIHWERATRELAARTISIIGRRDPEW
FT                   IREVALPVLLDRSLSTNLEARHGACVGAAEALLALKNAGEPCVEGELATKVTGLVTAIE
FT                   KARLYRGKGGEVMRAAVSKYVQCLASVSQPLDKGPGPATGPKSLRSTLLASLEENLKHP
FT                   TVDIRDSAVSAMEEFSASYMVGSNPAAGAKRLIVKLATLLREDQNPAARRGAALALGVM
FT                   PGEMLFSCVPGFAAEAPAEENVDAEADPEMIPAWRMALEALKAASIPEEDVEARDADAR
FT                   VCATKGMAGVLSRMATNLVEDDYAATSQAASEVISSLLTCMEDYCTDNRGDVGSWVREA
FT                   AMEALPGAISALQASGLELATGRCATIVSALLKQCAEKIDRTRASAATALCAVLRGRES
FT                   DMLEPLPDVPGLNKLLDAAPTEERLAASWAVPTSAYAALTPLIVADGSDPLAAYRADLI
FT                   EGIVVSAGGVGDSLGKASGGALVAAVKADPALQETVANELVDLLSRRQGVDRVTVPLLR
FT                   VLDLLFSSGALASVAPAHPDPPNAFAHTLAENLRAELKGSRDVAKLCHGVQALSHVAAL
FT                   GPNVINSDRCARTSGLQGILALMVSRYPRVRRVASEALYVLLLGLDEEAAGEGIEAAIE
FT                   LLSDTRWDAELTMVKPERNKLYPLLGLEAPAAALEAAKGPGVKVKVVDENESYAALVGS
FT                   AGY"
FT   gene            complement(<13366..>14031)
FT                   /locus_tag="MICPUN_56575"
FT   mRNA            complement(<13366..>14031)
FT                   /locus_tag="MICPUN_56575"
FT                   /product="predicted protein"
FT   CDS_pept        complement(13366..14031)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56575"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N1"
FT                   /protein_id="ACO62031.1"
FT                   /translation="MQFSEALFPQIFPPVEEGEDPTVMTGDFATDTQPRPGRNAFGQKP
FT                   RWPREAPGGIDRATDGPAAHVLFEPSRLHEATCKGFIEEVTWLLDSAPDEQRCTVDDLD
FT                   PGGRSPLHFAAGYGHLDIVKLLTERKCKLEVRDMWMKAPVDWAIQTEQHEIIELLRIEA
FT                   VKQKIIGGKGEVAPLKTKCEFATGKTFEEIDEFMCNWENKVWDKHERACMEERENRAP"
FT   gene            <14271..>16316
FT                   /locus_tag="MICPUN_66596"
FT   mRNA            join(<14271..14315,14430..>16316)
FT                   /locus_tag="MICPUN_66596"
FT                   /product="predicted protein"
FT   CDS_pept        join(14271..14315,14430..>16316)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66596"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491 - oxidoreductase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E0N2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N2"
FT                   /protein_id="ACO61586.1"
FT                   /translation="MSMNGKSALVTGAGSGIGRGLCARLAREGASGITMVDLSDDGLAK
FT                   TSALVSAANPKCVTRLISADVANAEDLERAFRGHVREFGDLHACFNNAGIGERANWRSV
FT                   VDVNLNAVIQGTRLAVDAMRGKMGSAKTSSSDRVVVNVASAGGVFPMPQAPVYSATKAA
FT                   VVLYTQSLAHLHKTHGVRVNALCPQFTDTALVQGQFQAIGEAGAKALLAQTGGELLTVE
FT                   QVVDAAMELVRDETKAGAALAVMNRGDSSGGFVAYVPAPNPKFWKRIRTSSLVPGMGSD
FT                   AVGRYPAPSSLPSTFRKVVVHLLSADFASATKIVDVPMPRPAAGEVLIERRYTGVNASD
FT                   VNFSAGRYFGGAKQAASKLPFDAGFESVGVVAAVGSGVKLQPGQPVATLTYGGFSEYAV
FT                   ERAELVMPVPEASPRALVMLTSGLTASLALEMTGGIPLDDALRGGSAKGKPKTVLVTAA
FT                   AGGTGQIAVQIAKLAGHRVVATCGGDAKAKMLTDLGVDRVINYRKEKVRDVLRREFKQG
FT                   VDVVYESVGGEMFSDAMDALAPKGVCIIIGMMSQYTSGGSDAKSAWVPSNHPGLPEKLL
FT                   WKSASLRGFFLPQYAAHFKRHLTGLFRLMQKGQLRGEIDPTRFAGLEAVNDAVAHLQGG
FT                   KSIGKVVVD"
FT   gene            complement(<16396..>17931)
FT                   /locus_tag="MICPUN_99223"
FT   mRNA            complement(<16396..>17931)
FT                   /locus_tag="MICPUN_99223"
FT                   /product="predicted protein"
FT   CDS_pept        complement(16396..17931)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99223"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N3"
FT                   /protein_id="ACO62032.1"
FT                   /translation="MVMVSQPTHPAFYEDDVRYHKCNVCAAEFNIPPPTRHELMQSFTG
FT                   AEIAALISEGCVIGSHRVFSDELERQMETMHPIQRLMTGYPHWIKGVYLIVDVREDNGR
FT                   ISLPVRTDASLDRVRQRFQAEAERSGYDGISLEVGGKKHTILAGVGSFKEVKDGDVEGI
FT                   KATLAALKAPAMLVLASETEPDCGEDSVTAVNMCRPVQLPPAAAQHLDALNERSNGADS
FT                   DLSTGIPDMMEWMEKFEDTEQFGSLDEAKNALRLEMHLAQYRATMDVMKKYPGVRRVKV
FT                   EHFIGGPCESDDIMWCVVPGGMKRGWTVVSRTLDSSEDESDESVKRAKSNVSTLVSAMM
FT                   LAHTRAVRRDDAQGDVCGGQTVRLRNLQARADLNGEVGLALRYDSESGRWMIRLRNGEG
FT                   KSVKPDNLEAMDGEGGRVFAFWGDARWSRAQLLGEIARGHWGLCRAGVGDITTSTAERW
FT                   ESLETSGRMAFAPVTEMTEDFMKNAHREMQVFRPSAAAAEGEDEGVQRDHSED"
FT   gene            <18257..>19363
FT                   /locus_tag="MICPUN_79463"
FT   mRNA            <18257..>19363
FT                   /locus_tag="MICPUN_79463"
FT                   /product="GHMP kinase"
FT   CDS_pept        18257..19363
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79463"
FT                   /product="GHMP kinase"
FT                   /note="GO_function: GO:5524; kinase activity - ATP binding
FT                   [PMID 16301]; GO_process: GO:16310 - phosphorylation"
FT                   /db_xref="GOA:C1E0N4"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N4"
FT                   /protein_id="ACO61587.1"
FT                   /translation="MTVGHICPDATDDITHRAYARVGLLGNPSDGYFGKCISVSVQNFF
FT                   AEVTLTPNQQMFSSRVTIEPGPSDSTVFESLETLAVTTAKSGYYGGVRLLRALCFKFQE
FT                   YCAERGYDLAERGFTLEYESNIPTQAGLSGSSAIIVAGLKCLMQHYSVYIPLEEQPALV
FT                   LSCEHDLGINAGLQDRVIQCYEGVVYMDFSNEEMVRTQGKGVYTRLPETCLPPLHIVYD
FT                   DNPSDSGKVHADVKQRWERGDADVRSKMSRIAELAERGYKVLSSIGTDKQTGEPMIELG
FT                   MLMNANFNLRKEMFGAEALGARNVEMIDTARGTGSFAKFTGSGGAAVVLCPTNSEEERE
FT                   AMYADCEAKGFKVCPLVVNPGKPSGGAA"
FT   gene            <19556..>20161
FT                   /locus_tag="MICPUN_79748"
FT   mRNA            <19556..>20161
FT                   /locus_tag="MICPUN_79748"
FT                   /product="predicted protein"
FT   CDS_pept        19556..20161
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79748"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3723; DNA-directed RNA polymerase
FT                   activity - RNA binding [PMID 3899]; GO_process: GO:6350 -
FT                   transcription"
FT                   /db_xref="GOA:C1E0N5"
FT                   /db_xref="InterPro:IPR004519"
FT                   /db_xref="InterPro:IPR005576"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013238"
FT                   /db_xref="InterPro:IPR036898"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N5"
FT                   /protein_id="ACO61588.1"
FT                   /translation="MFQISRLEDANVKILPENLGKPRLEAITQEIESLYIDKVIKDLGL
FT                   VITLYEIVSIEGGTVYPGEGSAHFKVEFRVVVFRPFVGEIIEGTLKKADKTGLYVDIGF
FT                   FSDIFVPEHLMQEPSVFDEDEQLWVWMYEDAKMFMDLEEPVRIRIQGIKFPDQPRTSDE
FT                   LVGRTALEGATPDGTFAPMVVMADINADGLGLISWWKQ"
FT   gene            complement(<20306..>21181)
FT                   /locus_tag="MICPUN_56580"
FT   mRNA            complement(<20306..>21181)
FT                   /locus_tag="MICPUN_56580"
FT                   /product="predicted protein"
FT   CDS_pept        complement(20306..21181)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56580"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N6"
FT                   /protein_id="ACO62033.1"
FT                   /translation="MAHVSTMMSRISITAPLHASPHRPAGAGSRRAAVTVRAGKGKGAK
FT                   YRRGADDPYAKEKNKDKMEKQTKAKQSAEDGPLNSVFSKEEPKEEYFLFVRKLRVDGSG
FT                   AAAPAADSDAEKKSVDEGEYSSANIGAMLGMKGPNTDGSGSKISSLGNWLPLGDVSIEA
FT                   GGDLDVVVAERRRMLVKFAKVKHLKLLPVCADEKLEFGVRVQRGPPRGTDPTAVFPVAT
FT                   DAEHEELVWDHETMGEEGSVRAELRLMQSLPSLGKGKKNEMLSSAMDMIKRQQEQAAAM
FT                   KAEREKVDDA"
FT   gene            <21162..23294
FT                   /locus_tag="MICPUN_99225"
FT   mRNA            <21162..23294
FT                   /locus_tag="MICPUN_99225"
FT                   /product="predicted protein"
FT   CDS_pept        21162..23291
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99225"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0N7"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR033443"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N7"
FT                   /protein_id="ACO61589.1"
FT                   /translation="MVETCAMVGCFAENCDNYLTVDLEPEDFSGGSTSRSSRATEPRER
FT                   VRVDVSRDMKRLRVFDGSSFEGPSPRSAKFKRRIARYFPGSATAADERLDAEARGVKEV
FT                   REAPASIEVVEEPDEPPFAEAATNDEPDEKPNAAKTGDEVEPVPYSSLAALDEGMARIM
FT                   KSNRKRSRDAQTLLKRAVKTKEIKFFNRIIKDFGNDKQMGFAEEAFRRIGDAGLSPTVY
FT                   SYTNLLNACVRVGELDRARKVWDDMIAAGVDPNEVTYTVLVKGLAQDGLLAEAARTVRD
FT                   MTAQSRAGVEGVAPNVRTFSTLLRNCVRHADPGVADECIAAMRDADVKPDVASFEYLLK
FT                   ARCAAMDAKGAWAVVDDMDREYLEVPPQAHAALATVSSLTGDVEKARSACEAARQAVKD
FT                   NGAGTVEDDGAGELFGSRGGYGSDSDEPKAANEQVKGRKKDKRHSQQQQQQQQQEEASK
FT                   SVQQFLKLRNSDALRQVEEVEKFLALGDDFVKEVAAVVNRGPESESSPVLIVEGAANVK
FT                   KPLCFKEVFGNDLPVRLEVCSGHGDWVTERAQRDEGKANWLALEMRRNRIRMTWAKAVR
FT                   RRLDNVALLCGMAHEMMGAHVPSGSLTEVYVNYPDPPEWVGSSQCLVDQAFLRDAHRSL
FT                   KPGVGHLTLVTDDPNYAMRMCRELSKVLRLFKPTEHGGKPFKSGVPEGYGGSYFDEMWK
FT                   NGRQNDRYYIRYKRV"
FT   gene            complement(23288..24177)
FT                   /locus_tag="MICPUN_107846"
FT   mRNA            complement(23288..24177)
FT                   /locus_tag="MICPUN_107846"
FT                   /product="predicted protein"
FT   CDS_pept        complement(23336..24058)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107846"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N8"
FT                   /protein_id="ACO62034.1"
FT                   /translation="MATADRNLTFYTHSLCPYAHRVSLCLAEKAIPHKREHIDLSNKPR
FT                   WYLDLNRRGLVPAIQLDGEVKTESLELNYFLDDVFEGAARLTPDGRKEEMQTLIDSFDG
FT                   SFISAGLQFVGGGWGFRRGAPGPRQADRMAVECERIERIIEINGNGGPYLMGAEVTLAD
FT                   LALWPFAERYELAMREFQGVELREMGPSGSLSRWIDAMRSRPSVVGLRPDDNKLLASWR
FT                   RTMRLDYFDYETADVDNP"
FT   gene            <24318..>26423
FT                   /locus_tag="MICPUN_56583"
FT   mRNA            <24318..>26423
FT                   /locus_tag="MICPUN_56583"
FT                   /product="hypothetical protein"
FT   CDS_pept        24318..26423
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56583"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0N9"
FT                   /protein_id="ACO61590.1"
FT                   /translation="MRAAAKTLAHAFTSSRWVAKRSQRVHNIVRATSSTTAPSPLLRRN
FT                   PRERPADGPTYSFDLGSARVAQLRFLAFHGCGTRYTVLYRECDKVEEQPKGGVGRRGRN
FT                   RAAKEVSDDIGFDAGELESTGEGDGPGWRVRLANSQEITLNALKEITPRDMALAALFDD
FT                   DLGDARLYRRGEERWLASTAAPKWPEELLASLDERGVGVHGANAVTCVDGSYFLELMEL
FT                   SAFPTPVIFPHGAWRLPGVGPTVQGNFRNLASAAIGVDAIDALSAIVNNGAGPDAIGRL
FT                   TGELPGRGRIQLGVDGGRAGVGSAHAAVTENEVTVTFAEGSLGLGFAPLDWERQFGAQV
FT                   WDVDDDSAAAEAGVVPGMVFTHIRGESVDGWTFSEIDREFDGPRPLEVKFNTKVPGAER
FT                   LYAVEMIAEEVTEALLRRKDPEMETFDFEEPGAVFEESTAAVIWREEPSTIFFGDAGST
FT                   TVVHHDIIGQVELCHVLSGSKLLAAAPWGKSSEELLRKAGARGLLSDGKDDGEAEEGVV
FT                   LSAPVHRSLTSDEIALLKHDDLAVVLARPGDCVAFSSICAHFATNGANEPCAAVFHGIL
FT                   TPASTHVLASHPERLDPFSDEEIDEDGFDGHLTGRAVLEELIPAGKDVITDYSAVDKID
FT                   SAMAKESGEKGWRMNRKMRGKAGDAAVKRRFAEAVLNMDSARDVSKAPKMWTGTSRTVF
FT                   YVEPVIK"
FT   gene            complement(26399..27153)
FT                   /locus_tag="MICPUN_107847"
FT   mRNA            complement(26399..27153)
FT                   /locus_tag="MICPUN_107847"
FT                   /product="predicted protein"
FT   CDS_pept        complement(26475..27071)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107847"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P0"
FT                   /protein_id="ACO62035.1"
FT                   /translation="MKPNRRGSAVSVRAAGDPPSIYGSPGSRTQIVEWLALELGQDIKS
FT                   VNLNRAIMSSPEYRDVHPFGKIPACKAADGTGIFESGAIMLYLADLAGSLPTPEARGEA
FT                   AAWVIWANATMWPALEASRGKCNLENLFGPVDAILADKAWLLGSELSVADVAVASYIKY
FT                   GQLFFRMDIKAFPNVVRYMEQVEQREAFQSTVMGG"
FT   gene            <27285..>28661
FT                   /gene="CNX1E"
FT                   /locus_tag="MICPUN_79735"
FT   mRNA            join(<27285..28396,28457..>28661)
FT                   /gene="CNX1E"
FT                   /locus_tag="MICPUN_79735"
FT                   /product="molybdenum cofactor biosynthesis protein CNX1E"
FT   CDS_pept        join(27285..28396,28457..28661)
FT                   /codon_start=1
FT                   /gene="CNX1E"
FT                   /locus_tag="MICPUN_79735"
FT                   /product="molybdenum cofactor biosynthesis protein CNX1E"
FT                   /note="the Arabidopsis thaliana cDNA cnx1 encodes a
FT                   multifunctional two-domain protein homologous to a
FT                   mammalian neuroprotein, the insect protein Cinnamon and
FT                   three Escherichia coli proteins; GO_process: GO:6777 -
FT                   Mo-molybdopterin cofactor biosynthetic process"
FT                   /db_xref="GOA:C1E0P1"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR005110"
FT                   /db_xref="InterPro:IPR005111"
FT                   /db_xref="InterPro:IPR036135"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="InterPro:IPR036688"
FT                   /db_xref="InterPro:IPR038987"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P1"
FT                   /protein_id="ACO61591.1"
FT                   /translation="MISMNEAVDRVISRAHPLPQESVAFVDAVGRVVAEDFVAPRPHPP
FT                   FAASVMDGYAVRSADCPGVMTLIGASRAGAPMRGSGNTSIQPGQCAYITTGAPLPPGAD
FT                   AVVPSEECRVDGGTVSIDANVDAGKWVRPVGFDIKAGETLVPAGSLVGAHEVGIVAAAG
FT                   GGEICVHRKPKLALLSTGDELAEAGEVEPDASSGRIYDANRPMLAALAKTSGVDDVLDL
FT                   GRAVDDPGALASLVARAHAEGCDVLVTSGGVSEGDRDYLKEVLLGEHGGGIEGEVHFGR
FT                   VMMKPGKPLTFAEVQSKTDCGGNKMLVFALPGNPVSAAVTFHLVVVPTLRRMMGWRDPR
FT                   LRRVHVVVSSDLKLDPERPEYHRATLDWQEHTRHLPAAHSTGKQVSSRLTSMRGAEVLM
FT                   ELPRGPGMVAKGTVVSALVIGNLSSASVQLPAISPEVVR"
FT   gene            complement(<28735..>31185)
FT                   /locus_tag="MICPUN_56586"
FT   mRNA            complement(<28735..>31185)
FT                   /locus_tag="MICPUN_56586"
FT                   /product="predicted protein"
FT   CDS_pept        complement(28735..31185)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56586"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P2"
FT                   /protein_id="ACO62036.1"
FT                   /translation="MKGQQNGAGDGSVGNQPPAGYLQRLWAWLRRPQARGKTNHHIRRS
FT                   RRLSHFATLKTMPELADVPSKCISSPAYRSGSAWEMEYAGKDMMTLLGDAMKSSCSPSD
FT                   LRNAALVCKEWRSMLGYAPAVASILRGGDAFAIAKMLAAKDIESVVQHHISDFVRVLAR
FT                   TAETEEDDTFLATSVADLGNIWMFAFKLSWNSHAEQMIEAWLKVFVTRVREMHLMCSDG
FT                   DPINAAITCIGPVDRNDADVDARLVLHMDLRQTVRRIGEALVPRLGDIIDRASRRLNNI
FT                   MQSLNNLWLHRFHDFIGSPSHVDPSESFATREAVEVDIDNLVAYSLVIRAVFLEFPREA
FT                   SVHLRSLLPLLSIEFDEVQGYLLFEFGVQNAFIGIREKYLSPGGRYATYVKTMQENFSV
FT                   VINITDALLAMQKVVKNGWEPDGLHDALLQALLGSSGDKKLELVRAFPTVAARNLSWLY
FT                   EAITLPDDYVHDEEAGRDADVWDHIEAGVNLVCCLLDTEVQFDGNLIMDRLVRLVPFDR
FT                   GPELLWAINELVRRELTDLRPDAHVIADVLDRPNYMKTRDQAITAFGLLGDEAEPHLDR
FT                   FMEQMKEVLVQETGDRFVQTLYEHRYRLKQNHLRDIILCLNESDWIPEIVTALETVRVL
FT                   CKTEEDATQIMYTMFYEMLDLTSEIDDDGQSYFPCNGGNYLFEAIQYVALRVDEPTRRE
FT                   ILQYLRANSKGPSSQNPYRWLSMLHIRAMIEKDVSPALALDHMLEMYDNNDGDRRRRDD
FT                   IVDYKVEQLEIFNEGRRKLRSEYCDRLAELRLQAEDAFDFLSSSDEEDADDDRDSTGSE
FT                   DIEF"
FT   gene            31426..32557
FT                   /locus_tag="MICPUN_107848"
FT   mRNA            31426..32557
FT                   /locus_tag="MICPUN_107848"
FT                   /product="predicted protein"
FT   CDS_pept        31431..32483
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107848"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P3"
FT                   /protein_id="ACO61592.1"
FT                   /translation="MWIRPAILGAQPSGRGGCASATVGDMCLFIGGTDRSPRAFDEVWI
FT                   LKMAPESTDGVSSSDWRWIRKSTTVRGGGTLPARTGATATAVGRKVYVFGGQEPSRGTC
FT                   FNDVVVLDCDSWEWSRLEISGPSPPPRNSHVACVVNGGRLLVVYGGSSPEVGPMSDVYL
FT                   LDLEEGAERWIRPKVTGQAPEPREMHAACVLPNTPGDGDWNGDREIIVVGGRGGASVLS
FT                   DAVVLDAQRLEWVRRGDVGVAVCAHTAVPWRLGRSGAALLFGGFGGAALRGNDTVTVDG
FT                   TTLKTIVKGVSSEDVAFAPEPRFAHSSCLVPGGGMLVFAGVTPEADLGDVAVWVPDERA
FT                   SGVVPACDLD"
FT   gene            complement(32511..33576)
FT                   /locus_tag="MICPUN_107849"
FT   mRNA            complement(32511..33576)
FT                   /locus_tag="MICPUN_107849"
FT                   /product="predicted protein"
FT   CDS_pept        complement(32563..33558)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107849"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:166 - nucleotide binding"
FT                   /db_xref="GOA:C1E0P4"
FT                   /db_xref="InterPro:IPR004130"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030231"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P4"
FT                   /protein_id="ACO62037.1"
FT                   /translation="MGFGQLVIGPPGSGKTTYCNGIQHFFQLTGRPCAVINLDPANHDP
FT                   PYECAVSVEELITLEEAQREFNLGPNGAMVYCIEYVSKNLDWLKERVTPLVAEGKYVLF
FT                   DLPGQVELFNMHDALREVVAAITGPEWNLRLCTVHLIDSHLCADPAKYIAALMLSLSSM
FT                   LHLETPHVNVLSKVDLMDKYGELDFNLEYYADVMNLEYLADRILDGNQDAIGTAPSPGQ
FT                   TMMRKKYGKLTKGLCELVEDFGLVNFTTLSIEDKASVERVVQLTDKSIGYFNAGGFSAA
FT                   AGPGMENAVGGTDYDERALVSNMTVGSNYERHHEVQERFFTDRDERVVPP"
FT   gene            <33700..35269
FT                   /locus_tag="MICPUN_56589"
FT   mRNA            join(<33700..33732,33805..35230,35262..35269)
FT                   /locus_tag="MICPUN_56589"
FT                   /product="predicted protein"
FT   CDS_pept        join(33700..33732,33805..35230,35262..35266)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56589"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P5"
FT                   /protein_id="ACO61593.1"
FT                   /translation="MTELAVDRSLLVPTRGESSTQDENFGGYRLARDLLIEDRTEAHVL
FT                   ETPAMDSSAAMGKTLGRIAHLAASRRNQLFDLGIQRPDPGHDDCFAFASEGGVFHAVDV
FT                   PRNIDEPIKVSPINSIPIVATEDPAEGPRMGPSIARAANSNTFALSTGGGDLSVTSEGG
FT                   AVRGCEPPTFGEDGGRRPFVIESVTHRPGSMALLVWAVSTGAGAAVELFRLTVEESPDS
FT                   KAWTPTGAAVKVAEGTSPPLWCKVATSSSVDEVFVVAMETVEGRSVKAKSGEPVQEWLP
FT                   QDDEEAEEWIGNPGSAMVPSDGRGMAAWKAFNAEGDSEDEDDDAPRNPFDADLEDGPLH
FT                   VLMVSAWSDEVKTTARMPRNKPCAIVHGGAHIGVSHGVHCLTVSVEADGSARHVSTNQA
FT                   LSYVAKGKPNRKFVLATPDGTCAAVVETKRSSFVYRTPAPAPNPPKSGLHQIFDLTEKV
FT                   GSKLRGLPAGGVARQNSAEAPVLGARLVC"
FT   gene            complement(<35367..>36682)
FT                   /locus_tag="MICPUN_56590"
FT   mRNA            complement(join(<35367..36311,36455..36527,36651..>36682))
FT                   /locus_tag="MICPUN_56590"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(35367..36311,36455..36527,36651..36682))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56590"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P6"
FT                   /protein_id="ACO62038.1"
FT                   /translation="MAKGKGADRRKSIFGSKTPAPQVPLEPVNVNSTRQAQLASEPRAT
FT                   RGMARTGKEVVVEDGFKYKRRKNKDTKAAGAGPGSNFAALGRRSTGGDEEILSEVERLR
FT                   SLDPATVFAPDDPAWTLHENIPEDLPESERLQMLIEEICELEMKRERERLVEELGPEAG
FT                   AEAAKSLEDALSEFQLKVEEMIVRGEIKFANDGDAGADLKDAKHEAMAAVLSQLEDEKA
FT                   QWDALEQEALAGASADDEASMEQMRKDVEEVNKAVEALIAAELAAENGEGGTAEELAKA
FT                   VEEAERKLAMQQEGLSALVEGVEALCTRAERAAEVFSKAIAENDFKGLPHVNSPQNLVK
FT                   NLVRGKTKK"
FT   gene            <36845..>38251
FT                   /locus_tag="MICPUN_56591"
FT   mRNA            <36845..>38251
FT                   /locus_tag="MICPUN_56591"
FT                   /product="predicted protein"
FT   CDS_pept        36845..38251
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56591"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:19867 - outer membrane"
FT                   /db_xref="GOA:C1E0P7"
FT                   /db_xref="InterPro:IPR000184"
FT                   /db_xref="InterPro:IPR039910"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P7"
FT                   /protein_id="ACO61594.1"
FT                   /translation="MADQAGQKKPYDYQERYRHVRQKPLSVYSVEVKGDERTRPGLFAR
FT                   VLDPVYRASTLDELRVRCVEANAVLNSYDIFDRVDIEMDAGPREHPDSAKVTVEVSEKK
FT                   KLNLKGGAYVSQQGEGSMEVSVGLNNALGYAEKLDVEFIKGHERSNSCTLAWNQPRVGN
FT                   VDVDVVTRAFQQVSCSKRLSSFDETARGISVTAVGGGPATVDYSLVWREIADPTRLASK
FT                   SIRQQLGHSLKSSVSYTYQVDERDRPVRPGAGYLARVRSELAGVGWDPQMTRFLKHEAE
FT                   VQAAHTPAEGVTFFASAKLGAMMPLGQNAKDPEKGTCIADRFFLGGVGSLRGFEPHGAG
FT                   PSDERRPPPTKAAASGENLITRDALGGDVLAQLFASYQLEPEWSKLRDIGVYGHFFVNA
FT                   GTLMPWITGERKRVSGRELADSFRASVGVGLVFPLPVGNIEVNYCHTLRSRPGDRVKNG
FT                   LQIGLATALA"
FT   gene            complement(<38367..>39365)
FT                   /locus_tag="MICPUN_99233"
FT   mRNA            complement(<38367..>39365)
FT                   /locus_tag="MICPUN_99233"
FT                   /product="cytosolic malate dehydrogenase"
FT   CDS_pept        complement(38367..39365)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99233"
FT                   /product="cytosolic malate dehydrogenase"
FT                   /note="malate dehydrogenases (MDH) cytoplasmic and
FT                   cytosolic; member of the family of NAD-dependent
FT                   2-hydroxycarboxylate dehydrogenases; GO_function: GO:16491
FT                   - oxidoreductase activity"
FT                   /db_xref="GOA:C1E0P8"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010945"
FT                   /db_xref="InterPro:IPR011274"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P8"
FT                   /protein_id="ACO62039.1"
FT                   /translation="MVSPVTVMITGAAGQIGYALAPQVCRGAMLGPDTPIILHLLDIAP
FT                   AETALKGVAMELVDAAYPLVKKIVATVNLEEACKGVDVAVMVGGFPRGPGMERKDVMAK
FT                   NVAIYKGQASALQEHASPDVKVVVVANPANTNALILSNYAPKIPKENVTCLTRLDHNRA
FT                   LGQVSERTGVPVSDVKNCIIWGNHSSTQYPDVNHATAGGKSVRELVNDDEYLNGEFVTT
FT                   VQQRGAAIIAARKFSSALSAASSVCDHVRDWVHGTPEGTWTSMGVISPGGDAGYGVEAG
FT                   LMYSFPVTCAGGKWSIVQGLAIDDRSRSLMDATAAELKEEKTMAEELIAAM"
FT   gene            <39478..>40530
FT                   /locus_tag="MICPUN_79568"
FT   mRNA            <39478..>40530
FT                   /locus_tag="MICPUN_79568"
FT                   /product="predicted protein"
FT   CDS_pept        39478..40530
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79568"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0P9"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0P9"
FT                   /protein_id="ACO61595.1"
FT                   /translation="MNGGNSELPTVSLASFIGECGGCVVGDEPTPEQRLTAGQIDAVFR
FT                   RHGFLYLTDFGVSEEDVRVVFNNMKRLFALNDEEKAKLSKFDPRTNTGFSKFATEALNT
FT                   LRPPDLKESFNIRSRKHYTNDYTGTPEGFGDVAESFWDKLEEASRRLFIACALAMKLPR
FT                   EDMRFFERTFRRFDFSTLRMLHFPPVEDFSPDKLTRDGDALRIGEHTDFGMVTLLFHDA
FT                   ESAGEGLQVKKADAGAGNDASGVAGTNTGWIDAISRGGATAIVNTGALIARWTNDEWRA
FT                   TAHRVVVPNDAAAGRDRYSLAFFLDPDKDEVIETHPRFSDAVDKYKPITSGGFVQMKIE
FT                   EMLKVQGKAT"
FT   gene            complement(<40580..>41458)
FT                   /locus_tag="MICPUN_80078"
FT   mRNA            complement(<40580..>41458)
FT                   /locus_tag="MICPUN_80078"
FT                   /product="glycosyltransferase family 7 protein"
FT   CDS_pept        complement(40580..41458)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80078"
FT                   /product="glycosyltransferase family 7 protein"
FT                   /note="Beta-1,4-galactosyltransferase, related to
FT                   b-glycosidases; expressed; GO_function: GO:16757 -
FT                   transferase activity, transferring glycosyl groups;
FT                   GO_process: GO:5975 - carbohydrate metabolic process"
FT                   /db_xref="GOA:C1E0Q0"
FT                   /db_xref="InterPro:IPR003859"
FT                   /db_xref="InterPro:IPR027791"
FT                   /db_xref="InterPro:IPR027995"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q0"
FT                   /protein_id="ACO62040.1"
FT                   /translation="MLPQSINSLIGAAAANFATKGGSATLHHTVVPGDASVVWQREVLG
FT                   VCVPYRDRRDQLEVFASHLRTFLHGQGVPFRIYVGEQMAGGSFNRGWALNVAYKFAEPE
FT                   VDYVVFHDVDMLPLPGVDYRYSSMEGMDARHLSTEISQFGYKIPYNRYCSGVFMSRKEF
FT                   FRDINGFATTFWGWGGEDDEFCARWAKKKFGGWEAAEAAPGGLHNMFGRPEKGRGRFLS
FT                   MEAGHKSDRKNPHWKKNDQKLQSFLSSPETVNKADGLSTTGEPTQILKGKVETPLYTVY
FT                   RSSFPPNLRQP"
FT   gene            <42389..>44795
FT                   /locus_tag="MICPUN_97103"
FT   mRNA            join(<42389..42619,42746..43267,43736..44165,44497..>44795)
FT                   /locus_tag="MICPUN_97103"
FT                   /product="amidohydrolase"
FT   CDS_pept        join(42389..42619,42746..43267,43736..44165,44497..44795)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97103"
FT                   /product="amidohydrolase"
FT                   /note="GO_function: GO:16787 - hydrolase activity"
FT                   /db_xref="GOA:C1E0Q1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR017593"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q1"
FT                   /protein_id="ACO61596.1"
FT                   /translation="MDVLSMIMALFFMLLAVWSQSQLAALQQPKSEAAPALEILYSKRV
FT                   VTRGAVIAAAVHVSDGRVQSIVPMRNAPKGPKVTDYGRLAISPGLVDVHVHLNEPGREE
FT                   WEGFETGTKAAATGGVTTVVDMPLNSYPTICDAATFDGKIAASKGKLHVDVAFWGGLVP
FT                   QNAHNETVLDELIERGVVGLKTFMSPSGIGDFEQSFKPDLEAALKTLAKHQVPLMAHAE
FT                   LPSDVDLDPNADPRKYATYLATRPRKWEQDAIAQLVEIASTTEGAPIHIAHVSDADSLE
FT                   MIAEAGRQGKRITSETCTHYLTFAAEEIPDGSTLHKCAPPIREAENRERLWEGIKNGTL
FT                   TFVSSDHSPAPPEDKLVEEGDFLRAWGGISSLQFSLPATWTQALARGLTLADVAEIWSA
FT                   RPAAVVGLGAKGTISAGKDADFVVWDPEAEITVGEDWKVEHKHKLTPYHGMKMKGKIVA
FT                   TYLRGEKIYSSSDERGKYSHNHRAAGPYGRPLLRK"
FT   gene            complement(<44858..>45592)
FT                   /locus_tag="MICPUN_79469"
FT   mRNA            complement(<44858..>45592)
FT                   /locus_tag="MICPUN_79469"
FT                   /product="cyclase"
FT   CDS_pept        complement(44858..45592)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79469"
FT                   /product="cyclase"
FT                   /db_xref="GOA:C1E0Q2"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q2"
FT                   /protein_id="ACO62041.1"
FT                   /translation="MCSSPNDGHGGHIVDITATIRASLPTWLSETGLGEGHRTETWSML
FT                   NGDDANASELTFSAHTGTHVDAPRHFVPWKNQQGMETVDIGAMNGPALLIEAYDVPVLN
FT                   REALEALGIPNAVSRLIIRTDNTRRKLMHTTAFTPDYVAFDTEGAKWLVEHRPDIRAIG
FT                   IDYLSVAALDHLAEAHVALLDHGIVPIEGLVLDEDKIDVGWWWLHCAPLKVEGSDGAPA
FT                   RAWLTPVNDPAGAKKPPRKCGQ"
FT   gene            <45722..>47734
FT                   /locus_tag="MICPUN_56598"
FT   mRNA            <45722..>47734
FT                   /locus_tag="MICPUN_56598"
FT                   /product="fused protein"
FT   CDS_pept        45722..47734
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56598"
FT                   /product="fused protein"
FT                   /note="Has two domains - COG3897, Predicted
FT                   methyltransferase and COG5285 - Protein involved in
FT                   biosynthesis of mitomycin antibiotics/polyketide fumonisin"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q3"
FT                   /protein_id="ACO61597.1"
FT                   /translation="MVLTVTSLLEVDGCPPIKLREERDNEDVPLRTGCRVWSCARLLAE
FT                   WLANRSGGGEDDGAGPIVVGRDVLELGAGTGAVGLTCAALGASSVTMTDRDEAALALMH
FT                   TNARINGHYDASSTCEVCVQGLDWGDPATYIQGASYDLVVAADVLYLPEHCAALPDAVA
FT                   AHLAPGGEVVVACGLRRAGLLEALVDSLRSVGLDDVCVDLGTLGLDPVDGADARNRAAA
FT                   AVTASEHAHDGAQISAAGGYALVTASVKADWKPPERLSARAVADAKREREEEERNEEER
FT                   NEAERNEADRPRIRGEGNRTPGAVASETAATREEDQLGGEPSEIDSDANSAMGDFLDDF
FT                   EDLGVDAGAPVTRAVPASDDDDEDEVDTLPPYRVHPSPAEVASGAPSASTIAAAADSLA
FT                   RNGFVVLEAEDGAGLVASDVLDSALAASDGYLDRLLAAAKAKGLRVDSDIFRFAELCSR
FT                   AQGGRRFDVTAERRRCGNGGSITLPPRPYPTSDDESAAAAATDAWDGLRRAVDPWVSSA
FT                   LLRSGLMVENDGKGATFGVTAVGCVTSLPSAPEQHFHADGRERGIVNVFVPLVDVPASM
FT                   GPTHFRRGSHAWDHDSPYLTREQRRAQEGAEDVVPELRRGSVLMYDYRVFHRGGANLTG
FT                   KRRPVAYVMYARDGTEDTWNFPDESVWDPDSTGAG"
FT   gene            complement(47775..48678)
FT                   /locus_tag="MICPUN_56599"
FT   mRNA            complement(47775..48678)
FT                   /locus_tag="MICPUN_56599"
FT                   /product="predicted protein"
FT   CDS_pept        complement(47829..48536)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56599"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5839 - proteasome core complex;
FT                   GO_function: GO:4298 - threonine endopeptidase activity;
FT                   GO_process: GO:6511 - ubiquitin-dependent protein catabolic
FT                   process"
FT                   /db_xref="GOA:C1E0Q4"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q4"
FT                   /protein_id="ACO62042.1"
FT                   /translation="MADSRSNYSLTTFNSSGELVQIKHALAAVQSGATSLGIRAVNGVV
FT                   LATEKKLPSTLVDETTVEKIAQLTPEIGMTYSGMGPDFRVLTKKTRKETQVYYRTYHEL
FT                   VPCSQIVRETASVMQEFTQRGGVRPFGVSLLMAGFDSNGPQLYQVDPSGTYFAWKASAI
FT                   GKNMVNAKTFLEKRYSEDMELEDAIHTAILTLKEGFDGQISAENIEIGIVAEDRKFRVL
FT                   TSAEVADYLSEVE"
FT   gene            complement(<48814..>49737)
FT                   /locus_tag="MICPUN_56600"
FT   mRNA            complement(<48814..>49737)
FT                   /locus_tag="MICPUN_56600"
FT                   /product="predicted protein"
FT   CDS_pept        complement(48814..49737)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56600"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1E0Q5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q5"
FT                   /protein_id="ACO62043.1"
FT                   /translation="MEGAPIDEAPASGQEPVGAPHEENPPHNDDNPVTKLFKDMGTKVK
FT                   NVVAAVERMEEEVIDDKTVNDKVKAIQHTRNVKTLRQMWIDLILSKEFTTIIDQVFDKC
FT                   CKLNDDDGDGHEGDGKLDRTELGAAMTMLWERLDQKTGGGKKLPRIKESEETVLRRYDA
FT                   DSDGHLDRDEFHGFARTYFSRVEWSSWRVACHGATKGFGFYVAQRMLLQPAIGMVKTAV
FT                   GPIVKAKIQKALESGAASVLRGSLRKVKYAVKRPLAKTNNAEGKAILEEELMEMRAKAR
FT                   AKLVALVKSVAICCVGGSVGAVAGWL"
FT   gene            <49931..51469
FT                   /locus_tag="MICPUN_56601"
FT   mRNA            <49931..51469
FT                   /locus_tag="MICPUN_56601"
FT                   /product="predicted protein"
FT   CDS_pept        49931..51466
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56601"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E0Q6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q6"
FT                   /protein_id="ACO61598.1"
FT                   /translation="MTTTSLAAGAVAVPRAMRVGARVSRRRSIARRRTLTTPRAGFLDD
FT                   MGVGDLGTSSPSSSAPVELANSIGSAVGRTYTELFPDLPSEVLGVSVPDTARALADAAR
FT                   PATDAAFQTLPDDAKSGLSDWWQREVDSGFTLVTGNAEYELALALLVFLWATGRPGVFG
FT                   GAFDAYFANAFDAVLLNKKFDKDSIKIRGKLGDGSFGSVSYAEDTDTGRELVVKQAKSV
FT                   QGAAQLQNAEEYMNRRVRRAPLVASGCAKYLGSYEVVEGASSPTLVWAFEGDVTLEELI
FT                   VRRDFPECVEELLYGGAQGGDDYAKRTSKVAKSVLRNLLSTLAGLHDIGIVHRDVKPAN
FT                   LVFMGRKFKLVDFGAAADLRTGKNYEPEQGLLDPFYSPPENFIMPERIPAPPPLRPLTA
FT                   SLSPLVWGTFLPDLFDSFSAGLVFLQMCVPQLRGRKVMDPNGSFRRLLEENNYDLRKWR
FT                   KVVEPQGWDFSALDANLGLGWDLACRLVCKRNFLQRGRLGCNTALLHPFFWTP"
FT   gene            complement(51468..52657)
FT                   /locus_tag="MICPUN_107850"
FT   mRNA            complement(51468..52657)
FT                   /locus_tag="MICPUN_107850"
FT                   /product="predicted protein"
FT   CDS_pept        complement(51506..52540)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107850"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001849"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q7"
FT                   /protein_id="ACO62044.1"
FT                   /translation="MAYISVVLNDWKYSCPIVWSFYSTALAAGRENGKLRREVEQNLRL
FT                   KYSKELPPPNTSSEPPSEKSMKSGIKSGMKGVAKGMTDVAKVTSGGLTYLLFGGKDDMS
FT                   NEMREELEVELDKIRRSRRARTRWFLALTLMNNPSLIAMRRPWGGQPQNVAMLKPSHLP
FT                   HAVKKGWLRRRGGILGVVNDDYVMLTPGVLYIFEHDLARNPKVYTLSSRVLVRRLFVSV
FT                   RDQTSGGWHFGGDRYEPGPDEVDPPDAEDGLRLPSKKIDDKEKGNKKKDDKDKGGDGDP
FT                   AKSAESSKWKLREKHFFVISIPGGPMEVFASADLDDVTDWVGALRASCLGAPDRSMLAG
FT                   LKQD"
FT   gene            56364..57310
FT                   /locus_tag="MICPUN_107851"
FT   mRNA            56364..57310
FT                   /locus_tag="MICPUN_107851"
FT                   /product="predicted protein"
FT   CDS_pept        56429..57250
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107851"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0Q8"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q8"
FT                   /protein_id="ACO61599.1"
FT                   /translation="MRGSFADLVAVPSSQLATKPPSLTHAEAAALVLPGLTVVQALRQH
FT                   GFGPGTRVLVLGASGGVGHLAVQVASARGAQLVVGVCSGRNVEFVKSMGADDVLDYEAL
FT                   EPPDDDEAGVAPDPLVEALREVLRKHGGRPFDLVLDTVSSHDARDRAHAYKSRIRSNPA
FT                   LLDDSPNAADKHNYVTIGGRTGGWITAGVKRVTGVNLFKRGKELFWINFNQCAPDLRTL
FT                   RALAEGEGSNGGVRAVKPAIERTVPLTDEGVREAFRALHGRRVRGKLAIEL"
FT   gene            <58152..>58379
FT                   /locus_tag="MICPUN_79671"
FT   mRNA            <58152..>58379
FT                   /locus_tag="MICPUN_79671"
FT                   /product="predicted protein"
FT   CDS_pept        58152..58379
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79671"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Q9"
FT                   /protein_id="ACO61600.1"
FT                   /translation="MALARTWGDELTLRACSDAFQCVIHVVQSTAENWYLVYEPQTEEG
FT                   DGRESRRRKRLFLTYVSPVHYNSFTREGDN"
FT   gene            complement(58488..60182)
FT                   /locus_tag="MICPUN_107852"
FT   mRNA            complement(join(58488..59286,59417..59508,59732..59846,
FT                   60082..60182))
FT                   /locus_tag="MICPUN_107852"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(58729..59286,59417..59508,59732..59846,
FT                   60082..60114))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107852"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R0"
FT                   /protein_id="ACO62045.1"
FT                   /translation="MDKASLRLSGRVAAHGNGRIGNEKFTLTASTGFANGGTVTLRATP
FT                   GFSPKYDENEKKLNFQGDAISNVGDIGKLSEIDVQFSKSGVELAGQACDVTVARDHAEG
FT                   DNAAPSGVRIKSNVDKVGDVTITAIQAGHKTLNDEDARAEKNAIRIAADIPLSDVNADL
FT                   TGSVDYDLVSKNANVRIGYHKDDITVKLRTLIKEDGDKRTAASTINLDYSGLEGIGVGV
FT                   EVKDDKTGHLQITKDDFKLKVPIEENKVKTNDASITYNWAIDM"
FT   gene            complement(<60993..>62148)
FT                   /locus_tag="MICPUN_68791"
FT   mRNA            complement(<60993..>62148)
FT                   /locus_tag="MICPUN_68791"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<60993..>62148)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68791"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16884 - carbon-nitrogen ligase
FT                   activity, with glutamine as amido-N-donor"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R1"
FT                   /protein_id="ACO62046.1"
FT                   /translation="TDPDGPLAGLTFAVKDNLDVAGHRTGCGQPTWLDTHPEPARQHAP
FT                   PVASLLAAGAACVGKTQMDELAWALQGENHHYGTPINPAAPERVPGGSSSGSAVAVAAG
FT                   YADVALGTDTAGSVRVPASYCGLCGFRPTHGRVDATRGCVPLAPSFDVVGWFARDATTM
FT                   LRCGSVLLPPWGAWDTAFDLRFDGAIARDAFELCDEETRATLREAVARACGPGPLGEAG
FT                   GGTVEVDVGGGGSTPPLTEWWNVFRVIQANEVWRAHGAWVSEHQPRFGPGVKERFEGAG
FT                   GVTDAEAAEASKTRDAIAASMESTMVDEATGKDRFLFLPTSPGPPLASGADAQTVESFR
FT                   NRQLRLTAAAGLARLPQATVPVPRRSGPPLGLSVVGPRGTDEALL"
FT   gene            62680..63448
FT                   /locus_tag="MICPUN_56608"
FT   mRNA            join(62680..62808,62902..63022,63113..63448)
FT                   /locus_tag="MICPUN_56608"
FT                   /product="predicted protein"
FT   CDS_pept        join(62719..62808,62902..63022,63113..63387)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56608"
FT                   /product="predicted protein"
FT                   /note="Antibiotic biosynthesis monooxygenase; This domain
FT                   is found in monooxygenases involved in the biosynthesis of
FT                   several antibiotics by Streptomyces species; GO_component:
FT                   GO:5737 - cytoplasm; GO_function: GO:16491 - oxidoreductase
FT                   activity; GO_process: GO:17000 - antibiotic biosynthetic
FT                   process"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R2"
FT                   /protein_id="ACO61601.1"
FT                   /translation="MSAFVQSAFTTGGSTFVRARPQTRRAPATRASGRVSLRVQAIAEG
FT                   RQSLFVAVTVKSGKMEEYEKLIKRHITNCYMNDRCMYFDFGVNQDGSDPNVVYLYEVYE
FT                   DEAALQEHRDSSHLKEYLSAAAELTDSHDVRTLNLAPYGSVNCNYAGQCEIGEGMWD"
FT   gene            complement(63412..>64727)
FT                   /locus_tag="MICPUN_56609"
FT   mRNA            complement(join(63412..64510,64692..>64727))
FT                   /locus_tag="MICPUN_56609"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(63593..64510,64692..64727))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56609"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0R3"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR024977"
FT                   /db_xref="InterPro:IPR027525"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R3"
FT                   /protein_id="ACO62047.1"
FT                   /translation="MRPILLKGHERCYNKEGDLLFTCAKDHHPTLWYSDDGERVGTYIG
FT                   HNGAVWTCDVTEDSKTLVTGSADTTCKMWDTETGTCYFTHQFEQPVRAVALSKGDQHMV
FT                   ISSDPFMGVPAALHIVDVAANREEQTNEIKISMSGPEGRINRALWGPLNRTILTGGEDG
FT                   VIRLWDVETGKIVHEANDHKKQIQHLSLSVDKTHFISASLDKTAKLFDSETLECLKTYA
FT                   ADRPVNAAILSPILDHIILGGGQDAMAVTTTHSKAGKFDSKIFYKIYEEEIGGIRGHFG
FT                   PINALAWHPDGRSFTSGGEDGYVRIHHFDNDYFRIK"
FT   gene            <65064..78403
FT                   /gene="DHC1.3"
FT                   /locus_tag="MICPUN_56610"
FT   mRNA            join(<65064..65129,65419..65544,65700..78403)
FT                   /gene="DHC1.3"
FT                   /locus_tag="MICPUN_56610"
FT                   /product="dynein heavy chain"
FT   CDS_pept        join(65064..65129,65419..65544,65700..78299)
FT                   /codon_start=1
FT                   /gene="DHC1.3"
FT                   /locus_tag="MICPUN_56610"
FT                   /product="dynein heavy chain"
FT                   /note="expressed; GO_component: GO:30286 - dynein complex;
FT                   GO_function: GO:3777; ATP binding - microtubule motor
FT                   activity [Evidence 16887] [PMID 5524]; GO_process: GO:7018
FT                   - microtubule-based movement"
FT                   /db_xref="GOA:C1E0R4"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR024317"
FT                   /db_xref="InterPro:IPR024743"
FT                   /db_xref="InterPro:IPR026983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035699"
FT                   /db_xref="InterPro:IPR035706"
FT                   /db_xref="InterPro:IPR041228"
FT                   /db_xref="InterPro:IPR041466"
FT                   /db_xref="InterPro:IPR041589"
FT                   /db_xref="InterPro:IPR041658"
FT                   /db_xref="InterPro:IPR042219"
FT                   /db_xref="InterPro:IPR042222"
FT                   /db_xref="InterPro:IPR042228"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R4"
FT                   /protein_id="ACO61602.1"
FT                   /translation="MAPNGEDMPPAGLGHTGRTQAEDGVGRASLTRDALANQLYLKTKP
FT                   PSATAFRPSQTMGRTSALKSTGRLEPLTAARPPAVSAPAMMGTAGRNNAMGATYETTVR
FT                   SSTPARVGGAVTLAPLTPTGDSSRANGSLGTTDAVPTGSLRVSPSKPLLRPESEDDGYQ
FT                   YLALLRWMRRNAADEERRVANALPPGPHGADEFVYLARLDRDPNDWQPYALGVREYHGV
FT                   DRTDYYTMSAQGITHFLDGVQPEFITAERWELEVANYKKIKSLTVFRTYKKWKSWKLWR
FT                   KSVMSAKMQRAASVLEKNLFVLDPVFAPTIDKIRDACRELSKKRLSKVRTGEVRTLGAF
FT                   VDEVKEAREEMTEEFARFSAEQTATVSDACQRSLDAMEARLEEFYGDDLPCTDRMDRIS
FT                   GHGSAGPSSPAAGRGSATGRMSGPGSKRGGSEDAAQYAYTVAATRRTEQRRCLTFVKLM
FT                   DYVMCDTMHDMLLDSVTDVLSATKQCEEDQFEMPKPPYRLHKPRLKVQSAMKRMFRKIT
FT                   QENRRQSASKKVREAAKENQLMDTIKDRQMQARHEKEDDELNRFEPEFPVLPQFEVELA
FT                   WDERASQTVFEPSFHDFQSEVEKTVKSFIDILAKVKRLPDDKALMSKMTDALEMEQSSG
FT                   KGVDMADLAYTERWRELVRQVRRSLAFGFDTATRYKDNFDIFVNMKKKNAETSTSQIVE
FT                   NYKSGDLVIDNFRRDTITYLDQKKRMEAFYVDQNVGIVKIKSQRLQTALLPSPTAKLEE
FT                   LSKMLPGLAAEMFDKFIEEVHAGTNKLANPPKSAEDFMDVMRFCVDLRESTLERLGAQA
FT                   EEVKALYDLINEFGFPIKEEDQAKFALLEDDFAMLETVLDESEGQQEDRIKQFAAEMIE
FT                   AGKEVNQNLKDLAKAATDEMILDVEAPREQVLEFVEDLTTKVEAQQAEAKRIVKIQETF
FT                   KVEPTEFESLKAVAEDVALKRSMWVSDKEFDGLVVTWAESVFDQIDVASMEEKVQKMGK
FT                   LCVKLERGLQPNSVVPAFKAKVDAYKQLLPVISALGNDALLMRHWDKIQEIIGQPIVRD
FT                   ETFTLQKILDMKCPDHSDAISQVSVEATQERQLESQLEKIVKRWQDVSFAVTNYKESKD
FT                   TFILGGLEEVFTALEDSMVTMTTILSSRFVAGIRTEVEKVEKNMNVFSDTLDEWLAVQK
FT                   NWMYLESIFSAPDIQRQLPNESKQFYGVDKMYRDVMRKTRENDNAMRAATTPGYLEKFQ
FT                   KANETLDFIQKNLEEYLETKRMGFPRFYFLSNDELLEILAETKNVQAVQPHMSKCFDGI
FT                   KSLDFGEDPKSVDIFAMFSAEGERVQLGKNLKARGNVEQWLTAVEAAMVAALKKQGKES
FT                   YVSYAKEARTDWVRNQPAQIVIMVAQIYWCRGVIECLESENPVAAMEKYLEKNRSDLKD
FT                   MTAVVREDLTRLHRKIIAALITIDVHARDIVEELWQEKVESVNDFKWQMQLRYYWDDKD
FT                   DICLIRQTNTLFNYAYEYLGAQSRLVVTPMTDRCYMTLTGAMHLRLGGAPAGPAGTGKT
FT                   ESTKDLGKALGVQCVVFNCGDNLDYKFMGKFFAGLSQCGAWACFDEFNRIDIEVLSVVA
FT                   QQLLTIQNAMKAGLDIFTFEGREMPLKHTFAVFITMNPGYAGRTELPDNLKALFRPMAM
FT                   MIPDYALVAEVMLFSEGFETSKDLSRKMTKLYKLSSEQLSQQDHYDFGMRALKSLLVMA
FT                   GALKRGSPDLDEQVVLIRAMRDANLPKFLSADCELFENLIMDLFPGKVVPESSSGDLER
FT                   AIVESINEVDLQPKETFVTKVVQLYETFNVRFGVMLVGPTGGAKTTNYQILKSAMTKLR
FT                   NEGHPNDSFQVIHTYVFNPKCIKMGELYGEYNLGTGEWTDGLGSTLIRNAVADQTMEKK
FT                   WVVFDGPVDAIWIENMNTVLDDNCTLCLPNGERIKLNPITMRMLFEVQDLAVASPATVS
FT                   RCGMVYMPPNELGWLPYVTTWANTQLPEAMTDDTKAYILSLFNKTIDGGLSFMRKNLKE
FT                   AIPTVDINLVTSLTALFKSLVQPEKGVDFADDKLSLHPKLAKVFVFSYVWSLGGNLQEQ
FT                   FHAQFDEWARAHFADNIKELEKVPPADEGAVLYDFYVVTDDIDFPKGRFEHWDKAVKPF
FT                   KYSKDVPFFQLLVPNLDTTRFSFLLETCLDVDKSLLLTGGTGVGKSVIITDYLARSQEP
FT                   RGLVNIILNFSAQTPAKDTQLLIESKLEKKRKTRFGAPPNKKIVLFVDDVNMPARETYG
FT                   AQPPVELLRQYQDFRGFYDREKLFWKDVEDTTLVCACAPPGGGRQEVTPRFFRHFNMLN
FT                   VPPPNDATMKIILGSIFSGFLDSSFGPENDKKFPKEFQEIVTPVVDSSVEVYRRMSEEL
FT                   LPTPQKSHYTFNLRDLSKVLQGMLLITPDKCKALDVMTRLWVHESMRVFHDRLISVEDK
FT                   DYYKVMASELVEKNFAVVLEGKYEDPPVPEGEAPPEPEVDEDGNPVEYKLGTRAYKDLF
FT                   EDRNIIFGDFLDQNCEPEERVYEEGDDIPKMIKIMEDYLEEYNFSATNQMNLVFFMDAA
FT                   EHATRIARILRQPRGNAMLVGVGGSGKQSLTRFGSFMAGFKCFSIELTRGYGITEFRDD
FT                   LKNLYVQTGIEGTPTVFLFTDTQIVTEGFVEDINNILNSGEVPGLFAQDEKERMMTEIR
FT                   PYAESLGLNPTKDVLFSTFINRVRDNLHIILCMSPVGEAFRSRCRQFPSLINCCTIDWF
FT                   MEWPEEALTSVSNKFLSTVDLGSPEVNKHVANMCVDVHMSVTQTSERFFQELRRKFYTT
FT                   PKSYLDLINLYTALLAEKREELGNAKDRLLNGLNKLAETNVIIDNLKIELGELQPVLEE
FT                   KSAATAELIEQVNRDKADAAEVEKKVIEEEAQAKALAAETEAIAASAKADLEEAMPALD
FT                   AAVESLNALNKNDIVEIKNLPRPPPLVGVTMEAVLTLLKEKTDWASARKVLGDTGFMKR
FT                   LFEFDKDNISPKTLKRLEKFVNREDFTPEIVQSQSQAAKSLCMWCRAMHVYAGVEKVVR
FT                   PKRKALAEAEASLAATLAALKEKQQFLKDVQDKVAQLEKDLAKAEAESQSLKDQAQLTE
FT                   DRLVRAEKLTSGLADEAVRWKSTAESLGDQRELLVGDVFVSAACISYFGAFNGAYRDEL
FT                   VDLWTSRCRELGVPVSENCSLKNTLASPVEIREWNIWGLPTDDVSVDNGILVTRGRRWP
FT                   LMIDPQAQANTWVKNMEQKNALKIIKLTDGNYLRTMENSIRNGTPVLVEDIGETLDPAL
FT                   EPILQKAVFVQNGRTLIRLGDTDVDYDPNFKFYLTTKMPNPHYLPEVCIKVTIINFTVT
FT                   IKGLEDQLLGDVVRKERPDLEEAKDRLVLSISNDKKQLKDLEDKILRLLKESEGNILDD
FT                   VDLIKTLETSKTTSTMINGRVKEAEQTEASINETREKYRPAAIRGSILYFVVADLALIG
FT                   PMYQYSLNFFMKLFNQCIDNSEPSERLRKRLKNLMSYTTYFVYVSVCRGLFEEHKLLFS
FT                   LLVCTSIMRVMTVQEKFDEANVGDAEESDEEDEDEEAKPEVAAPVESPAVIEAREWNVF
FT                   LRGTPLNYEAPAKTVEWLTDAVWRNVCYLETDLPDYLTGFTADMAAKSAEFEAWAESDS
FT                   PFQEPMPGGWDDKLTYFIKLAVVKVFKEDKAVASAQQYIGAELGKAFTEAPPWTLDDVF
FT                   PDTNSRVPIIFILSTGADPTAMLQRFATKMGWVPGERLHFCSLGQGQGPIAEEMVSKAQ
FT                   DNGDWVCLQNCHVASSWMLSLEAMVNNMSQDYNPVHDDFRLWLTSMPAAIFPVLVLQNG
FT                   IKLTNEPPKGVRANMKRTFNDIQEDVWEGCSKPQPYKKLVFALSTFHAIIQERRKFGPL
FT                   GWNIRYEFNASDIECSMLTLKMFLEEQDEIPWAALVYVTGQINYGGRVTDDLDRRCLMS
FT                   ILKKYYLPDILDDNYRFTPSGTYYAPPEGDLFSFRDYLEQLPLTEAPEVFGMHPNANIT
FT                   FQLQETRKMMDTILSIQPRATSAEGGKSPDEIVAALAAEIESNIAPPLDLDDACPGLFD
FT                   RTASGQLKSLSVVLGQEIERFNKLTRRVLSSLKELQKAIKGIVVMTGELEQMYTDFLNN
FT                   KVPGLWEKVAYPSLKPLGGWIVDYHRRIDFMRTWLTKGNPKSYWLSGFFFPQGFMTGVL
FT                   QEHARKYQQPIDALNFNFEVLEGKETAEDITEAPEDGVLIDGLYVDNARWNREMKYLDE
FT                   SDPGVMISNLPVVHFVPVMGYYPPPLLAPADPKEYQCPLYKTSVRAGILSTTGQSTNFV
FT                   ICVGLPIRPGTDSDFWVLQGVALLCATND"
FT   gene            complement(<78458..>79255)
FT                   /locus_tag="MICPUN_56611"
FT   mRNA            complement(<78458..>79255)
FT                   /locus_tag="MICPUN_56611"
FT                   /product="predicted protein"
FT   CDS_pept        complement(78458..79255)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56611"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0R5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R5"
FT                   /protein_id="ACO62048.1"
FT                   /translation="MMDNKVHISDGTTGRMPSAKSNKNHLFGHAIAEDLVRRYFSRSLD
FT                   KKDKVGLAAFGMHVLCHPPERRVLKLCYLCELMAVIAGLVMFFSSYLLRFDATSTFGIM
FT                   GAFFANVSLMCNLCGIINCLFMGFKISTGKGSVYEALDVLQGVGQTVNLIVFGVNGAGM
FT                   AYMFYSLDLTTDDYLRWANLGIFIPAFCYSYGFVIWYVLSYEPLSWWHQWSWNYELFKP
FT                   MYIIAWLRMGRVPMRERAAAQLEYLLADLPDDVMAILKADGNV"
FT   gene            79448..79981
FT                   /locus_tag="MICPUN_107856"
FT   mRNA            79448..79981
FT                   /locus_tag="MICPUN_107856"
FT                   /product="predicted protein"
FT   CDS_pept        79459..79935
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107856"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR007263"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R6"
FT                   /protein_id="ACO61603.1"
FT                   /translation="MNRRDEPGASTSSSSTLVALVDGDCALCSGYARLVSALDGKGAVY
FT                   FETQQSDAGRALLKRCGMPTDLSSIVVVEVSPKGKAVGYVRSTAVLRTFLALGAPWSAL
FT                   YLTVAIPEFIRDGVYGLVAKHRYSVFGTNGGRCALPDAVTRRRIGRVLPAGLLD"
FT   gene            complement(<80012..>80356)
FT                   /locus_tag="MICPUN_56613"
FT   mRNA            complement(<80012..>80356)
FT                   /locus_tag="MICPUN_56613"
FT                   /product="predicted protein"
FT   CDS_pept        complement(80012..80356)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56613"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R7"
FT                   /protein_id="ACO62049.1"
FT                   /translation="MSATPPMSHPTRPGLDDLPDPPAAPRKKKPTRSRVFPAPADDDDA
FT                   ATTPAASRRRLVFGDGGEFDSPEGGGGAGAAGGAGGTRTPASPPMTRGRASGGKEPKTP
FT                   PVSKIKSMPR"
FT   gene            <81190..>82810
FT                   /locus_tag="MICPUN_97107"
FT   mRNA            join(<81190..81219,81391..81435,81611..>82810)
FT                   /locus_tag="MICPUN_97107"
FT                   /product="predicted protein"
FT   CDS_pept        join(81190..81219,81391..81435,81611..82810)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97107"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4019; GTP binding - adenylosuccinate
FT                   synthase activity [PMID 5525]; GO_process: GO:6164 - purine
FT                   nucleotide biosynthetic process"
FT                   /db_xref="GOA:C1E0R8"
FT                   /db_xref="InterPro:IPR001114"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033128"
FT                   /db_xref="InterPro:IPR042109"
FT                   /db_xref="InterPro:IPR042110"
FT                   /db_xref="InterPro:IPR042111"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R8"
FT                   /protein_id="ACO61604.1"
FT                   /translation="MSAVALSSAAWGDEGKGKLVDILAQEYDIVARCQGGANAGHTIYD
FT                   DEGKKYALHLVPSGILNEKAKCVVGNGVVVHLPGMFNEIDTLEKAGVKIDASRLVISDR
FT                   AHMLFDLHKEIDGLREAELSGNKIGTTKRGIGPAYASKATRNGIRVGDIRNPETFAQKL
FT                   RTLAADAAARFEDFEYDVEAELVAYQKYAERITPFIADTVHMINEEHKAGKRVLVEGAN
FT                   ATMLDLDFGTYPFVTSSNPSLGGVCSGLGLAPNKFETVIGVAKAYTTRVGAGPYPTELF
FT                   GELADDLREKGYEYGTTTGRPRRIGWLDVVALNYASAINGFTHLNLTKLDVLSGLPELK
FT                   IATAYKLGDGTVTNAFPSSIEELEKVECVYETLPGWEEDISKMRDWDELPAKCKAYVEK
FT                   IEELTGVECRYLGVGPGRDAIVVKP"
FT   gene            <83178..>83663
FT                   /locus_tag="MICPUN_56615"
FT   mRNA            <83178..>83663
FT                   /locus_tag="MICPUN_56615"
FT                   /product="predicted protein"
FT   CDS_pept        83178..83663
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56615"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0R9"
FT                   /protein_id="ACO61605.1"
FT                   /translation="MGRCPTGGGKKTSKQKNRGYACKSVKRTKFQLPHADVIYKAVHQH
FT                   LKEQAEGGGAKRPGKAREISSYEAMIKGDPNQPFNEDLPGGGQFYCMFTGRHFESAEAL
FT                   ARHQKTKQFKRDKKRVLNGPKPHEQRDAEAAAGMGAPDNGRPLNRAPKQAPAAMAVE"
FT   gene            complement(<83764..>84849)
FT                   /locus_tag="MICPUN_99249"
FT   mRNA            complement(<83764..>84849)
FT                   /locus_tag="MICPUN_99249"
FT                   /product="predicted protein"
FT   CDS_pept        complement(83764..84849)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99249"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824 - catalytic activity"
FT                   /db_xref="GOA:C1E0S0"
FT                   /db_xref="InterPro:IPR000011"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S0"
FT                   /protein_id="ACO62050.1"
FT                   /translation="MAADPTAAGPGGLSEEQAAVYDRQLRVWGVEAQRRLGASRILVAG
FT                   LTGLAAEACKNVALAGVGALVLYDDGAPAVDAAPGNFLAASGLADAAGTADADALTVAN
FT                   ATAATLREMNPFGEISILPGPSDLSGIDAAAVKGCDAVLVTGCSLAVAERINDACRDAG
FT                   ASFFYGECRATVANFFADLGPNFRYAVERGRSNTAEKDGDAANNAGADAAVVSSFVPLR
FT                   EAVTCKWCTLGDGREGGVRRVNRLAPAWLLSKRFERSLKRPPSAQDVPTMLAEVPALEK
FT                   EHGVKPGWLGDARWAVEDVVAGASGVGDGGESPAVAAVVGGILAQEVLRSVTGKGEPVR
FT                   NSFFFGVRNGQGTVENMGCPT"
FT   gene            complement(<85104..>87209)
FT                   /locus_tag="MICPUN_56617"
FT   mRNA            complement(<85104..>87209)
FT                   /locus_tag="MICPUN_56617"
FT                   /product="set domain protein"
FT   CDS_pept        complement(85104..87209)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56617"
FT                   /product="set domain protein"
FT                   /note="Predicted SET domain containing protein. ChromDB ID:
FT                   SDG20129; GO_component: GO:5634 - nucleus"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S1"
FT                   /protein_id="ACO62051.1"
FT                   /translation="MGSSGEDGSKLELGKIVEVSGKGLGIVATRDAVAGEVVAREQGPM
FT                   AISLSRDQLGVRCCRCAGRAARPSATQICDEGCGAMWCSPECAVADTHLHADSGECSFL
FT                   LDIGPDPRVAMCQPCGPGDRRTGRRRRVESDWVTLADDVRLLLRARRVGILEGGAEERL
FT                   ASLDANAPAPDDDDESSLLAAASEGSDATLRRIASIAVDAHKRRDGGGGGGIIPEDAEA
FT                   NDANEARDDDHAELDSWLRAALIVFANSFDVEAWGARRGSEFPRPARVAGAVYRTLSRF
FT                   NHSCAPNCTWSFVHESESKPGGGAVSVNVRAIKPVKSGDELTISYVDPTVGRAERREQL
FT                   WAKYRFECACHLCVGPRDVNRQLPGTDPYLEAVFGTIDEKDARATVEETDGMIRDVRAA
FT                   IRSIRTDEDVKKLDLAVDALRGKLRCRTRPFEVDRGEMAKLIEGEEARPRWTHSRRPDH
FT                   VSKAEHERLQGDGFHPFHFTSMEAYGILGVASSIKAKWLMFREPGDKAGIAKLMKIALG
FT                   YSMLRASALDELARKEAGFGDAASRAWMEVSERAMSCGVLERVDDPVRGPYRHLDQTYL
FT                   MSNAFRKVIECDDGGEDGILHSAVMCLPTAPGSMGGPAWHGTSFNGVDVALEPPSGTFE
FT                   IASDVAMNLADYHSPGLWKHIVGAFNAHQEEVGAATVPVSEDNIEKEEAKPARMAVGEE
FT                   CADDAKG"
FT   gene            complement(<87378..>89518)
FT                   /locus_tag="MICPUN_99251"
FT   mRNA            complement(join(<87378..89289,89388..>89518))
FT                   /locus_tag="MICPUN_99251"
FT                   /product="oligopeptide transporter family"
FT   CDS_pept        complement(join(87378..89289,89388..89518))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99251"
FT                   /product="oligopeptide transporter family"
FT                   /note="oligopeptide transport"
FT                   /db_xref="GOA:C1E0S2"
FT                   /db_xref="InterPro:IPR004813"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S2"
FT                   /protein_id="ACO62052.1"
FT                   /translation="MTPTYEAVDPLSPRAVIAGMLVGFVVSAMNVSFGLKAGWGQGGSV
FT                   LAAAVSIGLFSAMKPKIPFTQLEANVCQTVASAAGSMTMAAGLIGPIPALHLLGMRYSV
FT                   WTMMTWGASVAFLGVFFAVPLRRHFLLESQLRFPSGTATAETIKSMFADARRAKSQVGT
FT                   LIHASVFAAGTVVLTWCFPWVLRPPLFATLGLASAARWGWGIRIDATLVGGGILMGTRV
FT                   GVSVLVGGVCAWGMVGPWAAARGWVTGDPLSMKGGARGLLLWPGVTMMAVDSLMQLALA
FT                   TVCRPRRRRKVAMGGDSSNKSGQEATKRRTKWTYDDVDADGSSEAPLLGGGGGDDDDEP
FT                   GLLKSPDVLPKSKPTLVGWAGIEDGNVHDESIVPAGDASPPADFKEDHPDAIPRSWWIV
FT                   GLAVTGVWTASVLHLNFGMALWQPVLALPVAAVMSYVAVRCTGETDINPIGPMGKIIQL
FT                   VFALVAPGAIVTNLMAAAVACGGAGQAGDLMHDFRAGLMMRLSPRKQLLAQLMGIPIGI
FT                   LGAVPTYALFAATYPIGGEQFPAPAAVAWRAVAEVLTGPEGGGLPAEAKALMLMAAAFT
FT                   AWVRTVERMAETRAETNPNSRAARWIKRLMISPTSAGIAFIIPPEFSTTIAVAAIGSGY
FT                   WERRNREHHEDHAYIAASGLLAGAGVMGVVTALVSMAFGTTAPET"
FT   gene            <89706..>91805
FT                   /locus_tag="MICPUN_52109"
FT   mRNA            <89706..>91805
FT                   /locus_tag="MICPUN_52109"
FT                   /product="predicted protein"
FT   CDS_pept        89706..91805
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52109"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3723 - RNA binding"
FT                   /db_xref="GOA:C1E0S3"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S3"
FT                   /protein_id="ACO61606.1"
FT                   /translation="MGPKKGGTKKAAQTAKTAKAAGKKPPGRPRKVKEPVQEEEPAEDA
FT                   PADDDQADDEKGSGRSEPADDATPMDDADPVEAKATDDDAPAAKEDPPAADGEADDKTK
FT                   AGGDEPHPTIGTVPDETVRSCLRIVVPSDKAGYVIGPRGKIVAHARKESGCGFHLQETS
FT                   KTHAARVAVVTCADKRSEPGSFQGVRGVEMVYLRSTEEMIPKDADLNDPPMGARPEQTQ
FT                   TQRVHIIVAASQMEKADVSELATGAGADCEKVVALEKGSKDCEALHAALGSIVFPTDRF
FT                   VEIVGTDAAVRAALTVLMMRLDYRANPPIASEDPLLLIDAPDVKEGYFREKKEKDRLQR
FT                   ARDSHGAGRDGRGRHHPYGGGGRGGGGGGNYDRGPPPRGSGGGGGGDEIRMTFGIDAQF
FT                   AGGVIGKMGSNVGQIRRESGARITVHESHGKFRVVAIEGTDRQCHDAKHLVQQAVTKQG
FT                   GGPVGAHRIEPSTGRGGRDGRGRDTAVHRDPVVRGGAAGGGSYYDQYDRRGRGDRGYDR
FT                   GGYDRGGYDRGGYDRGGYDRGGYDRGGGYGRDAYYDAQGPGSAYADRSSYPDRGGYGGG
FT                   GRDAPHYDERDTHRQWLGGDRDGGYNNYQGVQQSHQQQQGWAGQNQQWGGSNQQQSYNN
FT                   QQPSYHGQQQSYDQGGGYNNNQQGGGNDYYNRGQQQSGYGNQGGQYDQQGDYYSRGQQW
FT                   GGSRY"
FT   gene            complement(<91903..>96459)
FT                   /locus_tag="MICPUN_56620"
FT   mRNA            complement(<91903..>96459)
FT                   /locus_tag="MICPUN_56620"
FT                   /product="predicted protein"
FT   CDS_pept        complement(91903..96459)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56620"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S4"
FT                   /protein_id="ACO62053.1"
FT                   /translation="MPPPRGRGASPFGDPFTFGKPLVLNSQPPTFFGSSLAPPADASAS
FT                   DAPMGGGAVTRSRSARRKVGGYGVTAPAKHGPKDTFTRTTGTDAPSPITGDDRDRPARR
FT                   VAPRVVTKIPVLDDWEPAEDENEDPSVIPPHVDDVPASAAATKAARGRNPARTAETARG
FT                   PAPRRPPPVSSRTTRTTTTKRPASANLREEDERGRNDAAAVVIAARARAKARLAPPRVA
FT                   FGGRPPKKPSPVKRQRHDPDQPPPPDDQQTAADVDVVPRPKPGFSFGVRPNRGGPSLWG
FT                   PGKDSPGPAAYHEGPAPECDQVRGHVPAVTFGAPPDRTRRSGAGWNAGAFPELDPDAPG
FT                   PGEYAGGDDTARVLDKIAGKSRAPAFTFGGGKDDIGKVAAKDFAGAPGPGAYHIDEILA
FT                   VAAERRRIEKGFSFGERVGAAWHEAGPGRDAPAPGTYADGTEVRRSGGGFSFGNAPKTP
FT                   SFIPSSKDGPTPGPGDYLDRKKEKENGGGENDGGDGRTRKSAEGGFTFGWRRPDPAKSA
FT                   TEPGPGAYHRDAQLDDPEALRPGPAFSLGTKLERGGALDGKKDAAKMPGPGDYEVRKSA
FT                   EAGPSYTIFGRPNDGVVVGVDLNEKASLPGPGRYHTPLSPGGRAYTLGSRIEEKDAKRD
FT                   TPAPGEYGAPMPVGAQWGDRNRGFSVLGRDAWAGKGWGEEHAEVPGVGRYDVRGSNSKP
FT                   LPSAPAFTMAGKTKDPTHAPPPTRDIGPGEYDGDGGNRPPSGPSFTIGVRGSKDGAYGD
FT                   LESAAEKPGPGAYPNAPKAKDETRESAPSFTLGRKIDVPDERTKVGPTGFSERPGPGEY
FT                   HADGDVVPPEGPGGFTIYERTKSTEFRPGVDSPGPAYYGGFTTDDVEGGLRMSIHERYE
FT                   SGSVFQHTDRSDTPGPGEYAPEVFQFPVRDDGESTSFVGAPPGYTIGVRRESNYPVRRS
FT                   QIGAPGPGEYHPTEGDGVTDPAWSKGVTIGERRDERARRSLDSRPGPGHYHRTRESIER
FT                   ETGRKAPVPGPKIRDRKPWEREKVLEKKADVPGPSDYDTEPSMKKMDKRAPAHRIGERR
FT                   NDAADRRGSGEGAPGPGEYAGDVVRAPDWRRGATIIADRRERSRASAERRPGPGEYHRD
FT                   APRVAKTGVNIGRGAGKDAPGGVFDAAGRGGPGPGEFEPPPGAIRPGRSTGVNIARGTG
FT                   KDAPGGVFERAGRDVPGPGEHWPDGDAASGRGGRSGGKSVRAPGVKIPATGHDAPGGAA
FT                   VWPEDAPGPGEYHEERTKPVRSAVNIGKASGKDAPGGVFDAALKRGGGPGPGEFESGPG
FT                   ALRQKSTAVNMGKGTGREAPGGAMDRRDGPGPGEFWPDEDPAAPTRGHTQRGIPFGKPP
FT                   KPPRPGAKKSSAPGPGEYAGSVVGAPDARVGPTIPRGKRRGLVSKDARDTPAPGDFEPD
FT                   HHPKTVAGLVREALKRPGSMREPTVPRGGKKAGSERTPGPGEYYSGRGEIRVDRGVKMP
FT                   TREAWERDRDRVKGSGLGPKYHPNHEKVSKPLSVKQPMARADDYADSFRSTRGGSRR"
FT   gene            <97294..>97956
FT                   /locus_tag="MICPUN_99254"
FT   mRNA            <97294..>97956
FT                   /locus_tag="MICPUN_99254"
FT                   /product="predicted protein"
FT   CDS_pept        97294..97956
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99254"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0S5"
FT                   /db_xref="InterPro:IPR021788"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S5"
FT                   /protein_id="ACO61607.1"
FT                   /translation="MAEDPYKVLGVKEGTPGDELAKVINRKKLLYKTEPEKLKQMEDAY
FT                   EQIVQASLAARLRGDMSGVSESARKNDLAPSLFGPWAPIPSEAPLKDKKVNIAISVAAV
FT                   LFVWFTPGTIRTIQPIIYATIFHAFRMFMKLVDVDPGPSANIDRDAATKHNNKRFFRAF
FT                   ALVMGTFAVSLGITYWIPNMIFETFRLQVPVWYLLNQEVFVSVIVGGCLAYLTCFYR"
FT   gene            <98198..>99427
FT                   /locus_tag="MICPUN_56622"
FT   mRNA            <98198..>99427
FT                   /locus_tag="MICPUN_56622"
FT                   /product="predicted protein"
FT   CDS_pept        98198..99427
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56622"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5506; heme binding - iron ion
FT                   binding [PMID 20037]"
FT                   /db_xref="GOA:C1E0S6"
FT                   /db_xref="InterPro:IPR000971"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S6"
FT                   /protein_id="ACO61608.1"
FT                   /translation="MFSSLASSSVLSLATAPNVGGGRRLRPARGFARDTPFPIRGATLL
FT                   VPSDVSRLVLARASDVREGDYASEDSYDGDDDGAWEGMSSSRNRSATVIRTAGRDDMYL
FT                   EVDLPAHNMGITFTCGPDATIAMVEKVRQDSAAEQAGIEIGDILFSCSAVELTGSDTPV
FT                   VVGDSEGTDTHWRRIDNFRCLGQPFDVQMAAFNSTAIVDAGFKHRIVRAIFRRDVNPDG
FT                   RSRASRLDEMLGDEKAATDDPTEKDAETSVAKLVSESWKDIVSAVTIEGFGELLFKSLF
FT                   RHDWDLVRLFPFRDCESWEEVRAHPKFQSHAVNVAGAIDKAVSLLGNSSELVPVLRGLG
FT                   ERHHGYGVEEEHYDLLGSALLEALEEGTALSGVSPGGRGWTRELGDAWTETWATVAATM
FT                   KGDLYGTSPR"
FT   gene            complement(<99580..>102867)
FT                   /locus_tag="MICPUN_56623"
FT   mRNA            complement(<99580..>102867)
FT                   /locus_tag="MICPUN_56623"
FT                   /product="predicted protein"
FT   CDS_pept        complement(99580..102867)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56623"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0S7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S7"
FT                   /protein_id="ACO62054.1"
FT                   /translation="MPSRFPHGGEDAPLLAGDSRGRGGNAKKSDSGADRLLSRGVTALA
FT                   ALLLIGLCVMLGVHLMGSYHSADSDLSNKDRSWIETLDDGTKILHGADGKLSIVSGDAG
FT                   KKSSKHHKKKKGTDDILDLLHNENAKGSIEGEIDPNKDIASQQNDILLNKEKEMMDQLT
FT                   AMAKGKGGPDAKGSSKKPSVNPAEAAEKMLAGGNAPTTSTFDPRAALRHHEEALEHLST
FT                   KDKKANENLKLTDQEKSELEQLEELTRKPPPGPPAYVTPEEQLLHKAAMKAKKHDEKGA
FT                   EDWYNQLDDSVDVFEVRNQALIELEEASHKKDDKKGAEGVESTKASAKHAAKASAKAKA
FT                   TKPSAEPIASTELEPVASTEPEPVASTEPEPVADKEGEVAKTGEDELEADVELADTEPE
FT                   PEPEPEPVEPFGAHDSEAKNDDEDGPDPAEPIEPFGAHDSKVEAEPEADDDDEPVEPVE
FT                   PFGHDDEKDAEPVEEKPDAVEEEAEAAEKEEEPEPVAAKAEDPEPAANAEKEEEPEPVA
FT                   AKEEEPEPAAAAEKEEEPEPAAAADPTSAAPASDAGDKHPTPEQIKWWKDHHPNGAALG
FT                   HRTRNRRPVSRRPRHEAEAALGVAPSNPKASSVPASRWSGVDLAQHLSCSDSLADPATG
FT                   KTFDVATEFYMSDETTLGPNGEAIKLGPRARAVRDTTFVSAFLRVDGPGAPDPTRYLTG
FT                   VRHAACNAGRARLNSVFFADSPEMCAHVRRLYDNGRALSNELAPPVPRLGSGKFRCQVK
FT                   AVKNLPLKPATGLRPEAVIGGCANSANAFVWYNKVNFMVDAAEMCESDPDAEKTSQFAW
FT                   FDGDVAGPGALKALLAHPLDPAALVAGAKDEKVHFTCHPRAVREAQAVEPCRAGETMVM
FT                   PRVFSGTPQALRGFKRRWDAYMHRYVPLSTHTAAELGQWRMARGFFADYKNPPNAARGA
FT                   GLKPVEAAIAVNTRSGGWTCPCPSEEYVMNRLLNDEMFPEEKQFSGGKIAMLVTQEEKA
FT                   REEEKAQLTAKGGDAVAGMGGPRRPAAQAGVGTASSFSLRRGLGLLEDGLNAAALGAEA
FT                   IESDVPGKQFIDASPDGTDGSCARSEDGTPSGFAELPSMGLISWRFN"
FT   gene            <103342..>105057
FT                   /locus_tag="MICPUN_56624"
FT   mRNA            <103342..>105057
FT                   /locus_tag="MICPUN_56624"
FT                   /product="predicted protein"
FT   CDS_pept        103342..105057
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56624"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S8"
FT                   /protein_id="ACO61609.1"
FT                   /translation="MACAVLHPPSPVAEMFGRRPAEPSAGLPFSQATLDRLATAAADLR
FT                   RFLARVHFAHETVPGMMPGALYHPTEVFDLAKARYEHVWMPLLASENSASPRKLAAPLD
FT                   VQWMHHLHRLDPDAYRVDCERAFGRLVDPADPFLVAGDGAPSDDQAAESFARDAWNAIA
FT                   PEWPFDLEAALVDHRRRGGRLPPRGSSSAISFDSSSCDMIGSATRQGGFLWQVLPSETY
FT                   GDEDFIHRAARRYAMLVILWRDFPGEFLVPTYDQDLVWHAHLSVPSVYEKEMRTATYRN
FT                   AIGHDDSVNDRTPGAKLEVRGRRTMELWRTHYPVSTWDEPYARRGAMWRGDAPDWYWTC
FT                   QFPRPIPPSRAPGPVTEGSTFNQRIPAVELAPNVFYAPPSRIYDYTSRGNEKSGWICTF
FT                   EELVPPPFERAVDPGVQYVKVKVRYAGTTELVEGAWLRFQVPIGIFPPEFIADVDDASF
FT                   ITTCSFPVPHCEKYLHATFVTPVDIRHVIAQYQNRGCCVFCCGGGQQKNDYGLGPARQP
FT                   TTSSYGGGCGAACGSGGGGVGGACGGSYGGGGCGGGGCGGGGGGCGGGGGCGGG"
FT   gene            complement(<105911..>106626)
FT                   /locus_tag="MICPUN_80268"
FT   mRNA            complement(join(<105911..106190,106298..>106626))
FT                   /locus_tag="MICPUN_80268"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<105911..106190,106298..106626))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80268"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013170"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0S9"
FT                   /protein_id="ACO62055.1"
FT                   /translation="MSYNGIGLQTTRGSGTNGYVQTNKFHRSASRLQRTEWRDLKDIHG
FT                   AGPKSNKPNEEILAHQRKREIEVKLAQLEDDLEEKGVDAEEIAERLKEARVKFEREAER
FT                   KSGPGPADDTHAIARRKAEKMESLRRAFGITREHAEEREGEAFDQDLQAKIRDQKRADR
FT                   EEEMRQREERRVKEQRRREKERKRAEKERKEAEKVRKKEE"
FT   gene            complement(<107042..>107296)
FT                   /locus_tag="MICPUN_56626"
FT   mRNA            complement(<107042..>107296)
FT                   /locus_tag="MICPUN_56626"
FT                   /product="predicted protein"
FT   CDS_pept        complement(107042..107296)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56626"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0T0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T0"
FT                   /protein_id="ACO62056.1"
FT                   /translation="MSQFLRQLGALKVKEVPKFLQDKVTVANVTSHTQKFIAEYKTKYI
FT                   DAGSPMPIYHVMCGVFVTAYITVWPTEYRHMMAAKHGHH"
FT   gene            complement(107437..108679)
FT                   /locus_tag="MICPUN_107857"
FT   mRNA            complement(107437..108679)
FT                   /locus_tag="MICPUN_107857"
FT                   /product="predicted protein"
FT   CDS_pept        complement(107502..108644)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107857"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0T1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T1"
FT                   /protein_id="ACO62057.1"
FT                   /translation="MISATIATCRAAPATSVPRSRAAARAVPSAMRPAPTAISRSRVAA
FT                   RSAPAFREARRVRGAALLARASKGDRVSIGDMKKALVAAGVDTSSCFERADLEAKYALL
FT                   TDDQKAMKGGGSSGASAGSGSGASSSSTQQQEQQRASSSSSSSSSSSSSSSTSSSSSSS
FT                   SSSSETKKDSGSGFDPSKVFQSVLNTIRETANRVDVKWGVGAKLREQTKGFRDAIVNLD
FT                   EKLGATAFVKRVAPPAWAEVQKFRATPLGRIANSVFFIWLFFSGFFWTLVTLGITGVFL
FT                   TNLLFPNFFAERAQKMQAEAQARFREQQAAGMGGMGGNPYGGMGGMGGMGGMGGNPYGG
FT                   MGGMGGMGGGGGTGGGSSSAGRKSYGSGDVFDVDADVKDA"
FT   gene            <108818..>109318
FT                   /locus_tag="MICPUN_56628"
FT   mRNA            <108818..>109318
FT                   /locus_tag="MICPUN_56628"
FT                   /product="predicted protein"
FT   CDS_pept        108818..109318
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56628"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T2"
FT                   /protein_id="ACO61610.1"
FT                   /translation="MSRAFIVASTSSGLVAPGRAPRTRHSGPNPVALKPIGRSPAYAPS
FT                   LKKKEDDVGGSRNKPGIARLFGGGNSDMKAKVAQLEYELENERAHASELGGKLRAVEGE
FT                   LAKVKDSLDLYKGRCKEQEKEIFKLEKKNEETQRGFDTGMAVAKKQIKYLEELLEEEKR
FT                   KNQ"
FT   gene            complement(<109375..>109887)
FT                   /locus_tag="MICPUN_56629"
FT   mRNA            complement(<109375..>109887)
FT                   /locus_tag="MICPUN_56629"
FT                   /product="predicted protein"
FT   CDS_pept        complement(109375..109887)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56629"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T3"
FT                   /protein_id="ACO62058.1"
FT                   /translation="MEKTTIWRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAHV
FT                   GPCEHGVKYRSYCKVCSACSHGRRRSTCKECGGASICEHGRVRSQCKECGGSEICEHGR
FT                   RRSLCKECGGGSICEHGRQRSQCKECGGGSICEHGRRRSTCKECGGGSICEHGRRRFRC
FT                   KECGKEC"
FT   gene            <109990..110996
FT                   /locus_tag="MICPUN_79527"
FT   mRNA            <109990..>110217
FT                   /locus_tag="MICPUN_79527"
FT                   /product="predicted protein"
FT                   /note="Alternative splicing variant 1"
FT   CDS_pept        109990..110217
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79527"
FT                   /product="predicted protein"
FT                   /note="Alternative splicing variant 1; GO_function: GO:3677
FT                   - DNA binding; GO_process: GO:6289 - nucleotide-excision
FT                   repair"
FT                   /db_xref="GOA:C1E0T4"
FT                   /db_xref="InterPro:IPR009400"
FT                   /db_xref="InterPro:IPR035935"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T4"
FT                   /protein_id="ACO61611.1"
FT                   /translation="MVSAVHGSLIETDIPCKVYILHINEQLPPAERFVIQDLDETHLLV
FT                   QPHRLEYVKAEVKAWQQKNQFTPPTDLRQT"
FT   mRNA            109997..110996
FT                   /locus_tag="MICPUN_79527"
FT                   /product="predicted protein"
FT                   /note="Alternative splicing variant 2"
FT   CDS_pept        110227..110973
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79527"
FT                   /product="predicted protein"
FT                   /note="Alternative splicing variant 2"
FT                   /db_xref="GOA:C1E0T5"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T5"
FT                   /protein_id="ACO61612.1"
FT                   /translation="MGVATVTPVIAAPRPTHRPGGRKSRVVRANALEIADVVRVASDGG
FT                   VVLAGYVASDLVAQASETRSAERSAEECRVDVDCEIPPTPQGLDVIRLNRYAAFGWFDG
FT                   CISHVFIGWLDAASSGWTSNEAARCFDQVVVDMALFSPVWCALFLISMEAMMMDTRLPL
FT                   RAAVSARLKGEYSELLLGNLGFWIPANAVVFGLVAVDYRVAAFSAINFAYTVLLSIWAE
FT                   GDKDKPQEAADKEKVETKEIETVDQI"
FT   gene            complement(<111081..>112881)
FT                   /locus_tag="MICPUN_56631"
FT   mRNA            complement(join(<111081..111096,111131..>112881))
FT                   /locus_tag="MICPUN_56631"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(111081..111096,111131..112881))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56631"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="InterPro:IPR037695"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T6"
FT                   /protein_id="ACO62059.1"
FT                   /translation="MVAEDAPPAVETEESPAPAEGAPAADDPPPSPPVEAEETPAPNPD
FT                   DDAPAPSGDSRVDGGVVARGPRTESHHDAGAGAEDLVDCTFVVLPERFEHSATIPATEP
FT                   FASVKSMLASALPIPLDAVMTLRQPDGGEPLPDDACLADYGVGAADEVDLELVVAYRTE
FT                   REMRAEAEENARREAEDFARLEEQAAAAAAAEAAQLAEESRLANTDAPSSLPETLRVTV
FT                   RGARRGEPSRVVTVRIDASGCVKPRYLGGFRDRRDGTVYHHASNQTIPTKPRVWKTKFT
FT                   TETQTAQGRSRLAQTTAQASTQMARKDLVMDESRDVEVWTGKYMTYDEVMVIKARHTLT
FT                   LQKYFRGMRARRLANELRAIRDDAVRRAEEEEAARAAAEERRRRFEIERRIRPKTSEDF
FT                   ELLYDELEQWRVRETAKVEAEFPPETDARRLAMSQLLAKETELIRTIGRLRIAANNANR
FT                   ERRVERALEDMSQTKRWERKDGSLVEVDTPFTVRARELARLYDALRLETRRDVSTDERL
FT                   DVLVHVKWTVKEFDCGLTREIVELADREADLLNRGRDPAAMTGLRRRIANLFLQFVETP
FT                   EFNPESARRTTD"
FT   gene            <113184..>114520
FT                   /locus_tag="MICPUN_80273"
FT   mRNA            join(<113184..113276,113369..113572,113683..113746,
FT                   113880..>114520)
FT                   /locus_tag="MICPUN_80273"
FT                   /product="predicted protein"
FT   CDS_pept        join(113184..113276,113369..113572,113683..113746,
FT                   113880..114520)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80273"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824 - catalytic activity"
FT                   /db_xref="GOA:C1E0T7"
FT                   /db_xref="InterPro:IPR001045"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030374"
FT                   /db_xref="InterPro:IPR035246"
FT                   /db_xref="InterPro:IPR037163"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T7"
FT                   /protein_id="ACO61613.1"
FT                   /translation="MAHTSGIGADVFDKGNWYHEVLEDGLAISYRVEEVLHKGQSKFQT
FT                   VEVVKTKPFGRLLITDGLMQSSEDDEYVYHQSLVHPALAGHPEPKKVFIAGGGEGATLR
FT                   EVLKHPSVEECKMVDIDGEVVDMCAKHTPFYNAGAYESPRAKLVIGDAKAGLEAEPDGS
FT                   IDVIICDLSDPLDGGPCYQLYTTSFYEMCKSKLAPGGILVTQSGCAAVRDCKAVFTPIN
FT                   KTLREVFPQVWGYTVCVPSFCSEWGFNIATKDADHVDLYTGITANGELDKRLAARGLGA
FT                   LSYYDGITHTRMFSLNRTVREACERETRVMTVENPLFMCSTDTHAGVFEPEK"
FT   gene            <115061..>117271
FT                   /locus_tag="MICPUN_56633"
FT   mRNA            <115061..>117271
FT                   /locus_tag="MICPUN_56633"
FT                   /product="predicted protein"
FT   CDS_pept        115061..117271
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56633"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0T8"
FT                   /db_xref="InterPro:IPR001878"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T8"
FT                   /protein_id="ACO61614.1"
FT                   /translation="MADDEPPGDAVHTKGLWNRRRDLRCVRRHLGIGPDGDPDVEVRCA
FT                   RGDRVIAVGYRRVLLGDHGPYLELEREHVRWENLRLMPGGAARFYDEYRAIVDGESYDD
FT                   IAHSSIGTGGGGRGAKLYDQLKTVEGQGNPPRDSAWAVANNRPHEEGYAAYVVGKIYVG
FT                   AYDVAVRDPVVDADDVRRALPKPGGSGRVAWWKPARGVGAIVPDGVVGARNEGAGGGEE
FT                   EFATKEVSVTRDALAGGADTLAPGEGVWFDLESSGPSDRSVAVNVTGPGGEPVRQLCPG
FT                   AAAAAAEAARNGQKRSETARALRDGRRSAAALAAARARTVPWEARAEVERDAVAGAARR
FT                   IARILRDNCAAIAGLARIEGEGQRTLRACLRGWARWARKGSKSGEGDGSFGAGGVGRPS
FT                   TAPTLASPRRRDPPPGESPPPPRLNLTSAGRAKGLFAPVTRPPTPVASNPKTPRGPDEA
FT                   GDDPPAASVALPAWLTAVARGAVVCEVSHTRSSSAGDAAADAAGRVSKRCGFEARMPGL
FT                   EDSVRPVVVELTRDGVGALRTGAEGAEGADSGDRDPVAEAVARVDENLPVAEFGSSPLV
FT                   LVLPAGEEKASGSTVHPPRVPRLALRASKRVVGVVCVSSGPEQLVRDAVALAGACALGT
FT                   APFVPTEVFAAAGLDAAREWSRDDPRVASCVAVFERAGWGAARGMETGAGRDYCWRCGD
FT                   RSHRKRDCERVAGARPGENRPATTGGGGGRDVEAARVAELRL"
FT   gene            complement(<117377..>118370)
FT                   /locus_tag="MICPUN_56634"
FT   mRNA            complement(join(<117377..117391,117465..>118370))
FT                   /locus_tag="MICPUN_56634"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(117377..117391,117465..118370))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56634"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491 - oxidoreductase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0T9"
FT                   /protein_id="ACO62060.1"
FT                   /translation="MSSSLLRPSLLAIASRHAMSSPTKAALGRKHASPARRSFDVTVSA
FT                   AASQNVDKKYVPGEPIANACVVVTGANRGIGLEFCKQILAKSPGNSVIASCRDPNAADD
FT                   LVALQKEVGESRLAVVALDVADETSIASWAQGLGALEPVQAHGGSIDVVINNAGTTGTD
FT                   GYSKWELEDMTADEMMHVYKINTVGPLLVTQQLVKRGLIGDPGSLNPVSLVGNVTSKVG
FT                   SVDDNGSGKGYAYRASKAALNIVNKSMSIDLADRGIWCQLLHPGWVRTRMTEGRGLIDA
FT                   DESARGLIRCVMFRETRLFPLGYGG"
FT   gene            <118548..>122960
FT                   /locus_tag="MICPUN_56635"
FT   mRNA            <118548..>122960
FT                   /locus_tag="MICPUN_56635"
FT                   /product="predicted protein"
FT   CDS_pept        118548..122960
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56635"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="GOA:C1E0U0"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U0"
FT                   /protein_id="ACO61615.1"
FT                   /translation="MEASEELDHAGTAPGATGAKETAAGGGDSPMNENVGPGAMGTSTA
FT                   QTEAAAPGSGGKSAGTPDLPQSEPRSLTADDDDDERSGAAGVTADARDDDAGAELPPSR
FT                   SPDDAPVAPTTTTPAGPSSGDPARSLADVLGKRPTPASDPKSSASAKPPAKKAARAKPS
FT                   TGPGITSFFGGGGKGGSGSDEDAPSRMPTRAEKLAADEAEEAAAIAAALAASEADEEDR
FT                   RAKAAAAAAATEAPTAVPVATEAPTAVPAEGAAAATASPVQDHEPDPTAAVVSASEAKK
FT                   THPLLVAAQRKKEKAAAEARAKAEAEARAKAEAEAKAKAEAEARAKAEAEARAKAEAEA
FT                   KAKAEAEAAAVAKAEADARAKAEEEERRRAAEDAALLADGSCEICGVDDDDGLLCDGCD
FT                   GVFHAKCVDLDSTPANEWFCARCAEHGVTNAGGGVAQRRAAKRKKANDEKRRANPFFMT
FT                   PDERRVAAEREAKQALMRDLEAVKQTDAALSTGKKVHHFFAMQKEKAAAAKESGASAAS
FT                   LNPLGLYVLPAPIERAMPPVHITPPIDPTVAEDEAVGRNALASVAGPPRKITRDGRFNP
FT                   SPDATLDSIRRALSPPAAVDTEEEQEEEDPGGEEGVDLEEAEDAYLTDAARYVLASEGR
FT                   WNAGAIVSGELASARGELRARLASLRARGAARAAGRDGSSSTDGSRLDRSTPSIGPAAA
FT                   AGALWTDAYAPAATDQLVCDGGAARGVRDWLDAWSSRIFAEEAGVVVKPPKDKEKAGNG
FT                   GRKGKRRKKGRGNAAASDDDTSDEECDEWDDESSGSLGTYAPLVTKRGGLPANGLLLCG
FT                   PVGSGKTSAVYAAAEEFGFKVLEVNPSRKRSGLEVLSQFGEATQSRRIGGGGDEQKKQG
FT                   AGGIGGFFGKKPAPAATTTSAPAKDTAKKDTAKETARNTLILFEEVDVLRGEDRGFMAA
FT                   LAQLIAGAKRPIVLTSNSPSLPSLIDAPLPAGTSGDGLRLARVRFRSPSPADAAVYASL
FT                   VAAAEGKRVSPGEVASAARLADAGDVRRALLSAQFAASSPAAEMTRRPTRGTTKSRSTA
FT                   AVAALEYDTNAVAAVAAELIARVDPRVAAAEALAPARALYAMSLVAEASQIEERETERR
FT                   AEEAAVRRRAEVVAAAAAAKAERAARNDARIEKGPLGSVGGRGGDRRGSLGLVAAGRSA
FT                   ANGDDEDGEEAERAAKVAAAADAARDAYLAEAAARFAERAPGGESPGGDSPETPPDAYP
FT                   GDDWARALRELDSLASLSASLSAADAMLNPARATVTGPSNGAAERVDVGGWLGGAGAAW
FT                   GDGGDGGWFDPSDDAEERGGADLAGEPRHTIGGGGDVAREASARIERLAVDACLGDRLV
FT                   DCRPPPRGGVGGGPPPAATGPASSVPKPAVSYGRVPAMGAAAARLRELAECTGATCARG
FT                   YGCGLGATGEANERAFFLARIVRIQEESASGVGAEGGRRRRKKASQYLQVGADVARELA
FT                   ALGTFGVTA"
FT   gene            complement(<123029..>123388)
FT                   /locus_tag="MICPUN_56636"
FT   mRNA            complement(<123029..>123388)
FT                   /locus_tag="MICPUN_56636"
FT                   /product="predicted protein"
FT   CDS_pept        complement(123029..123388)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56636"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U1"
FT                   /protein_id="ACO62061.1"
FT                   /translation="MSTTVTVIRKRPHCSATSVHEQEAIKLMPPPPPLLVPVMESEWER
FT                   KRRQSDIRRAENAFMEQQLRRERAEVERIACERTRIAMDNCERSELHAFLEELRVSGRV
FT                   SADEIVKRLACRVPA"
FT   gene            123838..125408
FT                   /locus_tag="MICPUN_56637"
FT   mRNA            123838..125408
FT                   /locus_tag="MICPUN_56637"
FT                   /product="predicted protein"
FT   CDS_pept        123994..125280
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56637"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U2"
FT                   /protein_id="ACO61616.1"
FT                   /translation="MVAIEEGLTRINSAPYEALLPRPDSPPLRKADPNKATVAKWSETA
FT                   DIFEYGAAANPDMAPIPVLVHPPSLHEEGETRIIPFDINDCLDIETACTSPNLMASFVR
FT                   VRVGESIETKANATSQAFYVIRGTGSTSSEHGTVSWGDGDLFVVPVTEGALKHTCVEAE
FT                   KGGAALYWIHDEPLMDYLGVKPNGKKFEPTFFSREKMLAQVQEISHQQTEGERNRLGVL
FT                   LGNKACDQTKTLTHVLWSLLNSIPAKTVQRPHRHNSVALDLAVAASPNVYTLMGKEIDA
FT                   NGDIIDPIRCDWTPGGVFITPPGWWHSHHNESDEVAWVLPMQDAGLYTHQRTLDIRFVD
FT                   DELELHKAGKIRGSAFAVTNKQYMHMVECGATVPHTRVAGMKRVWSLQEVEEEDPSSSG
FT                   DAAAPKKKTVKKVASYSRLPAMKASSVEP"
FT   gene            complement(<125420..>127501)
FT                   /locus_tag="MICPUN_56638"
FT   mRNA            complement(join(<125420..127298,127443..>127501))
FT                   /locus_tag="MICPUN_56638"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(125420..127298,127443..127501))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56638"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="GOA:C1E0U3"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR027734"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U3"
FT                   /protein_id="ACO62062.1"
FT                   /translation="MAAWEMTKEALRKVCRDNNGYAHAPELNDVLHLHCKGIAEITNLE
FT                   EYTGLKTLYLESNSVDDLEGLLHLDRLRCLYIAKNCLRDLDRAARLVALTTLDVSDNQI
FT                   VTLEGLRDHPSLSTLVAVNNKLREVSAIEALGSCVQLVTVDLSRNKLEDRAVVDFFLSP
FT                   AMSDRIRLLKLQGNPAVSEVPSYRKTLVSGMKRLNYLDDSPVFPKDKRLAAAWLRGGVE
FT                   EEKAERARIFEDERRERERHRAAFDDMVANARREAEEKERAGIRTKRDPYRFMSEEAAE
FT                   EARMLADGMTEWELEEMRANEQLPWQVRERERTLSEKTEADRAPNRAERPDEDDEDDEE
FT                   EGDGVAEVGPPEHVADDDGDERIPVAIPIDDDRPTPGIFVAQVDDDDDPAAPASAPPPP
FT                   PAPTSTTMTDEDREASEASAAEELRRELEKMRAARRGDRHEVVDGATRRRKELERAADS
FT                   ANRSGGRGSGSQRSPVVFGTRAYDQLWAQAKAMGDADGDNGEEVREDDEDSLDKESFKE
FT                   SFKDEDGVQNELDADGANSVNSESVDGTSNYSYGDKENRWERASMASVGATVASTEAGE
FT                   LDGIDEFDETEDETENTEDTEDTDEVNSTDGDDPLDRYTVSTVASGKETGKETGDDGRA
FT                   ANDDELWGLD"
FT   gene            <127700..>129784
FT                   /locus_tag="MICPUN_56639"
FT   mRNA            join(<127700..127770,127874..128172,128322..>129784)
FT                   /locus_tag="MICPUN_56639"
FT                   /product="anion exchanger family"
FT   CDS_pept        join(127700..127770,127874..128172,128322..129784)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56639"
FT                   /product="anion exchanger family"
FT                   /note="chloride:bicarbonate anion exchange; GO_component:
FT                   GO:16021 - integral to membrane; GO_function: GO:15380 -
FT                   anion exchanger activity; GO_process: GO:6820 - anion
FT                   transport"
FT                   /db_xref="GOA:C1E0U4"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U4"
FT                   /protein_id="ACO61617.1"
FT                   /translation="MAPLNETPEDGDGTRELLTDPLPEPLAWSGEFAGGLIADVKRRAP
FT                   HYVSDWTDAFLPANRGRCLSSVAFLFFACLAPAIAFGALFAEYTGNELGATEMILSSAI
FT                   SGVAYAFLSGQPLCVLGATGPELAYTVVFYNMCQKFNVEFLPARVWQGLWTALFTCMLS
FT                   AFDASALMNRVTRFTEEIFAALISVIFIIEALTSVVKLYTEHPGDDNDGTSRMASAFLG
FT                   TMLCFGTYGTAMALRSVKRGGKMFNRSVRDAMGDYGVTIAILAFTGVAIAFKRYGDTSV
FT                   PTLAIPSEFAPTWINPKTGEPRAWLVSPLGINEDFPPWAIFGTIVPALGLTFLGYMDQN
FT                   LTSILINRKDHALRKPPAYHLDLLVCGAVVYPVCAMLGLPFTHAATVRSMTHLVSLTEY
FT                   KAVPVDVTTGGKSIEESKGFVAARRARSLSMCGEPSVAAAKKTAKEGFEDASGDNSGSV
FT                   EMKTVAVGVCEQRVTQLLIHALIACSLAISPVLRVVPKSVLSGVFLYMGVTSTAGNQLF
FT                   DRLHLLLFVWCEENRPRGLPFMRPSRCGAEFLPVRRVHAFTCVQVALMGGLYAMTKVGA
FT                   VAVAFPFFIGALVFVREWALPSMFTSDELDALDA"
FT   gene            complement(<129992..>130489)
FT                   /locus_tag="MICPUN_56640"
FT   mRNA            complement(<129992..>130489)
FT                   /locus_tag="MICPUN_56640"
FT                   /product="predicted protein"
FT   CDS_pept        complement(129992..130489)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56640"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1E0U5"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U5"
FT                   /protein_id="ACO62063.1"
FT                   /translation="MKLLDALSGRVTRSARFREYVDQSFAEVDHNANGSLDRAELHLAV
FT                   MLFFDKLNAKVKKRAIPPTKAELMALFDEVDTDESGELSLEEFVAYMERLCAQCTSGLT
FT                   VSLLKSFIAVPFTAIALSVGIKKVAPGMHQKIKEAKGLGSATLSFCASQIVNKVPAFAA
FT                   VP"
FT   gene            complement(<130670..>132871)
FT                   /locus_tag="MICPUN_56641"
FT   mRNA            complement(<130670..>132871)
FT                   /locus_tag="MICPUN_56641"
FT                   /product="predicted protein"
FT   CDS_pept        complement(130670..132871)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56641"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E0U6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000938"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR036859"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U6"
FT                   /protein_id="ACO62064.1"
FT                   /translation="MAAPDAPDESTSRMGPYDVLEQIGKGAFGAAWIIQTRGNDSNPPR
FT                   RFVLKKIPLARLSERQRHLSLQERQLVAALRHPYIVPYHRSWIERSHTVCIVMRHCDGG
FT                   DLASAAWRARRRRERFPEQTLRRWLAQLLSALAYLHSERVIHRDVKCGNVFLASPPGFE
FT                   PGTSHAPTNSTNSWGDVMLGDFGLARVVDANAADDVQATSTVGTPHFMSPEMLRGAKYG
FT                   FAADVWSLGCVMYELTTLRQPFTAFNMEGLRRKILTSPPAAFIQPGKEGEEDASLYGDG
FT                   WRATIRSMLRKAPEERPSASELLRTSDMADAAADADARAREIEAAAAAERREEGRGEEG
FT                   GEDGRGDGAGDAAFLAAPDREPMPAPGGDWSPSADERSQPPGRSSVRRGWADLDPSYMR
FT                   FNPQRKPRPPPRPQSARPARASTGAPRNPDTETGQKQRAAATPATQKTAQKTAGRRPGW
FT                   NASPRVRPASGGPLGRPASAPRTPSSGDRAAARRASGVVVTGRAVTGRAVTGRAASGGG
FT                   ADGSDGFDPYAPVAAEPASALAPKHPADENEAPNNTDETPSKSRDEAPSWTRDEAPSRD
FT                   DVVARARRLLAETSPKLAAPSPIARHDGTDDDADDSRVLRAVAALHARGRHAELARVLS
FT                   NFYPPAEAIPPTPSAPDLEPGQCVMVGASSPTRGTIRYVGAVAFAEGEWVGVEMDDEGV
FT                   GAVTGRAVTGRDGRVGAIQYFACRPGRGVFVPAATLTRA"
FT   gene            complement(<133147..>134469)
FT                   /locus_tag="MICPUN_56642"
FT   mRNA            complement(<133147..>134469)
FT                   /locus_tag="MICPUN_56642"
FT                   /product="predicted protein"
FT   CDS_pept        complement(133147..134469)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56642"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U7"
FT                   /protein_id="ACO62065.1"
FT                   /translation="MRGSASRTVAWAALARSATIDPARIIASAARASAPAHRREDASRS
FT                   RGRWIERRRRHEHPRFSTVGEAFLVAAHAEVLRRAGAEVPANLAQLLAVVTAEGASPLP
FT                   PDARDGLHPLVLPIAKAWRGDRDDDRVVGLLLRPSPSSPRAPLAGPLPVVLAGPGGVRM
FT                   LAKDAASYVHAAIIREDASPASATTTPEPYPVAGAAGAAGRAMYTRGELAASSMPDRPE
FT                   VFILRNVGKFPDDMEAMALRHLRGVEKEGASPSQSAVTSALVTAEWYANDRAFEGWAGP
FT                   QAFNARMLFAMGRADEARDAARVALSTAACWDTVGTERGGAAEMAALAGLDARMGAREL
FT                   REMLETGGEAHKAAAAAMAGRIPENVGASGGPRGEGGMSEETSRGYATRAAAAALDAVA
FT                   LGSEADVARGAGESWENAREEVGSAYGEAGLAGLAAFVLRR"
FT   gene            <134554..>135915
FT                   /locus_tag="MICPUN_56643"
FT   mRNA            <134554..>135915
FT                   /locus_tag="MICPUN_56643"
FT                   /product="predicted protein"
FT   CDS_pept        134554..135915
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56643"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0U8"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="InterPro:IPR038753"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U8"
FT                   /protein_id="ACO61618.1"
FT                   /translation="MPSSSPSSSSSSGGTSAKRRRAKYERKFLRAAARGSLRGCKKALK
FT                   RASSRGSGVDAGFLDVTSASDPDGRTALHLACASGDDDLARWLIKRGADVTSTDARGDT
FT                   PAHLAAHRAPDNVAITRRLTRAGASTHARNDAGETPSSIAERAAESRAARMREFDARRE
FT                   ARTRRGRDADDYEGLGRGPSREAIEEMEWREKLRAEAALGDAIDEFGGGTAGIGTADEM
FT                   NAFYASYVDDWDDGSAYAWREEEEAYAEYMRAGMAARRRKRLDDDNDDDDPRRRRRDSA
FT                   AEAQARATRERDEAAQRVLDEERRKDAEWRERTARRATQQASSSVSSSVFTDFATYRRR
FT                   WGIAAAKADRGESIAYADVPWPFDPESRRGEPDERVVRDVLLGPTGAGAVEEGSGSDAA
FT                   RRALRSEMLRWHPDKFFASKVGSRVASEDVERTRLGVNAVAGVIASLFRRSAGS"
FT   gene            complement(<136036..>136548)
FT                   /locus_tag="MICPUN_56644"
FT   mRNA            complement(<136036..>136548)
FT                   /locus_tag="MICPUN_56644"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(136036..136548)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56644"
FT                   /product="hypothetical protein"
FT                   /note="CUP C11; putative uncharacterized protein"
FT                   /db_xref="GOA:C1E0U9"
FT                   /db_xref="InterPro:IPR025354"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0U9"
FT                   /protein_id="ACO62066.1"
FT                   /translation="MAPPRIPGGRGGGRGRGKGGYKGRMGKNFRKNPDGSDKPKGKARR
FT                   SGLGLWGIGLVTGAIAGLVALVAHGERAALERESEAVRRRLRRKPRGFSEHAVCRMDCR
FT                   FIGEDEATATLARGKLSKRHSTPGATPCPRWALEDGRVRAVWAECRDETKLVTVIDTVT
FT                   DHPCGPC"
FT   gene            <136695..>137873
FT                   /locus_tag="MICPUN_56645"
FT   mRNA            <136695..>137873
FT                   /locus_tag="MICPUN_56645"
FT                   /product="hypothetical protein"
FT   CDS_pept        136695..137873
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56645"
FT                   /product="hypothetical protein"
FT                   /note="cupC11, conserved uncharacterized protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V0"
FT                   /protein_id="ACO61619.1"
FT                   /translation="MARGTLRTTPRRANRPVGDEEAATRKMGAMGTGGVSVNARLNLEA
FT                   VERTLAALSGGKENDALGLDTVLVKGLHDMAIDEAIARAGRKASARAGKGIVHNRKGPT
FT                   VSVPDAVKTPAAVRAIVAKALAGKVLSRREQDRLRDELERREGAVPGKPPASSPFTPPP
FT                   PPVNTPVGLARRYPAMTCGDTNESADADASPPFAMTPTLLAEAARLAMRNVGTGKGPSN
FT                   PLGRALAAGERGEPLTSTQRNILDAVEELRAGKIIPDDRMRLLEWAQTDDDDVAVAKGS
FT                   RPMTSPSTVASLCAATFGILPLTPPSDADEDAASSYASDEVFSFDQGKIAGENRVEETS
FT                   PEPWISPVEFNRGKSMTPTLEELARRKEGGEALTEGEDAMVSIFKLASPVAR"
FT   gene            <138883..>142961
FT                   /locus_tag="MICPUN_56647"
FT   mRNA            join(<138883..140250,140386..140703,141030..>142961)
FT                   /locus_tag="MICPUN_56647"
FT                   /product="predicted protein"
FT   CDS_pept        join(138883..140250,140386..140703,141030..142961)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56647"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_process:
FT                   GO:6886 - intracellular protein transport"
FT                   /db_xref="GOA:C1E0V1"
FT                   /db_xref="InterPro:IPR002014"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR004152"
FT                   /db_xref="InterPro:IPR008942"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR038425"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V1"
FT                   /protein_id="ACO61620.1"
FT                   /translation="MNAALSGAALGARLPAIRASKTFGRREGSVSPIQTRISALETAHH
FT                   GRVTESTPPPPPHVEKTVRVGVARVPSDIYAANKVAPDIAAVSRLGAGEISDPRLLLRR
FT                   ALPFVLPDSHPLARVEDSLMEHAGEVKTRGMGSRSISNEALVENLEAQAAPGRGQRASL
FT                   AARRAVATIRSERDALVSFAVAAGNGAVADDIVAELDDVLQSIVDRSEATTTAETTERQ
FT                   SEKKLELDFERALLLVARLQACGADAPAFPVPPRDSPVPGAPPGVVIPRDAMPLNRRAW
FT                   VDLTVRKAKTGEKIVVRVAVDGFNAPYAAGRFMQLAETNGFKRIDRADGFIVAFGEDVG
FT                   TPRHPSASTPLPLEVKLADDGKSEPPLYGVSVDDAGARNARVELPFNAYGTLAMSHSAD
FT                   DVNDGATQFFFLTKESEVTPSGTNVLDGRWSVVGYAVDGAEGLADLNAGDVIESVRETK
FT                   RKKTVDGGLSVPDLALRISRGGFFQVPSIKSRCLGEEARRGTSHGRPERDAPCLSAGTT
FT                   ATGASRRRVARCRARGGWSPACFARISPATPPTSSSRRCAIRTLTATSDVLREPDWGVN
FT                   VDMCDLVNSNFHRYGKDTVKALRLKLQKKTKPQTQYLALVALEMCMKNCGVMFHAKVIE
FT                   KACLDETTKCGAQRGGDARVKQKALALVQEWALQLQLPQYRAAFDELRRKGERFPPTEL
FT                   TSAEVTPMYTPRPNRVDIVEQRLAQMDPADAAAVRAAVAEAEAEVEAEERRMGTRSPRV
FT                   SNGFATSPGGGSTPVGSPPGTRGFRVGSPPGSSARPAAPPRGYEALDEDEPFHGTAERN
FT                   GTAERTYSDGNPYGTAGGGHTSNPTPRSHHAHYPVSHRPELQPPAADASALGDVTSPDA
FT                   VKKLHEDLDVASNTVKVLRDMLGEVDVVTSPEALNDPTIDELSEQCAQMRPRVVSLVQS
FT                   VADESLLMKALSLNDELSEVAQKRDALRAAASADRDTRAAIVASMREEEAAAQRHASAG
FT                   DASGGAPVGNLVDLLGGVSVDPGTDARPGKDKAAPGRAAAAGRAAAADPFGLAAADAPV
FT                   DPFDVSVTVGDGGNVRGRPGASNPLDELLAPPPPPPQVYDPFAASAGVDPASTPPAGGS
FT                   HQPANYYPTVAGTARGGGAVSDPFASANPFASRPPGASPMGAMSVNPLFQAQQQPQQPA
FT                   SSGGMGSLPPAIGASQAPYDPFAASPPPQQRGGSNPFAR"
FT   gene            complement(142992..>144416)
FT                   /locus_tag="MICPUN_56648"
FT   mRNA            complement(142992..>144416)
FT                   /locus_tag="MICPUN_56648"
FT                   /product="predicted protein"
FT   CDS_pept        complement(143046..144416)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56648"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E0V2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V2"
FT                   /protein_id="ACO62067.1"
FT                   /translation="MDFDITTARPAGPRPAAPVAAPQQPGGTQAGSAHHHPPGAGGAST
FT                   SPPVAPDDVPASIFITGVSPAVNDGTLREFLECCGPLRSLAQFGDVPLPGQPRQYVATY
FT                   ADVAAAQSSLVLNNMTLVDRPITVVAAERAVGPGGVLDLSKGGSSAVPSGADLLNPLAS
FT                   MEQAVMTGLVEDPLKLWRQAAEKLPSWFPAGYKRCALFVPIPHLINGAMAAAEARIEFE
FT                   KEVRDTAGGHVDDSDVSRTVYAGNVNSSITEDMLADFFSIAGNVTYVKFAGSEFNPSRF
FT                   GFVEFDTKAAAESAKALTGTQVAEMTIKVKHSNNPIVKDRMRNFWGTCRTERRRRMRRE
FT                   RKRFKEKERERLRGGESSSSESESESSSSSSEERRRRRRRRREREERDEKREKKSRDKD
FT                   ADEGGDEKERKSSREKKEDAREKKSDEEEDEKKLREEARRSRKSRRKSEGEGKEDAA"
FT   gene            <144592..>145497
FT                   /locus_tag="MICPUN_56649"
FT   mRNA            <144592..>145497
FT                   /locus_tag="MICPUN_56649"
FT                   /product="predicted protein"
FT   CDS_pept        144592..145497
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56649"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V3"
FT                   /protein_id="ACO61621.1"
FT                   /translation="MTTGRRPNVRIDIEDVVADAEVADEVNDASLTKKGTKRKRAPPTK
FT                   GPCEHGLKYRSRCKVCSACPHGKWRKRCKECGGSQICEHSRQRSKCKECGGASICEHSR
FT                   QRSTCKKCGGSQICVHGRRRSTCKECGGSAICEHGRQRSTCKECGGSAICEHGRIRFSC
FT                   KECGGGSICEHGRRHSRCKDCGGASICVHGRVRYQCKECGGSAICEHGRIRFSCKECGG
FT                   SAICEHGRVRYQCKECGGSGICQHGRQRSTCKECGGSQVCEHGRRRSECKKCGGSSICE
FT                   HGRQLHRCKECGADEGTRRR"
FT   gene            complement(<145548..>146496)
FT                   /locus_tag="MICPUN_80139"
FT   mRNA            complement(join(<145548..146066,146230..>146496))
FT                   /locus_tag="MICPUN_80139"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(145548..146066,146230..146496))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80139"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:16780 - phosphotransferase activity, for other
FT                   substituted phosphate groups; GO_process: GO:8654 -
FT                   phospholipid biosynthetic process"
FT                   /db_xref="GOA:C1E0V4"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR014387"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V4"
FT                   /protein_id="ACO62068.1"
FT                   /translation="MPPRRTRSGDASSGSTTRFFQRHSNVYAYVPNIIGYVRVLLAAAA
FT                   LRLAFTDVPTSLALYALSFVCDELDGRFARMFDQCSEFGKLLDMVTDRLATTGLLMVLS
FT                   REYPDWFFTCVSLVALDVGSHWLQMYAQLLRNKSSHKDVDPSSFFILKLYYTNRIFMGA
FT                   CCVGAEVLYLAAHAATDPRIAAIAGPLRIGATPAKVSVPLPAALGWGTELGVECASALG
FT                   QLALVALPFWAVKQAANVAQLVTSCEALVAHDFPKRKRT"
FT   gene            <146804..>149577
FT                   /gene="APC3"
FT                   /locus_tag="MICPUN_56651"
FT   mRNA            join(<146804..146953,147103..>149577)
FT                   /gene="APC3"
FT                   /locus_tag="MICPUN_56651"
FT                   /product="anaphase promoting complex 3"
FT   CDS_pept        join(146804..146953,147103..149577)
FT                   /codon_start=1
FT                   /gene="APC3"
FT                   /locus_tag="MICPUN_56651"
FT                   /product="anaphase promoting complex 3"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V5"
FT                   /protein_id="ACO61622.1"
FT                   /translation="MTVIVPEQTPAGEAHLEPFLVELVHESLNSYAYSNAAFLCERLHA
FT                   AAPTEANAHLLATCYYRADQANRAYHTLKGRTSPKCRYLFALCCVKLRRLPEAEAALCR
FT                   SPLPAGGRPPATDSSAAERPAANARATSDVPNGAHGLYLLGRVCKETGRDKAAAAHFAD
FT                   ALALDPFMWCAYEELCALGAEAEAEAATEAALRSADRYPKLADLGKFGASFGGAAESMS
FT                   FGTYGGETTSAATNSEGTSGLSGGGGGGTHSGASSNPNHALGGVLGTVAEGTPTVEKSL
FT                   GFAKPPHSGLPSASGPPVPMSTGGESAYYGAYGDEKTPAPDSTRGLMPPPPPSTATAAG
FT                   VPADDLVTPAPIGGEADHGKPPGPPGGPGGGGGGGGGGGGRGDGGRRKFVDEGKLRKVS
FT                   GQLFQESANAGSGAVRRSSRLAAQTGGGGGAGLDFSTPAMEAGSAEGAEGADPTTSPPH
FT                   HRARGRGGRSTHNPRGSLDGGSRPPLPLPPTSSSGHGGMNAGMNAGYGSNGAGRAGYAS
FT                   NGTALHAGHGGYVGCGRFAEGAAATAALLRPLADGLRTFSMFRCEDALAHLRELPRSQY
FT                   VTGYVLCLVGRAYAEMVNYPEAQRAFEWARTVCPHGLDGMEVYSTVLWHLKKEVELSYL
FT                   AQECVQLDRLAPQTWCVLGNCFSLQKEHETALRFFQRALQLDPRCTYAHTLCGHEFFAN
FT                   EDFEKAMGCYRNALRLDGRHYNAWYGLGTVYYRQEKYELSEYHFRHALSINSRSSVLFC
FT                   YLGMAQHALRRNADALTLLQHAIDLDKRNPLAKYEKASVLLSEDRLEDALEELERLKEV
FT                   APREASVFFLIGRIHKKLGAADAAMVAFSTALDLKPASADVNLIKSAIEKLHVPDDSEE
FT                   EDL"
FT   gene            complement(149649..150884)
FT                   /locus_tag="MICPUN_107861"
FT   mRNA            complement(join(149649..150212,150369..150450,
FT                   150555..150884))
FT                   /locus_tag="MICPUN_107861"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(149716..150212,150369..150450,
FT                   150555..150851))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107861"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5839 - proteasome core complex;
FT                   GO_function: GO:4298 - threonine endopeptidase activity;
FT                   GO_process: GO:6511 - ubiquitin-dependent protein catabolic
FT                   process"
FT                   /db_xref="GOA:C1E0V6"
FT                   /db_xref="InterPro:IPR000426"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR034642"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V6"
FT                   /protein_id="ACO62069.1"
FT                   /translation="MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPII
FT                   PSLFTPARIARLTGDPVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLD
FT                   PTDITHMFKITKTIGLCATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADW
FT                   FQVYTQHAYMRPMAAMCMFVGIDEERGPSLYKNDPAGYFVGYKATSAGAKEQEAINFLE
FT                   KKVKGKDAGNTFTEQETVRTAIACLQTVLGEDLKARELEVGIVTVDDPNFRLLSETAIE
FT                   DHLTAISERD"
FT   gene            <151072..151674
FT                   /locus_tag="MICPUN_56653"
FT   mRNA            <151072..151674
FT                   /locus_tag="MICPUN_56653"
FT                   /product="predicted protein"
FT   CDS_pept        151072..151671
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56653"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8270 - zinc ion binding"
FT                   /db_xref="GOA:C1E0V7"
FT                   /db_xref="InterPro:IPR002893"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V7"
FT                   /protein_id="ACO61623.1"
FT                   /translation="MGIRIEWSSPCGGCQKTLTKGSNAKKCGKCNSVWYCSKECQTLDW
FT                   KRPNKQGHKHRCAALAEADKLRGAGNPRSQKAFEAHDSKPMMDRFHEILQRKIQPGERA
FT                   YEVMSKMLEDGVAKGARAIMMIHEEVLGNGTIEFTVVPEAQVEVMLEDDAAFSRHALMV
FT                   RTYDPEKQFVICYETSQPERHIVFRVMAEDILNRRS"
FT   gene            complement(151744..>153837)
FT                   /locus_tag="MICPUN_56654"
FT   mRNA            complement(151744..>153837)
FT                   /locus_tag="MICPUN_56654"
FT                   /product="formaldehyde dehydrogenase/S-formylglutathione
FT                   hydrolase"
FT   CDS_pept        complement(151792..153837)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56654"
FT                   /product="formaldehyde dehydrogenase/S-formylglutathione
FT                   hydrolase"
FT                   /note="This protein contains two domains; putative esterase
FT                   - This family contains Esterase D ESTD_HUMAN. However it is
FT                   not clear if all members of the family have the same
FT                   function"
FT                   /db_xref="GOA:C1E0V8"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014183"
FT                   /db_xref="InterPro:IPR014186"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V8"
FT                   /protein_id="ACO62070.1"
FT                   /translation="MELKSTNKAFGGEVRKYTHASTATGTPMTFSVYVPPAASLAKCPT
FT                   IYYLSGLTCTDDNAVQKGGAFQACAELGCMMVFPDTSPRGDDVADDDAYDLGKGAGFYV
FT                   DATTEPWAKHYKMYTYVTEELPALIEANLPAAPGLKSICGHSMGGHGALTIAFKSPNAW
FT                   ASTSAFAPICNPVECPWGRKAFAAYGVDGAAHDATELLKANGKAVYPDVLIDQGLDDQF
FT                   LADQLGIDAFEAAAAAAGQKVSIRKHAGFDHSYFFISSFMADHVKFHVNALNKKAEETA
FT                   LVDVAVADDAMLAEFAKTAGKPITCKAAVAWSANQPLSDETVVVAPPKAGEIRVKVVAN
FT                   ALCHTDVYTLEGQDPEGLFPCILGHEAGAIVESVGPGVTSVSPGDHVIPCYTPQCNQPA
FT                   CIFCASPKTNLCPAIRGTQGQGVMPDGTTRFTTVDGKEIFHFMGCSTFAEYTVIAEISA
FT                   AKINRRMPLNKACLFGCGVSTGLGAVWNTCKVTAGSSVAVFGLGAVGLAVVQAAKMAGA
FT                   SRIIGVDLNKDKFAVASKLGCTDCVCPADHGDTPVQSVIVNMTKWGVDYSFDCTGNVQV
FT                   MRAALECAHRGWGESCVIGVAAAGKEIATRPFQLVTGRVWKGTAFGGWKSRSSVPRLVE
FT                   RCLAGELPVDHYVTHQFEANGDVAKATNEAIEALHGGNCLRAVVNY"
FT   gene            complement(153945..155365)
FT                   /gene="LHCP3"
FT                   /locus_tag="MICPUN_90184"
FT   mRNA            complement(join(153945..154802,155144..155365))
FT                   /gene="LHCP3"
FT                   /locus_tag="MICPUN_90184"
FT                   /product="prasinophyte specific chlorophyll a/b-binding
FT                   protein, chloroplast precursor"
FT   CDS_pept        complement(join(154194..154802,155144..155314))
FT                   /codon_start=1
FT                   /gene="LHCP3"
FT                   /locus_tag="MICPUN_90184"
FT                   /product="prasinophyte specific chlorophyll a/b-binding
FT                   protein, chloroplast precursor"
FT                   /note="light harvesting antenna protein specific to
FT                   prasinophytes, type needs to be determined with
FT                   phylogenetic analysis; ChloroP predicts 21 aa cTP;
FT                   dissimilar to other LHCPs, but more like this group than
FT                   standard LHC genes; GO_component: GO:16020 - membrane;
FT                   GO_process: GO:9765 - photosynthesis, light harvesting"
FT                   /db_xref="GOA:C1E0V9"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0V9"
FT                   /protein_id="ACO62071.1"
FT                   /translation="MALTMSNALVGTGLVAKPAVRSVQARAGLKVFARMTKDRVSLKKD
FT                   TKLGKSRIEIYPEWGEFPSSERTSPLTSLTYDEYKNNVSTEIIHGRFAMLGVTGAWAQE
FT                   NLTGIPWFMAGQECTFDNCSISYLNQSFTPSYDGALLGLIFLEVLLMGYAEGTRTGLIE
FT                   NPFDDVVAGSVFPGGRFDPLNFSDGKEANFFGDDLDTLKIKELKHCRLAMLAWLGILAQ
FT                   SVSTNPEGTEIGPVANWSAHVADVVHCNVVDRSGCVF"
FT   gene            <155861..>157578
FT                   /locus_tag="MICPUN_99274"
FT   mRNA            join(<155861..156049,156202..>157578)
FT                   /locus_tag="MICPUN_99274"
FT                   /product="predicted protein"
FT   CDS_pept        join(155861..156049,156202..157578)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99274"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W0"
FT                   /protein_id="ACO61624.1"
FT                   /translation="MSAVVAGNLLALAGTAKPLKRGRSATRTRRVVSAAANADDARVAD
FT                   VKRAVVATLASAAIALPAIAAPVAEIALTPEEQIAAEVAKFEEQRAKCGTSACRDTVTQ
FT                   WESAAVKKIKKKAGIPLDAPAPKAYPTPKRVAPAPVAETEAAPAPAAAPEATSQPAPRA
FT                   AAGPPVDAKADAKARLAERQAASAAAAEKAAAEKAAKAEALRQAQADAQAERVAAAKAA
FT                   AEAAEAKRAAAAAAKADAKADAKPAPAPAKKAAPAPPPAKKAAPAPAKKTAAKPKSPGV
FT                   FDYVVGDVTVAALGSAAALALVAPSFKDKALAGDASGALEEVKGLVTGANQDAAIGKAC
FT                   LLGGVVAADALIHLPVLGFFLPGPAEFVGTVAATLLAAKYFVTREASYEEDIKDFAASI
FT                   PAGVPDVASTVVEPITKFVGAVKAPDADALVGDFNEWFNGLDDPVEEIAPKAAAFGACV
FT                   AVSYVAHFPVLGLVLPRVLELVGVYVCGGAVARYGEAGTVSLKADLIKVGDDAGAIVKS
FT                   VVSK"
FT   gene            <157786..>159048
FT                   /locus_tag="MICPUN_56657"
FT   mRNA            <157786..>159048
FT                   /locus_tag="MICPUN_56657"
FT                   /product="predicted protein"
FT   CDS_pept        157786..159048
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56657"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W1"
FT                   /protein_id="ACO61625.1"
FT                   /translation="MELPEDLVERIAETCVRAGGLKEWCRSWRGTCRRFSSLRWFEAVA
FT                   RGGVPLAVVPSDRCPTVQLGVSRARSATEDAVARAAATRRALSRIAGRSEDDDDDDDDD
FT                   DDGWDVLGTGPTVLVTPGVHRENVRLTRTCALIGWGSRGSAVIEGSGWEPALAFAGLGM
FT                   SERGTGDTMGWSVGDTGERSVACNLSIRSRNRAQAFAVAVVNGAPKFVRCDLRGGLLVL
FT                   GWKTSPAALACVVRDGRGCGVKVTDHGEARLDGCVVERCGTHGLLLERGGRAVLAGRTV
FT                   VRDNDLEAVLHTPDTDGVALEGEGVDLGPPAIVRVGVRKYDSDDEEGDSGHVSVVVRPN
FT                   VRRLRVGAETLEHLHGHAPDYAWLKRGGFSFDDDGGDEDYEEEEATGSDYDEEETGSDY
FT                   DFDDDDEGVSASPRINEPYRE"
FT   gene            complement(<159790..>160146)
FT                   /locus_tag="MICPUN_80006"
FT   mRNA            complement(<159790..>160146)
FT                   /locus_tag="MICPUN_80006"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<159790..160146)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80006"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5524; mismatched DNA binding - ATP
FT                   binding [PMID 30983]; GO_process: GO:6298 - mismatch
FT                   repair"
FT                   /db_xref="GOA:C1E0W2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W2"
FT                   /protein_id="ACO62072.1"
FT                   /translation="MLLTGPNMGGKSTLLRQAALAVVAAHVGCRVPASACELHVVDAVY
FT                   CRVGAGDGIRSGVSTFFAEMSETAAALNAATDKSLLVIDELGRGTSTADGYAIAYAVAS
FT                   AVAERGSRCLFATHY"
FT   gene            complement(163838..>167667)
FT                   /locus_tag="MICPUN_56659"
FT   mRNA            complement(163838..>167667)
FT                   /locus_tag="MICPUN_56659"
FT                   /product="predicted protein"
FT   CDS_pept        complement(163903..167667)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56659"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W3"
FT                   /protein_id="ACO62073.1"
FT                   /translation="MRASFFRSRVVGKEKKGRGKGRAESTDEWDARVAEVDALRDSSLG
FT                   CLPRSIFADVVSRLDGPDVARLGMTCRAARAYCSRPAIWRALARAQEAPALVREDLVNR
FT                   DFTWKQLYAWRRHVLWHRARGVDRIAVADHARVLTCDPVEGGGRVRVAYEAPSPQPLAP
FT                   NLLTWSPDASMLVVAQESAEGCKLVLSAPTACLRPKRSNRFASGDRQFQILDRRRRGTG
FT                   HDRGDGYDSEDATMGDEDSTAAAGHGLGTSGRTQTAGRTQQLAGTNAAFFGRGDSGGGQ
FT                   SGGAAWQQLDDEDDSVDANKAKEPRAYPRGIVAPIDRVRSHKLPAMNSVHVPLRNPVFA
FT                   AFTACGTRLLLMNVRRHGEEFALHELDLTVAMASLHGATPGAAGTRGSKFLAKNHQFKN
FT                   HQSLAGTKRRRGDFVAGDDDDAAAAPANVRGVGPDGWLSADARETLTLVESGRELSFSP
FT                   GPSTRDVLSLVNGAAVGKISPANLRAWSGLDRECTARPVAGGARDRVRAARALERDEDV
FT                   RMNERLRKEENETASEASFELDGDELEEERDNRASTGNTHPAWRAGGGADGGAVEGAVW
FT                   GAHAASDDDEGGLREVSSAPESLWWRRSVDAFRGGYSAGVETLRSAAVQLARSLLPAAI
FT                   VHPAGVRRGGSSRRRGGGSVWGAGRGEREEAAMRRAAEVERRSRSGGRAIKRARLTGRA
FT                   AAAGGAAGGGGDRSRAPVVGGFSRLGKAKKGSGPSASVGYVNPFACAIPSVRRARPSDV
FT                   VSFRRDRLHETSLPGLAHIVQWVRPARDVPSVGRGSNLVAGDSPGGDSPGDHGHWLVPV
FT                   SFPDAMPRAVHLALLPAAPTPGPNEIRGTDAQRRESARLAMLGLDASMPRSAASRVAAA
FT                   VERSVIAARSLFSKDARHPSAPVGAPVGTLEDACVVELAPPAAYNELHVVVSTVAAAAP
FT                   GGKIVCWADDGALWARRAVDGPDGNRTWDRATRVLDLRRCGFGADAGLRIDDEGSVAPN
FT                   PVLHQVCAMQWSASGTRLLILVACHFTTTSHVFPMHQWMVWDPPATWLGASDLSLLEDP
FT                   PSATTHGAGCFAASGGGPGAPVFCRCVSRSYDDALAGDFRCSHGRDRYRCEECGGAGVG
FT                   EDAIDPGTLDSIRARVHETGAYGFDPDDVLGVITRGRWHVPTKTFVQDVLPIFEQYSQT
FT                   HSLWAPDEDRVCYPVRSDGSGAGAGVGGGDHVWMTRFPRMPIVHRLASVGGGRNVRQVG
FT                   EHNALPFKHAFVDSAVVVCEGSFCVWSPC"
FT   gene            complement(<168219..>169832)
FT                   /locus_tag="MICPUN_56660"
FT   mRNA            complement(<168219..>169832)
FT                   /locus_tag="MICPUN_56660"
FT                   /product="predicted protein"
FT   CDS_pept        complement(168219..169832)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56660"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5634 - nucleus; GO_function:
FT                   GO:30528 - transcription regulator activity; GO_process:
FT                   GO:45449 - regulation of transcription"
FT                   /db_xref="GOA:C1E0W4"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W4"
FT                   /protein_id="ACO62074.1"
FT                   /translation="MLNGQNNYQTAPPGGGGFPLVGSHGNMQGMQYGMGPGRGPGGMQG
FT                   APQARGQFMGGMQGGMQGGGMGNPPGVFNAQAQMNGGLGLGGAPPGLGGSPGGARASMD
FT                   RTGSGGQLLARQGSMPGAANGGMMGPNAGAGPRGMMAGGGSFGGGGGGGIPGPRGSGPD
FT                   LLAMINKGGAGSPFGAQGGMGMGGMGEDQTPFDMSEFPSLGGPPPGARGGLGGQPGAQG
FT                   AFGGMGPGQGGVFGGMDGMGSMGDGYGAMALQKPHPEFTIQNEDFPALPGAPGGGGGGG
FT                   GGASKGGGGPALGQPGPFAQGPQGGKLDLNGPMGGGAPYEFGGGKGSGGGKGVGGGQMA
FT                   AATDRFGLLGLLGVIRMSDPDLTTLALGTDLTTLGLNLNSPEPLYKTFGSPWADTPPRP
FT                   EVELLLPACYSVPVAGVRPAVFQKFQQETLFYVFYSMPGDESQLFAADELCARGWGFHK
FT                   ELKAWIMRVAGTEPVMKSERGERGSFWIFDVMSWERIRKDNFNLQYDQLEARPETGDKG
FT                   AGGKETKPPAGGLLTASAGK"
FT   gene            <170740..>171867
FT                   /locus_tag="MICPUN_56661"
FT   mRNA            <170740..>171867
FT                   /locus_tag="MICPUN_56661"
FT                   /product="predicted protein"
FT   CDS_pept        170740..171867
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56661"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0W5"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W5"
FT                   /protein_id="ACO61626.1"
FT                   /translation="MAPADTAGLERLVRTVRSDAEQRKRLVCNACFLAALAQLHPEVVA
FT                   KPKGERRWRREELDALAAATAGRIDDADPVHVIVGVDDLNVNIRYMKGSLVYLRAETNP
FT                   PLRCMMYSSMPPPPGQEEPSADDSADGPKTPGQDETADLPTGPAKVLDDADASHALVRA
FT                   VLERLNDDPTIDTAGGGVDADDPEAVATWRAARVRESLTAAHGAHWHVVHDAKPFGAAV
FT                   VTSGEGRRVLAQRGRYSFLVWRHSSSIKSPLEAIRRRIRADLPALRRGARTTFLVVCAV
FT                   YALWYRAMCREEEEEGGGGGAGGGTRPNDDRTAVGIIAGAEPRLTTFLCAAGESAAPFA
FT                   FFALAVMFALGGGGTASAIGARYARAFARRKRKSA"
FT   gene            <172023..>173102
FT                   /locus_tag="MICPUN_56662"
FT   mRNA            <172023..>173102
FT                   /locus_tag="MICPUN_56662"
FT                   /product="predicted protein"
FT   CDS_pept        172023..173102
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56662"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W6"
FT                   /protein_id="ACO61627.1"
FT                   /translation="MSFALASLQGRALASPLHVKRTAPRRGTRAVLVRAAVDPERDVIL
FT                   VSGCRERVAQCCVDQLSKNERSAGVVIKVTLPHDAYVGVKNPLNAMAKDLVFPDKPMID
FT                   CLGALDAVECVDESTDLFKGCLKDATGVILASEYAPTLLQTAVDLCDRIKAGAMPKLRR
FT                   VVVLSHIGVERRDVDPWKFMNRKTMVGTGVIGGKPQPGGAPLDRWVDAEELIKATLESC
FT                   GGADKSPWSYTIIRVGDLRGNGPTSVTYGDAMLTLVDNAFDVRMQDIEMEEGDAFEGFT
FT                   KRLSVAVVMNRMLTTQSYRVINRTFSCISTGPVDRERRKGWDVAKGRSPPPIEDKVVDE
FT                   ELQPKEEEENVPAGAPVPT"
FT   gene            complement(176264..177260)
FT                   /gene="PSAN"
FT                   /locus_tag="MICPUN_93625"
FT   mRNA            complement(join(176264..176828,177168..177260))
FT                   /gene="PSAN"
FT                   /locus_tag="MICPUN_93625"
FT                   /product="photosystem I subunit N, chloroplast precursor"
FT   CDS_pept        complement(join(176382..176828,177168..177194))
FT                   /codon_start=1
FT                   /gene="PSAN"
FT                   /locus_tag="MICPUN_93625"
FT                   /product="photosystem I subunit N, chloroplast precursor"
FT                   /note="Also known as PSI N; ChloroP predict 46aa cTP- no
FT                   result with TargeT; GO_component: GO:9522; thylakoid
FT                   membrane - photosystem I [PMID 42651]; GO_function: GO:5515
FT                   - protein binding; GO_process: GO:15979 - photosynthesis"
FT                   /db_xref="GOA:C1E0W7"
FT                   /db_xref="InterPro:IPR008796"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W7"
FT                   /protein_id="ACO62075.1"
FT                   /translation="MAAMTVCAPAMLSSKVSTGIKAKATAAKASKAQGAVCFFGDAKKA
FT                   AAATLAAAVLVAGPAMPAKADLTSDLLARTEANKELNDKKRAATSSANFERSRTVTDGV
FT                   CKFPQNMLGCEIASSTGDVAFLSADKALECEGTRDGKVCASKAPGSFPPVFGM"
FT   gene            <178847..>181057
FT                   /locus_tag="MICPUN_52126"
FT   mRNA            <178847..>181057
FT                   /locus_tag="MICPUN_52126"
FT                   /product="predicted protein"
FT   CDS_pept        178847..181057
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52126"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR007751"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W8"
FT                   /protein_id="ACO61628.1"
FT                   /translation="MRPMANGAGGSKGGDAGPAPVVDSANDPMAISETWRRFMDAHVAG
FT                   VGIGTMDDSREWASTALTRLREEEDENRRRMDAVVTPDGRDANGEIVFPVKKDNSFVDL
FT                   LAVAKDDEAARCAVLLALALEAAETEARVAWNKLRAELRWKEPFAPAEKSAALESAHSL
FT                   DSAGDDNGVGGRRLGRRASGVADLDDIIIESPGEFLEQRRNSVAGWDAGAGVGRGGAWL
FT                   LEPLRDRWEARRVLEWSPWVMSEASVGASGELAILSGGGDGDAEGGVAEGGVAEGAPAA
FT                   AADEGAVVGLRGAKEEAARRRAAMTEEPNYVVESVPTQRAFDWTSLVPAASVPQVSVQE
FT                   VISVDAGDDLSSPSSAPGSPKGPGLEDPGSPTSKSIHSVTSDASTINIDALTDLRYGEH
FT                   MVFLVHGYAGSLQDLRLLRAHLQVACPNVHTRVSAANHERTGVDSIEAMGARLAEEVAE
FT                   TMEDLESGALVPRGGGREPRSPAAAAATTAARFGAPPRVSFAAHSVGVLIVRAALTHPA
FT                   MEPYLSRLHLFLSMSGPHLGYAGGDRVGADGMDKKSRRFIGKSAAFQLGLCCTRAINPK
FT                   AKCLSEITFRDAGKIEDCYLYRLAHHKNGLALFRHVVLVSSPQDKYVQRHSARLQLEGF
FT                   RIREGSRRARATMEMARAILAPVLEKAISRERGEAGSSGRDGVERESGARLTSLSRVDV
FT                   HFAKVGGGVDFNQLIGRKAHIDFLETDEYVRFLIWKLRRAFL"
FT   gene            complement(181094..>182837)
FT                   /locus_tag="MICPUN_56665"
FT   mRNA            complement(join(181094..182570,182748..>182837))
FT                   /locus_tag="MICPUN_56665"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(181251..182570,182748..182837))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56665"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0W9"
FT                   /db_xref="InterPro:IPR019385"
FT                   /db_xref="InterPro:IPR038092"
FT                   /db_xref="InterPro:IPR039047"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0W9"
FT                   /protein_id="ACO62076.1"
FT                   /translation="MAQRVNSCNFEDSFSDIDMEELDSYLTSPPEMLSGDSPTDDARAA
FT                   ARARLAARAAHVEGGLAAAAAAEAAVASVAAGRGGDELRPVLSNLSANVPAKTPAPRAG
FT                   FKRHHIISPPMKNARVKNDDGLGVNVARAARDLCGDLGEPKESLMRRALEVIGVVEAND
FT                   IAIQVYRIEGEGGQMTSDGARRRTPGGVFWALLRERVTKEEWADIFAEEKEVQRERCRR
FT                   RRRAASAAASLAGSPTFREGFGKGGGPVAPASSSLKTPAPIAAAARLAANADAPARATM
FT                   ASKLRDTAAAFATAVAATPAAAPGSWAARARAPPAFSRAQSAPAAVLASAAKKAAKTPA
FT                   AAAPATPATPFGVVTPENDPNASKGGSWAQRARAAAEAEAAAVEARKIAAYKQRLAKLD
FT                   AKPLAAEAPAPPVVNVEAPAPPVDAMDADVQDGEDWAAEMETEDAGAIAAGTPAANPWA
FT                   GMATFASMVRA"
FT   gene            <183379..>183975
FT                   /locus_tag="MICPUN_56666"
FT   mRNA            <183379..>183975
FT                   /locus_tag="MICPUN_56666"
FT                   /product="predicted protein"
FT   CDS_pept        183379..183975
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56666"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0X0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X0"
FT                   /protein_id="ACO61629.1"
FT                   /translation="MDAQQLERYANLAPCFFAVIGVVFMAKCKVAWHPILNKTGWKKDG
FT                   VFACSADSVFLRWASLVSHTFFIIGAVIFGNGILAISNVLGLPLVLGFWCASSSIIQSI
FT                   MYMAVFKQSPMGTPDIDGPPVPARVVIAAVWIITTANYIVNRATLYRDVDETRLFGLMA
FT                   VGVFLPAAIGAKHRTKNWRLHYMKDLPARDEAKTY"
FT   gene            complement(184052..185483)
FT                   /locus_tag="MICPUN_107865"
FT   mRNA            complement(184052..185483)
FT                   /locus_tag="MICPUN_107865"
FT                   /product="major facilitator superfamily"
FT   CDS_pept        complement(184073..185401)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107865"
FT                   /product="major facilitator superfamily"
FT                   /note="multidrug efflux"
FT                   /db_xref="GOA:C1E0X1"
FT                   /db_xref="InterPro:IPR001958"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X1"
FT                   /protein_id="ACO62077.1"
FT                   /translation="MLAVFLHLLGFTVTGPITPSLVAHFGLHPSQVGYLTSAYPLGMFF
FT                   ALFAWPRLSDAVGRKPILVMSLLGVGVGLVAQAACVTNGWSLATFLGLRVASGAFAGAS
FT                   PVVKAYLADAAAPEQLPSFMAWREAACTLAFIVGPSLGGLMFSANKDLGACIAVTGWAS
FT                   VGAAFIVAVAVKEIGWRRRDGSNEGAGISGSSADESGADVDESEDDAGDGIDPTGASAA
FT                   AKRAAREQARTEAASAPACPLGRRLYAAVATICVTSFLYNAGQSTFDSFFPVFCAQQRG
FT                   MGPTQIGATLTALAAVSFSISAAGFAAVNKKLGLTSTTALGLALVAVGLGAIGAAPTAG
FT                   LTLFAATLYVTGIPLFTPAIPILLMQCVPPNRRGAVMGLDSAVNAVARIATPIALGGVY
FT                   HASPTAAFAAAGGVVAFACALVLVRRWMVMGPGMKFGGVGSAR"
FT   gene            <186102..>186791
FT                   /locus_tag="MICPUN_56668"
FT   mRNA            <186102..>186791
FT                   /locus_tag="MICPUN_56668"
FT                   /product="predicted protein"
FT   CDS_pept        186102..186791
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56668"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X2"
FT                   /protein_id="ACO61630.1"
FT                   /translation="MCAPIRASYRRDNVVESVFEYTQLSLDTSLGISLHDITPQVRRAI
FT                   RESGVTNGTVNVLSRHTTTAVTINEAEGRLMDDIRQYMLKLAPPGDPYLHNDIHLRDGP
FT                   PDWPGGNDAWRAQEPRNAHSHLLSILIGNTLAVPVVDGELAIGTWQSLMLVELDGPRKR
FT                   TVGVQVCGTRSGMGDKPKRIDTSESSSNAASKSYQKKASPVSDGYKDPMDALCEDDPSA
FT                   DECKVFD"
FT   gene            complement(186812..187587)
FT                   /locus_tag="MICPUN_107866"
FT   mRNA            complement(186812..187587)
FT                   /locus_tag="MICPUN_107866"
FT                   /product="predicted protein"
FT   CDS_pept        complement(186865..187356)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107866"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X3"
FT                   /protein_id="ACO62078.1"
FT                   /translation="MGPRPGWCFKADRHGLGYYRDPVQERREPEVPHHRATRNADRDKP
FT                   SPLYHAGEETEEPTYGHHHRGGRSATHHGGDGSQNRGNSIGTRPVVRQSKLFRRHESGN
FT                   AMKDILGNGGAMKWDENRMQGGYSGATYDHEAHNDALLRQHEQASILREVLSEVRGGQR
FT                   "
FT   gene            <188489..>189812
FT                   /locus_tag="MICPUN_99282"
FT   mRNA            join(<188489..189762,189806..>189812)
FT                   /locus_tag="MICPUN_99282"
FT                   /product="amino Acid/Auxin permease"
FT   CDS_pept        join(188489..189762,189806..189812)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99282"
FT                   /product="amino Acid/Auxin permease"
FT                   /note="amino acid"
FT                   /db_xref="GOA:C1E0X4"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X4"
FT                   /protein_id="ACO61631.1"
FT                   /translation="MSSPPWSPTREPHGRYEELAQVDEYGTMRPTPQNDDVSDQASDDA
FT                   LVHHDDSSGWAQTPAWNICLNAAMYCAVPLSMPATLAAGGWFWGTVFFAYATFATYWTG
FT                   LVIGRVYLEHPRLATYPAMASEAFHNLALERTNGDARVARNWRTWSRRAVKITQFATFY
FT                   LDTVTQMIYVAQYFAQLDLGWFGTGAGRDEGDEIQSDSPAGRPRLCQWAWVLVVWAVSV
FT                   PVMQIPTFHASRWVIVPAVAVLAVSVALFLYEVAVVVKPWSCEPGPSFGGVTLPSAMVS
FT                   LGNMAYAYGGHGVFPESLREMREPHRWPSVMRWMYAGLVPAYVVCAVVGYAGYGRFAQA
FT                   NINLNFPKNWVNGVSITLQLLQCYYLIFYTNVVLVLMVETRWGIDPTKTWRPRTSLPVI
FT                   GSTSPAVARMLFRTAFLGTQVALAEWR"
FT   gene            complement(<190250..>190819)
FT                   /locus_tag="MICPUN_99283"
FT   mRNA            complement(<190250..>190819)
FT                   /locus_tag="MICPUN_99283"
FT                   /product="predicted protein"
FT   CDS_pept        complement(190250..190819)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99283"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X5"
FT                   /protein_id="ACO62079.1"
FT                   /translation="MADVSDDDEDWYDTQADADDADADADDDDDANRQPDSWDAFWQRC
FT                   VRDNEQAVRDAGGDPAKVPGPQNLPTGRHGDVLKNGAPADHGKIRCWGCDARTTAQMEC
FT                   AQCLEIMKERAVKAAFDNWERAFFCSHLCYKEHYHEHKARHGPSKSVPTKTDGTIHHFP
FT                   CAEGCGALWDSKALRRHVFDECEPYE"
FT   gene            <191201..>193954
FT                   /locus_tag="MICPUN_56672"
FT   mRNA            <191201..>193954
FT                   /locus_tag="MICPUN_56672"
FT                   /product="predicted protein"
FT   CDS_pept        191201..193954
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56672"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0X6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X6"
FT                   /protein_id="ACO61632.1"
FT                   /translation="MAQTSRSTDIKVTRAMRDATNSVAPRDIAPKPPAEGKENSKYDGF
FT                   FFADPAGLTTPAPAFPTKTMDPSPTSVLMGPGTPDEAAEQRPREKATPENATDDGADAE
FT                   MTLATSPSDGESVDDDVASPESPERPATVPDLAVASTSPFVPNVLEELLGAQLPRAESN
FT                   VRARRDAAGNLAANGAPQSAQTRRVQHATSTPTSATSTRWRSVPSPAQIVSMGREWAAS
FT                   GTVTPGRSTAIPTFLDDLVNNHVAKVAVDTKGTNTESNNTDEWDRTGDLKVECERLKRE
FT                   VDFHREVSKEVGVSLDASAAELERTKRRVEFLEALKDEWDAQFKELSAETERYRAEADA
FT                   AREETLAAEALAAAARAAATSANAEAESLRKNVIHDDDGSTGEAPETSGTTSTSASATS
FT                   AEVGSAALFRRHRSGAENDVAASIAAALRERESELDAARLNLDQTLAAAKAAEAKLAAK
FT                   CEECAALRGEVNVAKSTLAAAREAVAQTEGALMTTLEDKKRLVEDKKRLIKKIEMMETD
FT                   ADAKARDACERVRDATERGRRSVLRARANWGAVALTTAALALGVCAWAAAVPPAGVLIA
FT                   VPFGIDFRDWRLGSDGSTSAFNAGFNVRTVNFTLPGAGYAVAAELSACRADLATSTALA
FT                   SALSSEASRFAGLAEENDRLAAEVEDFARVTESLREREADVRSLESRLAHLEASANDAA
FT                   TRGDDPFAASLAARAETERLRHALAKERSLRRRSAFLEKLDVVSIAAVCVAWGTCLLSA
FT                   WFFARKESGLRRTLNDYGALMEAASAEHERLGSELTRATLDANEERTRRERSEGRAREL
FT                   ERQLDASRKAANEATKRVEAFEAIGRRERERERDGARSAEKRFGKASSFGGGKSVTWDD
FT                   DVSIAPSTTSSSSVVDARAGAQNPEAAARPHNTVFKPPVGGVKSFQ"
FT   gene            <194212..>196180
FT                   /locus_tag="MICPUN_56673"
FT   mRNA            join(<194212..194274,194411..>196180)
FT                   /locus_tag="MICPUN_56673"
FT                   /product="kinase/lysine decarboxylase"
FT   CDS_pept        join(194212..194274,194411..196180)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56673"
FT                   /product="kinase/lysine decarboxylase"
FT                   /note="Two domains identified; At N term is Adenosine
FT                   kinase (AK) catalyzes the phosphorylation of
FT                   ribofuranosyl-containing nucleoside analogues at the
FT                   5'-hydroxyl using ATP or GTP as the phosphate donor"
FT                   /db_xref="GOA:C1E0X7"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="InterPro:IPR031100"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X7"
FT                   /protein_id="ACO61633.1"
FT                   /translation="MKDVDTPHVTPIKGYAADAGKRKRSLDGTPDASPPEVIALETLAV
FT                   IDHSCKVPDHFFKAGPGFKGEVGGSIRVDEETLQTMLVNVGEFSTKAGGSAANTARGLA
FT                   AGFDIRTSLISAVGKDEWGALFTSSMRRAGVDASKTVVRDDPEARTGRCVCLVDKTGQR
FT                   TMRPSFDDKHRLLPNEITPDMFEGSRWVVVNGYSYYSPGFLEAACDAASIAGCKVAMHL
FT                   ASFEIVRKFRPHLTSLLASGKVHVVFANEDEARELVGGGDASSESIETDTKIEAALAKL
FT                   AEWCDIAVVTLGDKGCVAMRDAERVDQKAFKGFDVKDTTGAGDLFSAGFMYGLLRNASL
FT                   ERCCELGCLSGAAVVQTMGAEISADGWTWVHAHMHEGRARSLVRGSAGAVQRELLACYE
FT                   LIESIGRGVVYYGSARLKADNPHFIRSRELGKMVSELLGTPTWTGGGPGMMEAASLGAM
FT                   DAGKAVAGIRIEREAGTKVRSAAQSYLKPEHTVFCKFLSPRKVALVDAGVRKKSEDRTA
FT                   YVFLPGGLGTMDELFELFTLYQLHKLGTDHPVPVIIVNYDGFYDCLLDFVNTMQGHGTV
FT                   GAGEYDQMVVKNTNDEVVDYLKQYYNIEGHDVAA"
FT   gene            complement(<196297..>196938)
FT                   /locus_tag="MICPUN_56674"
FT   mRNA            complement(<196297..>196938)
FT                   /locus_tag="MICPUN_56674"
FT                   /product="predicted protein"
FT   CDS_pept        complement(196297..196938)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56674"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X8"
FT                   /protein_id="ACO62080.1"
FT                   /translation="MAAAARVASSSGASSTSRPVPPRRRGRVAASAASTVATDAAQLAA
FT                   GVVAGAALLSIAWPLLERELRPIRCARCRGMGWTVCTNCKGRGKTGCPPLMYATVERRA
FT                   KMRRSTASDDADSEVPIDGSCDGVMIAGPPRSREDAPTCADPETEAAYAPGLVERLSYC
FT                   RECGGKGRCGCDACNRTGIENNWLYGPAANGGWGARGQWRDPANPPPPPP"
FT   gene            <197061..>200516
FT                   /locus_tag="MICPUN_56675"
FT   mRNA            <197061..>200516
FT                   /locus_tag="MICPUN_56675"
FT                   /product="predicted protein"
FT   CDS_pept        197061..200516
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56675"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8168 - methyltransferase activity"
FT                   /db_xref="GOA:C1E0X9"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0X9"
FT                   /protein_id="ACO61634.1"
FT                   /translation="MGDEQEKWRRALLKKLRGAAGVKARIDAGDGASLQRSQLARGTAS
FT                   AVADLVARCVEAGLARDGPEIAAALAAGADGGIVAMAAANARGPDGEPGARARRKRERA
FT                   AALAAASSQSGGGGGGGEDAKRTRLDDGDRARGSKRASGECKRATWALHALAKAPDADP
FT                   ASVAVTAKALTAVLRDSKRDAASMDALLASVALYAAAKLRSSALIAEGATDAASDARRE
FT                   LRVCASRVAARVDAQLCARVDARGASNALWALATLASSRGEAGVGERERHAATRALVGA
FT                   LSTRVELRAAFNARDAANALWGCAKARVGLSDEATTQLASAVSGSAPGSAPGSAPGSAP
FT                   PGERGANAVEASMALWALASMRGDGTIGAHVARLAATGVVRRLAECAVKVGPTSTTEVD
FT                   QHRVVANASWAAAKLSERVVSGGGGGDTAGDDPAKMDSEFDAVATGLLRRFASAAVEAG
FT                   PAFQLESPRAAAQLVAALRPSLLDAACGGGGADGVPSADDVAAMTILTHRGLRSCFARG
FT                   REEMEKEARGTRRTSANGAHDVVRKYPESIQKPSSDDLAAFCDAAEALSGFGVVVDAGY
FT                   FRSAVAAACTGGPTALGWRAAGRLEHCVFSVLGLGPVAATVTARGSGSHRGRRGGAAER
FT                   APSADDVAAAERLLRRGAAAAEAANDTRLAMETAAADVLLAVPGPDGPVASGGGGGGRM
FT                   LCVDDTHRLLSRMLRERGGWSVTNWNRFSRKDRRGAPRPPAGAFDAATVRLPPTKAAFA
FT                   MALVAVAARLRAGAVAWIYGADREGVRGCEFDLPDGSFEDVRVVHSCASGGGGGVEGFD
FT                   RGAHVEDSVGSFSVLRCVRTDKPFGVSGSGNPAGGGATQLATRSTTPNRDEDLLEGFKK
FT                   VGRLDVRLGDDVHAFERWVTYPGLFAGGGLDVMTAFLLETMTRSSDGWLGSALRGTPEG
FT                   RGGKEGEFSALDFCSGSGTLAACVRRLAPSARLTLLDADAVAMLAARENLSLPSGSSGA
FT                   SVLDSSEPDGSSPRSVHLPAAFALGDGWTGLSSDERFDLIVSNPPVHLGLRPEFTVLKS
FT                   MCAGFDARLKPGGEAWFVAQRYVPVAGICAGIGGLAAKVARVCANDKFAVWSVRKPPGA
FT                   GREDGSLERKAAKKAKKEKKEKSGGKKEKSGKKEKKEKKEKKYS"
FT   gene            complement(<200575..>201168)
FT                   /locus_tag="MICPUN_79960"
FT   mRNA            complement(join(<200575..200907,201013..>201168))
FT                   /locus_tag="MICPUN_79960"
FT                   /product="glycosyltransferase family 1 protein"
FT   CDS_pept        complement(join(200575..200907,201013..201168))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79960"
FT                   /product="glycosyltransferase family 1 protein"
FT                   /note="C-terminal subunit of a glycosyltransferase;
FT                   GO_function: GO:16758; carbohydrate binding - transferase
FT                   activity, transferring hexosyl groups [PMID 30246];
FT                   GO_process: GO:5975; lipid glycosylation - carbohydrate
FT                   metabolic process [PMID 30259]"
FT                   /db_xref="GOA:C1E0Y0"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y0"
FT                   /protein_id="ACO62081.1"
FT                   /translation="MPKKRKSVFVTVGTTQFDSLIEALDTPECADALRGNGYGSVVIQR
FT                   GKGTRELPTPLEVRVFDFAPSLADEMLAADLVVSHAGSGSVFEALGMRKPLLVVVNDAL
FT                   MDNHQAELAEELGKRGHLRWCESGGLANAIATFDPRGLTPYEPGDPSGIARALDDALA"
FT   gene            complement(<201432..>202093)
FT                   /locus_tag="MICPUN_56677"
FT   mRNA            complement(join(<201432..201804,202032..>202093))
FT                   /locus_tag="MICPUN_56677"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(201432..201804,202032..202093))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56677"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y1"
FT                   /protein_id="ACO62082.1"
FT                   /translation="MIAAAHTVTVRPAAALSARRGLAGSSLRTAAKPPARAALRVRSTA
FT                   TRAEGIVDDVMADIKKKIADNKEKLERAKIVASPPGVPPPPVVPILEPGKIGFVENAER
FT                   QNSRWSMVGWWSLLLVELVAGKGLLEIMGFTVGKGINFTF"
FT   gene            <202395..>203588
FT                   /locus_tag="MICPUN_97114"
FT   mRNA            join(<202395..203186,203277..>203588)
FT                   /locus_tag="MICPUN_97114"
FT                   /product="predicted protein"
FT   CDS_pept        join(202395..203186,203277..203588)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97114"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y2"
FT                   /protein_id="ACO61635.1"
FT                   /translation="MSASAPFGSAKRTEELLSLSFNQDSGCFACGTDGGFRIYNCDPFK
FT                   ETFRRRFDSGGIGQVEMLFRCNILALVGGGRSPRFSPNKVMIWDDHQSRCIGELSFRVE
FT                   VRAVRLRRDRVVVVLEHKIYVYNFADLKILHQTDTVANPLGLCALSPTQDSTVMACPGL
FT                   NKGQVRVELYDLGVTKFISAHDGELAQLQLTLDGALLATASEKGTLIRVYDTASATLMH
FT                   EFRRGADRATVYSIAFAPGKDFLAVSSDKGTVHVYVVPERASGSNQEGGVVDAKAAFSF
FT                   VKGFLPKYFSSEWSLAQFKLPDFTRSLVAFGPEPNTLIVVTVEGTYYKVGFDPKSGGAC
FT                   AQVAFSRFLKTAEEEEEGGWGAVRDVR"
FT   gene            <205043..>205345
FT                   /locus_tag="MICPUN_77080"
FT   mRNA            <205043..>205345
FT                   /locus_tag="MICPUN_77080"
FT                   /product="predicted protein"
FT   CDS_pept        <205043..>205345
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_77080"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:6355 - regulation of transcription,
FT                   DNA-dependent"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y3"
FT                   /protein_id="ACO61636.1"
FT                   /translation="HALCVADATAKDQPIVFANDNFFVQTGYPPEEVLGRNCRFLQGPG
FT                   TDRETVRAMREAIAKGKEFHGRLMNYHKNGTSLVNSLVMSPLRDEKGVVTHFIGIQ"
FT   gene            complement(205532..207449)
FT                   /gene="PGK_1"
FT                   /locus_tag="MICPUN_104767"
FT   mRNA            complement(join(205532..206670,207101..207449))
FT                   /gene="PGK_1"
FT                   /locus_tag="MICPUN_104767"
FT                   /product="phosphoglycerate kinase"
FT   CDS_pept        complement(join(205666..206670,207101..207409))
FT                   /codon_start=1
FT                   /gene="PGK_1"
FT                   /locus_tag="MICPUN_104767"
FT                   /product="phosphoglycerate kinase"
FT                   /note="Phosphoglycerate kinase (PGK) is a monomeric enzyme
FT                   which catalyzes the transfer of the high-energy phosphate
FT                   group of 1,3-bisphosphoglycerate to ADP, forming ATP and
FT                   3-phosphoglycerate. Cholorplast transit peptide (29 aa) on
FT                   N-TERMINUS; GO_function: GO:4618 - phosphoglycerate kinase
FT                   activity; GO_process: GO:6096 - glycolysis"
FT                   /db_xref="GOA:C1E0Y4"
FT                   /db_xref="InterPro:IPR001576"
FT                   /db_xref="InterPro:IPR015824"
FT                   /db_xref="InterPro:IPR015911"
FT                   /db_xref="InterPro:IPR036043"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y4"
FT                   /protein_id="ACO62083.1"
FT                   /translation="MAAFAAAPALSARAFFAKSSVRAKKTSVRAQARAALKVEAKKKSV
FT                   GDLKKADLEGKTVFVRCDLNVPLDKDLKITDDTRIRAAIPTLEYLVENGAKVLVTSHLG
FT                   RPKDGPEDKFRLTPVGARLSELLSCSVSKVDDCVGDVVKDAVGGMANGSVCLLENVRFY
FT                   KDEEKNGKDFAKQLSEYADLYVNDAFGTAHRAHASTAGVTEFLSPSVAGFLLQKELDYL
FT                   DGAVSNPDRPFCAIVGGSKVSSKIGVIETLLNKADKVILGGGMIFTFYKALGKDVGSSL
FT                   VEDDKIDLAKELMAKAEEKGVKLLLPTDVVVADAFAADAKTQTVSVDAIPDGWMGLDIG
FT                   PDSVKEFQKELNECKSVIWNGPMGVFEMDAFAKGTFAIADTLANLDGITIIGGGDSVAA
FT                   VEKAGLADKMSHISTGGGASLELLEGKVLPGVDALDEA"
FT   gene            <208031..>208795
FT                   /locus_tag="MICPUN_99290"
FT   mRNA            <208031..>208795
FT                   /locus_tag="MICPUN_99290"
FT                   /product="predicted protein"
FT   CDS_pept        208031..208795
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99290"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16788 - hydrolase activity, acting
FT                   on ester bonds; GO_process: GO:6629 - lipid metabolic
FT                   process"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y5"
FT                   /protein_id="ACO61637.1"
FT                   /translation="MIEYVTRGEWYDGEIRRFVRIDNENPPRKRGVLFVGSSIFREWRE
FT                   ARDFAADVAPLGADCLNRAFGGSTTRDQLDVMEQIVFPHDPKVLVYYCGSNDVNAGVPP
FT                   RVIRDNFLEWCARAFSRCPSARRILFVSIMRAPQKAPVWDALDEANALIREACGEEGEE
FT                   GRRGLKRVSFVDVNPLLRDASTLEPLAQLYRDDGLHFHPSSYDRFAPAIVDAARRALDE
FT                   CGDSVGRGGTGVRGGESSEAPYDPALPPSLGR"
FT   gene            complement(<208827..>209576)
FT                   /locus_tag="MICPUN_56682"
FT   mRNA            complement(<208827..>209576)
FT                   /locus_tag="MICPUN_56682"
FT                   /product="predicted protein"
FT   CDS_pept        complement(208827..209576)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56682"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:31072 - heat shock protein binding"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y6"
FT                   /protein_id="ACO62084.1"
FT                   /translation="MARSECLYDLLGVADDATDDELKRAYRDAARLHHPDVNPDAEPGR
FT                   FSAVSSAYDVLRDPNKRRAYDATRAWERGVDGGGAGVRTPGATHATWGGFEEYAKGFAE
FT                   RYHRAHATETEWQRRERMAKAAAERAEMEKEFWIQEKARARHMAVEYRRRAAALKHSRA
FT                   LRHEATIGGFWFSKKGWLPMDFVALFTALAFAGGSAHVWKESGRRKFEARGGRAAGEGE
FT                   ETPVVGAVDPKVEVAAAAVKEGETRHR"
FT   gene            <210593..>211957
FT                   /locus_tag="MICPUN_80233"
FT   mRNA            <210593..>211957
FT                   /locus_tag="MICPUN_80233"
FT                   /product="predicted protein"
FT   CDS_pept        210593..211957
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80233"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E0Y7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR022052"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y7"
FT                   /protein_id="ACO61638.1"
FT                   /translation="MTKPNRREEGGAPIRPAVWRPGVDGMDADEELEYDPSVYDCLHAW
FT                   QLDWPCLSFDILRDELGDTRERFPHSLFAIAGTQADVATKNHLTMMRLTRLKKTRRVDK
FT                   AAADMDDDSDASESDSDDEDGGIAPINGPIIQVQKVAHHGAVNRVRACPHRPSLVATWG
FT                   ETGVVQVWDLAPQLTKLSMLTADARDAQAAMNVQPQRSAPRHAFTGHADEGYAMDWSPT
FT                   VDARLATGDNAGGIHVWEPREGGRWAVDKTAVFKGHESSVEDLQWSPAEAQVFASCGAD
FT                   GYVCVWDARNANAAPALRVKTHECDVNVMSWNRVANCMLATGADDGSLRIWDLRMFSPS
FT                   DAKHVANFSFHRGPVTSVEWSRFDSAMLATASADHTVCVWDLAVERDAEEEAAAMAAED
FT                   NAMAPEDLPPQLMFVHQGLKDPKELHWHHQIPGLCLTTAADGFNAFKAYNVGPGC"
FT   gene            212121..213108
FT                   /locus_tag="MICPUN_107868"
FT   mRNA            212121..213108
FT                   /locus_tag="MICPUN_107868"
FT                   /product="predicted protein"
FT   CDS_pept        212151..213002
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107868"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR018971"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y8"
FT                   /protein_id="ACO61639.1"
FT                   /translation="MASAAGAPAALAARLPRARGCRGARRGVRRVRVSAESPGGREELS
FT                   RPSPPEKFMRFEVRKTLRVPVPEPARVNEAAGRAPRSLERWIQRPENVMEVVFSKEGVI
FT                   PRESGEWRISVIKLPFLDWELNPEFDLRVLPKDAAAREFGVRMVSDALRFAPEGGLEKL
FT                   PPGFAGMDIWSYIDCELFIERLPDDDDGTAGGGARSRTAVCADIDLLIAADIPGVFRWI
FT                   PFFEGIGESAIAGSIESVGEFAQANVQAAYEEWVGAEEAATEPSGAPFGGINLAKREQR
FT                   AR"
FT   gene            213247..215907
FT                   /locus_tag="MICPUN_56685"
FT   mRNA            join(213247..213384,213634..213676,213992..214070,
FT                   214242..214300,214568..214719,214896..215907)
FT                   /locus_tag="MICPUN_56685"
FT                   /product="predicted protein"
FT   CDS_pept        join(213373..213384,213634..213676,213992..214070,
FT                   214242..214300,214568..214719,214896..215579)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56685"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Y9"
FT                   /protein_id="ACO61640.1"
FT                   /translation="MANAVLGEHVSEAEMPSKEGYVEAQAFASVHDLVHHAILSRPDHR
FT                   AILKEIYATCEREGRIAYKHGKGSRLLTANEHWKSQIRHALYTSPRFRRVDDGEAWSVS
FT                   NPEAKAPEPVTVRVYPGDDEAVAAQRSHEREEHKREKALAAAAALAAAVDLPHQLPHKA
FT                   SRAVSNSRKRRFSNASTTSDDVSDDSPHKRNRRARHHAQGRAPLAEVAELAQTGQPTNN
FT                   PWRKRDDEGRLHRALRRARENDRGLPRLVSRDSSPEPDGEHEATRDDKPVIVMVGNKPV
FT                   VPKGRDIAHNRRKPLEGHRAAMPSGAIPDAWNSVKCGAGASTGFIYHPSNEFITYHLGL
FT                   SG"
FT   gene            complement(215814..217440)
FT                   /locus_tag="MICPUN_113699"
FT   mRNA            complement(join(215814..216913,217131..217440))
FT                   /locus_tag="MICPUN_113699"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(215924..216913,217131..217382))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_113699"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z0"
FT                   /protein_id="ACO62085.1"
FT                   /translation="MSHRAVVTAREAHARLTAARRYSGGSAGAILKSRHVAPAGRISGR
FT                   WGGVSHRRGSRRGPCLVVAKIWTDDGRRKAAEMMGLTAEEAADEKTLKRAFRRLALRYH
FT                   PDIAKDDAGVEKFHQIQEAYRVLSGADLAHVELPQDQEWDTHDWRWAHRYKGAANGVAG
FT                   VDPEQARRRMGEEERRARVGEQLRSMAGAPTRRKRRVIKPLSAQPSNVAVEFNSGTYDD
FT                   DGGGDECPSDGCASEWAQPARSSADTAGDTAGDEENSTKFAYNARAVRGYQSDRHSTET
FT                   AHERLNAQLAGLHRKKVIRARAMGIEFTESAQSANSGAGKTGRAEDPDAEARRQENKVW
FT                   AAKAARFYGGAGLQLEESTPERFLRLAKLAKEWRDQRSQNSFSQALFSSAEEKMSPKEL
FT                   LQSAVEGASLGACA"
FT   gene            <217787..219742
FT                   /locus_tag="MICPUN_56687"
FT   mRNA            <217787..219742
FT                   /locus_tag="MICPUN_56687"
FT                   /product="predicted protein"
FT   CDS_pept        217787..219739
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56687"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR006636"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013105"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR041243"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z1"
FT                   /protein_id="ACO61641.1"
FT                   /translation="MADEHKVRVPTRLRSPSSRLRRSRSCYPISRVGARSSSFHRLPTG
FT                   EIARSIRRCSVHSAAYPPDTDLAMIHRYVAAQALGNAAFSAGNYADAVKHFTDAIGVDA
FT                   ANHVFYSNRSAAYAALNDFDAALNDAEKTVAIKPDWVKGHSRKGAALYGLKRYDDACDA
FT                   YQKGLDLEPDNDACKSGLADAETAAVRAMGAAGDGGDPMASMGAMLSSPELYGKLATNP
FT                   ATRGFLSQPDFIAMLTDVQKNPDKFGSYLSDPRMMQVLSVALGINVMSGEDAMKNPDAM
FT                   FTNKGEPTVPNVTKTTPPPPPAPEPTPMAVEPEPEPEPAGPKAEAKKEKELGNAAYKAK
FT                   NFDVALEHYDKAIALDGEDISFITNKAAVYFEKGDFDSCVKACDDAVEKGRELRVDYKL
FT                   VGKAMTRKGNALVKLDRLEDAIEVYGKSLMEHRNADTLKRLNETERELKERTKKAYLDP
FT                   AKADEAREKGNELFKAQKYPEAVEQYTESIARNPDDHRVYSNRAACYTKLTAFNEALKD
FT                   AEKCIELKPDWAKGYTRKGHVEFFTKQYDKALETYQEGLKHDPNNEELKDGLYRTHVEI
FT                   RKASTGQVDEKELAERQQRAMADPEIQGILSDPVMRQVLNDMSTDPKAAQEHQKNPMVM
FT                   AKIQKLINAGIVQTR"
FT   gene            complement(219756..220652)
FT                   /locus_tag="MICPUN_56688"
FT   mRNA            complement(219756..220652)
FT                   /locus_tag="MICPUN_56688"
FT                   /product="predicted protein"
FT   CDS_pept        complement(219822..220583)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56688"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z2"
FT                   /protein_id="ACO62086.1"
FT                   /translation="MARGAGARLGAASPSARVAPPTSSSSSSSSSRQTSHRRVTTTRRH
FT                   APPRGASSASDAPIASWMESLADRLPPRFPDAPDTYWRGAGSPAGNPQVHGDDSILDLL
FT                   HASGAFHRPRLMVDEGGARQRVMLSLRTGTRTAGHPGWTHGGLTSLLMDETAGQAFAHF
FT                   VQPSRGLGVTANLTVDYASPLPTAKDLLVVAGVGKVDGRKVWIDVQVRDGPPRDDGGDD
FT                   EAEKHSCAGDDDDDGEVFARGSALFVVLAKD"
FT   gene            complement(<221452..>222259)
FT                   /locus_tag="MICPUN_79584"
FT   mRNA            complement(<221452..>222259)
FT                   /locus_tag="MICPUN_79584"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<221452..222259)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79584"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z3"
FT                   /protein_id="ACO62087.1"
FT                   /translation="MQGIGRRDPGSKPGEAVLSCSFNQDRSCLAVATRRGFKIYSCDTG
FT                   TCVYDDSMGAVRIVEMLFCTSLLVVVGAGDTPELSPRRLKVLNTSNHTCIADLTFVSSV
FT                   LAVRLNRARLVVVEERRAVVHDLSTLCVQRTIDTVPNPRGVCALSHDEDSSLLALPAHT
FT                   HAGAVVIHDCVNLHVVCELQCHNSPLAACALTRDGAMLATASAKGTVIRVHCLPHGTKL
FT                   WSFRRGVVNANVRSLCFGAESTMDEPDPGAKLLAASSEKGTVHVWRI"
FT   gene            <222456..>224612
FT                   /locus_tag="MICPUN_56690"
FT   mRNA            <222456..>224612
FT                   /locus_tag="MICPUN_56690"
FT                   /product="predicted protein"
FT   CDS_pept        222456..224612
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56690"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z4"
FT                   /protein_id="ACO61642.1"
FT                   /translation="MVSGGEYQDVLVDALRGALGRDRPPRPPPVPDDVKSVGVQTPAAV
FT                   QNPGGLSGTDDGIPRGVCPACRRAPANWRACGECQRICADGGSSGGGDDDDDDVRPSRT
FT                   LASCLRRSKSRCLFRTWRRRVLSCAEERRDVEKATRHRSGVIFRTWREARRAVRVREHA
FT                   HAKASTFHRRRALKSKLAAWRVHARRVRHLTDLTRSRHQEKVVHGALNAYVRVRRLAPA
FT                   WRAWWRFHVTCDVARDRAEQLGEANVHNFFLVAAAFGKWRTSILHTRRARTERVAADVD
FT                   AKTAQLVERERALDELTGAIIREHVDRTDVELKRALRNEESVLEKLRLMELELRRKDVV
FT                   IEGREAQIATLTEDARAFEATLARRAVEASRAEREIIVAEHEREVAWLRAAVERAFEEC
FT                   VWYRKRYGAVDRDDDLHAFLVRIAGKDRAREMLPRGARLPWVESFAPERDQLATRLGGP
FT                   KQRRAGPVGSRVLGGVPRVPRHGRWGGAHPTHPVTAPWYPSSTLRAGGGSSVGGGSFPG
FT                   FGKGVGGSRAGLRASDRAWEAHRRGFVLASAASNARDFAASKLAIDVRGDATEHAAATP
FT                   RRSVEHEVQYTVEIPPSAAKTADSRPTPTRKSLLDEEESPDREKAWNDEARTSADDVSV
FT                   RSEREKAASVMSVAASMLDFDGEDDKDSASAAVCSDDSDDDLFAARVKPSVRVKPAIAA
FT                   AAKGGDDSDDDDDDWMFRGKGVKA"
FT   gene            <224689..>225282
FT                   /locus_tag="MICPUN_56691"
FT   mRNA            join(<224689..224971,225107..>225282)
FT                   /locus_tag="MICPUN_56691"
FT                   /product="predicted protein"
FT   CDS_pept        join(224689..224971,225107..225282)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56691"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z5"
FT                   /protein_id="ACO61643.1"
FT                   /translation="MSLTTARRALTRAVCPGTRASFSSSRVASAAATPAAKPKDGARQV
FT                   AEMTPEQIEELSVFQAVGGLTSAAIGGIVVFVIGAGATLGVASGISQVLGHTMNSKAPE
FT                   PPPPPTKDELRARLAEWRKRPRGPERDDAVRAIKDQLRELRRTEGSWW"
FT   gene            complement(<225348..>228875)
FT                   /locus_tag="MICPUN_56692"
FT   mRNA            complement(<225348..>228875)
FT                   /locus_tag="MICPUN_56692"
FT                   /product="predicted protein"
FT   CDS_pept        complement(225348..228875)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56692"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding; GO_process:
FT                   GO:42147 - retrograde transport, endosome to Golgi"
FT                   /db_xref="GOA:C1E0Z6"
FT                   /db_xref="InterPro:IPR012501"
FT                   /db_xref="InterPro:IPR039745"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z6"
FT                   /protein_id="ACO62088.1"
FT                   /translation="MRSSRRGGGRRADHPFPLVPRDPENLDRDPETLKRQTAYLACALN
FT                   DPTELNALHAAQTSATPDASEVLNSLGQYLGVPGFEREPSSGGARGLSAEERPPPLAKG
FT                   VLPEVARGDHDAYLRKVAGWGAFTAANADRRARDAEDEADGRRRNAFDADDDAEHSCAT
FT                   SGIPSSNGEENERRDATDRWTLQRSSDLDRHAHEDVPAMYFDDSFDLSDPAVFRRAFCP
FT                   DDDDDDLNDTAGESSRTAVRASTSSSHPTAVRRSRALFGLAAQTRLGSYLDKIETSLVL
FT                   AIGSRSESFFEASARLHELDAFVSETCETIERTRRTLLDASTYAARARESVASLHSKRA
FT                   NLAALADAFEQLATVRECREDLDVLRRAGDWGGSLEACEDVRRAIASPSLPPGLRLLED
FT                   VAHHADVTERDVVDALVCEFVRAARVQPGSVGYVQHGGERGDDGGGDSPGGDSPGGDSP
FT                   GGGGSWSPATTRAALAAVRAAARDAGMEGVEDEEEDEDEEDAYETDTGLGPGETSAADV
FT                   RESLLPPLMALTRGATDRVSGGRIADAMRAWGRTAAADARACVRAACIACIAAVQPGGE
FT                   YAVAEPGGRNASPESFSGGGRDGIIQRAIGALPPSVFAVVVRAVTVALAGHFARADIVR
FT                   SAVRSALGTAPRRGDDDVGRGQKTKNDDEKNASGTPTDECARAACAALPAGERAAASAA
FT                   ASDAVLALTDAAQGAVARAIASLTKGCTLAEFSNVCDAADDFLERAERLGGGRRCLALR
FT                   ATLAAQCKDLFAARHAAFAAKLGVVLEAETWTAATPVPPEFQRVLDDVVSFAAAGREGN
FT                   EESGDASVTTNGDASSCASADALMFPNTGERVVPVGASLALLKMLRDHVASAARFPSLA
FT                   PTAVHKTAELLRVFNARTAALVLGAGAMRTAGLRSITAKHLALATESVRLFSLVTPLLS
FT                   AALAPALPQSRRRGLLADFDATVKDLATHKRELHAKTVGIMRDRLAHHSSRLPTIWCSR
FT                   VFTGRSRKAGSSVGWRERTEEDESKGESKEDAEARGPSEFATALGKEIGTLRRVIAGTL
FT                   CARDASAVLDEVLAHFDECATGTLREARRSVAKEWMAKMGDDSGEGSGSGDGAGAEGVA
FT                   EGGAEGGAEGGDDAEIASKAPPSDEEVRALIALDGAALLECLGTLVKGGEGGDGAVGAP
FT                   TLTRFLSEL"
FT   gene            <229247..>230182
FT                   /locus_tag="MICPUN_68058"
FT   mRNA            <229247..>230182
FT                   /locus_tag="MICPUN_68058"
FT                   /product="predicted protein"
FT   CDS_pept        <229247..>230182
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68058"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E0Z7"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR039171"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z7"
FT                   /protein_id="ACO61644.1"
FT                   /translation="IRDPEADGWERTDFPIVCEDCLGPNPYIRMQREDYAAECAISSRP
FT                   FTVFRWRPGNEARYKKTVVCREIALAKNVCQVCLLDLDYGIPVQARDAVLGKEREMIAK
FT                   SDVNLEYQTEQIARRLEEGDEVAIRDQNRAVGKVRAAELLQKMARKKPYYNKNKAPICT
FT                   FWLRNACTRADCPYRPCNGDTHMPELTSAPELRQQNIKDRYYGINDPVANRMLAKANES
FT                   KQDLAPPADESITTLYVGGIDDRVTEDALKDAFYQYGQISSVRTLYAKNCAFVTFVDRA
FT                   GAEKAAEECGSRKAISGINARIMWGKSKKEK"
FT   gene            complement(230530..231205)
FT                   /locus_tag="MICPUN_107872"
FT   mRNA            complement(230530..231205)
FT                   /locus_tag="MICPUN_107872"
FT                   /product="predicted protein"
FT   CDS_pept        complement(230582..231181)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107872"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16757 - transferase activity,
FT                   transferring glycosyl groups; GO_process: GO:8152 -
FT                   metabolic process"
FT                   /db_xref="GOA:C1E0Z8"
FT                   /db_xref="InterPro:IPR000312"
FT                   /db_xref="InterPro:IPR035902"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z8"
FT                   /protein_id="ACO62089.1"
FT                   /translation="MGFMFAPRYHPAMKAVVPVRKALKVRTAFNMLGPMLNPAGTQYAL
FT                   VGVYTPDLQPLMADSLMALGMKKALVVCSTVGDLSLDEMTPCGPTSVVEVTPAGTKSYS
FT                   FDPKDVGIPPCELKDLAGGDAKLNARMLTDALGGEKGPVADCLMLNAGVAMAAAAQAES
FT                   VEEGVAMCKEAHAQGKAGDTLRSWIELSQELKLQEA"
FT   gene            <232035..>232694
FT                   /locus_tag="MICPUN_56695"
FT   mRNA            <232035..>232694
FT                   /locus_tag="MICPUN_56695"
FT                   /product="predicted protein"
FT   CDS_pept        232035..232694
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56695"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E0Z9"
FT                   /protein_id="ACO61645.1"
FT                   /translation="MSTIWRPDLLSGDHIVVKEESDDDHQPPAVDVEPPADDHEEDEKS
FT                   EDLAGKMSTIWRPNLSRLYASVAEMEGSESEEEEKDATKKGVKRKRAPPTKGPCEHGVK
FT                   PRSKCKVCSACPHGKWRRFCKECGGASICQHGRQRSKCKECGGGSICEHSRERSQCKEC
FT                   GGASICVHGRQRSQCKECGGASICEHGRRRSECTECGGASICEHGRRRYRCKECKK"
FT   gene            complement(<232735..>233526)
FT                   /locus_tag="MICPUN_99299"
FT   mRNA            complement(<232735..>233526)
FT                   /locus_tag="MICPUN_99299"
FT                   /product="predicted protein"
FT   CDS_pept        complement(232735..233526)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99299"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E100"
FT                   /protein_id="ACO62090.1"
FT                   /translation="MHCAARAGHLDCVRALGADRERGCDVNARDDHWGTPLHAAVGEGH
FT                   VAIVDWLLANAGADVDAADRDMCTPLHESVRWADARVTAILLARGASPAKRTKRGLTPL
FT                   HVAVAGFGATSRASAAAASALSLHGFVGDGARSDSKRILRLRRGGQVEDGDWYDLRADQ
FT                   ARRDDIVDALLASGACDVDARCFEGGSTPLYLAARWGHAEWVKKLIDAGADVDAARERP
FT                   DPGLGGSVVGPGGPTPLQAARAVGHSECVAVLLEHGAAEAA"
FT   gene            234697..236123
FT                   /locus_tag="MICPUN_56697"
FT   mRNA            join(234697..235213,235374..236123)
FT                   /locus_tag="MICPUN_56697"
FT                   /product="predicted protein"
FT   CDS_pept        join(234773..235213,235374..236045)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56697"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E101"
FT                   /protein_id="ACO61646.1"
FT                   /translation="MSFGTPGAFGGGGGFGQPAQSPPGAFGAPSPTQPTQVPNPNNDFQ
FT                   VANPPNDGISSLSWSPVANFLVATAWDGDVYCYEVGNNGQAVPKASQKHQGPVLCSDWS
FT                   HDGSAVFSGGCDNKAQKWDLATNTPTQVAQHDAPIKELCWIKEVNLLATGSWDKTLRYW
FT                   DTRQPTPALQVQLPERCYALSCSHPLLVVGTAERHIQVYDLNNPNQPFKQLQSPLKYQT
FT                   RTVAAFPDKSGYLVGSIEGRVAVQHVEDAQQSKNFTFKCHREQSDIYAVNDIKFHPTHG
FT                   TFVTAGADGVFNFWDKDSKQRLKQMAKCNSTIPCGAFNRDGSIYAYAVSYDWSKGGQDP
FT                   MAQSGQNNIFLHAVQESEVKPRPAAVRGRR"
FT   gene            complement(236072..>238801)
FT                   /locus_tag="MICPUN_56698"
FT   mRNA            complement(236072..>238801)
FT                   /locus_tag="MICPUN_56698"
FT                   /product="predicted protein"
FT   CDS_pept        complement(236336..238801)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56698"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR038925"
FT                   /db_xref="UniProtKB/TrEMBL:C1E102"
FT                   /protein_id="ACO62091.1"
FT                   /translation="MATCLEPGRAAWRGPVNARGALRGDSTGRPRRAPRPAGTPGTSGE
FT                   RSRSRGARLVNRARADEDGRDAAAAAARLAPLEASTAAGSELERILKTDPVAFERALSD
FT                   QVGSRPPAPPPLLPQSLLSEFTLFFWPTRLGFWPAAARRRGRWDARTRPERAGEGYECG
FT                   CFGASSEGAGGGPRAESPRARSPLASRREEKAQRPLFSRFSARANNASSHERFTRMLTE
FT                   SIPPPIVFPRSQLRAMASDVFHPSFPGGRSGSLRDRVGGSFGAQPSSLQPGHSCDLREK
FT                   PGAGDGFPSTEYLQLEGVISSKGASSGAAEGGAEGGADASMSRLDKSSKGAKNGHPKEP
FT                   CEDERNPSSRPNADKAERVILSELADAVAFGAKVDRANELRDAMYLSVVARHCALGVPL
FT                   VPEVEAFQGSRGSSRGSALFGGSVSGRGVGGGGGRRTGAHDRKVSRLVRECLPTGADEL
FT                   IERHIDRIISDVEAFGLSDGALAGAYRKSALFGYFLRCAATRLALEHSFQATPTRDERL
FT                   PGDDEEHARHLREDGYELVSNISSLPAYPSSIGDWIAEDGDDVDDEQRVDPAVSEARAR
FT                   RRREAEATFRAQATRAKAEATSRTARSDITESTSPRTAGSDEFDADSPEAELERARERR
FT                   RERQWRRALGGAYPDRPLAAFPSSIGDWIASSSSADDDAEYDEPFYEKPIFDAVEDADA
FT                   APNLRAFVDAMEPTLRAQLATIGQADVAAVLDSHVAALFYGDVEAAPRDVRGATAGGDG
FT                   VEAEVVSFDFAGLAGLSKGLMPLDGLRYMVVEACAFGASLWSAERRCERYDLTRRSVDG
FT                   AKDQSESRR"
FT   gene            <239434..240417
FT                   /locus_tag="MICPUN_56699"
FT   mRNA            join(<239434..239751,239877..240417)
FT                   /locus_tag="MICPUN_56699"
FT                   /product="predicted protein"
FT   CDS_pept        join(239434..239751,239877..240353)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56699"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E103"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E103"
FT                   /protein_id="ACO61647.1"
FT                   /translation="MSVVAASTFAPFSARVRSAIPARSRRASPSSTRRPVATARAEAEA
FT                   EAGGEGSTLSTTPRTAGRRAGLAAGAGLALAAAAFPARAIGGAAVGLPDVVELTPDNFA
FT                   KQVEVPGTTFVEFYAPWCPFCQRLEPIWNELPNRLKEKGVDTKIARMNVDTYVDYGERF
FT                   GVTGFPTLMLFKDGRPVGQKTGLTDMNTLMKYAGYKESGPLAALAGAGAEMNLVLSGEQ
FT                   VQSAADELNELRRMINGEVDGDKASALAHIDAVERLFAKRAL"
FT   gene            complement(<240489..>242924)
FT                   /locus_tag="MICPUN_80244"
FT   mRNA            complement(join(<240489..240821,240933..242246,
FT                   242376..>242924))
FT                   /locus_tag="MICPUN_80244"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(240489..240821,240933..242246,
FT                   242376..242924))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80244"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:50660 - FAD binding; GO_process:
FT                   GO:8033 - tRNA processing"
FT                   /db_xref="GOA:C1E104"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1E104"
FT                   /protein_id="ACO62092.1"
FT                   /translation="MLSAVARRASRAAASASSSLGASRVPRRAARDEAARHAIVLTADA
FT                   RRGFASASAHRPTDFDVVVIGGGHAGAEAAAAAARRGARVALVTPSPLGSVGEMSCNPS
FT                   IGGLAKGALVREIDALGGIMGAAADASGIQFRVLNASKGPAVRGPRAQMDRTTYKRSVQ
FT                   AMLFGTPNVEVVDAAAYDLITCAVAGVETADGRKITAEAVVVATGTFLRGVLHVGGRRI
FT                   PAGRMPTAITENPDATAARGAHALADRLYGLGFQMGRLKTGTPPRLDGASIDYSGLEEQ
FT                   RGDEPPRPFGFLHDKAWVPPMKQVSCWATRTNAETERVMKESRGFLNFEGGENGEAIGP
FT                   RYCPSLEMKVKRFPGRSHIVWLEPEGLDTDVVYPNGLSNTLDEPDQIAMLRTVAGLENV
FT                   KMLRPGYGVEYDYVDPRELRWTLETKRVGGLFFAGQINGTTGYEEAAAQGLVAGANAAA
FT                   TALSRLGMDALPPSIVGRGASYLGVLVDDLTRRGTSEPYRMFSSRVEHRLSVRPDNADQ
FT                   RLTAAGELAGLVDSARALIARRRGDATDRAIAALEDARMGAQAWAAHGVDNAPAGKSGR
FT                   TVSAAELLAIPGVGYARVTSALAEAGKTTGESTASGGIDDSRADSATVECYYAPYLARQ
FT                   RRDVETMRKEEAMELPMDLDYDAVGGLSAEDREKLKEFRPATLAAAQRISGVTPSAAIA
FT                   LFRFVAAQKLKGNNKRFSGRRGAVTNGGRDPLMESAL"
FT   gene            <243095..>244198
FT                   /locus_tag="MICPUN_52141"
FT   mRNA            <243095..>244198
FT                   /locus_tag="MICPUN_52141"
FT                   /product="predicted protein"
FT   CDS_pept        243095..244198
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52141"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E105"
FT                   /protein_id="ACO61648.1"
FT                   /translation="MLHSWEKIPRSHTSDPEEVCQLSSPTCHLFEIKFGEVDQIAQSSR
FT                   ALPHPRSAMSLVFASALARPTPAPVAGSRRIAPGAAGKPPRPSASPVVAFAKKKGKGGS
FT                   RDGYDDWDDGFGSGSGNYDANFNSIDDDFYTGAGGDYDSFGSKSGAAKPESGKKKGAAK
FT                   RAKKAKGSDVDDGYAPVAGDVSRLIRSKAPAKPESGAIGSSLDSGDGPNFVRPLDGWKK
FT                   KGEASSYGDVFENSAAFSMDDGDLDFGAEPLAAEPIDAPRVVTVAKAVPKKEKREEAKE
FT                   AKAVDPADPGKGEKKASQTLKKWGFAQSNIDDALGATEEAAATAVGEGQTAYNKRRQVL
FT                   ALDWLLLNAPEDAIPMDYRNDAIKARS"
FT   gene            complement(244266..245497)
FT                   /gene="RPE"
FT                   /locus_tag="MICPUN_104768"
FT   mRNA            complement(join(244266..245044,245282..245497))
FT                   /gene="RPE"
FT                   /locus_tag="MICPUN_104768"
FT                   /product="ribulose-phosphate 3-epimerase"
FT   CDS_pept        complement(join(244436..245044,245282..245479))
FT                   /codon_start=1
FT                   /gene="RPE"
FT                   /locus_tag="MICPUN_104768"
FT                   /product="ribulose-phosphate 3-epimerase"
FT                   /note="Ribulose-phosphate 3-epimerase, chloroplast
FT                   precursor; predicted (ChloroP & TargetP) TP 1st 36 AA;
FT                   GO_function: GO:4750 - ribulose-phosphate 3-epimerase
FT                   activity; GO_process: GO:5975 - carbohydrate metabolic
FT                   process"
FT                   /db_xref="GOA:C1E106"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:C1E106"
FT                   /protein_id="ACO62093.1"
FT                   /translation="MSAVTNSAVFARKSLAGKAIANKRVATKARAAFNVSANAKVDACD
FT                   KNSVIVSPSILSANFATLGAEVKAVDEAGAEWIHIDVMDGRFVPNITIGPLVVDALRPV
FT                   TDKVLDTHLMIVEPELRVADFAKAGSDIISVHAEGASTIHLHRTINQIKDLGCKAGVVL
FT                   NPGTHPDCLEYILDCVDLILVMSVNPGFGGQSFIESQVDKIKKIKAMCDAKGVNPWIEV
FT                   DGGVSPANAYKVIDAGANALVAGSAVFNSDDYAKAIAGIKASKAPK"
FT   gene            <245771..>246711
FT                   /locus_tag="MICPUN_56703"
FT   mRNA            join(<245771..246097,246346..>246711)
FT                   /locus_tag="MICPUN_56703"
FT                   /product="predicted protein"
FT   CDS_pept        join(245771..246097,246346..246711)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56703"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1E107"
FT                   /db_xref="InterPro:IPR001854"
FT                   /db_xref="InterPro:IPR036049"
FT                   /db_xref="UniProtKB/TrEMBL:C1E107"
FT                   /protein_id="ACO61649.1"
FT                   /translation="MAAFTVSMSALVGAPVKVRRIARARAQFVPSSVVGTSPAPQGFHG
FT                   RSGEKASGERRAETTRRENRERSTRARHATGARARSSLAILAARESGEAARRSQTARAA
FT                   RDVIAARAVVARKAVQQRGARLIVRAEGEEAKADSFAGLKPTKAADFKSMSNDELNAQI
FT                   VEAKKMLFELRMKQSTRKEYKGHHFGILKTKIAQIRTVKREREVTEGVNKRDSRKIKRE
FT                   ERAANIYL"
FT   gene            complement(246847..>248274)
FT                   /locus_tag="MICPUN_56704"
FT   mRNA            complement(246847..>248274)
FT                   /locus_tag="MICPUN_56704"
FT                   /product="predicted protein"
FT   CDS_pept        complement(246949..248274)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56704"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; metalloendopeptidase activity
FT                   - protein binding [PMID 4222]; GO_process: GO:6508 -
FT                   proteolysis"
FT                   /db_xref="GOA:C1E108"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:C1E108"
FT                   /protein_id="ACO62094.1"
FT                   /translation="MAPLRASSIVRRGLPDARDDEALIATPVVEVDEATPREDDVDEWF
FT                   PPFAASAPKLGLAGLGAGLLNTGFELDGPASTIEAIVVLATIIFVHECGHFFAARLQNI
FT                   HVSKFSVGFGPNLLSYKGPEVEYSLRWVPLGGFVAFPDDDPDCPYPQDDPDLLRNRPIK
FT                   DRAIVISAGVAANVAFALAILNFQVNTVGLVEQAYKPGVKVAQLLSTSAAREYGVKVGD
FT                   VITAIDGEALPAAGKSVNDVVAKVKAAGSNPVRLKIQRFGTNGPAPPVDIEVVPKTGVN
FT                   GEGRIGVQLEANAEVRKRVAGNPAEGLFLATKEFARLTGLVCKSLFSLVSNFSQAKDNV
FT                   SGPIAIVGVGAEVMRGSDLSGLYQFASVININLAVVNILPLPALDGGFLLLIAVEALRG
FT                   GKKLPAEVEQSITASGVLLLLGSGMFLILRDTLNLVGSLGQH"
FT   gene            <249135..>249962
FT                   /locus_tag="MICPUN_79493"
FT   mRNA            <249135..>249962
FT                   /locus_tag="MICPUN_79493"
FT                   /product="predicted protein"
FT   CDS_pept        249135..>249962
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79493"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E109"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1E109"
FT                   /protein_id="ACO61650.1"
FT                   /translation="MEVDPPPAAPASAEPGSPPAVNPAPVAPRRIGHWQVDKQIGRGSF
FT                   AVVWRARHAETGQRVAVKEIRLDKLNRKLRESLESEIQVLQRSRHGNIIRLHDIIKEEK
FT                   RIFLVLEYCAGGDVSEFIKKHGRVREDVARHFMRQMASGLRAMRAQNLIHRDLKPQNLL
FT                   LTVASPDAELKIADFGFARYMHPTGMAETLCGSPLYMAPEILGYQKYDAKADLWSVGTI
FT                   LYELLVGRPPFTGMNPMQLLRNIERSDAKIPSKVANGLSRECVSILRGLLRRNP"
FT   gene            <250416..>252305
FT                   /locus_tag="MICPUN_52144"
FT   mRNA            <250416..>252305
FT                   /locus_tag="MICPUN_52144"
FT                   /product="predicted protein"
FT   CDS_pept        250416..252305
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52144"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E110"
FT                   /protein_id="ACO61651.1"
FT                   /translation="MGVRDVAAAAAAAGTNWLSTSPLSRRPGFLGGTSPGGGRPLGGSG
FT                   SHQKPPLSSSPSVARAASFGGFTPGGDGVSVEIQPVPFSLQGSKARSGSDRSLNSMDAE
FT                   YVLVEDDKSGGDKSGGLASMESSPGGSLPSGGGGGGGGLTQMAAGLTRRLSSNLGAVIL
FT                   GSSPPPSKFGNNHHHVTSSSSSPGRELYRMSSSPGGTGLGSGGSPGSFPPRPGSSRHSP
FT                   PGMLGEFRNSPSYPSSRVSSARSGGGGGSGLALGAGASLAPSQSPSEKEAAAALALARV
FT                   AQAAAAAAPGEKRFASAAQRVSVLERAATVLRDVAMERWDSGKKLDALSVSLVSLTALR
FT                   EGYKLAQAVAKEAAEAEACSNAPQGVGPLDGSRNVRLSDMSDSSRSSGGGGGGDCASRP
FT                   ASASSSSSGSPPWIPGRSSSSSQSGTIGSSAELPRLSSKTPERLRKDRERAVKTAERIK
FT                   NAFNAALTRADRAAAAVKGVGVEGSAVLPDAMDLAYDAALALGRSGAVEELMGNTRTAL
FT                   EAYSRAQTLLVFILSEGPRFVTARDEQSGDERAATDAERETAAALVSAPGRAAGDGVET
FT                   GDGSRLITPSVHPCDEFPARGRIARFVGAIGARQQACAATAMRSSSGATRRPP"
FT   gene            complement(<252548..>254692)
FT                   /locus_tag="MICPUN_56706"
FT   mRNA            complement(<252548..>254692)
FT                   /locus_tag="MICPUN_56706"
FT                   /product="predicted protein"
FT   CDS_pept        complement(252548..254692)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56706"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1E111"
FT                   /protein_id="ACO62095.1"
FT                   /translation="MASSDWESTHLVVGAPEGVVELARDLTPLCDILKPDSEVGKVDLI
FT                   RAKATRLIRVCMRTRIGRECLLRRGGLVPSLLAALAPVAKYEDAGADAGADAGADAGAE
FT                   GEEGDGVGPKDPVLEHAMVCGDLLVKLACASTQTALELVEEHGVVETFHALLRRHDADS
FT                   RACGAVGLRKFAKFSERAAREMVWRGVMDDVRAMLPTCDRYRTPPTTPLAMEKDNILAD
FT                   AFGVGAGDEARAKKVDLEALLSSRKRSSKKDETDETEGGGVVYDGPAVPNMGKPPPPPP
FT                   PFVPKANTPRVVAEVMELLGALLCHSFVADQFIGRVGGDVNKRGLLPSGKHRPTWTTTI
FT                   THQCAPAATYAPPPPPPPPPVMVRKLDEEGNPVQATDEEGVPIVDDEGEPVYEMVEEKP
FT                   KTEETEGVEEPEPEPEPEPEPEPEPLAVSEPEPVAKAEVEHDDMLEEYQPVLIEGDAPC
FT                   DDFLACSASLRCLEHAARHPRCRAELLEDDGAHCKRLAAIVRCNMPHCAEPALRILLGI
FT                   MSWAKHEGPNATGPNSFKDLREAQGRVRGGQGGALAAVKAAKAAREAEERETKGGARAY
FT                   DILRCEEVRGAVMSADLGPEDSVMHRSLRSAASHALAGYELTAILPPPPPPAPVPGMEV
FT                   TARAPLPNHKTTPLLETIEKQTLGREIAERDEMREPFFDQVLTIKERLALRYRQTRGHR
FT                   TSRSGSVKDPNELEEVVTEA"
FT   gene            <254745..>255992
FT                   /locus_tag="MICPUN_56707"
FT   mRNA            <254745..>255992
FT                   /locus_tag="MICPUN_56707"
FT                   /product="predicted protein"
FT   CDS_pept        254745..255992
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56707"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E112"
FT                   /protein_id="ACO61652.1"
FT                   /translation="MRLVASGFGAPASSAAATSSSVGSTTLSNGCSWRHTASTQARHPT
FT                   RCRRISPCLVASAWIARRPARRAASSASASRSFTRLSTTSVSASTSASFLKRRGGASRP
FT                   GRGVRMAFGRVDAGSTRLVPNRDRRLLLGMRAIASSGADVPGIRREFPQLRGGVRASRV
FT                   VGRVAKLLGDRRDEVGTIPILRALPRHGASRVWGAAVRIGLSVIVRHARVEKTEMRGTR
FT                   VIRARGAMGRGGHSDDEGTPYDQRLEEVEFMRSACVAAQRGDVDKLRAMLHRRPDVMLD
FT                   DGVGGDSGYTPLHYAAREGHAECVRALLASGANANARTRAGGATPLHRAAFTGSGACVM
FT                   LLLEGGADPCLRDADGESALHKASANGHADVVRALLRAGGERGIAGERDRKGMTPVERA
FT                   ADEATRAAFGDRVGNC"
FT   gene            <256081..257508
FT                   /locus_tag="MICPUN_56708"
FT   mRNA            <256081..257508
FT                   /locus_tag="MICPUN_56708"
FT                   /product="predicted protein"
FT   CDS_pept        256081..257505
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56708"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E113"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:C1E113"
FT                   /protein_id="ACO61653.1"
FT                   /translation="MPKTPASYETKDLKKLKVADLRAILESKGLDATGKKDELIEKVQA
FT                   SNDAPEPAPEPEPEPEPEPEPEPAPEKSPPAKKPAAKEKPAAKETPAAEEDDDDEPRRA
FT                   NDFFFSTAGADDDDDDDDDEKDEDPAPEPEAPVDRDDDRPATDTRDADDDADDDDDDDT
FT                   AGDEIYLGFLGENCNREFIANLLRPFFECERVHLPMQSAPGGGPKRPKGYAFVRPPRGT
FT                   PDSALAAAVEKLNGSASYPGAKHPLKIAMATRKTNDDDDARGTKRRRDGSGSGGVPQGK
FT                   SPNRLYVLGLPRHVTEVLLKEFFSRFGAVTDARVLASRDGEDDVGPRRGTVTFASADDA
FT                   ARARAETDNTRAFHGGGELKVVYSNLRDGEGGRRGGGGGGGGGGVGGGGASAQPWSVYP
FT                   MQPGMPMYTPMAAVALDPATGQPFAPTGVAAGAGLADHPAAVPPTGLSEAGYTGVHLAG
FT                   LPPSATVDAKYAHLYQ"
FT   gene            complement(<257608..>258612)
FT                   /locus_tag="MICPUN_56709"
FT   mRNA            complement(<257608..>258612)
FT                   /locus_tag="MICPUN_56709"
FT                   /product="predicted protein"
FT   CDS_pept        complement(257608..258612)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56709"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E114"
FT                   /protein_id="ACO62096.1"
FT                   /translation="MATKTTIWRPNVRVSLDEYGEVEDTESGGEEVAKQGTKRKRAPPT
FT                   KGPCEHGVKPRSRCKVCSACPHGKWRKQCKECGGASICEHGRIRSVCKECGGASICEHG
FT                   RQRSQCKECGGSEICEHGRHRSKCKECGGSQICEHGRQRHRCKECGGSSICEHGRHRPQ
FT                   CKECGGASICEHGRHRYSCKECGGASICEHGRHRSKCKECGGSQICEHGRQRSRCKECG
FT                   GGSICEHGRERSLCKECGGSQICEHGRRRSRCKECGGGSICEHGRIRSQCKECGGASIC
FT                   EHGRQRSQCKECGGSQICEHGRRRSQCKECGGGSICEHGRIRSQCKDCRCERL"
FT   gene            <258710..>259990
FT                   /locus_tag="MICPUN_56710"
FT   mRNA            <258710..>259990
FT                   /locus_tag="MICPUN_56710"
FT                   /product="predicted protein"
FT   CDS_pept        258710..259990
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56710"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; zinc ion binding - nucleic
FT                   acid binding [PMID 8270]"
FT                   /db_xref="GOA:C1E115"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C1E115"
FT                   /protein_id="ACO61654.1"
FT                   /translation="MSREGEAPDPPGPLPATPALCRHWARRGRCDYGDGCRFRHERVPG
FT                   DDADADDPRVSAMDGRREGATRFGRRHHARNRNKAGDFRRWLVATFGFETLASGAGVLD
FT                   VAGGKGELAFELRNLSGIPVTVVDPRPMRLERYVRRFRSGMYHRNQSPAAAKLRRPLDS
FT                   TLAAPDHLRMFLHRGVFDPARSDGERRLAAIESHRLSHATRWSRRGLVDGESAPGDGDG
FT                   DGESAPGDGVRDGANLDEAYRIPGEPVRHATMFSEIPRRRDPDADDVESDVYADVEADV
FT                   EADVDDPDAAAMTPVAMDASATADACERVFRDCSVVVGLHPDQATDAAVDLALAFGKPF
FT                   AVVPCCTYSRDFPHRRLPPGPGRPRGGGAVTTHAHLVEYLLAKAAPGTTIERDELPFEG
FT                   KNVVVYSLGDGGSELLCRAVDGLGVGE"
FT   gene            complement(<260485..>261324)
FT                   /locus_tag="MICPUN_99310"
FT   mRNA            complement(<260485..>261324)
FT                   /locus_tag="MICPUN_99310"
FT                   /product="predicted protein"
FT   CDS_pept        complement(260485..261324)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99310"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1E116"
FT                   /protein_id="ACO62097.1"
FT                   /translation="MASSDDDVTRPPEEGLTVSASIGPRFGNAGVWREAVANSYYAARA
FT                   DEDEISLRVAEADREARESARWREECEKERRAIAERIKARHGAYPPKPAPATPAEMDAR
FT                   RASKKAEIMRLSKRDEENKMLRARILPPHQYDGEFPEEMRKHGRVLEHGGVYADTALWR
FT                   RHEAEWEEFMETARGMSIIRKRQIPFPEAGGAALYRHLILKSIHEFNLSEEDAEKFAFR
FT                   RCAMRWHPDKVMTAVGIRLLPEEYDEVGAKCVEVFREVQEEHKNRLRLRGTLPSGCD"
FT   gene            262977..263830
FT                   /locus_tag="MICPUN_107875"
FT   mRNA            262977..263830
FT                   /locus_tag="MICPUN_107875"
FT                   /product="predicted protein"
FT   CDS_pept        263002..263742
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107875"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E117"
FT                   /db_xref="InterPro:IPR009453"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1E117"
FT                   /protein_id="ACO61655.1"
FT                   /translation="MIDKIIQLMEIGVHVAIVTAAGYPGDSKKFEGRLRGLLDSFKENE
FT                   LTAETRKRFSVMGGECNYLLEVNEEFELEFVDPAVWRDQPSTKNLYWYAQGEAKTKVEA
FT                   FLDRAEQFLKDEAEHLELDYEVMRKEFAVGILPQSSTVYENLEEISIGAMIELSDAEVP
FT                   YCAFNGGNDVFVDVGNKNIGLQTLMNYLGFEGHQTLHVGDRFTSTGNDSRVRDACSILW
FT                   VASPDETTFFMRLLYRDIVNARVL"
FT   gene            complement(<264888..>266273)
FT                   /locus_tag="MICPUN_79876"
FT   mRNA            complement(join(<264888..265283,265668..>266273))
FT                   /locus_tag="MICPUN_79876"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<264888..265283,265668..266273))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79876"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR004182"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="UniProtKB/TrEMBL:C1E118"
FT                   /protein_id="ACO62098.1"
FT                   /translation="MDVTGGPKSTGYAGATKAKAKSDGKDSLRKLFKLPDDEVLIEEYL
FT                   CALYKKILLQGRMYLFRNYVCFYSNVFGYQKNKVIPLKDVTIVRRAYTVKVVPNAIEIV
FT                   CNGKCEFFTSFIFPDRAYRNITNAWKECSQYAKIFAAADVDNSKVAAEMLVVPKFSSPP
FT                   SAEVAAMLGLRDGGDGGDDDDAGSKGSGPRSSGSDGPRSDDDVDDDVDDDVDVANEDDF
FT                   GERLVATSTPVPPRPSDMRTLEECVLECAVEDVFSLVWSDSAAGAFGAEDHASRGETAV
FT                   QTTKWSRHRHHGHARDLTFIAPVNASIGPKQTNCHQTQSYHACRGGALVVDTS"
FT   gene            <267775..>268128
FT                   /locus_tag="MICPUN_73414"
FT   mRNA            <267775..>268128
FT                   /locus_tag="MICPUN_73414"
FT                   /product="predicted protein"
FT   CDS_pept        <267775..>268128
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73414"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E119"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E119"
FT                   /protein_id="ACO61656.1"
FT                   /translation="ALLESWPDFRAATDRSNRQVLAPLTRGDLVTVSALPAVAEEALFR
FT                   GCVVPALGGGPLGVIVSGMTFGALHVGGGRNAAFAAWASAVGCLYGACAVGCGDVSVAI
FT                   AAHAMANYASATMW"
FT   gene            complement(<268216..>268902)
FT                   /gene="HPF_1"
FT                   /locus_tag="MICPUN_99313"
FT   mRNA            complement(<268216..>268902)
FT                   /gene="HPF_1"
FT                   /locus_tag="MICPUN_99313"
FT                   /product="cysteine-rich protein with zinc finger"
FT   CDS_pept        complement(268216..268902)
FT                   /codon_start=1
FT                   /gene="HPF_1"
FT                   /locus_tag="MICPUN_99313"
FT                   /product="cysteine-rich protein with zinc finger"
FT                   /note="Cysteine-rich protein domains are also occuring in
FT                   antifreeze proteins from insects"
FT                   /db_xref="UniProtKB/TrEMBL:C1E120"
FT                   /protein_id="ACO62099.1"
FT                   /translation="MEGSESEEEEKHATKKGVKRKRAPPTKGPCEHGVKYRSNCKVCSA
FT                   CPHGKRRCHCKECGGASICEHGRIRSTCKECGGATICEHGRRRSQCKECGGSQICEHGR
FT                   HRPQCKECGGSQICEHGRRRTECKECGGGSICEHDRVRSQCKECGGSQICEHGRQRSKC
FT                   KECGGSQICEHGRRRTECKECGGGSICEHDRVRSQCKECGGGSICEHDRVRSKCKECRA
FT                   AKARTG"
FT   gene            <269255..>272497
FT                   /locus_tag="MICPUN_99314"
FT   mRNA            <269255..>272497
FT                   /locus_tag="MICPUN_99314"
FT                   /product="predicted protein"
FT   CDS_pept        269255..272497
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99314"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; ATP binding - nucleic acid
FT                   binding [Evidence 8026; helicase activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1E121"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E121"
FT                   /protein_id="ACO61657.1"
FT                   /translation="MPRSVGLDASSREALLDLIYRLSREDKDGGDEGGGDARAARGRGS
FT                   GSVEGADEDDADADPTRVRKDRVKEARRAEKERERKEKVLAKALKKDRRASAAEGANSR
FT                   DDGDAKGWASSPHPPGSEVNVSVTSAQGGGETKVMKIKRAADLKDFLSAAKSKLKLKKK
FT                   PLSARLVPSGREIRDTLRLEPMATVSVSADPPTERARERDDDDEDEKSAPGTGDGDIGD
FT                   GDTGDDPTERLREAVASRLRNAERDVDRSRLPPGGSDDATADESTRLLSLLSIDRSERT
FT                   ANATSRQALPAAAVRAEIIAACVDSDSRVSVVTGDTGSGKTTQAPQFVLEHFVAAGEGA
FT                   RCGIVVCQPRRVAAVSIARRVAEERGERVGDVVGYRVRGESRTSNRTRLTFCTTGVLLQ
FT                   RLRWDPTLEGITHVFVDEAHERTADADFLLILLRRLLRSGAAPGLRVTLMSATVDAGRF
FT                   IDYFAGEPGEPTPRSTHIPGRTFPVDEVFVEEYLPSRRRDRGGGEKNGRNGRNGDGHEI
FT                   DYDLLRAAVDKASRDVQRHGQKPLGAVLVFLPGVPEISRAEQAVSDVRDVRVFPLHGQL
FT                   APEDQRAAFAPAPPNKVKVVLATNAAETSVTIPDVTVVIDTGRVKRMTFESRTQLASLT
FT                   EGWCSLASAAQRRGRAGRVRAGVCVRLYERWAAGKSPMADHDEPEMRTAPLDTLVMRAL
FT                   AIAPGEHPAAVLGEALDPPDADAVRAAVERLRAIGAVVVDPRRGNGPGDSPGVSTTPLG
FT                   FHLSLLPVEPRVGKMLVMGCVMGCLSPVLTAAAAMSCRPMFTARGGDRADASAAKRRAS
FT                   RGSRSDHLACVNAFDEWMGSSNRRRTCADLNLSHAAMQDVARTRTQLRKRLEEAGFSPG
FT                   APAANAQTDNDDFVRCVLVAGLFPNVARVGVGPSGRTRVLNNRGVEVAVHPSGVNAAFH
FT                   RDDVDGDDGATRQGRGRRTFSGGGPETGLLVYQEEVTTSKTFIRDTTAVPDASVLLFGG
FT                   ELCVDHASASVSVSTGRSSAVGGGTASRFTFRAPPETGVLFKLLRKELTAVLASAVGDP
FT                   SGNHGTLEGSARGRRVREVLETLFPGSGVSAR"
FT   gene            272657..274774
FT                   /locus_tag="MICPUN_107876"
FT   mRNA            272657..274774
FT                   /locus_tag="MICPUN_107876"
FT                   /product="predicted protein"
FT   CDS_pept        272672..273619
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107876"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8146 - sulfotransferase activity"
FT                   /db_xref="GOA:C1E122"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E122"
FT                   /protein_id="ACO61658.1"
FT                   /translation="MAGWTKTKTYDSHHFDSGAWDVVKPRDDDIVIATAYKAGTTWMQQ
FT                   IVAQILFNGEPPAAVGELSPWVDLRVPPREVKEGMVEAIPGRRFLKTHLPTDALDYNPS
FT                   QKYIYVARDGRDAFMSLMNHYKFGNEMWYGALNESPGLVGAKLPAWEEACEGKEGDEAI
FT                   RAVFDKWLNTPWGEHPWEKDGWPFWSLFYNMKTWWDAKDLPNVLMVHFTDLKKDLAGQM
FT                   RRIADFIGVPVDEAKFDAQVHACTFEAMKGNAAAVAPLGGAMWKGGADTFINKGTNGRW
FT                   VGVLTDEQVAAYEKAAQERLGGECAKWLAAGGDI"
FT   gene            274849..276953
FT                   /locus_tag="MICPUN_93648"
FT   mRNA            274849..276953
FT                   /locus_tag="MICPUN_93648"
FT                   /product="predicted protein"
FT   CDS_pept        275057..275593
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93648"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:19787 - small conjugating protein
FT                   ligase activity; GO_process: GO:43687; regulation of
FT                   protein metabolic process - post-translational protein
FT                   modification [PMID 51246]"
FT                   /db_xref="GOA:C1E123"
FT                   /db_xref="InterPro:IPR000608"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR023313"
FT                   /db_xref="UniProtKB/TrEMBL:C1E123"
FT                   /protein_id="ACO61659.1"
FT                   /translation="MSSLAKTRLQTERKGWRKDHPHGFVAKPRTARDGSVDLLNWDCKI
FT                   PGKAGTLWEKGLYPIRLEFTEDYPSKPPKVSFPAGFFHPNVYPSGKVCLSILNEDKGWK
FT                   PSITVKQILVGVQELLDNPNNADAAQEAAYKLFKKSGAEYAKRVRIEAAKYTEAPAGFV
FT                   AGGGATGAEDDVIVL"
FT   gene            <285066..>287648
FT                   /locus_tag="MICPUN_56720"
FT   mRNA            <285066..>287648
FT                   /locus_tag="MICPUN_56720"
FT                   /product="predicted protein"
FT   CDS_pept        285066..287648
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56720"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR009836"
FT                   /db_xref="UniProtKB/TrEMBL:C1E124"
FT                   /protein_id="ACO61660.1"
FT                   /translation="MRLLDLLPNDSWLASKSSGSSSFALLRRPDDRPVPSVSVADMRAH
FT                   IAFLRAVHVHSTRDESSSLYVDGPPLRAAVGDYLAWLAEVSLGPSASPGPCPGEMLVTR
FT                   APTLPVAWCWHVHRLDPHAYVRDCASLVGAVPYPVPGVGFASDEDQVASPQRRIDPPDP
FT                   VSSSSHLADILVAAIGRHAPFLWQVSGAAYNDDAFLLSAASRYEEFVAMTVRARGASLA
FT                   PPLDIDLAWHTHMLRDSEYLRESARMRGVELGAMAHDNGEGMGAHGDTSRLEAPWAKTL
FT                   AAFRETVDVSETDGATAMKSAFEAAVPRGARHRGYAPAWWFARGESVVVVDDFLSPEEC
FT                   EAIVSQMPGPESAMNCPSGKKAQMYVDGDASVEARIRAAVSVGLGFEGEPEASKSSLVL
FT                   EDIVNRETGIGGTRSDQFDPHRSLTVERTTPTVKLPARVSVGTMHPHRDRLAIYTLEGE
FT                   TMFEDDTLTADGYTCVVYLKADGGTLVLEPDECPGSGDASWTPPGAKLTRREIDVRPGR
FT                   LVAWPNHAFKHCAGRRDVVEGEDAVAESRWLLGPFHFTPGRARLPQVGDCGSAGSYDTG
FT                   PSKPPPPPFELADIWPDHKVEWDFTPPEPLKMHRSGEAFQQKLRADLNRFAGTYKAVFE
FT                   KGEISLGDEPFKFFGLLSYQPLNLCLLPFMFIPFIGCTTVNVSPTYLESYTITLRPIGL
FT                   HTPQRNYEEDVMYGNQKSCYFGKCHGSYSEVRRRAGPMHVTGVGEAKDDKYKSVVRLTL
FT                   VEANENELRYRRKGKDATAVFDAEGSRAASLARTYPEDPEHKGIFQEWLEENKKRPFWS
FT                   DLSICEDSAPPDKRILDIDGEMVVRDGEIVLTESVDGREPFTITLKKQ"
FT   gene            complement(287734..>291796)
FT                   /locus_tag="MICPUN_56721"
FT   mRNA            complement(join(287734..291455,291680..>291796))
FT                   /locus_tag="MICPUN_56721"
FT                   /product="condensin complex component"
FT   CDS_pept        complement(join(287793..291455,291680..291796))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56721"
FT                   /product="condensin complex component"
FT                   /note="Predicted member of the Structural Maintenance of
FT                   Chromosome (SMC) superfamily and a member of the condensin
FT                   sub-family;predicted homolog of Saccharomyces cerevisiae
FT                   SMC4. ChromDB ID: CPC20101; SMC protein group;
FT                   GO_component: GO:5694 - chromosome; GO_function: GO:5524;
FT                   protein binding - ATP binding [PMID 5515]; GO_process:
FT                   GO:6259; chromosome organization and biogenesis - DNA
FT                   metabolic process [PMID 51276]"
FT                   /db_xref="GOA:C1E125"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR010935"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="InterPro:IPR041738"
FT                   /db_xref="UniProtKB/TrEMBL:C1E125"
FT                   /protein_id="ACO62100.1"
FT                   /translation="MTAPSSDAGVKKPRLVIKKMVLENFKSYAGAQHVGPFHKSFSSVV
FT                   GPNGSGKSNVIDAMLFVFGKRAKQLRLNKVSELIHNSTDFRNLEYARVEVHFHQIVDKE
FT                   GEDFEAVPDSDFVIAREAYRNNTSKYFVDKKTSNFTDVTNLLKHHGVDLNNNRFLILQG
FT                   EVEQISMMKPKAANPGDEGLLEYLEDIIGTNQYVEPIEQKSKALEELNEKRTGQVNRLK
FT                   LVEKEKDVLDDARQEAEAFMAKERECLRHKTVAYQMYVKDARDNVAKIAESVAELEAKL
FT                   EEEKAKSTEYDKAVEELEVVVKEHAVKLNELKGELDRATKEFAEFERKDIKHREDLKNM
FT                   KSRAKKLDEKVAKDTKKRDDMAKECEAIEKEVPELEAKKAELESRVEKEEATLDAMLES
FT                   LKGEMAAIGAELERAQAALSPWEGKIADAKAAVDVAVTERDLLATEKEDAKRRFEEAKA
FT                   GAEAAVALAKSKTEEIADAESTLESERSRAAERREAEAAAKEQERRANEMTREIRGKLA
FT                   QSKSAADQAKSQSVIVQSLMTAKSKGKIKGVLGRLGDLGAIDKKYDVAVSTACAALDYI
FT                   VVETTADAQACVAHLRSNNLGVATFLILEKQRSLEGKMREAKKTSAPASGAPRLIDLIK
FT                   PAEPRLEVAFYYGVRDTAVADDLDAASKIAYGGNVRRRVVTLQGQLIETSGTMSGGGSK
FT                   PRGGRMRTGTAAPDLDGEGAESAAAVAQAEADLKKASVTYEEAHKAAVSAGKEAKDAEA
FT                   AVAKLERSLPKLRAEVIAAEERAADLEGRLGELEAAAKVTKEDAAELKRLEKAVADAKA
FT                   LYEKVVADAAGVRAECEALQAKMDAVGGEKLKKQKALVKDLAAGIAAAGDAATEKRATA
FT                   ASHAKATARLEKAIEEAVAERAKLSEDVKTIKAEFAALEEGAMAVLESQKELQGLVDAK
FT                   SAECAAASKARDAAVKEMAALKHVEVDIQSKLEDLDAQSKENDDKAKHWDKELNKLRKE
FT                   QESLHAECEVPVPELLTPEQLDTVDAADEMRRAGALEEELKEMKPDMSSIEAYRVKMGE
FT                   YDERNDELKSVTEQRDETRAQFDELRKKRLDEFMAGFNVISLRLKEMYQMITLGGDAEL
FT                   ELVDSMDPFAEGIVFSVRPPKKSWKNIANLSGGEKTLSSLALVFALHHYKPTPLYVMDE
FT                   IDAALDFKNVSIVGHYIKERTKDAQFVIISLRNNMFELADRLVGIYKTNNTTKTVAINP
FT                   GAFAVGADNGSAKKAADASAAGDEENRAPNAIAA"
FT   gene            complement(<292157..>294679)
FT                   /locus_tag="MICPUN_79795"
FT   mRNA            complement(join(<292157..293694,293761..>294679))
FT                   /locus_tag="MICPUN_79795"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(292157..293694,293761..294679))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79795"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5524 - ATP binding"
FT                   /db_xref="GOA:C1E126"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C1E126"
FT                   /protein_id="ACO62101.1"
FT                   /translation="MNRDLQRLYASTPAPEANDANGGEEKAAFAPPHVVAAAAQRALAA
FT                   EGKAGGGAPSGGSGAHPAAPASRREESADAAAATHVAAIALARARRLQEAERGNRRNRR
FT                   DNRRVNNKKNRRNKSEFGDDFLEDYLPGGSKYKPGGVGNGPGDPFGPGGGDGVNTFQPV
FT                   PPRDVTLADLGGIEESLRAIRELILCPLTHPELYSWLGVDPPRGVLLHGPPGCGKTTLA
FT                   HAIAREAGVPFFSIAAPEIVAGVSGESEAKIRQLFAAAAAAAPSIVFIDEVDAIVPKRE
FT                   SAGRQMESRIVAQLLASMDNLNDGVVRGHVTVIGATNRPDGMDAALRRAGRFDREIMLG
FT                   IPDEGARARILAVQAKKLRLAGGLDLAEIAKKTPGYVGADLSALAKEAAASAVARIFQQ
FT                   LSGEESQSVVEKENVGPVEIGPEETLMGSGRLADRRPFDASELANLSITIEDFALALTK
FT                   VQPSAQREGFTTTPEVTWEDVGSLTEVREELKFSVCEPIAHPARFHAMGLAVSTGVLLY
FT                   GPPGCGKTLVAKATANEANANFISIKGPELLNKYVGESERAVRTLFARARAASPCVLFF
FT                   DELDSLAPRRGNEGNQASERVVNQLLTEMDGLEARSSTFVVAATNRPDMIDSAMLRPGR
FT                   LDKLLYVPLPPPDGRAAILKTLTRKTPLAADVDVGSIGTSARCGGFSGADLASLVREAC
FT                   VAALKGNLAAATAADAEREKIRKAGAAAGALPAPPAPPEVTLEHFEQAFERVQPSVSVA
FT                   DQKRYDELRRKLRRDVGALKPKDERPIDAGTESDMGGGAMEESGRATPSLYAGAPGGGS
FT                   GKKRKM"
FT   gene            complement(<295336..>297216)
FT                   /locus_tag="MICPUN_56723"
FT   mRNA            complement(<295336..>297216)
FT                   /locus_tag="MICPUN_56723"
FT                   /product="predicted protein"
FT   CDS_pept        complement(295336..297216)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56723"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:4222 - metalloendopeptidase activity; GO_process:
FT                   GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1E127"
FT                   /db_xref="InterPro:IPR001915"
FT                   /db_xref="UniProtKB/TrEMBL:C1E127"
FT                   /protein_id="ACO62102.1"
FT                   /translation="MWAARAAHRGARRVAQRTESLSVASALRSNLPSRSTTSGSIVTAS
FT                   SSRVRSFVGPSRHVSFAPPNPIIPAAYVAGSIASRTVLATARMNAANRVFNAVTTPSAR
FT                   ARLRDALLGRTRSGSVTRVAVVATGAGVVAHVYTEEVPATGRRRLMLLDLGDEERLLRA
FT                   ATAAQFERLDGSFLPPSHPATQRVAGILWKLVNRLDPALVVGTNPKNLSHHPLLAEGAT
FT                   WSLHVYDSPEVNASVAPGGHIFVSTGLIRACGRDDGRLAFVLAHEMGHRIARHVAEHAS
FT                   IEMLRTMGVAVGWALAAMFGADFLGGAVTASAMVGAEAAAELAVSLPYSRTMEYEADEI
FT                   GMRLLTGACFDPDAGPRMMSTLEAFAVEQRRLAERESSSTRDGSFNGVQRRSTSFNGDD
FT                   ERARKEMERYLSTHPLNEERIAAMRERIMPRLFESASNSDCGAYVAALQSSMGLRHRRL
FT                   PPNAHDANKGKVFIPTSKWRARYVRELDVTHSTERGMNRVLDRRNKMSSTDAANAGDHG
FT                   AMTGPLGRFDDRRMRALLARPDTEAGAKAREDAAALGSKGMHSRGWRGPVRRKVELSKA
FT                   SASDGVEASPGVRDEASRGDAEEGTELGELVGMYWSGSGARRAVRRAAAA"
FT   gene            <297318..>299243
FT                   /locus_tag="MICPUN_56724"
FT   mRNA            <297318..>299243
FT                   /locus_tag="MICPUN_56724"
FT                   /product="predicted protein"
FT   CDS_pept        297318..299243
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56724"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E128"
FT                   /protein_id="ACO61661.1"
FT                   /translation="METPSREVSDAGSAARRNPRSPGVSLGRGLDSFLDDLTPEATRQA
FT                   TTEDRAALLQLTKFRERLAAMGDGAGDGDEHDPPATPSDSPRTMDTTSRASSPPSPDEN
FT                   APPGTGIPGMTPRKVHPSFTLPPHEQQRRDAAAAAAVRTRGTSPSLITSPSGRIEVGAT
FT                   ATTTARSSPLGREPTTPTDLDDAGGSQRRRRARVLEDGTDVFGRDDDDVFGRDNDDGDG
FT                   LTETRGSAAADTTARPPADDPRSLATRSNDDPRIVGRLLGSVEAALAEAVTPRAALGAL
FT                   RADVDECRAAIDALRESHVALEREDGALTEAQGQMREELDDAWRTRLPRLERLMFRLAD
FT                   RLDRVVDEAVAASEAVNVRRLEEELGRLRVEIAETIASIGDGTGEAVGEATLEAIAHVD
FT                   SSVNALRAETAAAVESVRVETLARLERMEAAQLAEEARRKSAVESAVESTRGSRHWSSF
FT                   AAGLEPCVDVITALAARVLGPGRRSGKDERESYPAVTATGSALDDEASGVINRGLRRQI
FT                   HRCKTIGGVEGVAWDDDAGADLLGASLVVLAAEAAHAIAPRGPCRVATRVVRAAVWTST
FT                   AALASGAVKSWCHRVANEAMAERRRRLEGGAKEGADVDDDDEEEERFETPPARSSADPE
FT                   LFVDTH"
FT   gene            <299356..>300531
FT                   /locus_tag="MICPUN_56725"
FT   mRNA            <299356..>300531
FT                   /locus_tag="MICPUN_56725"
FT                   /product="aryl-alcohol dehydrogenase related protein"
FT   CDS_pept        299356..300531
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56725"
FT                   /product="aryl-alcohol dehydrogenase related protein"
FT                   /note="Predicted oxidoreductases (related to aryl-alcohol
FT                   dehydrogenases) [Energy production and conversion];
FT                   GO_function: GO:16491 - oxidoreductase activity"
FT                   /db_xref="GOA:C1E129"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C1E129"
FT                   /protein_id="ACO61662.1"
FT                   /translation="MKPATVLSSSVAPVGVSRSRAAPRRAAVAARASTDAAATTPAAGV
FT                   GNTFRTATDRVTLGTSDLSVAATGAGAWAWGDRSGYWGSDWEGDRAKNLDAYMTLLAGG
FT                   VDFIDTAEVYGFGKSEELIREFMRDTAADATLAPPLLATKFAPIPFRFRAEDVPNALRA
FT                   SMARMGVRKVALYMQHWPAFGLPGVTEACNDAFLEGLCLCYERGLCRAVGVSNFNAERV
FT                   KRAAKKFKERGVPFASNQIQYSLAYRAPETDTGVIDACVECGVTPVAYSPMAQGLLTGK
FT                   YSAASPLGEGVKATGPRARILSEEKLASADALVDLMREIGRNHGGVTPAQIAVNYCMTK
FT                   GTVPIPGAKDARQAEAVVGCLGWRLDEAEVAELEAAAALVPSTPGAPFERW"
FT   gene            300804..301916
FT                   /locus_tag="MICPUN_105248"
FT   mRNA            join(300804..301088,301244..301916)
FT                   /locus_tag="MICPUN_105248"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(300990..301088,301244..301690)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105248"
FT                   /product="hypothetical protein"
FT                   /note="Protein of unknown function (DUF1077). This family
FT                   consists of several hypothetical eukaryotic proteins of
FT                   unknown function. expressed; conserved uncharacterized
FT                   DUF1077 protein cupA54"
FT                   /db_xref="InterPro:IPR009445"
FT                   /db_xref="UniProtKB/TrEMBL:C1E130"
FT                   /protein_id="ACO61663.1"
FT                   /translation="MDAKWRLDFADASTSGNNAPVNPPGYASLRELGDVDAPAKGKADA
FT                   PKGGVVAPGGALTSAARQQKAYQFAMSQVQAIGMTGFMMYMAGSGVQIFSMMVVGNGLF
FT                   QPIKAIASSGKIFEPYADASTDVTGPRALFCAIQLAGLAMALYKLNSMGLLPTHASDWV
FT                   SGMKPPTPVEHAYGGTTL"
FT   gene            <301973..>302530
FT                   /locus_tag="MICPUN_99323"
FT   mRNA            <301973..>302530
FT                   /locus_tag="MICPUN_99323"
FT                   /product="predicted protein"
FT   CDS_pept        301973..302530
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99323"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E131"
FT                   /protein_id="ACO61664.1"
FT                   /translation="MRYIPHKRGKPSRWVREAAGNDDVEGIDAALDAASNKDEALNKGD
FT                   IMGRTALHWAAGRGRVDAVRHLLALGARVKISGMHHTPLHDLAESGAAAAPTLVQELVE
FT                   AAPWQLTYKDNTGAMPVDRAKSAGQRQMVRALESAAMMVTGAERAMMSRHTHSFLPSCL
FT                   SVATISLDSPGSSVTRPLLEGA"
FT   gene            <302802..>303365
FT                   /locus_tag="MICPUN_56728"
FT   mRNA            <302802..>303365
FT                   /locus_tag="MICPUN_56728"
FT                   /product="predicted protein"
FT   CDS_pept        302802..303365
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56728"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E132"
FT                   /protein_id="ACO61665.1"
FT                   /translation="MSYARPKRGKPERWVREAAGNDDVEGIDAALDAAKDRERLLNKGD
FT                   FVGRTALHWAAGRGRADAVRHLLALGARVKLSGNQASPLHDLAASGSPNAPALVQDLLA
FT                   AAPWQLTHRDNMGHYPVDKARDVGDKSMALALDALMMTVVGKRGPTAKPRTPSSWMPSC
FT                   MSAGKARGIVGSDERPLLEGAARA"
FT   gene            <303500..>305074
FT                   /locus_tag="MICPUN_56729"
FT   mRNA            <303500..>305074
FT                   /locus_tag="MICPUN_56729"
FT                   /product="predicted protein"
FT   CDS_pept        303500..305074
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56729"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491; FAD binding - oxidoreductase
FT                   activity [PMID 50660]"
FT                   /db_xref="GOA:C1E133"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR012951"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C1E133"
FT                   /protein_id="ACO61666.1"
FT                   /translation="MGALEDLVASHLGGFSPEGGVHLPNTPGYDACLLSAGAANYACLH
FT                   ERRRPPVALQPARESDVVLAVRFVTAGIERGLWPEGGRVDGSPDGGDGVPLTLCGGGHS
FT                   ELCVRHGAVLIHFGRMASVSCDPAAGTVTIAPGALLGAMNEAAQNHGLAVPTGVFAGVG
FT                   VGSILAGGIGRLARARGLSVHSVVAMRVVTADGEIHVLGEGTHMDGLARDMWWGCRGAA
FT                   AALGVVTSVTLRAAPIAPTVSHGRRIYPTFADAPDAAARLRRIETIARALPEATQVDVC
FT                   VTRAAGGGGGGVRIGVFPCATDGGDVPADVVASLELTPRHVTRSRYCDVPYHSMLPDDE
FT                   LDDESAPGDDESAPGDDGTPSQATPGMFSYVRQWFVDELGEIGAAAVAAAAAAAPTDDS
FT                   LVMMQHAGGAVRRGGRPADDDDAPADDDLSFPHRQWEWSVVIIALWTDPSSRARTTAEA
FT                   WADDAFESLRGCGVGCYAVDIDRFRRSGADAEEEVKLAFGEVNAARLRELKRRVDPMNV
FT                   FAAAVPL"
FT   gene            complement(305113..>307471)
FT                   /locus_tag="MICPUN_56730"
FT   mRNA            complement(join(305113..307177,307345..>307471))
FT                   /locus_tag="MICPUN_56730"
FT                   /product="xanthine/uracil/vitamin C permease"
FT   CDS_pept        complement(join(305298..307177,307345..307471))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56730"
FT                   /product="xanthine/uracil/vitamin C permease"
FT                   /note="COG2252 Xanthine/uracil/vitamin C permease
FT                   [Nucleotide transport and metabolism]; expressed"
FT                   /db_xref="GOA:C1E134"
FT                   /db_xref="UniProtKB/TrEMBL:C1E134"
FT                   /protein_id="ACO62103.1"
FT                   /translation="MPVGTGIKREKVPLQQVLLQLSPFYWQGDASWAWNFKVPLWTGSG
FT                   EMEAFCELFFDNLATLLGVTGAAMDVGRIGGINSYSDATDLYKATVTGEWTRIYYDWNI
FT                   PACGLALLFGNVWFAWLATRLATKENRLDVTAQPYGMNTTVIYITIYAISLPAIQAGFT
FT                   KFNPGTGASDADSIAMGKKAAEFGWKVSVATNFIIGFMEILGCFLGDLIRNTVPTAAVY
FT                   VPLAGVGFVWLAFSPMLTIAKAPMMCLLPFMVVVFGFFGNVRYPVYGKVTFPIALMAIL
FT                   LSVIFGWAGACKRSTEVIGGAYGDVSVSDFYNGFRAIQGTGASGTCQGTDGNAAKAAWK
FT                   TYAFKGDIFGGFGSGLAGLSESSLMEDFAAPALLFGMIGFLGTMTCVESAEAAGDAYPM
FT                   SEIMIVDGIGTCMAALAGGMFGTTVYIGHPVHKALGAKIGYSIANGVLYFIFLSTGLFA
FT                   CLYNVIPECANGAILVFVGLLLARQGFEETPERHYPCLLLGLMPFICNWAWLESDGAAS
FT                   KNMGVLSLGPSGGIVQGIILAALTAWAIDRKFEEVTVFSIIVAFFSLFGIAFSHNDLVY
FT                   SYGVWGAEHQTLKVYADGSGVDKDTGTPEEAFNGWRWCVAFFMVAFFAACHIPFQKGNK
FT                   YTKFEAIPPRIEDDAEDPYDYSVHAAKAAEIPK"
FT   gene            <307809..>308090
FT                   /locus_tag="MICPUN_56731"
FT   mRNA            <307809..>308090
FT                   /locus_tag="MICPUN_56731"
FT                   /product="predicted protein"
FT   CDS_pept        307809..308090
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56731"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E135"
FT                   /protein_id="ACO61667.1"
FT                   /translation="MRKETAFLLVICYVAFHLSQLSLEDLVAHLESGKQIVAGVLADPI
FT                   GKGQEYYDRLVQTGAAKFLAFAAASKLISWHFKRSATSRKIAADKKAK"
FT   gene            <308170..>309591
FT                   /locus_tag="MICPUN_56732"
FT   mRNA            <308170..>309591
FT                   /locus_tag="MICPUN_56732"
FT                   /product="cysteine hydrolase"
FT   CDS_pept        308170..309591
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56732"
FT                   /product="cysteine hydrolase"
FT                   /note="Has two complete cysteine hydrolase domains like
FT                   Chlamydomonas; missing in CCMP1545; GO_function: GO:3824 -
FT                   catalytic activity; GO_process: GO:8152 - metabolic
FT                   process"
FT                   /db_xref="GOA:C1E136"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C1E136"
FT                   /protein_id="ACO61668.1"
FT                   /translation="MSRVASAKPYAWPYDGSLAADDVALVLIDMQTDFCGLGGYVAQMG
FT                   YDVSLTRAPIEPLRSVLAAARAAGVRVIHTREGHRPSLADLPDNKRWRSMQAGAGIGDP
FT                   GPCGRILVRGEPGWDIIPELYPLSAEDVVDKPGKGSFCATDLDLILRSRGIKRIILGGI
FT                   TTDVCVHTTMREANDRGYECLLLEDGCGATDAGNHAAAIKMVHMQHGVFGATATCDAVC
FT                   AALDALPRVPDASALVRTTMTAGLKSSHAAGEVASAKPYPFAWRVGECALVMVDWQRDF
FT                   CDDGGFGASLGNDVTSLRRAIPAASRVLAAARKAGMPVIHTLEAHAPDLSDCPPAKKAR
FT                   CPAIGEIVVGGIEGSRVLVAGEPGNALVPELAAAEGEVVIRKPGKGAFFGTDLHTRLES
FT                   LGVKSLLFTGVTTEVCVQTTMREANDRGYECLLVEDATESYFPEFKAATLAMITAQNGI
FT                   VGWTASAADVVAAMK"
FT   gene            complement(<309825..>310541)
FT                   /locus_tag="MICPUN_56733"
FT   mRNA            complement(<309825..>310541)
FT                   /locus_tag="MICPUN_56733"
FT                   /product="cysteine hydrolase"
FT   CDS_pept        complement(309825..310541)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56733"
FT                   /product="cysteine hydrolase"
FT                   /note="Cysteine hydrolases; This family contains
FT                   amidohydrolases, like CSHase (N-carbamoylsarcosine
FT                   amidohydrolase), involved in creatine metabolism and
FT                   nicotinamidase, converting nicotinamide to nicotinic acid
FT                   and ammonia in the pyridine nucleotide cycle; GO_function:
FT                   GO:3824 - catalytic activity; GO_process: GO:8152 -
FT                   metabolic process"
FT                   /db_xref="GOA:C1E137"
FT                   /db_xref="InterPro:IPR000868"
FT                   /db_xref="InterPro:IPR036380"
FT                   /db_xref="UniProtKB/TrEMBL:C1E137"
FT                   /protein_id="ACO62104.1"
FT                   /translation="MVRRGVEAAKPEALIAEAQVACFHDREFPVSSSDTALVLIDMQTD
FT                   FLSKDGRLGKNYSDPRVKQLAATEAKVATLLAAARRAGMTVAHSRSHRYGADVRRDLCV
FT                   PTIDPTYDLVDSCRPLPGEIVVDKWTFGAFASTDLETQLRRRGVRRILLAGILTNVCIM
FT                   ATAVQAVDRFFRVCLVEDACGAFDARWHQHAVELINGPQTLKENHHNSVGLYFGEVAKL
FT                   SDVETALAKCGGGAAV"
FT   gene            <310782..>312593
FT                   /locus_tag="MICPUN_56734"
FT   mRNA            <310782..>312593
FT                   /locus_tag="MICPUN_56734"
FT                   /product="cytosine deaminase/metal dependent hydrolase"
FT   CDS_pept        310782..312593
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56734"
FT                   /product="cytosine deaminase/metal dependent hydrolase"
FT                   /note="Bacterial cytosine deaminase and related
FT                   metal-dependent hydrolases. Cytosine deaminases (CDs)
FT                   catalyze the deamination of cytosine, producing uracil and
FT                   ammonia"
FT                   /db_xref="GOA:C1E138"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR013108"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1E138"
FT                   /protein_id="ACO61669.1"
FT                   /translation="MKTKHVACTTERQYQTQTHSFVRAEISDFGGSCFARSLRPRSRRS
FT                   VGLFGSKDTCFSFGHEIRFENERKTRLIQWRFLARNDGTVTRHFCQRETGRGVTTVQHN
FT                   PTSRMLPRKAAVDALKGGEETLVLRRVTVPLACLTDESLRAAADAEGAVSCDVTLAGGT
FT                   ITGVAIHDPTPLPGTGRLDARGSMLWPAFVDAHTHLCKTHAVPRCRNPSGSINDALACE
FT                   VTDQPRWIEPGDVERRMDFALRSCLHHGTRAVRTHLDGTNAPDAAMRQRIYDVFDAKRA
FT                   EYESRGIVLQGVANLYLPLYADAPEMAARHAEDAASHAGVVLGAYCGDVSHGEPGATDK
FT                   HLDALFALALKHGLDVDLHIDENNNPDCCGVRVLCGALERARERGYDGSVVLGHVTSLA
FT                   LQTTEVQAEVVARLAKLAPVHVVCNPFTNLGLQDRRGTAPPIGKLVARDEPRTPLWRGL
FT                   TLLQELRAANVPVAAASDNVRDWWHPYGDYDPLQVWREAVAMGHLDTAPSEGAWADLVT
FT                   AAAADAMGVGGGVIAVGEPADLVLFPGARRFSELLARPHHDRVVVRRGKATETKLPDFS
FT                   ELDDLVDGREAVVDTSQDILRGATKKE"
FT   gene            complement(<312717..>313733)
FT                   /locus_tag="MICPUN_56735"
FT   mRNA            complement(join(<312717..313291,313412..>313733))
FT                   /locus_tag="MICPUN_56735"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(312717..313291,313412..313733))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56735"
FT                   /product="hypothetical protein"
FT                   /note="semiconserved uncharacterized protein cupA53"
FT                   /db_xref="GOA:C1E139"
FT                   /db_xref="UniProtKB/TrEMBL:C1E139"
FT                   /protein_id="ACO62105.1"
FT                   /translation="MGEVTNRATTAAIAVGAAAALGLSYLAHGWYRSRRSPRVLVLVSG
FT                   TLQDGFPLRRNLDAPGAPAEFVGWALVRGVKMYLDPKPRGCREWVDPESGERQRVNPAL
FT                   VCTGDPKDANVYACYAVSEGACLRALLGEPRMLGMTPDTALVDLRAEETSRALASFLAG
FT                   QARRWWENSTPAFGDVAVTERGTLDEGRVAMLTVVAHRVPHGAVPVEPAYVKDDGTRVT
FT                   SFAPCLKRFGGGFELGTRAHELGLEEAIRKWQRRMDPGDGTRGDSLYGAAPETFRMNYA
FT                   VTAGEVARTFSSKRVAA"
FT   gene            <313886..>315024
FT                   /locus_tag="MICPUN_56736"
FT   mRNA            join(<313886..313952,314069..>315024)
FT                   /locus_tag="MICPUN_56736"
FT                   /product="dioxygenase"
FT   CDS_pept        join(313886..313952,314069..315024)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56736"
FT                   /product="dioxygenase"
FT                   /note="PcbC isopenicillin N synthase and related
FT                   dioxygenases"
FT                   /db_xref="GOA:C1E140"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C1E140"
FT                   /protein_id="ACO61670.1"
FT                   /translation="MSPPDADTSAGLSEVDLERSLKASGVGDKAASSYAVPIVDLSNPD
FT                   ETAVADALWDAATTVGFFTVVGHGIDEESIDAQFEASREFFEQDLAVKEAASPFESALN
FT                   SGFEHMKQVRPSTGLPDVKESLQVTARADAMSGRWPPKPADFEARTRAFMTKSHALAAR
FT                   ILTLLEPRACPGQARGTLADAHTLWGPDGQCTLRHLHYPPMSAERVAALPPGSWRAGAH
FT                   TDWCCVTLLFQRTGEFGLECAANPRTNSTEWAPVDPVPGGVAVNVGDMLSRWSDGRLLS
FT                   NLHRVRMPAPNPGTGEVPVRYSLAFFMQADKSAMIQCAEQPPITAGDYILGRIRSNFEK
FT                   "
FT   gene            complement(<315132..>316502)
FT                   /locus_tag="MICPUN_56737"
FT   mRNA            complement(<315132..>316502)
FT                   /locus_tag="MICPUN_56737"
FT                   /product="major facilitator superfamily"
FT   CDS_pept        complement(315132..316502)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56737"
FT                   /product="major facilitator superfamily"
FT                   /note="L-type amino acid"
FT                   /db_xref="GOA:C1E141"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E141"
FT                   /protein_id="ACO62106.1"
FT                   /translation="MAASLLPTRRWALVMLSCVEVLTATGVMFGWSSLSIALRREGTYA
FT                   ELCDDDRSGCDAQALRLNAVYTAGAFCVPLGGMIWGPLMDVKGAKWTRAVGMCVFSAGC
FT                   LLFAFADSKTFDAYVPAACLVSIGGMANFLSHFVLAEYFADDHFGLVHSLINCSFDAST
FT                   VTFTVLELIHREGASTQSLFLAMAALGLVYLALTNETVWAGHLSPPLKKLNTSSAVGGE
FT                   GNEDGLVGAQSPQYGARLDESGKPFRRQVESRAFIALAVWGLFTVYRTMLVLGSVTEQM
FT                   LYNADGRDASHAERLVRVFNFLILISVALTPSFGRFIDTHGMAAGLALVNALGVLTFGL
FT                   LVTRPDWSLYVAFLAFGCFRAWNYSLMTAYSMGVFGGASFGKVYGIGVGTVSCLAAAAQ
FT                   YPTMAIVLGGSNPNFEGLDWAMLGVGVVMFGFPAFVHSRTVEGKETGAAAAAAANAA"
FT   gene            <316675..>318186
FT                   /locus_tag="MICPUN_56738"
FT   mRNA            <316675..>318186
FT                   /locus_tag="MICPUN_56738"
FT                   /product="major facilitator superfamily"
FT   CDS_pept        316675..318186
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56738"
FT                   /product="major facilitator superfamily"
FT                   /note="has sugar_tr domain - sugar (and other)
FT                   transporters"
FT                   /db_xref="GOA:C1E142"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E142"
FT                   /protein_id="ACO61671.1"
FT                   /translation="MMGEELAKWVLLAYGLFMTTLVAGVVYGWQSFRAVFIAEGVLSEG
FT                   CDANSADVECPSQAKELGLIFACGAWSVQACRMVTGLVRDRYGTRVCVVGVMLTVAVGI
FT                   VLLAVSPPQSLAMFCVGYFLLGIGAGVQLCMQSISMLFGEYQGAASATLSGAFTLSAVI
FT                   PLACAEAIQSVARSDGGSASSYADARAGVLTAWCVTVVVFAASAMWLMPRGGEFRESVR
FT                   YLVGERGGDENNEKTKDDDDKDDKEDRDDEPPRVPPANAPKAANGTRRAPHEGKSAREQ
FT                   LLSLDFILLAAWFTVMLLPTNYFIISVGDQLEGMGDDDGEITRGFQLVWVVSTILSPIA
FT                   GYSADVVGRGSTMTFAMGCYAASFVMLGFGGDGWGGLSLEAQWLNFVCFNVGRLWVFSM
FT                   YFVSVGRLFGFRHYGTLAGAGLLLSAMSTPLAVPMHRSGVDGNFGESNLASAMICLGLT
FT                   PYTVGWAWRREITEEGMRGFPARWGIRREEEAKEEAKEEAGANAV"
FT   gene            <318500..>320269
FT                   /locus_tag="MICPUN_56739"
FT   mRNA            <318500..>320269
FT                   /locus_tag="MICPUN_56739"
FT                   /product="metal dependent hydrolase"
FT   CDS_pept        318500..320269
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56739"
FT                   /product="metal dependent hydrolase"
FT                   /note="TRZ/ATZ family contains enzymes from the atrazine
FT                   degradation pathway and related hydrolases. Atrazine, a
FT                   chlorinated herbizide, can be catabolized by a variety of
FT                   different bacteria; GO_function: GO:16787 - hydrolase
FT                   activity"
FT                   /db_xref="GOA:C1E143"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1E143"
FT                   /protein_id="ACO61672.1"
FT                   /translation="MDLTLDNSVGKFSPSPAPPAGPPTLLRGALVPNDASEPGTYTRRD
FT                   VLIADGVLKRVAPGGTLSLDVDCPPGTIEEDCSERMLVPGFVNGHTHSVEHWARGLIKP
FT                   LPLEMWVLQLIRHEPRGEEGWAGPESWIKTPAAAIAVSAMHCGVEALLSGTTAIMDHLL
FT                   CRDIKDVEAAVFAYRALGIRAYIAPMLGDDLEPYVNYVPLARDAQGRNGAICGPAGPAP
FT                   GCPDCGGLGAHGSFRTEVGERDPAKTEANLALWREAAQKFHDPKNGINIVVGPVTAYSA
FT                   STELLRGAAEIRKEFGLCGHIHLLETRAQALMARQFLPSGSAVKHLRDTGFLQVPGTTC
FT                   GHCVWLDDEEIAIMAECDATAVHNPFSNLRLGSGVAPLHKYARLGMNVCLGADGACSSD
FT                   GQDMLEVAKLANILPCVATPEYRDWPTAHHTALVLGAANGYKGILLEGKPGQVGKGGVL
FT                   EEGALADLSSWDLTALSMLPRTDPLSLLVQGSRTQAPGAGSALDCAWVNGVRVVQGGSP
FT                   VNVDVKALREVLRAAQGTYRDPAITDPSTHEKTARAETEYRAAMDLDPAGATGLRPAYE
FT                   WPEHCVLYPASQN"
FT   gene            <320782..>322363
FT                   /locus_tag="MICPUN_56740"
FT   mRNA            join(<320782..321776,322138..>322363)
FT                   /locus_tag="MICPUN_56740"
FT                   /product="predicted protein"
FT   CDS_pept        join(320782..321776,322138..322363)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56740"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E144"
FT                   /db_xref="InterPro:IPR038753"
FT                   /db_xref="UniProtKB/TrEMBL:C1E144"
FT                   /protein_id="ACO61673.1"
FT                   /translation="MWTPGHGPELRRARPTCGVDDVDEARFNPLCRRARGVEDDSDPSE
FT                   SDTGFDDDDDDSHSSECDLVENVRQARLNALRRRRDDREEIRRQNETLDRIHRARHAER
FT                   EMAKELSSMRFEAERRHTLAWGDDAEVRDRERAAERAAEAIGDAMDEEELIESTQRGAG
FT                   GDGGVARAAEEAHAWATHDEAWAAFEASVRDGARVRTRDVPWPPGHDRGGDGGGGGTLL
FT                   ASLARCELVERGGGGGAGSCRGGSEDKRLAAFRRAFKRASLRWHPDKFEGKFGGALCDD
FT                   VCGDDDDGMVRTGGTGGTGGEGRGETHAQHIRRRVRCIAQEINDAWSAIVAFAQRRNYL
FT                   ILSLWANVPIDFKARWIAIAVWIEEIGFQFFGLDSREPFAGYFPFTADSLYDGDAGIDP
FT                   HCLSLIA"
FT   gene            <322778..324902
FT                   /locus_tag="MICPUN_56741"
FT   mRNA            join(<322778..322940,323104..323165,323539..324902)
FT                   /locus_tag="MICPUN_56741"
FT                   /product="myb family transcription factor"
FT   CDS_pept        join(322778..322940,323104..323165,323539..324423)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56741"
FT                   /product="myb family transcription factor"
FT                   /note="SANT domain includes SANT SWI3, ADA2, N-CoR and
FT                   TFIIIB'' DNA-binding domains"
FT                   /db_xref="GOA:C1E145"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR006447"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C1E145"
FT                   /protein_id="ACO61674.1"
FT                   /translation="MAGLSELVEAATEGMRKTQSADPIEENSNQPPPPTKDDGHLSDSA
FT                   VAPTRERKKGVPWTEDEHRLFLLGLQKLGKGDWRGISRHFVQSRTPTQVASHAQKYFIR
FT                   QNNLNKRKRRSSLFDIVSEAPAEPAKAPEVASKPPAGIPGGLSMAFAAGMPAFPGFNPA
FT                   SMPMPPGFGAHGAVPAAKKAGAGMDEGEKAAAATIAALAGSPIAAAGFAQAAAAAAGSK
FT                   GPNPWEVKHAPMGASPPGQHNAQQAAAAAAAAAAANPFAAMMAMGAMGQMGAQMPAPAA
FT                   WMQGYHQFMQQMAAAGAAHQQAQAARPPMPPPPAGVTFPPNFQGFTPGVFPGAHNVFGN
FT                   FMNGAMAKPAGEKPETVAKKEGSATAVTA"
FT   gene            <325610..>329869
FT                   /locus_tag="MICPUN_56742"
FT   mRNA            <325610..>329869
FT                   /locus_tag="MICPUN_56742"
FT                   /product="C2 domain-containing protein"
FT   CDS_pept        325610..329869
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56742"
FT                   /product="C2 domain-containing protein"
FT                   /note="Has C2 domain. The C2 domain is a Ca2+-dependent
FT                   membrane-targeting module found in many cellular proteins
FT                   involved in signal transduction or membrane trafficking"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR028928"
FT                   /db_xref="UniProtKB/TrEMBL:C1E146"
FT                   /protein_id="ACO61675.1"
FT                   /translation="MSGQVVTGTPVFSMSPSNPRSAQVQPGMAPATPPPFNGSSSMSAP
FT                   GYGAGAEGPGASSSPAHTALDVDDQGNRGGDFVTRTWQPARAPDAVALAEVTSQMTSAA
FT                   NVAEVFKATGLGQQDIQSSASRTTEDDGLIVRQRPRARADNIAVRKARAAREARPGDWF
FT                   DPNDGGILCQADPVPPGVERARPARWFDPEAPYLQTVPATDSRIDLEIVDAAGSDRTYR
FT                   FDISVGRLEFSCHPLMSKEDFLAAQLEESFRSYKRREASDLVTLYTAKSAAAAARARAL
FT                   RQEMAAGAALWLAGVSPSDRLIALEEEAEEAQRLAIDEGDRMKASVQHMSELHDAIERE
FT                   RIAYGCRSTSIRFAVRQKGNGESEPVLLAGAARDEGAHVPKPEQQRRAKATSTRFCVAL
FT                   EVNGQQVPGTSRPVTLRSSGGFSTEVAHAFSLSVQRWPDSVRLALYEKGTIVDTFLAVV
FT                   PIAVPGSNPGEPLQDPAPRQYQFSAESPHAPTWRGAQPGASQVQYTSGSLFVTCAWTPN
FT                   AAEAINMGAYGRQHTADVERSVPVAPPPPPSTAAKRAAAAAKVGYADAAGGFGRAVPRP
FT                   APDAVPGGSPSKTSAAALRASLDPLNPEDATLLETLATREALRNAGGGGFRLNLNDETM
FT                   LGVNAKATKRQQLLKLRAEGGVEALPEGGVPLSEGDIPDHLLEQNAEVQSQSKLLSAQL
FT                   PGLAEADKRATRIAEFLAKVKLNVAKGRRDQKMGARASKGVMHTDDVVKDSPLPDITFD
FT                   LTGVFEFFQPRRKLRPARRRAAPPESHPDYCELVVGIQKAFNLPTRAGMQGGAMGGVGG
FT                   GRRSMQRGGGGGGGGYGGGYGDGYGGGAALVASGELNSFVEVSFQGQTLRTRLANGSAP
FT                   SWQESLQLPFRPPGGDFSPAALQGCEDVVTISLFDEATEPAERTYGAGAVAGGTSTTQH
FT                   FLGSIDIPVAALYRGDGGKIEGVLPLDAPPVLLGYSGAGGGGGSGGGRASLPGGGGLAQ
FT                   QPKPSMSVYIQFAPALAKPEPTLSDPGVGEDESVLRHAKVWEKECRAASRHTKQRPYRA
FT                   VATDGMGRSVHLCRYIASAQLPPGFQGAVADEPTLRQLMRFCHLVPHVTDMSAFNLPPG
FT                   VDIWTTSQEFLDMCAGDSEEHALLLCGFLVALGVEAYVVLGVSATDSDAAMVFTPGGQG
FT                   KRPGNPPTYAPMLEDSLIWDPMAGTIFSVYDSACSACLGEIGVVFNSDNVWANVQAHGR
FT                   PHEMNWNLNDTHGWRPFFSAGSFPHRAMPTVQTAITYESYPPAFYERLGAAVEREAMDA
FT                   IVKKRARQHTPFNRRASRALKDLLRDLEGQILISPDDQGGGLNLGGGMRVGSLTELHMS
FT                   QLAGICEGYTVTGCPMNLPFTDAATVRDVIDRLKIADTTRSDVEFAVATHVEPYGCTFV
FT                   CSVWVYVVRLTKISSYQ"
FT   gene            complement(329896..331099)
FT                   /locus_tag="MICPUN_56743"
FT   mRNA            complement(join(329896..330491,330612..330660,
FT                   330791..330917,331091..331099))
FT                   /locus_tag="MICPUN_56743"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(329947..330491,330612..330660,
FT                   330791..330895))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56743"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E147"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E147"
FT                   /protein_id="ACO62107.1"
FT                   /translation="MLCALVMFLGLIIAPTSAYPTGKVVEVTEVDFDAQVAKGPTLVDV
FT                   YADWCGHCRQLAPVWEELAKELEGEVYVVKVNGPKCRSLQQRLHVKAYPSILYLRDGEM
FT                   RSYDAAQRTVQALAAFARKGWRRTKPVPFYMAPNNWYGRSVGWVYKIPAIAREAHGNLR
FT                   KAGWGDVSIIFATLAVPVAAGMFAIFVADVWVVRTTRAQGAAARRRDDARRLLREQQEA
FT                   LERMNRVHAD"
FT   gene            <331059..>332345
FT                   /locus_tag="MICPUN_56744"
FT   mRNA            <331059..>332345
FT                   /locus_tag="MICPUN_56744"
FT                   /product="predicted protein"
FT   CDS_pept        331059..332345
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56744"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E148"
FT                   /protein_id="ACO61676.1"
FT                   /translation="MPPAGDDYEPTMGAVQLLVHRRLRTVQKRVAKIAKAEEKRSAGGE
FT                   IDDQQKELIDGKPLTMALLEEFTKLSQEVEKAVEEDRLAVLREERAKVAAKAERSAARR
FT                   AAAAGDRPDEATKANEASAAPPVPPVDGGATRTTGKKPGRRGGGRESPADGAAPPAREP
FT                   LASTPNQPPPAEIPQVVDAPAAAKPRRERGGRGKNRRREGDIGDADTRAAPAPGPGAGP
FT                   GGPPGGVFPGHQQGPFQQGPGAPVATVDGVSLRFGSLGVNGPPAGQSRPPDGSVATEEE
FT                   RARRPETVAATLPKPPVPVEMTPAEINLADYGFDDEYGAPDDLVDDNVFHVAPHVAPRF
FT                   DDVGGAPRVDSRARGDRSSAATGGQRPAGTRAAGHSSREKVGGGGERRDAGGRGRGGER
FT                   RDGGGGGGNRGGGRGGRGGRGGRGRPGVE"
FT   gene            complement(<332425..>333078)
FT                   /locus_tag="MICPUN_56745"
FT   mRNA            complement(<332425..>333078)
FT                   /locus_tag="MICPUN_56745"
FT                   /product="predicted protein"
FT   CDS_pept        complement(332425..333078)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56745"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E149"
FT                   /protein_id="ACO62108.1"
FT                   /translation="MSTIWRPDLNEDPIVVKEESDDDHNPPAVNVEPPADDHEEDEKSE
FT                   DLAGKMSTIWRPNLDRLYASVAEMEGSESEEEEDASKQGTKRKRAPHTKGPCEHGVKWR
FT                   SQCKVCSACPHGKRRCHCKECGGASICEHGRIRSQCKECGGASICEHGRQRSKCKECGG
FT                   GSICEHGRHRQYCKECGGGSICEHGRRRSQCKECGGSGICKHGRRRSRCKECKK"
FT   gene            <333290..>334597
FT                   /locus_tag="MICPUN_56746"
FT   mRNA            <333290..>334597
FT                   /locus_tag="MICPUN_56746"
FT                   /product="predicted protein"
FT   CDS_pept        333290..334597
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56746"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E150"
FT                   /db_xref="UniProtKB/TrEMBL:C1E150"
FT                   /protein_id="ACO61677.1"
FT                   /translation="MRPARAREEGRGGGARPPRGREREDMSRRPGGGGPGGRPGGRRGA
FT                   DGRPPRMPRQGPGGRGGPPIRQRYKKPPGLLSWYKPRVSHGFIAAFSLGILLMLALWTF
FT                   PSYSAYVDRAEMVKQYCLVHGGDNSTGCVKVEIVHESVCDPAVPELYGHLTTDNCTDLC
FT                   VYSDEERTVGNTTAAERLAFVDSFIPGAEVPCFYPPGDSNFTQATFTVPYNPNEQMFLS
FT                   LVWLSPLFFCLLVSVHCALRKPREALELEDDQMLTGLFNEVVIQRNHQEKFVNDVEMRV
FT                   KHLKSAVDGEQQKRLDVVLEVEKERRDRLTSEDNLKHALHENMRSLESKLVREMAQRLA
FT                   SIPIPSKLKEKMMRKADKYREDRDPLLGGRRSKNDRPDSAASLIFEDHQRNAERRRAAL
FT                   ANDLDAQRGAFKQRLEERKSKGKRSKSKDPGAKRRD"
FT   gene            complement(<334707..>335657)
FT                   /locus_tag="MICPUN_79549"
FT   mRNA            complement(<334707..>335657)
FT                   /locus_tag="MICPUN_79549"
FT                   /product="predicted protein"
FT   CDS_pept        complement(334707..335657)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79549"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:151 - ubiquitin ligase complex;
FT                   GO_function: GO:4842 - ubiquitin-protein ligase activity;
FT                   GO_process: GO:16567 - protein ubiquitination"
FT                   /db_xref="GOA:C1E151"
FT                   /db_xref="InterPro:IPR016818"
FT                   /db_xref="InterPro:IPR031790"
FT                   /db_xref="UniProtKB/TrEMBL:C1E151"
FT                   /protein_id="ACO62109.1"
FT                   /translation="MGTGSRHSKNAGTMGSENLTYHEKKALGFGTVKERLGKETVKDFD
FT                   ACGLGLQHALDPVVTPEGVLYDREHILQCLLHQKKDIARKMKTWEGEQARDAEKASAEE
FT                   EAKRLAELEKFELENKGGFVNYSASAGTSTATGTSDARIASSADVAATQDDKERMKTMK
FT                   AFWLPSKTPTAERKAEKPDTDTKCPTTLKKLRLKDLLAVKWTKVRKGEEIGGARYMCPV
FT                   TFKTFTNATKIVVLKPSGHAVSEEAWTKVVKDEGTYDGHRVKGVIRLQRGGSGFAGSGT
FT                   QVESKTEFMLGAGSGLADGRGQNRGATSKFGLRFN"
FT   gene            <336145..338227
FT                   /locus_tag="MICPUN_56748"
FT   mRNA            join(<336145..336249,336409..338227)
FT                   /locus_tag="MICPUN_56748"
FT                   /product="predicted protein"
FT   CDS_pept        join(336145..336249,336409..338073)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56748"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E152"
FT                   /protein_id="ACO61678.1"
FT                   /translation="MSRPGGVSRSRPANEGERDPKRPRIGGAPQNVETEDDDLQVICPP
FT                   VNPVQSEVNAIVAMAVAGGADPVAVEQMLAATLGDPTQVQATLAVLRAVAAGAQNRTTA
FT                   GITAAALSAMNAASGPNGQGNSLAANAVTAVLTRPPHADRPAIIRRCQVDACNKLDVGG
FT                   GKCTAHGGGKRCQVDGCNAGDRGGGKCISHGGGKRCQSDRCDAGAASGGKFCVTHGGGL
FT                   RCTEEGCDRVRKVRGKCAVHGGINKKKLCVVAGCSSKDLGGGLCKTHGGVRLCSHEGCN
FT                   KRAKARGACVQHDSREKICSHPGCAFPARARGKCKDHGGVVMKMCASEGCAAKAATGSD
FT                   RCRAHGGGKRCSHEGCEKMDAGRGFCVAHGGGKRCQVPNCTKGATRSSFCVAHGGGKRC
FT                   TFEGCDKPGHFKGLCAAHGGGKLCQAPDCKKWDAGFGFCRSHGGGKRCSVEGCTTPVKL
FT                   RGLCIKHGGGHTCSVEGCNRSAKTRSLCIEHGGVKLCKVPNCTKMDRGRGFCSKHGNLL
FT                   GLGGLKCTHEGCNKCAVSKGLCCEHGGVRRCQMKGCQKMDRNGGFCNAHQPGGPVPDAL
FT                   PPPGMTQLPGIMA"
FT   gene            complement(<342440..>344125)
FT                   /locus_tag="MICPUN_56750"
FT   mRNA            complement(<342440..>344125)
FT                   /locus_tag="MICPUN_56750"
FT                   /product="predicted protein"
FT   CDS_pept        complement(342440..344125)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56750"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006968"
FT                   /db_xref="UniProtKB/TrEMBL:C1E153"
FT                   /protein_id="ACO62110.1"
FT                   /translation="MSAAARPAAIAPRDAARRVASTRARRVVSAPLRGRTERRRAPHPA
FT                   RATTRASTPREGRSDDGPTLVETSSGGQQLRRWGRTPTGGFDRQPPRRPEEELAGQGEA
FT                   TSGRSGFARWDPRLSPRLRAVFLPAGYPDTVSPDYAPFIRWHLGSLMFRNVLEVITAQS
FT                   LLVALGMGSTPGALPLTAATKWVLKDGIGSLATLAAGSLGGQKCDEDPKRWWMVSNAFE
FT                   DVARVIELVTPAAPALFLPLAATATFVRTAALTGRGSLVNGSLMQHFARNENTADVRAR
FT                   LEVQGRWLALVALPVGIGIFRTVSQSFASDPEEPARDVAIAVALYGGVVCAHLVCIWNA
FT                   AKVLRFETLNRARLVRQARAFRDGGAAAIADYNAAGDEEGVFRARFSPGDPVLGASLPD
FT                   AARDWAHLERLVGHARDGFISPMELPPGSSGRTDVGRRFALGWNERDGGCPAVLLDADA
FT                   TARDVFAAALAGVHASRGVRGGDDAEGFGRAYAWGDARVDEFIVAMAAKGWRVDFVQLG
FT                   TAPRYRLGSLLGTGSGGGEVGGGTRGGKGGSVGVDASVDDVLAT"
FT   gene            <344602..>345435
FT                   /locus_tag="MICPUN_56751"
FT   mRNA            <344602..>345435
FT                   /locus_tag="MICPUN_56751"
FT                   /product="predicted protein"
FT   CDS_pept        344602..345435
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56751"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1E154"
FT                   /protein_id="ACO61679.1"
FT                   /translation="MREARDAEGPRRSFSLHRVSEHDRLVGEGRDVRILHVVRHAQGTH
FT                   NVDQKYRDPRNHDARLTGFGEQQCEALSRTPAAIEAQRSASLVVTSPLTRCVQTALLSF
FT                   PDIARREEVPFVALECIRETVNFACDGRRRRSEIAADFPRVNFSADDGVGDEDELWARY
FT                   ENLCGPTSAHDGHRESCDLPSVADRGRAFFAWLRRRPEREAIVSSHSAFLRCVFSWGQD
FT                   GGVRAAPDQALGESVWGELVDVNVPVVDYRGDVKLEYDLRRDWENCEMRTFLVAF"
FT   gene            complement(<345588..>346661)
FT                   /locus_tag="MICPUN_56752"
FT   mRNA            complement(<345588..>346661)
FT                   /locus_tag="MICPUN_56752"
FT                   /product="predicted protein"
FT   CDS_pept        complement(345588..346661)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56752"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3935 - GTP cyclohydrolase II
FT                   activity; GO_process: GO:9231 - riboflavin biosynthetic
FT                   process"
FT                   /db_xref="GOA:C1E155"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:C1E155"
FT                   /protein_id="ACO62111.1"
FT                   /translation="MSFAAVSTHAGAVASSRRAPVGMGASTLGEQRQVGRLVDHVAGRR
FT                   YRHRRFDVRWTASAGDPNNESRRRSLNSRNAPGHAHRRGPKPPSIDRVLRAMPELTPES
FT                   PKDKPVSTNAMSFDESSIGDTEFIAETKLPTGSGFYRLRGYRHSVDGGVPSEPVAICFG
FT                   DIEGREKVPVRVHDACFTSEVLGSLKCDCKQQLQLAMEYIQENDGMVIYLHQEGRGIGL
FT                   ANKIAAYALQDTQGLDTVDANRALGLPDDVREYTAVANILEDMGIRSIQLMTNNPRKVA
FT                   TLERLGVKIEGRIPCIVKANLFNQGYLEAKEGRMKHFLDGSWCYWDHSGNTFDEDDAAA
FT                   SGEGGGAEQGEPAAEEK"
FT   gene            357728..359329
FT                   /locus_tag="MICPUN_107881"
FT   mRNA            357728..359329
FT                   /locus_tag="MICPUN_107881"
FT                   /product="predicted protein"
FT   CDS_pept        357736..359223
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107881"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR030392"
FT                   /db_xref="UniProtKB/TrEMBL:C1E156"
FT                   /protein_id="ACO61680.1"
FT                   /translation="MAVTSTFGVTSDFTVNTDKFIVNATNGNTKMTGNLEMSGDTATLT
FT                   HSGSTGGLAISSAQHVDVESVRFTTNQIGSTGDPDLITLTDNKVSISGQTLEMSGSTSR
FT                   LQHTGTTSLAISSTNGHITIAGGSGDYVDVESVRFTDDYIGISGDTDIIRLTSTGSQAT
FT                   VAMVADVDVTGTMDVSSDFAVNTNSFKVTGTNGNTEILGSLTMKAVSGIITHDGASGSL
FT                   AISSSTGPVTIAGQSTGGYVDVESVRFTDNQIGINGDADIITLTSLSGTSTVAFANKIT
FT                   TGDLATLNSATVTTTLHSGGDLTVGTGPKLTVAASSGDVVTAGKIAVAGSHGDATKALY
FT                   VTGSVYATGAVTSASDSRFKRDVRSIHDPLAIVRSLEPVTFTFKRDAFPTRDFPVETQA
FT                   GFLAQDLERVLPHLVTEDDEGYKGVAYERLGVYAVAGVKALDESMERLDESMERLDESM
FT                   ERLQNDTVARLEARVVELERALAALVSRASGPTPAGR"
FT   gene            <359714..>359944
FT                   /locus_tag="MICPUN_74755"
FT   mRNA            <359714..>359944
FT                   /locus_tag="MICPUN_74755"
FT                   /product="predicted protein"
FT   CDS_pept        <359714..>359944
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_74755"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E157"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR037366"
FT                   /db_xref="UniProtKB/TrEMBL:C1E157"
FT                   /protein_id="ACO61681.1"
FT                   /translation="YSVFVGGLNFDTDERTLRDHFERFGEVDSVRIIYDRETGRSKGIA
FT                   FVHFAEKESIAIAAERTHGVEIDGRAVRCNPA"
FT   gene            complement(<360631..>361968)
FT                   /locus_tag="MICPUN_56754"
FT   mRNA            complement(<360631..>361968)
FT                   /locus_tag="MICPUN_56754"
FT                   /product="predicted protein"
FT   CDS_pept        complement(360631..361968)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56754"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E158"
FT                   /protein_id="ACO62112.1"
FT                   /translation="MGVDPGDLLSLVPRDVLVKHMFADFAPIELLICSRVCHSWRTVFI
FT                   ESGLLPLPDRCELLDSIQVLVRSVSLLKWARSNARSWMEGERLQQIMILAAAEGRLDTL
FT                   RWLSSEGYRIHSKCLSDLVFAAASGAHQETLEWLWVVDNMRSLAIPESFKGTPEFNSDE
FT                   YDEYDECISLDHWRDIWFIVAVQGSGSSGNIEFAVWVRNFAASVGHTIDLHLEEDCLVR
FT                   AIHEKHVHFIKWRRGMFEKFNDQTRRTLCWEAAREGSVEILTFLLEECRWNTVFDDYGD
FT                   LYRAAIFYNPDVDHQPILSYLYEKGHGFDSRATVAAAFVGNLDTLEWLRARGCPWNSNV
FT                   VENAAEKGHLHILEYALDHGCDGGAWVFCYAARGGHIQVMEWAMARGLEWDERTCFSAA
FT                   KRGHLDALKWLRARGCPWDRWTRVYAERGRHTELLQWAIDNGAPPP"
FT   gene            <362071..>363294
FT                   /locus_tag="MICPUN_99342"
FT   mRNA            <362071..>363294
FT                   /locus_tag="MICPUN_99342"
FT                   /product="predicted protein"
FT   CDS_pept        362071..363294
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99342"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E159"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:C1E159"
FT                   /protein_id="ACO61682.1"
FT                   /translation="MRRLHVQRLLLCCALLLLPNARALWFSMPPECDGRCWEEDVKHPL
FT                   ASCDLEVVEGAITPEEADDVVAAAEAHAAVHGWHSQRHIAYPTRDLPWTALPSVARVFD
FT                   KLWGAMEESVRRRCGVRPIDRLTPNDIFVVKYTPEGQAGLDRHRDASSFSFNAALSDPT
FT                   SYGGGGTRVWLDSAVRTLREKYLRAELEGVVRDGTAPGASAEARGAAARAEATLDRPPG
FT                   TLDVDGYVVRPDRLLPEDGETRKIAKGSVMVHGGRNVHEGTAIVSGTRHIVAGFVGLNR
FT                   HCCTLRYSGWRGVMALVRVTAMNNSARGGVRDKVGGRVPLWDYVLYEEWRGVFRWIRGA
FT                   SLVLALLSLAAYAAWHVATRLSPRFNLAARRALAVVAGYESSFFRGLARKRRRAMRSAL
FT                   PTKHSLDD"
FT   gene            complement(<363422..>364594)
FT                   /locus_tag="MICPUN_56756"
FT   mRNA            complement(<363422..>364594)
FT                   /locus_tag="MICPUN_56756"
FT                   /product="predicted protein"
FT   CDS_pept        complement(363422..364594)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56756"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E160"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="UniProtKB/TrEMBL:C1E160"
FT                   /protein_id="ACO62113.1"
FT                   /translation="MASALVTARSTAPAVLAGALSRPPPRRVDRLPRSVSPRTAAARPR
FT                   EAPSRRRLAAAEEDGTATTATTSEGDDEEEIPQIEIPERPEHVRVVDAFLPAADAVALR
FT                   GVFDAHNDDPRRVHEYRFVWDYWHVPGQYTQLRTPAADYFPKEQFEQLEDALLTYAKET
FT                   LGCSAMTPVWLSNYVDGMRQEIHADVPHGPFAFVLSLTNWDKRRFTGGETFLLRPETLD
FT                   YWRGFETSSVVERGAVVQTVEPEFNRLTVFDPRIPHGVNVVEGTRDVREGRLVLHGWFR
FT                   DLAPHFSGALTEAACEPALGEILPRLYEALGALPRARGVVVIRVNVDANGAVTGTEWKA
FT                   DTLVPAPAPNLPDPTEVRDAILLEIAGTFMDAEFPAAGAPGAVTMPFEFD"
FT   gene            complement(364737..365424)
FT                   /locus_tag="MICPUN_107882"
FT   mRNA            complement(364737..365424)
FT                   /locus_tag="MICPUN_107882"
FT                   /product="predicted protein"
FT   CDS_pept        complement(364807..365370)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107882"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E161"
FT                   /protein_id="ACO62114.1"
FT                   /translation="MRNKGRSRRLAAAANSADAASAEATSPTSPGAGADDDEVRQPFAA
FT                   SDRVGSRAGSGAGTGPSDADTTSGDVRLNMFASSEHVGGEGDEGFRGDGATTPVEARGV
FT                   ETLAVLDEQQLWAMGLLGDEQIETKNMSREGSAHSEIGYEPAAWVDSETCQLVPELRNE
FT                   LLELMHQKRARSTEPEDVDDYLVL"
FT   gene            <366970..>371157
FT                   /locus_tag="MICPUN_56758"
FT   mRNA            <366970..>371157
FT                   /locus_tag="MICPUN_56758"
FT                   /product="predicted protein"
FT   CDS_pept        366970..371157
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56758"
FT                   /product="predicted protein"
FT                   /note="Encodes a protein with hydroxyproline-rich
FT                   glycoprotein (HRGP) motifs; GO_component: GO:5737; membrane
FT                   - cytoplasm [PMID 16020]; GO_function: GO:8565 - protein
FT                   transporter activity; GO_process: GO:6886 - intracellular
FT                   protein transport"
FT                   /db_xref="UniProtKB/TrEMBL:C1E162"
FT                   /protein_id="ACO61683.1"
FT                   /translation="MRRLFGGLGARGASGEKPKKPIRANLGDESSFYYDEKLKSWVDRN
FT                   DKSGAAGGGGGDGDASSLPPPPTSAPPTPAMPIRPSSTAASSTNGGDGDGSTAPGSNPL
FT                   SRSNSLSHVRNRYVDVFAGAASTAVSSGASTPGMTPATGSAANLLAPVLPGSFVPAPAG
FT                   ANGGATSGATAATQSGGTAGAPKFFVPAVPSQSSMTETSAEDDDDDADGVGGQVSGAHA
FT                   GGPRGGATGGAGVGRLGLDRLIVPDEGTTMLRGEGATVSPKAAKGGHHHARGPTLTAIA
FT                   TGGGAREEDTDPRNGPSGVGGDALGSSEDASGPFGSPPRRRGDDARDSKSRLGDWAQAL
FT                   GRVSEGMSSPKAAASARVSENFAPDEPAASAFSGSGGGFSDAVGGGAGSGDEPRVAPGG
FT                   FFVPTSGGSGGPSTTDDAGTSNARSLLGGDDGLLGEPALLQPAGDGGGGGKRRGGGGGR
FT                   DSVDAGAAPEELPDVPADLTYSERRERERLARLSGNAGYGVPDGTSTSPVKAPTYGAGA
FT                   YGGAYQDEYREYSDGYGDGARFGYDAATAEPSLDYQQGYEQQQQQQQQQQQQQQIQDGD
FT                   VTWSQDEQGNWWYQYPGQEAAMYVDPSVAATGGGGEGSSETVAAFDDAAGAILGAETID
FT                   PDPVALPGAETIDPPPSSGVLEILPDPEPEARVQPTTAEPEARDPSATAPAFAASGGGG
FT                   GGDGTLEPPPVVGGSDLPPPPTRAAPAPGAPPNPEDFKTDEDYDRAWQEALDAAYADAN
FT                   EAERREKIASAALEDAEAALASAKSENEAFRRELETVRAAAEASAAGAREDATAARSEL
FT                   EALRLELEGARATIEEARAEAASSRERQKQVVSSDDAGGDDGMPGGDGGDAAGDAAQSA
FT                   RAAGYRAGHADGYREGHAAATADGDEQMEDLLVCLGQEERKTERLRELLEANGVDTAPI
FT                   MAELEAEAEANMAAQMLGGGDTTAADDEETQDEVEDGPAQLDAGGEPPVREVTRSDADV
FT                   HVDDTSFASSVAFMTDASALDPPGAAGVRGFGFGPTRGVGGANGEGLTTTPAPGYGYGD
FT                   VSIDGSIHGVEVSGMASVPDTPTAGGAAVLRDISLPDIPAFRVGDEPEPEPEPEPEPEP
FT                   KEPDLPSAFGGDDDGWRDGDDGWNRDDEWNISGEIARDGEAAQNISGWDLNSPMPPGLE
FT                   AAPPPTAPPPMAPPPVAVAAPPPMAAPPMAPPPMAPPPMAAAAPPPVAPPPMAPPPMAA
FT                   AAPPPMAAPPMAPPPAAVATVPFGSPFDDAVDAGDDVAFFNQFNADVQPMVPAQPMVPA
FT                   QYQQHQQPHHQEHQHQHHHQQHHHQQHQQQADVYSFAPVQPQAHHYYGYDQAAQQQQQQ
FT                   QQQQHQQAGYYQQHQPPGQAQVQTPVNDSAMHAHTPGGLHYQAYPPAPGKWD"
FT   gene            complement(371186..>373858)
FT                   /locus_tag="MICPUN_56759"
FT   mRNA            complement(371186..>373858)
FT                   /locus_tag="MICPUN_56759"
FT                   /product="predicted protein"
FT   CDS_pept        complement(371270..373858)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56759"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E163"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR025751"
FT                   /db_xref="UniProtKB/TrEMBL:C1E163"
FT                   /protein_id="ACO62115.1"
FT                   /translation="MPNTRKTEVIKQEANGTAGDVASVKKVDSVTNLLSPLPSIEKVAS
FT                   FGLTPNPSGNPPLNPAVNAMKKSGSGLATSASPSADAAGAGGRPVDSGVTSSGATGSDA
FT                   NALGSGFRPIKRSRRSSENHDKDVNVRDFEGVDLAGISRRFPQEKRVQLAQRIDEHAEK
FT                   VAGAWAALLLAQTGMRYAEWATTASRVEQTKQNTLRIVKAIVDYLTTASQAKLRQTISY
FT                   IVAKRRRQGFGHEEVITSMLLLRRSFEKGCGPIDGEAGFLIDAVTRVMVGEVATYLHAI
FT                   NPHEESQLDVCVATEDDDELGVEHPEDLNLPPQRHLQQDLEDVRPPMHLFIVPKVPAQY
FT                   VRAREGGTPIMLAPLWSRAAHEPSGLWTWPRGTEPLVGAIVNNRFVVEAYIASGSYGHG
FT                   WKAVDLHSKKPVFLKTPRASHDYMPSDMMGELARELGTMRRILHTIPKHPRLVNVIEVT
FT                   PPHAPKPCATSCGVTAPIHYFACDLCEGGDLFGYISTQPLEPMREPVVAHIFRQLMEAL
FT                   EFLHGRNLFHRDLKTENMLVSREEGRYSLKVADFGRTVFVPPQPSETGEGPTNIHEQFS
FT                   YDNGIFPAEAVRGGMIGDEVMAAEDGMYRLPSADVWAAGLVLLLLTGVGRMSKIKHNIA
FT                   DALRGRGERFAPLSKDETPIDRLYRLIGPGWQVSPELDQLFRAMVHKDPMMRPSAEEVL
FT                   ACDWMKKADEVTEAEVVAAFESRRPVSEEAHNTMSVTCAPRLKDTATAFDALIEALQSL
FT                   EWPTAGNDVRAEVHVDRDRLTATCVMDEMRIRAILTPVEGLLEKNPTVNMFKEGEGEAD
FT                   PVAAAKRMEAARRERENNQTPIVRLVWIGGSAGAMQLVNVYMAVSAMLST"
FT   gene            <374641..>377124
FT                   /locus_tag="MICPUN_56760"
FT   mRNA            <374641..>377124
FT                   /locus_tag="MICPUN_56760"
FT                   /product="annexin family"
FT   CDS_pept        374641..377124
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56760"
FT                   /product="annexin family"
FT                   /note="Annexin homolog; GO_function: GO:5509;
FT                   calcium-dependent phospholipid binding - calcium ion
FT                   binding [PMID 5544]"
FT                   /db_xref="GOA:C1E164"
FT                   /db_xref="InterPro:IPR001464"
FT                   /db_xref="InterPro:IPR018502"
FT                   /db_xref="InterPro:IPR037104"
FT                   /db_xref="UniProtKB/TrEMBL:C1E164"
FT                   /protein_id="ACO61684.1"
FT                   /translation="MSGHCPSDKWFFGSVFVFLIAVGLLVGGAVNMQSAADDPRTPRVK
FT                   TYDGYVDAWQSTHFDEYSGKYASTTPTISVARGASAGNGSTTTVSVWTKLETATIVLKD
FT                   SRSDYKRHNKHFALFTDIPNFHATGKKSEKQSEDVTLTIGSNTMKFHVTECKVTKHNRK
FT                   KKVKNANGEEVEVDDPYWTIAPTFLNRINFVESINGGSGVSTLSREKCDDVWWPVDVNN
FT                   KYTSSVAAANGCTTNLAPPSNKALEIVIRSPMDPVIKAMSIDDTGCERDFGPTADEFRF
FT                   RGIMFYSFMGVALLGAFYLLERSRRSHGWKYPMQDAIYWQIFGDPNDFRERQTFPFCCY
FT                   RIDPPKVFDTPIEKICYDISEALKNGKTKEIMGALLYDITAEANNEGMLRDEYIRERVV
FT                   EEFNRLGYGDLRAEIADKIPKANPLRDVLDALLTEQFDFEAQVLHRAMKGWGCDEDTLT
FT                   TILCTLDEADIFKLQNAYSSRFEKSLEQAMLSETEGKYKRVLLLAGCDGIAEAYAKVCR
FT                   SAIEGAGTDCKALIRLMVTCTHQVMYDTRKAYGRLYNLDLARDMSGEWAISGDFKNILC
FT                   ALVKKHPDNIETDPDYDADIQILHDAVEGLGTDEDAIIGVLRNKTEEQLQMLQRKYDAT
FT                   HCEDLKLRLKSETTGLFESEGFRNTLMGLLTNREEQIAIYLKEAFEGWFSNDDWGLISM
FT                   LVHRTPQEMELIRNAYTRVHGRDLIADIRKNCKGDYEKALVALVAPRARTYARGIKATA
FT                   KGWISSTNKSGLIALLTHKDMLMNEIRVEFQKESKGGTHLIQFLRRECSGEFERALVNI
FT                   AEYTPPASYTASNAV"
FT   gene            complement(<377344..>380458)
FT                   /locus_tag="MICPUN_56761"
FT   mRNA            complement(join(<377344..380199,380306..>380458))
FT                   /locus_tag="MICPUN_56761"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(377344..380199,380306..380458))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56761"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E165"
FT                   /protein_id="ACO62116.1"
FT                   /translation="MGSEGAGAPPAPLRPEECLDLDLWDHIFDDAAVAKRSPLRTLARD
FT                   MRAQLEIAEKALPRTAERDALLAKLEDIAEAASRDVTLLVADWRGIEGSVVADDDETNG
FT                   TPAGKGLEHLPLQEGLPPGVNVVTRVGTVTRAALADADALALILDEHQAASAEETTTPS
FT                   VAAPYSSDAPRADETPEREEGSRQTPASSTDEGAIEGEAREGEGDDAAVTTVTTAGADA
FT                   AQLARECVKRAGEFSVFIAVEADQRPPELRFDRAAGPPTADQPEEPETPPPLDAAAAEG
FT                   SGEGHSGAGDEEPGANPLESFEAFGSWFNKMVETAADQFTGNNDDDGSSDDDGEDLSDG
FT                   GDAAAGMVKSSGPKSPEKKPAAKREKRDSESERKERERKEREAEALRRYKPKRPRDAAN
FT                   GLAARCGVRAGRILSVATMHLVPPPGGFARTAGGAAEGTAGGDDDSDAGPDGDGSKPLQ
FT                   REGGEGETEAEKAERERNAAERARAMSELYRKMMDEQDRGEGPSDDGDKTDGGDDRTGG
FT                   EGGDLTNYVDDAEIEAMLGETEAANNWSKVTDREYAWVKAVGKTCQAIMVEKTLGLIER
FT                   YAPLRAYVRYWAAVVRADETLSNHADAAEQAKAVAANTLGRILTSAAEGMPNVGFVGAA
FT                   ELAALHRRRDPSISAGWLKALIYGDSTMSFTGGTILSLGGPAAAPVTAPPALAMYFTIR
FT                   LRLCLAIAALGGCDVLGPEAGAATLACFFGTDARELLDARPRVEELDALIAAANDAAAG
FT                   GADGGNGPGRSSSWLPDVSGAMSRVFKAGASAQRVAQRCAAGYAARASAHVARRAAMGR
FT                   ETFQSGTGDVDADCTRAYEVAYQRALPREMVRAMGEHVFTAANMVVVAAELVPFVSSYL
FT                   TVRAANAAIKCHLPHLAPAAEAELENAKDSADANAAAATPSGGWTKDITDGASKVANSV
FT                   GAAASEAAARTSAAAAAAGAGIASLWSKASETAASSIKVTGLVREGGTEPVPRLSDPDA
FT                   LRTFVSTGSGGVV"
FT   gene            complement(<380608..>381921)
FT                   /locus_tag="MICPUN_56762"
FT   mRNA            complement(<380608..>381921)
FT                   /locus_tag="MICPUN_56762"
FT                   /product="predicted protein"
FT   CDS_pept        complement(380608..381921)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56762"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491 - oxidoreductase activity"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:C1E166"
FT                   /protein_id="ACO62117.1"
FT                   /translation="MRLAHAMRASRGSPGRGPGAARAAKGETRRPGEGPAPAKASPHPR
FT                   THRLGRADRGERRRLGDSDLRVSLASLDASTWTRIGDEVEAHAQLSLAVDNGVNLVDLG
FT                   SCDHLGDGMPRSASSSSSSSATIFELTRGRADAYLGSWLRRSRDTRREDLVVAASVPFG
FT                   AAAGAAEGGAKGRRRRIKNLVERTLMAADTDHVDLLQLHYPRRDSSAMGNSDAPDEDEV
FT                   AALLDLVGDGKARFLGVDDDTRWAALETARLFANPKILVPDGLGSFVKSARGEYNLLAR
FT                   DGFECVWVEGEDAYADALRNVGLVAHSPLANGALRSRRTAVHKSHADATTAKMIQTRGE
FT                   RGARDESVWALVDAYEEVAGQFGMCLGDLALGFVRSRWFVTSVCVRARTSDALGTTLAQ
FT                   LYDIEVTEEALAEVERVARLGRVAEEVDRGRRRWSQEL"
FT   gene            382098..383201
FT                   /locus_tag="MICPUN_107885"
FT   mRNA            382098..383201
FT                   /locus_tag="MICPUN_107885"
FT                   /product="predicted protein"
FT   CDS_pept        382228..383127
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107885"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824 - catalytic activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E167"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:C1E167"
FT                   /protein_id="ACO61685.1"
FT                   /translation="MAMASSGEAARPSVIDAHLHVWPSPSAYTYAEGKAPPDSLAEVSS
FT                   AESLLEQFAKAGVDGALVVQPINLKFDHSYVSSVIDKYPGKFVGCCLADPTEHGGGVDE
FT                   LRRLLDGGYRAVRFNPGLWPSGTKMTDRVGREMFALCGERNAPVGFMCFHGLDLSIEEI
FT                   ETLCTDYPETPVLMDHFGFCKGVRDPNWQKLLGLARFPQVSVKASAQFRVTPEGANGAS
FT                   WPYVSTGEQLRELIDTFGAERVVWGSDFPFVLEQCGYSGETPAAGIIRECGARLSDEEM
FT                   AAVMGGNLRRMFPGAWSR"
FT   gene            complement(<383200..>386064)
FT                   /locus_tag="MICPUN_99349"
FT   mRNA            complement(<383200..>386064)
FT                   /locus_tag="MICPUN_99349"
FT                   /product="predicted protein"
FT   CDS_pept        complement(383200..386064)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99349"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E168"
FT                   /protein_id="ACO62118.1"
FT                   /translation="MQAPWVRPSTRSVGVTSTPRARCAVASSSTRATGEPSPRRCAPDR
FT                   RGGARDGRTTTIFSATTAIVPLAVAPPRRSTGRRGADFSRRGPVSLRARRARFAVVPDA
FT                   GDGETVPGGGDDDGTSDDSDPSSANQGDDRGGIVDEATEETEEEDEEDEYEEVEVEVDY
FT                   TVLDHARDAIDSLGTWSDVAGWGDDQSVTNRETSRGVGGAAGTSSFKSAATAPVSAAPG
FT                   GKLGMAPTDGVVVALAFTIGALFGRRQAEAGGASRGLAELVKSGNGGAVPGGVELRPMT
FT                   EEERIADEKRRAERRAEKERREAEATKKRKEDEAKFLAAEKKRLEKEAAEAERVRVAEE
FT                   ERRAKVRAELAERAEIERAIREEKEAKEREERERREREAEEELRKRREEEARVAAERLA
FT                   AMNAEKERRGETLKGFDVAASVTYEYRAGAGDVEVEVRARCGISSPATISDAFPTSEKA
FT                   RRGALEMCSAVAKSAVANFASDQRVRRMTGETDRCLIGVDPVTGAGFDDAEFDHWMRVS
FT                   QARTDAELRTLVMRGGAAMELKIRQPGGASNNQRETSELEFRPERASLPSADADNVANR
FT                   LTAAAAAALDNAYGVATEDLDWVARYELSALHGLDASLCFPAVSEGDGDKNRLKGTVTA
FT                   TMLTLSHWIARAKMNLASAGDAGPGLAAVSALEELASQTLSRVANAEGASWKAMYLDGF
FT                   SGDAVTRIAATARALLEEDDVIRAILERTEEEHLRKLMNQPTLDEEQFPDREEARRMRY
FT                   RAEKDAEPLAERLWAMRNSAAQLAQSGARAQARTMLEEAYTMRIDDVAKRREASGLDPA
FT                   PPGSVAPEALPELLALEECFRGEPSWDKELAGVRGQVLKAVRAAAARSLAMNDAKRAAA
FT                   LLEGAAREYGSDRKLGATHVSVAKTRDAADEAWRAAGIEADDEEAKDAALAVVAGTPVP
FT                   RGQGGGIVMKLGKTYLEELEIRRK"
FT   gene            <386448..>387974
FT                   /locus_tag="MICPUN_56765"
FT   mRNA            <386448..>387974
FT                   /locus_tag="MICPUN_56765"
FT                   /product="predicted protein"
FT   CDS_pept        386448..387974
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56765"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E169"
FT                   /protein_id="ACO61686.1"
FT                   /translation="MSDPIGFGELGELGRTLDEDMMMNSAVFDGALDAIYSKFDLGNPD
FT                   DLASLYGVSPGAPDVRDVRVPAQTGTGTGTGSGDGSGDGSGAFNPKIDGKAETTSTAVG
FT                   KRGRANLNQAEVQKRYRERKKNRMLDLEKQVEDLREKVKELEREKARRGDGTDLKEASG
FT                   SGNSTPPDAATTTTEGGRSSDDDTTTLLRPFAVAPGDGDPEFTERMLREDAARRSRDSK
FT                   GLKTDSGDGSGCEGHLTFIIEASEALKRGVDGPSATGKFKNYTEAEIWWGGVTEVYNKA
FT                   VRNIRDLVDVGANDSNLRSAIDAISNVVSVARESRSELAVISTMTRSAENMEKDAASKG
FT                   LDLRAACRTSCALLAKSVVDASMQSQNTQEVLTKLQNELPPKDLEIIVDWFESYTDEFQ
FT                   RIGMVRYSMIQKYEHTKLTADVPHTVYGIPASEVTKEEGPYAEDSRVIMDSLRKEMLMY
FT                   KDGIQDLLQQLPVRSAAQLYLSAFPSAPDPLSLALELKKKLRPESKATSE"
FT   gene            complement(386550..>391526)
FT                   /locus_tag="MICPUN_93660"
FT   mRNA            complement(join(386550..389274,389410..389981,
FT                   390246..390311,390489..>391526))
FT                   /locus_tag="MICPUN_93660"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(388071..389274,389410..389981,
FT                   390246..390311,390489..391526))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93660"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; ATP binding - nucleic acid
FT                   binding [Evidence 8026; helicase activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1E170"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018973"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E170"
FT                   /protein_id="ACO62119.1"
FT                   /translation="MRDSEEEKRATEEKRATSTTLNDDDLWSRVNAAPVSAFLAVAEAE
FT                   RRRNGVAPPLIREETVARAKRGGRGGGRKKGRAACRCHGLEQLDVDAFIAHLTIGPDSL
FT                   GGKGQCEHRLDVPARPTRLAPEGSPPPALRPATVAALVASGVPLHDADHARLRLFSHQH
FT                   EGICAALRGKNVCVATGTASGKSVCYNAPVLDSLLHDPDATALYLFPTKALAQDQIRAL
FT                   RVMLDGAATYLGDHAAPIDVGVYDGDTPETERTRVRAECRLVITNPDMLHVGLLPQYKR
FT                   WARVFKGLKYVVLDEAHVYRGVFGSHVSLVVRRLRRISRELYGSDPRFIVTSATIANPR
FT                   EHAVDLWEVIDVDGSPSGEKTFLMWNPPAPRSSPIVEVAALLAECVRHDLKCIAFCKTK
FT                   KLCELVLRYCREILRDTGAGHLADSVAAYRGGYAAVDRRAVEGALFGGALRGVAATNAL
FT                   ELGVDVGYLDCTLHLGFPGTVASLVQQSGRAGRRGRRALGVYVAFDGPLDQYFMRDPAR
FT                   LFERPIERAAVDPQNFKIMRAHAQCAAHEIPLDPRVAEDNRPGGGGGGGGGGPAPDARL
FT                   VWCGGLVSDGERGPANGVSIRTIEEERYRIVDEASGRVIEEVEASKAFWEVYPGAVYLN
FT                   QARTYLCKSLDVESRTARVRLADVKYFTGTVDATTVTLVQHGSQRHAYPHRPGPAHRRP
FT                   QFPGTTAQCAECEIKVTFSAYHKIWQGTGRVFDTVSLNLPDVTYKTRAAWIRVPDGARR
FT                   ECEESGVDFRAGVHAATHAMINALPLFLMVNQSDVGAECDDPQRGHYKPTRILIFDRQP
FT                   GGVGIAERAAPVFPRLLRAAIELIEECRDCRGDRAGVAKGTGPDPPGDGSRGRREADGE
FT                   GGPDSASQTPASQTPRDQSGCPGCVHYLACDVYNVSLDRLAALVVLRSIVNAEEGTFGS
FT                   FEDAAGSDLTAAGDGRGCCANGRHGNVGA"
FT   gene            <393339..>394739
FT                   /locus_tag="MICPUN_56767"
FT   mRNA            <393339..>394739
FT                   /locus_tag="MICPUN_56767"
FT                   /product="predicted protein"
FT   CDS_pept        393339..394739
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56767"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:C1E171"
FT                   /protein_id="ACO61687.1"
FT                   /translation="MAKTSATSTAPNDAPASSPAAGGDGWTQRVLTLNPKRRGIFIWTD
FT                   ALRKNVPEIASCKAGVLNLFLRSTTAALSVNENADPDVRTDLENALDRVVPGTDVLDAT
FT                   ARSAFVGVSLDVPVQGGKLALGTWQGLYLCEWADGAEPCQVVATLVDASDDVRCTRNVT
FT                   VRAPRRGCHLVQDEVDDAFKPARDRTFKPDRTNKPGLANLLIRHTSASLTLNENADPTA
FT                   RGDLENALNRIVPEEWHSTLFSHVEEGPDDMTAHVKSTLLGCSLTVPVDAHGAMKTGTW
FT                   QGVYLCEHRNVGGMGVGHAREVATTLIDGAGVANTAGQTTVTLTAPGRGCHDVTAEIAA
FT                   AAKAIGVGSNVRTGWLNVFVQHTSASLAVCDSTLAGAGDRLERALNETVPESWNDEFFV
FT                   HTYEGPDDMPGHVKASIVGCSVTVPIVDGELGLGKAQGLFLCEHRDAGGYGCNLNRKVV
FT                   LTLQGVDK"
FT   gene            complement(<394850..>395436)
FT                   /locus_tag="MICPUN_56768"
FT   mRNA            complement(join(<394850..395063,395142..395215,
FT                   395293..>395436))
FT                   /locus_tag="MICPUN_56768"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(394850..395063,395142..395215,
FT                   395293..395436))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56768"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E172"
FT                   /protein_id="ACO62120.1"
FT                   /translation="MPTYGTHTPDVKYVPSSLMAFGYKGVKPVPGVPNMYLKDYQDNLF
FT                   EMDIKDGAAGVSNCNFHWNDCDIAPRFGNHEDRVADKDIKYRPNVANICPRPKDWKPGK
FT                   YQSKGVDGVDVNYPRIDERNRKYWGSAGGSHAKTFPSDE"
FT   gene            complement(<395586..>398315)
FT                   /locus_tag="MICPUN_99353"
FT   mRNA            complement(<395586..>398315)
FT                   /locus_tag="MICPUN_99353"
FT                   /product="predicted protein"
FT   CDS_pept        complement(395586..398315)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99353"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E173"
FT                   /protein_id="ACO62121.1"
FT                   /translation="MKRKAPASPPPGRDDVTVETFVHEDFAGRYDGEVDDEGRPHGAGI
FT                   LRLDDDGAWYEGEFRRGARHGQGTLHFPPDDDDDDDEDEDEDHDRKHGPMPETSLEGLS
FT                   TRGDRVVGSFADDAIEGYAEYLSSDGTRRAGLWHDGELSGLIEEFDEDGECVFGGEMDA
FT                   DGNKNGRGWFSFPDGGCYGGQLAAGKPDGKGLYLFPLTYGVCPPESKLAAATFAFWGMY
FT                   QSETKEWEAWDHRRDQAELEWQKVADGKRCPTSLAAKPDLEKDWRDEEPGPWSESPEMC
FT                   GDDPEPPAGMPERMCMYGEWVGGKCVRAGFYEGFGFWKEHFWAQPHLSPLLADIFMCFF
FT                   ELGHTEGHGEERYAIAKAAGLSMRDEIEKFQLYSTEQGCHMPNNSEGPWGVVKAGADSY
FT                   SGEKPRNHEPGELLGFVSGRRRALRGGWGERRWLPSDKIFFLGDDDGAPDPPAEGSGAD
FT                   PDGGSGAGGVFIIADDTDPVPGEAKVPDYDSEGDEKTFLTNIDVPLKRKDGSRRRIYTT
FT                   LGEHAKVVVRDPPNCERRPYVHPVLGNILALVATRKITRDEDITVPPCYDTGWRLNPRT
FT                   EAGYYYHLKNSPPAELFESGRGGEAGVGKVYVRAHGPWRALWLDKVEQGLAYDFNAGKA
FT                   YAEDPAFVDFKHDPAVLGFEYVRAMATAAVAAIGANALNARTRALCVGLGAGALPAFLS
FT                   RVVGLDVLCVEIDADVADAARNFLGVDFRETNPDDAFDVFNERSTLNDDRLSAARGSGF
FT                   GLVIEDIADFLDRDECAGSFDVVLLDAYDGEGRVPAHLRDPENKFVQKVLGSVRPNSGC
FT                   IVANLWNSEDRAEFSRERRELEEFRKQLAAGGASARADVTVSGQENNVVVLAASGAAGG
FT                   GHLASGALRRSLVEIVKAHPGVGASLVPPEHFAATEPY"
FT   gene            398864..399867
FT                   /locus_tag="MICPUN_107886"
FT   mRNA            398864..399867
FT                   /locus_tag="MICPUN_107886"
FT                   /product="predicted protein"
FT   CDS_pept        398943..399830
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107886"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E174"
FT                   /protein_id="ACO61688.1"
FT                   /translation="MWRRMAWEKFGREWFDACETDESILYYEHPQPNHDKWYLRLRDRE
FT                   TVVQDNGMYEITTITEYGHEAEEYRASKKMPAGATECEWAGRKYKLHNYSPPPICVDST
FT                   KEISFKLHLKCIWDVVEAAWNMMCDEVDVPSYADVRRFFYRPGQIMSMSEPECWYDDED
FT                   GEPNDRKYDRETTIQAAKEFCGNLLGLMMKHFEGADHVLRKCDWPEGEDWTDMRKEEYS
FT                   EAFKEVVDKQCEVRDGRSWSLIPLLHDKRTRVVDMLVDRIGGFRYKEGIVRTLKVLDGF
FT                   KMIDGVVTNTSIHG"
FT   gene            <400211..>404140
FT                   /locus_tag="MICPUN_56771"
FT   mRNA            <400211..>404140
FT                   /locus_tag="MICPUN_56771"
FT                   /product="kinesin-like protein"
FT   CDS_pept        400211..404140
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56771"
FT                   /product="kinesin-like protein"
FT                   /note="GO_component: GO:5875 - microtubule associated
FT                   complex; GO_function: GO:3777; ATP binding - microtubule
FT                   motor activity [PMID 5524]; GO_process: GO:7018 -
FT                   microtubule-based movement"
FT                   /db_xref="GOA:C1E175"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029329"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="InterPro:IPR039873"
FT                   /db_xref="UniProtKB/TrEMBL:C1E175"
FT                   /protein_id="ACO61689.1"
FT                   /translation="MPTRGAGARKVRPEGQNMRTVVQLLTAGNKNLRRDVSVASRHVSL
FT                   IRPGYTEAQTDDTYEVDDCFGSDLGNTEAYKRVLHPAVKQVIDGFNSSCITIGCSGSGK
FT                   TTLLHGRTSGDGIVRLAIKALFEGLHNKAAQVGLLLSQHKAQGGGGQSMEFAVDASFCE
FT                   VYEEKVRDLFAAARDAEAAGGKDSVKTEYLEVEETADDGWHVAGLSHRSAPDAASLQTA
FT                   YAGALNHRVTGLSEYGHSKHDRAASVLTLKVSQYIPGLPNATGEIAPAQHIVSTIVIAD
FT                   NPGAEPLAMDPAVLRLREGARLNKAITALAGVVRALATQRREFAGHGDSVLTKILSEPL
FT                   GGNCATTILGTLKLGEWERSSAVMDLVGHARRAPCFPVVQDDAARGLQQRLRSRLLQIN
FT                   DARETYRDQIQSTGADGIDPNNIGLQMAKLHELEGQLLNERGDKAELLAEKEALIERLQ
FT                   RLNGMDKANLAEKEELQKALIASEEDRLEIARALVEAQLEANEAALQAEKTRHELVERV
FT                   HELEARAIASEVRVKGAEQSYGELQNKAGSLNVENQRIKEELDQTRQELEKELKEIRTE
FT                   HAEVSGEVSSLKAANEDLSAELEDFRRKINVERRRAEDAESERDEFRANQEMYQSNMQK
FT                   KVEAAERMAEEAVKVAEETKNRLVQAAKAERDEAVAAARASKDKAVQAAQEERDEEVAK
FT                   ARSARDRAIDEMRMEKEKAVFEARKEKDEAVALANAEKAERTAYLENDRDTRVAKAEKD
FT                   KDEAIAKALRERDEAVTEAKRRSSEAIAAAQEDKDAAIAEAHRLRDLAQERLKFETERL
FT                   GSIANEANGSIQGVTRAMEEARSAERMARREADRAVGEMTQLREKLENVRAEFSQRLKE
FT                   YMLQVGDLERGAQVLATDPNADHVLRPSQLYEAAQTLALDLHRASADQVTEYRRVTEDL
FT                   QQRLTRAQRDVRALHAGYRTLRHRFEDVAPETVDEKGKAAVPHEDDLVGTPPTPAEARE
FT                   MDARGLAQKLADLRDENAALQKELRMAALDGRGPLAPHNVRAAKEAAARGGGSRPGTGE
FT                   DGEIAYYNDGNKQDRDGGFGQVGKGEIVVKKNAPDDSFGGAMAGAGENARLRAENARLQ
FT                   KTIDELKHRRPSTTEEDMRAEVSKLRIQLHALSNQDNTRAKLTQEISVLKIQLQERTQE
FT                   LKEHKNHSQREAFKQQKAAIKEFTDRVQSELEKENRALQTRAAMAEEQIKEINAYMAQS
FT                   TLAYQKEIMRLRTIIQATAPERLRSPVNPGLMGSKTQDRSGAGGAQPHQREGRGDKGGG
FT                   VRASGGWDRSTKPSEPLRPRSNNGA"
FT   gene            <404237..>405268
FT                   /locus_tag="MICPUN_56772"
FT   mRNA            <404237..>405268
FT                   /locus_tag="MICPUN_56772"
FT                   /product="predicted protein"
FT   CDS_pept        404237..405268
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56772"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C1E176"
FT                   /protein_id="ACO61690.1"
FT                   /translation="MIATPMTATAPTRAIVSSTSIRRAIRPARVLGAPARRCRHTTLAT
FT                   SDSSDPAEGKGKEGAEEGDGISLDDLRILQQRVESIREREAKMDVLQLLVLDASVPGQV
FT                   LPLQFDAGGDPRRPLNGGTYVGEDVNLGDRFGMLGQAPSNGQILPNGVEVTVTRVLLKP
FT                   DGSSMVELTAGRRFKVHGQPFEDPDNDDAPSGRVVWIDPDLGAGEQTVEGADPALVHPE
FT                   APAPRDPATYDEESERLCRELPALVSTWRALVRDTGRERQPNQLELIEKHLGPQPGVSK
FT                   PARLACWVAGLINPIPALGVAYEIRPAMLMATTVGDMIGVAHKGISLSIKGLRKSAGDV
FT                   DAE"
FT   gene            <405419..>407098
FT                   /locus_tag="MICPUN_56773"
FT   mRNA            <405419..>407098
FT                   /locus_tag="MICPUN_56773"
FT                   /product="predicted protein"
FT   CDS_pept        405419..407098
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56773"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E177"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:C1E177"
FT                   /protein_id="ACO61691.1"
FT                   /translation="MATSATPAGLRAPSAGRARSSRTRILAISRATSATATSQDVIARG
FT                   SARRVQIPVVDLSEPDAVCASIVRTACDSCGFFHVVNHGVDDNLAFDVIRWGATFFDRP
FT                   WDDKMALVRGDMRVSRGYEISPEHIEALDRDVTREEELAAREPSAARRIISERFSVGPF
FT                   DVPNDSYHTDEEGALFFHPNAWPEDSIPSLRPAMEAYYREMESLCARLHRVLALAMGAP
FT                   ADFFEDKIDKHCSNLQVANYPSLDPSRWRDSDRIPLRKKSHADSGTLTVLWRSPPTEGT
FT                   KGGLQVLDDTAGTWVDVPVLPGGNERESGALLINLGNQTQRWTDGKWVSTKHRVTNPDV
FT                   HAPGYAPSRRLSVAFFHKANYDAVIDHRDFVPGRERDAPSVSYPPVRSGDVSRVGALRR
FT                   LGRGVDAREASMRYHEELMGGRDRAERAAGESTAVKIDASAETEGEPPKKGEPPKKAEP
FT                   EADRWASLMDPRGQAGPISAGDLGLDRGASAEGAGAGNDNPAAGCPVCRGTGWKPCGQC
FT                   GGTGINREDLFGGKFKEGDTCWLCSGKKKTMCGNCVDLTDSF"
FT   gene            complement(<407212..>408135)
FT                   /locus_tag="MICPUN_79669"
FT   mRNA            complement(join(<407212..407473,407540..407869,
FT                   407930..>408135))
FT                   /locus_tag="MICPUN_79669"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(407212..407473,407540..407869,
FT                   407930..408135))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79669"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C1E178"
FT                   /protein_id="ACO62122.1"
FT                   /translation="MLVREDDRQNRRGLRCFGWNKYGQAQGWDAPIDVVAVAAGERHSL
FT                   ALSAKGTVFAWGDNHTGQLGLGGEDPLPMDVPTTSLGRDVVIVGVAAGARHSVMVSATG
FT                   DVFTVGWGLYGQLGHEDAEDLFAPRRVEHLAGITVVSVAAGSAHTACVTRDGALYAWGS
FT                   NRKGELGTATGDVTKARESNDGAGSLAVAVACGSSHTVALARLESGEAGLFGFGWNNMG
FT                   QLGLGDDKDRGIPARIPLPANEKGKVTKLRCGWWHTVVGVEEY"
FT   gene            <408660..410576
FT                   /locus_tag="MICPUN_56775"
FT   mRNA            join(<408660..408788,408884..410576)
FT                   /locus_tag="MICPUN_56775"
FT                   /product="predicted protein"
FT   CDS_pept        join(408660..408788,408884..410521)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56775"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E179"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR003034"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="InterPro:IPR036361"
FT                   /db_xref="UniProtKB/TrEMBL:C1E179"
FT                   /protein_id="ACO61692.1"
FT                   /translation="MGKIPDTAAARKALKVAEIKALLEEAGLATDGTKPTLLERLEEHV
FT                   AKTDGDDGAEVAAPAAEPAPAPAAEPEAAAPEAAPEPVRDVPPPPVREVPPPPPAPAVA
FT                   KDDAKHEEDEEDGGEKWVLVAPAPTPLESLREMCAGCVSVEPLGGGPADGASTMALVEF
FT                   PAERDALNAVAALAALGHEAEIARRTLWQDDEDDADVTSTIVRVEGVSATIHESIVASV
FT                   FGTYGTCIAATREEGTDAFAVRMADRRGAETATAALSGVYRFEEGQEFPVRVTWCPCPS
FT                   KKSGGDRSSAAGEKRKRDEDVANGEGATLSAKQLLAVGLPATTQSGEQVAGWFAAEGGA
FT                   CTLFDKDRRCAILAFPTADAATEALDTHGGTLRPEGNPCPVTLRRIACDLDARPKKRSA
FT                   VQGPPPGVWPPVPKPGPEYGEPSAKIYIGSIPQEYAEDDVRRIFSTVGEVREVKILRNP
FT                   GDGRHKGSGFVTFSDIAATERAIHFIDNKYTLIAPAHPLQKPIYMKYAKIGRPSAAPQQ
FT                   PMVYQQPMAYQQPYYPPQQAYGHYPQHPQQAYAQYPQQAYGQYPQQGQAPQGPTHQQQQ
FT                   MWQQGFGGGAQQ"
FT   gene            complement(<410691..>412022)
FT                   /locus_tag="MICPUN_56776"
FT   mRNA            complement(join(<410691..411245,411640..411669,
FT                   411957..>412022))
FT                   /locus_tag="MICPUN_56776"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(410691..411245,411640..411669,
FT                   411957..412022))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56776"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E180"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C1E180"
FT                   /protein_id="ACO62123.1"
FT                   /translation="MPRGKKKEPEPEPEENEVMEDAAVEDDDEESAELEEMKKRLAAME
FT                   EEAQKLKDEANAIGDDMNTGDGASGAADADRAEADSRSVHVGGVDYATTPEELAKHFEA
FT                   CGTVNRVTILTDKYDNPKGFAYVEFLEADAVQNAIKLTDTEIHGRKLRVSAKRTNVPGM
FT                   KQGGRGRGGRGGRGFNPYGMMMMPMMMPHMFGGRGRGRGRGGRGGRGGRGAPY"
FT   gene            complement(<412297..>413073)
FT                   /locus_tag="MICPUN_56777"
FT   mRNA            complement(<412297..>413073)
FT                   /locus_tag="MICPUN_56777"
FT                   /product="predicted protein"
FT   CDS_pept        complement(412297..413073)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56777"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E181"
FT                   /protein_id="ACO62124.1"
FT                   /translation="MTLLTANSSIASRVRAPRASVRSRASSLRESLSGGWNIRRIVRAD
FT                   IAARDRRGGRVATAVRAADDGNFLDKLNPFKAMEKAKEKNAIAKREKEANQVINDDMRK
FT                   QLFGDGLGGRMLQGMVNNVAGALKEQMGAAAAASQETYDAAERAVRSDPKMRAALGDGI
FT                   RCTPPMSQMSSSQNVNGVQTQATTIVFIAQGSNGRQAQVQATGTGGGDQELRLDISGML
FT                   DTGEVVKVDGMGGGSMADGVFDVEAKTIDDDDVIDV"
FT   gene            <413551..>416436
FT                   /locus_tag="MICPUN_56778"
FT   mRNA            <413551..>416436
FT                   /locus_tag="MICPUN_56778"
FT                   /product="predicted protein"
FT   CDS_pept        413551..416436
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56778"
FT                   /product="predicted protein"
FT                   /note="Encodes a protein with hydroxyproline-rich
FT                   glycoprotein (HRGP) motifs"
FT                   /db_xref="UniProtKB/TrEMBL:C1E182"
FT                   /protein_id="ACO61693.1"
FT                   /translation="MEEAIAAAEATLEALVKAAEDFAVPLIAEQRAVLAAADAKAADAA
FT                   SPARDAFETVRAEFEKKIDELDGALTSAVEKERAEIAVVARAAREDPFAEDEDADVATI
FT                   VASVFDPAREHLGERLRNSRSAAEKMLQWLERRAPDLDRAATDAASKAADAGDGIDDDS
FT                   GKHEDWAADEESDLEDLPPLGGDWAEDDEDDLPPLEGEWQKDAEAGPSPTPPSPKKKPA
FT                   AFKPRDASPPRGNAWGHAPPAHGRDRSDAGHRMGPAAGRDVDLRDRLGGGGSRDYGGDR
FT                   RSSFDRGGDYGRDRGGGGFRDSWGAPGGGYRDDRRGGGGGGGGHRSEYIERMERKYGRV
FT                   DDGPPPRSTMRDRSPPKPPPEVHYPTRDEQRAEAKAREERAAWRLATRPLKEFFANAKK
FT                   GEGISPSTIRELLNELSEPPFAEGRLAPNARKAFELVAASAKETGSKRTFEEVEELVRG
FT                   VVNPLYHLLTYGVKAPGAEGGGPPSSVAETIAEQMHTAAVKLLAASLDILSKGDATKKA
FT                   VESAKGIVIVREQVAAKLAGRAPGGGRGDKETTVTRRDSVDGRGHGKGSAANKPAQASG
FT                   TDADRWDRKKDGRPTPSPEVYRAPRGGEKGVGVMARLGDKNDSSSPANGVKPRAVPKVV
FT                   IHRPFSEGKQRELTPSPAQQGQGERGGKPKPSPTPPQQGQKLSPFERGPASAASQALGK
FT                   SPPSARGGVFARLEGKPKLQGLGKSDLPAPKPDAAKELPHPKSTEKELPHPKRVVVVHK
FT                   PNEPNDHKELPHPKPAPKPRDPPAPPAKGARGDKEKPAKQRDALDDALDEELAKATKGK
FT                   KGGRTKGGSDRQGAPSEPHKELPHPKPAAPAPGSEKPHPVPAPRPVSAPDSESAKQLPH
FT                   PNKPPVPKGNNGRSPIPAPKPATNTNTGGSSVGGRPGSGKARNESASPPPPKERDELDD
FT                   VLDAELEKAMGGGGGGKRRPRGGRGSRGGGK"
FT   gene            complement(416466..417418)
FT                   /locus_tag="MICPUN_107887"
FT   mRNA            complement(416466..417418)
FT                   /locus_tag="MICPUN_107887"
FT                   /product="predicted protein"
FT   CDS_pept        complement(416531..417379)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107887"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E183"
FT                   /db_xref="UniProtKB/TrEMBL:C1E183"
FT                   /protein_id="ACO62125.1"
FT                   /translation="MAPRMMHPRVGTGEPDPEEDESEEEKKDGILIPLLTFFGFVFVFI
FT                   PITVMLMGAIFGLILAEVEGWKIKDGFYYIISMLCGLPTPLTEVDPDTDEGKLVDVIVA
FT                   LWALALAGTIIGVVGGLSVINRLVDAAESFGQRFKRAARKAVTGSDEEAPAAADEDGEE
FT                   KPVSLTLNVLTFLVFIFIVIPIVIILVAVLFGFILAEVEGWKIKDGFYYIISMLCGLPN
FT                   PLTDVTPDSDEGKIVDIIIALWALSLAGTIIGIVGGMSVINTLVESAEALGERFGKKKE
FT                   N"
FT   gene            complement(<417583..>418845)
FT                   /locus_tag="MICPUN_56780"
FT   mRNA            complement(<417583..>418845)
FT                   /locus_tag="MICPUN_56780"
FT                   /product="predicted protein"
FT   CDS_pept        complement(417583..418845)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56780"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E184"
FT                   /protein_id="ACO62126.1"
FT                   /translation="MAPVPPALFKARGTTLRADEYLRGVNPVGTVHRGPLSAFGRQEIS
FT                   ALRTEPSVAFSRTDRLEAIRPFSIEYFLPGEGNRAYAASHAREYLARHEAEGLDRFARP
FT                   AVSEPPEPRWKTFGRSGTHHDFAKTQARGGHLPLKPDWPNKNESRWGAAERLHRPLDGG
FT                   HDLVQYSSFARQRLSTHANSPKAYVDIGAATTRAERGRQTLGRAHDERSAALGACSPGP
FT                   QVPRDRDGFALGAVGRQIEAGRVTEPRAVVGSNSRVTAPTWAPAGVKGGDWTRPVRPDP
FT                   SVPGPGAYHETFDFRRTRGERGNGDGSGRRSTGRRTHRQLITGEAAIADERERRLASSF
FT                   NPKDAGAYWGSSGRGTLPSLSSSSSPAVPPLGSLGGGSPARTYPVSGKEIRARTRSGRW
FT                   TPRDEQRGRARRLLGRASPAP"
FT   gene            <419146..>419886
FT                   /locus_tag="MICPUN_56781"
FT   mRNA            <419146..>419886
FT                   /locus_tag="MICPUN_56781"
FT                   /product="predicted protein"
FT   CDS_pept        419146..419886
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56781"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E185"
FT                   /protein_id="ACO61694.1"
FT                   /translation="MALVVTPTLASIAPAGRPSLGRSRGGTGAMTLPRPSTSSPRQPAK
FT                   PVGRSGRSSRGSIQVAASPLPIADVAALFDNPFSKAAEEVDSSLPGWFPALSFIAYVLV
FT                   LREVRRIRQREERKAREKMAKAAQEAAQRKVESMGPEVWGKLIVCLVIDALGDSSFLLP
FT                   GLGEGTDIAYAPLEAFLLSQLFRSNVVSGVGFVEEALPFTDVIPTATLAWMTETFFSDT
FT                   WPGRALGLGGDKPVEKEKDEKKDK"
FT   gene            complement(<419946..>421005)
FT                   /locus_tag="MICPUN_56782"
FT   mRNA            complement(join(<419946..419955,420044..>421005))
FT                   /locus_tag="MICPUN_56782"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(419946..419955,420044..421005))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56782"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E186"
FT                   /db_xref="InterPro:IPR013158"
FT                   /db_xref="UniProtKB/TrEMBL:C1E186"
FT                   /protein_id="ACO62127.1"
FT                   /translation="MRTRPAFGRCDCAGSDRGWEVAGGYTSEASHVRRSPTPDGNSLLG
FT                   GVAQLCHAFFHCSPTPELSSHPDELCLRVACDPAGRKCETKGVVVVAALRDRAGDLRFL
FT                   SRYSNCPLSSHAEEYVVRDEELVRAVMEMAPEDDARSSTKTPGSAGTLTLYQRLQPCHG
FT                   SSDNRGPLWSCSDALVAGLHRELLGPRGVSLRVAVSYTYRAHWDVRGFESERERRWWGP
FT                   KVEAAREGIRVFAAAAKDGVTLEALNAEDWAFLVSLCDEDVARDYAAAFGEGGEGFGSK
FT                   GCGVFTAPAVAHRRAMDEFVAEQIRRHSASGPTNGRATNAAG"
FT   gene            <421185..>422681
FT                   /locus_tag="MICPUN_99363"
FT   mRNA            <421185..>422681
FT                   /locus_tag="MICPUN_99363"
FT                   /product="predicted protein"
FT   CDS_pept        421185..422681
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99363"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C1E187"
FT                   /protein_id="ACO61695.1"
FT                   /translation="MGLFHEGDVVSAIAAAKAKGAPLLVFILGDDPSSAEMVRALEDSN
FT                   DGGGATLRSEAGDEGWVALRLAEGGTDAANFRALCPAGNAPVAVAVDARTGAKIGEASG
FT                   ADGADVLASKLKDLREAHESDLRLQTMAALARLAGAQTPANPAPATQPPPANPAPATHE
FT                   PPAQPAPAPRADDPSRDETSRGDASFAAADADAIFAKAKAEAELNAARAEMAARIKADA
FT                   ALKRAAAIEERARMAAEAEKRREDEAKRAAEEKERKAVEARERLGVAARIQLPDGTSVT
FT                   ARLPAGATIGDVRDFLVADAPEVDWKNLEIWNAWPRRVVDESDPTATVAEDLGLGARPS
FT                   LLAIYRVGGGNGGGSVTHRAGPGGVTAGGGGTAGGGALDALLGILRKIWALVCSFLGMD
FT                   LFAARGGGAAPRGDPVSHRPTAVPRGDGADGSNPVRRSGAGGGGNGNVHTLGGLRDDDD
FT                   EGDDGRNRFWNGNSTQFGGGPADADAGDAPMDGFYTSRNE"
FT   gene            complement(<422784..>423821)
FT                   /locus_tag="MICPUN_56784"
FT   mRNA            complement(<422784..>423821)
FT                   /locus_tag="MICPUN_56784"
FT                   /product="predicted protein"
FT   CDS_pept        complement(422784..423821)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56784"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491 - oxidoreductase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E188"
FT                   /protein_id="ACO62128.1"
FT                   /translation="MSLLARTSRAAFSFLGSSQGTRALRLASTAAPPRGHHLHTAPRHL
FT                   PASHLARPSTAPSFATRAMSSGNDQATTHVPPAPGVSKLYAAEPVAGRCALITGASSGI
FT                   GQATAERLAELGCRLVVAARRKDRLDALATRLANDFGAKVHCVALDVTDVDAVMSLPSA
FT                   LPAEFADVSILVNNAGGALGTAKCTENNMDDVATMLDANVKGVVACTRAFSPGMVERGC
FT                   GHVVNISSIAGVEWYGGGSVYCATKAAINAFTYASRKDLHDTPCKITSVSPGFVNTEFA
FT                   TVRFKGDKGKADNVYAGMKYGGPLLAEDIADNIVYALTRPGRVQVCDMLVYPTCQASAR
FT                   DIARE"
FT   gene            <424141..428532
FT                   /locus_tag="MICPUN_56785"
FT   mRNA            <424141..428532
FT                   /locus_tag="MICPUN_56785"
FT                   /product="predicted protein"
FT   CDS_pept        424141..428529
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56785"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824 - catalytic activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E189"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR020807"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="InterPro:IPR042104"
FT                   /db_xref="UniProtKB/TrEMBL:C1E189"
FT                   /protein_id="ACO61696.1"
FT                   /translation="MVVATASGDGFAPHKGALDTAARAAETMWWWDPADRADRAKDGGG
FT                   APGKTKGVVASGARAGAWRTRDELVPAGSGVKTPTPARDRARWTPWDELVDCSEAPYFR
FT                   WFAGAKTNAAFNAVDRHVLDGRGDDCALTTLPEEEDPKAGVDGARLSVTRRELLGAVAA
FT                   AARDLRDRHGVKPRDRVLFHMPTDATHFAYMLACQRLGAAYSATAVDSVEGVLASRTAD
FT                   LAPKLVIAYAEPVVHGGQPVDCAAKLRSALDALNREGSEGSEPTGRGNEQSKGNKRTKK
FT                   ASSNDVDPKSKVPKTNVPAPALVLLPRWGAKKNVASAGAAQFRSLRDEDAFKSAQKICA
FT                   CEPCDSDHPLFVSYTSGSTGKPKGVVHGHGGYVSGVLQSMTTVFECAPGEGGDGVKGGI
FT                   LTVGSAGWITGQSYMLMGPLLAGVRSVVMVGSPVYPTPLRMIRAVESEGCTLLKTGSAV
FT                   VRQLMTDPSNAAKVDAIDTSTLRCATFCAEPVSVEVHKYSHDHITDKFINSYWATEHGA
FT                   MVFSRDVAAPNGLTARGVIKSDARTWPLPWVSAALDSESSDVVIAGPYPSLALTVFGDV
FT                   QNVYDQNWRGDFAKYKETYWPKDGGGFVQGDVARASGEKGGGFTFHGRSDEVINVNGNR
FT                   VGTEQIERCLWNLEADGYGVKDCAVVGAPDFVKGTTPVAFVVFEPLARGGKKRKVGAGA
FT                   PDLAAFKSAAATAVGDKVGSYAAPDHIFAVNALPKTITNKTARKTLQMLLAGGEPPSGN
FT                   LARAEVLPPIAEAVAEWRLTAATTTSTIDLGKYWRRYTMDDHNIQGRAIVPGAGWLALI
FT                   AHEAGTSKLADVAFMRGVFEPDTTIRVVKRRRLMQATAGEETILKASLVSGDAAPETIG
FT                   PDVFGRGVALGSPSKKKPARGKENGVEENSVADNGVEQSDASRNKNAEAVGVKITDDSN
FT                   HEQHYRRCSALRLEYGGAYRAIERVAWSGHAFRAECFPRTHLAAVLDAGLQVVCASVRA
FT                   NTFIPVAVADFQITEGVDAFDESRRCVVHGEILEQYPEFLVADLRYEYEGVQGSSGVQG
FT                   SKSGGVQGSSGKKKKKASVVSSSSAAAATTGNGVFASMGRARFARVEGTKPRLQPTKAK
FT                   EANPTASPFGSQTLDPKTALARLRQLTTEQRVDAVRSVIGSIVSDLTDADVDFSKTVFD
FT                   NGMHSLNAVELLSRLNQTLGTGVTTKLVVNDAPMADFAVAVAEHATTFESTADDPNAKP
FT                   FPNVDYANLNEIVRRRLAGKTVGNTPYWFLFKYITYNFWKKSFQFFRIGGHKFLMNPPR
FT                   EIDLSLEVRMDRVVEFRDVDMNQHYTVEMIVARSVDGVEQLMAKSGLTHIEHYYRRNLF
FT                   AAKIQSTFHKELAHGDRYVIKTKITKVTGSLMDIRVAFLDPDDVLCFEILWTILIVLDS
FT                   NERLLLDWENVDLMDSGRRLIAGPGKGRAEAPTSASKGLKSSSKPSSVAGVESGRTIHT
FT                   K"
FT   gene            complement(428561..>430266)
FT                   /locus_tag="MICPUN_105259"
FT   mRNA            complement(join(428561..429982,430109..>430266))
FT                   /locus_tag="MICPUN_105259"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(428644..429982,430109..430266))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105259"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5737 - cytoplasm; GO_function:
FT                   GO:5515; zinc ion binding - protein binding [Evidence
FT                   16620; NAD binding ] [PMID 8270]; GO_process: GO:6520;
FT                   amino acid biosynthetic process - amino acid metabolic
FT                   process [PMID 8652]"
FT                   /db_xref="GOA:C1E190"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E190"
FT                   /protein_id="ACO62129.1"
FT                   /translation="MHSSSSGELETQRPVCRICWENTCEVNGSEEFLSPTPCSCRDERS
FT                   NVHQACLERWILEARSQGRFDAGTICHACGDHYSHPALSLTVLSDEAVRDAKISTASGG
FT                   GEGVDHREPLAIIGGTGYVGRSLALHLLGHPTFRLGAIVGSSATVGKPFSAVFEKKEEA
FT                   LAEHYGADLWKPMDFPTELMSARVCGVEDVIERGECRTALSFIAPEHGEIEDRLAAAGI
FT                   KVFSISPHARFDPSNPLSVPEANPEVLKDAVDKAAGEGFEGDCHSLVKSPNCVTCGVVV
FT                   ALKALDAAFGVEDVSVTTFQSLSGRGDAKYPRDVVMGNVYPLHGTVERTGEYQHGELKR
FT                   IMPDVKRVSVAAYRVPVQRGHLVDVRVRFRCETKPTARAVERALSSFDPLRDVPLPSKP
FT                   RRVIYVKPLDEEETGPRIGTPRPKDDHEYEGGMSVCVGNVVCEDELYDVRFCLVVNNVV
FT                   RGAWGAALLNAEYWHWLKGRKTAAPGEEPAAPSAAARIEC"
FT   gene            <430660..>432005
FT                   /locus_tag="MICPUN_56787"
FT   mRNA            join(<430660..430722,430821..>432005)
FT                   /locus_tag="MICPUN_56787"
FT                   /product="YABBY like transcription factor"
FT   CDS_pept        join(430660..430722,430821..432005)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56787"
FT                   /product="YABBY like transcription factor"
FT                   /db_xref="GOA:C1E191"
FT                   /db_xref="InterPro:IPR006780"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:C1E191"
FT                   /protein_id="ACO61697.1"
FT                   /translation="MTQLELDIVGDSAAKARLEVSGYFGDPSEQSVAFRCFLKDMKFTY
FT                   DGKRRVWDGECTVLRARRLLAGAKQEGFYFLTANWDMASAKLHSLFGERLHEVFEEEAD
FT                   DQWPSYDHSCDHVLSCDDDPAAANAIAGGDSDNWTSRYRRVYFVPIVRNKMATDVAGRR
FT                   SEKTYVSLEAIGRGAFNVKDGLKACKFRWDGEVWHYDRDTDARARKSFRQTARDVRAQF
FT                   ALHHRDGIPVRLTPASDEADEMYERMRKTPVEEAEVKEEVIEFGVKEEEVEETPVGTSL
FT                   KKKKEKRDPRAPTKFNEFMRTKVAQVKSDNPTMSPKDIFAMCAAMWASAPENPKNRNMA
FT                   PPPNRKRAAPAASHAGTMMSEARSRPRVRREPDAEATSVKREQSPEPSEATAQFAAGAP
FT                   NTPGLATRTRRRSSIA"
FT   gene            complement(<432175..>434082)
FT                   /locus_tag="MICPUN_56788"
FT   mRNA            complement(<432175..>434082)
FT                   /locus_tag="MICPUN_56788"
FT                   /product="predicted protein"
FT   CDS_pept        complement(432175..434082)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56788"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003609"
FT                   /db_xref="InterPro:IPR009722"
FT                   /db_xref="UniProtKB/TrEMBL:C1E192"
FT                   /protein_id="ACO62130.1"
FT                   /translation="MMTRIALFLVTLLPLAAASDVGNEGWTVPPFKCFGTTAVNKYEMT
FT                   SVPSDLSGITWNPSTKTLFAVNNGDRMIYEIEYPNKLIQKWDVKALTLDLEGISALGGR
FT                   KFAITDENPVKITEVTLNTDGTYSGATTLVQGITPKAASNLGFEGVTKIGTTYYAVQEV
FT                   SPAKLWKLESGATAYTDLSGDLEKHATYQLKSIGGLTRGGDATDELFLMAKTYTGTGRD
FT                   GSSKYYQKGIIRYKISDGTILERFGGEMCNMGQPEGLTFWKDDTSGKIRMLMVGETHEA
FT                   RLYEADPSCTDAIGSITNNMATCVEKKVSTATCEKTKADGGCPWTRCDKDITDHNKICT
FT                   DDTPGVTDCTETQCFNRCNNTLVKGNKCTHWAYDVAEKECYIFAGCKNDKFDADYTTYA
FT                   MEDPTCEKTRAKAPLGCEKRRCDKDISKHNKICTDDTPGTTDCTLDQCEDKCKKHTDFT
FT                   CTTYAYDVKEKECYLFETCEGEKFDEDYSTYVLRDPTCEEPRNSTGGGGCTQRRCDKDV
FT                   TPHTKICVDDCPEAQCTIDQCEIYCAQTTFTKEHAEAYCTHWAYDEVDKECYLFYGCKG
FT                   EQYDDDYTLFTQSYGERTKLQGKHGKTIAKTPTCPAKSGAASNVAGAFTFLAAAALVAV
FT                   "
FT   gene            <434836..>435906
FT                   /locus_tag="MICPUN_71524"
FT   mRNA            join(<434836..434949,435175..>435906)
FT                   /locus_tag="MICPUN_71524"
FT                   /product="predicted protein"
FT   CDS_pept        join(<434836..434949,435175..>435906)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71524"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8759 - UDP-3-O-[3-hydroxymyristoyl]
FT                   N-acetylglucosamine deacetylase activity; GO_process:
FT                   GO:9245 - lipid A biosynthetic process"
FT                   /db_xref="GOA:C1E193"
FT                   /db_xref="InterPro:IPR004463"
FT                   /db_xref="InterPro:IPR011334"
FT                   /db_xref="InterPro:IPR015870"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="UniProtKB/TrEMBL:C1E193"
FT                   /protein_id="ACO61698.1"
FT                   /translation="QQTVRRSFTLIGVGLHSGEWETVRVCPARAGEGRYFVRVRIPAAA
FT                   ALAQDNLRLSMRLAVDDDNGVITCEHLLSALEAIGVDNARIELEGSGEVPIVDGSAYQF
FT                   AYECARVGLVPAHADGSTAEVPRMAWRPSEMITVRDGDAFVQFIPDAVTKLTYGVDFTY
FT                   KSTAIGKQWESWTPTEDGDYVDLIARARTFGTMQDYMAYFRAGYIRGGLEQCALIANGD
FT                   KFWNPPMILPNENARHKILDLVGDLSLMAEPGMAGVPIGHVLAYKGSHRLHAKFLAALA
FT                   A"
FT   gene            complement(<436333..>436485)
FT                   /locus_tag="MICPUN_56790"
FT   mRNA            complement(<436333..>436485)
FT                   /locus_tag="MICPUN_56790"
FT                   /product="predicted protein"
FT   CDS_pept        complement(436333..436485)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56790"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E194"
FT                   /protein_id="ACO62131.1"
FT                   /translation="MPCPMCASALVANILGASAVGTAGGVAALKMKDKARKVKSSKPKP
FT                   KPKAK"
FT   gene            <437213..>439098
FT                   /locus_tag="MICPUN_99369"
FT   mRNA            join(<437213..437412,437529..437638,437773..437831,
FT                   437995..>439098)
FT                   /locus_tag="MICPUN_99369"
FT                   /product="predicted protein"
FT   CDS_pept        join(437213..437412,437529..437638,437773..437831,
FT                   437995..439098)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99369"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C1E195"
FT                   /protein_id="ACO61699.1"
FT                   /translation="MLLEKLPAHVLRDVFGFLSAGDVARAACACKTFKQVARSESLWRK
FT                   LLSEKLGSQASIVLPKTLPNERYPHGDMVVEPAWKEMFQFWMNPGPNSYSWMEHAKGEE
FT                   LENRGKFAARYLHRCTAIGDGNKILLFGGQGSGADFFNDLHLLDLRKKSLQLEQLDAAG
FT                   DPPFPRCSGTLTAVSVTGIPGSEVVALFGGSQGFFEGFSNSLCILQGDENVSISDAASQ
FT                   HKGLTWREPLVVAADPEDGVPDARWGHSAVSWNGKLVLFGGSNTQHCFNDTWVLDVGLN
FT                   PREPESRRLLATWKKLKLGNDARPPSRAGQTVSLVGDALYVFGGCHISDVFNDLWRLDL
FT                   GVRVPTWERLDVAGTPPAPRVGHAAVVLGDRIVFSGGRGSPTAGASGTYATADQGLATM
FT                   QGLTFFEGGFAMLDISRGTWMPIQHPNRNNHVYLRGEDDGAVDMEDAAMEDEVWEHRTG
FT                   HVMVPAKDGLLVIGGLAYNGEFQNDVQHIRVF"
FT   gene            complement(<439299..>440663)
FT                   /locus_tag="MICPUN_80065"
FT   mRNA            complement(join(<439299..439901,439986..440123,
FT                   440268..>440663))
FT                   /locus_tag="MICPUN_80065"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(439299..439901,439986..440123,
FT                   440268..440663))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80065"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E196"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:C1E196"
FT                   /protein_id="ACO62132.1"
FT                   /translation="MQECLTHPEFGYYMHRDVFGEAGDFVTSPEVSQAFGELMGAWAAW
FT                   TWESMGKPSTVRIVELGPGRGTLMADLLRGTKNLKGFADAVTVHMVDVSPANRKAQREA
FT                   LKCGPKTDDAENGDDNTGKNPTRHGLGKWHETMDAVPPGPTIVIAHEFFDAMPVHQFTR
FT                   TERGWCERLVAISGDMVLSPGLTPAGALMVPRRLEGVEASRRDGLRQLEISPRSLAIWE
FT                   RIAARLEEHGGAAIAIDYGEEGPLGDTLQAIRDHEFVDVLTDPGRADLSAYVDFGAMRR
FT                   VIETRKNSGVECHGPVTQRDLLFGLGIGQWLEKMVEKCATEKEVDKLIAGCERLVSGEQ
FT                   GALGEGGRTEGAGKGAGMGFRYKALAMVSKGLGKPAGF"
FT   gene            <442341..>445088
FT                   /locus_tag="MICPUN_79939"
FT   mRNA            join(<442341..442805,442950..443651,443853..>445088)
FT                   /locus_tag="MICPUN_79939"
FT                   /product="predicted protein"
FT   CDS_pept        join(442341..442805,442950..443651,443853..445088)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79939"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR033443"
FT                   /db_xref="UniProtKB/TrEMBL:C1E197"
FT                   /protein_id="ACO61700.1"
FT                   /translation="MSTARPHLQLYETLVDCGRLHNALELLRALKTAGLNTVGGRVSNK
FT                   AFLRQCARRSAVAVAFDFVSFVDYPDVRLYNMLLSVCASAADSRSAFAAFVMMYDNGVQ
FT                   PDVMAYTTLISACAKAGELEKAFETFRRMEMDGLEGNVVTYGALMDALSRRVAATLRRC
FT                   FDLREEMDDAGVAPDGTMINTILSACGRAAEVRALSADALQKAFDLYDEMESSDEADLA
FT                   PDAYTYSALIKACVNAGQSMRGLSLYDRAMDPSAGIEPSIMVFQEAMIACSHLADLGKA
FT                   WAIWEDMRVERVAPDAMLYATLIAVAGRAGKREEAERVVFEMERAGVAPTPEVFASLAG
FT                   IAARAGDGAGVESAIAEVASRGLAVPLEMYNALVTAAARRGDVDAAQEAMFEAEAEMRA
FT                   AGLEPDEQTWCELLSSCARHGDASLTWDTYKRSRKAGQPPSEVALNILIGVTLLKIRAL
FT                   TDPDDRRNIKRMSQWDQDDDSAGRKKEEPEWTEWADRAIAAYHEATVAGVRPRLATFSA
FT                   MLACLRPPTLPSLRAVDRETRPGSKAESLARAVSHEDSSHEDARKYYPLRALIMYEEAQ
FT                   AIGVVPKFATETDSVYDIRKFPPAAAEVAVLTMLRVFRRRSDAHAGAGDDELPNVTLRV
FT                   LSDEEHEEMIASGDDEGRRLAQTGDRVIVLLRRLRFNYGGSLSAGRIELSGHVIKRWLQ
FT                   AKPPKDERAPGVEAGLRQNLQDQARNIRMQSFDDSDGSGYGGGATDWGAIFGRRGGGAG
FT                   GRLGVGRRPLLPRRRLVKGEKRTEDREERGVAREITSVPLARASHLL"
FT   gene            complement(<445152..>446276)
FT                   /locus_tag="MICPUN_56794"
FT   mRNA            complement(<445152..>446276)
FT                   /locus_tag="MICPUN_56794"
FT                   /product="predicted protein"
FT   CDS_pept        complement(445152..446276)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56794"
FT                   /product="predicted protein"
FT                   /note="Encodes a protein with single ERF domain;
FT                   GO_component: GO:5634 - nucleus; GO_function: GO:3700 -
FT                   transcription factor activity; GO_process: GO:6355 -
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="GOA:C1E198"
FT                   /db_xref="InterPro:IPR001471"
FT                   /db_xref="InterPro:IPR016177"
FT                   /db_xref="InterPro:IPR036955"
FT                   /db_xref="UniProtKB/TrEMBL:C1E198"
FT                   /protein_id="ACO62133.1"
FT                   /translation="MGGTDGSPGSTTGRHHRDEEERSWLEMLAADDDVEGPSLLRAPDV
FT                   LTRNGASPDAPVLDDDGLLLRPLGSLGDDDDDFACGGDVCDLVHRAPVHGGIARGVISA
FT                   LRRSATDVGGELGRRRADVRAAASPRGVAPRGEARRRPPDRGGGGHTRGQHSPLAGGPG
FT                   DASLVERLRDSLCPDRAEDLSERRGARGGLRRARTLPTNLHAHDDDLPLDPRAAQADVV
FT                   AARAVEAAAQAASPRPFGYLGVTRPPWTTRWEANLVDEHTGGHVFLGNFDQKESAARAH
FT                   DAAKLKLALGDDEPVPQDQLNFDASDYREELSAMTECTFEDFVKTLVTHSYGGSRSAGH
FT                   SKFRGVFAREDGLWEAKLDAEDAGGAREDRRWKK"
FT   gene            complement(<447183..>448301)
FT                   /locus_tag="MICPUN_79518"
FT   mRNA            complement(join(<447183..447359,447390..>448301))
FT                   /locus_tag="MICPUN_79518"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<447183..447359,447390..448301))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79518"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4674; ATP binding - protein
FT                   serine/threonine kinase activity [PMID 5524]"
FT                   /db_xref="GOA:C1E199"
FT                   /db_xref="InterPro:IPR000687"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015285"
FT                   /db_xref="InterPro:IPR030484"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1E199"
FT                   /protein_id="ACO62134.1"
FT                   /translation="MKFDVEVFRYIEKDAWRVLVSVEMGMKNHELVPVELINAISGLKH
FT                   GGAFKFIRDLLKHKLVHHDNSKYDAYRLTPLGYDYLAIKAFVNRGAIEGVGRRIGVGKE
FT                   SDVYEVVTEDGETLALKLHRLGRTSFRAVKSKRDYIKKTTTHTNWLYLSRLAALKEHAF
FT                   MKALGDNGFPVPVAVDVNRHAVLMSIVDGYPLTQVGPSRLETGAVGRVYKQCVDQLENL
FT                   ARHGLVHCDFNEFNIMVNPETTNITVIDFPQMVSTKHPNAEELFVRDLKCLHKFFLRRF
FT                   DYRASEDPDGRRDPVFFEIAGGGKSLDVSLRASGFTQKQSKELEEYQAAKEAEENGGGG
FT                   GGDDDDEDDDDEDDDSELDDDDD"
FT   gene            448597..449329
FT                   /locus_tag="MICPUN_107889"
FT   mRNA            448597..449329
FT                   /locus_tag="MICPUN_107889"
FT                   /product="predicted protein"
FT   CDS_pept        448719..449285
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107889"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A0"
FT                   /protein_id="ACO61701.1"
FT                   /translation="MLRDDAERQLQERREASQSTSSSSPRSERSFFRPMARNDGTLAPV
FT                   KPAEVDVQKMVGEKDQTLVKRMDQLAGGISMSRLEISGHVRAREIAQKRRTAQEGRLRI
FT                   KTANARDILREAAVDPTRFDPASSARTHGTDEATVVELMRWYEDADVENLPNESEGAPP
FT                   GSMLKVKRTREERAADDEHAKRGAS"
FT   gene            complement(<449400..>451874)
FT                   /locus_tag="MICPUN_56797"
FT   mRNA            complement(<449400..>451874)
FT                   /locus_tag="MICPUN_56797"
FT                   /product="voltage-gated ion channel superfamily"
FT   CDS_pept        complement(449400..451874)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56797"
FT                   /product="voltage-gated ion channel superfamily"
FT                   /note="potassium/sodium hyperpolarization-activated cyclic
FT                   nucleotide-gated potassium ion channel; GO_component:
FT                   GO:16020 - membrane; GO_function: GO:5216 - ion channel
FT                   activity; GO_process: GO:6811 - ion transport"
FT                   /db_xref="GOA:C1E1A1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR027359"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A1"
FT                   /protein_id="ACO62135.1"
FT                   /translation="MSWVFAGVRKSVASKYSEDDDTPPRSRKPGPSSEELREKYGKASR
FT                   EEMEGGRHESDTDSGEDVERKREAPQTPKSPSKMFTNLSYNKLTKGIVNYKFRRNKQRM
FT                   PRKAGVYYHPDGSEYDNRMRWYSINPYGNFRKNWDLAQAIILVFVSITVPFRVGLKQPA
FT                   EGPSYWVELLIDLYFWFDIAFNFCTGYEAEEEEGVIVYHPKLIRAHYFKTWFTIDLLAC
FT                   LPVDLALRATEGTLKCSMEVDGCDAREEDGTGQLFKLFKLLRLFRLVKLLRLFKIMRLF
FT                   ERYQDDLFKYMHIISVAKLVVFMLYLGHLFGCFFHYFSVSEWRTAEENAQVADGTLEPW
FT                   LKSYFGDDHPTGREVWDRYIASIYWAFTTMTTVGYGDISATTRVERVIACFGMIVGGFV
FT                   FSGVIATMADVMANANPSKKAHSEKMDKVSAFVRDNNLPREFLKDVLGFFRKQSTHPYD
FT                   QQQILMELPYNLRRKLLMHQYGHIIYKVPLFDVDGDGSLDDHVFVTELCMRMTLVSFMN
FT                   EQMIYQMGEIGRHMFIISSGKVEVLDNARKDVMCVLEAGAYFGEGCVLGDVRRRENLRA
FT                   LGGNVQLCTLLREDVDVLLDSYPHMQRLLHDSYYKRKELFKRFEQARTTQPKLTMNEFI
FT                   SSQRGLMSPLSKKRILGEDAPAPAEDTGGDEDTVGDLPPSKPPPGRSLQRLESWNVKKG
FT                   QEAKSEFLSETELEAQASIQAKMDPTLSFVLSEEGEREKADHMETFRSSKAGGGGWAAA
FT                   EGKALARRVREVEETQRRMEGKVDQLVALLTERMAAEGTPMRGEQSRAEVTPERRGAGA
FT                   SAAPVDDMTPRL"
FT   gene            <452045..>452964
FT                   /locus_tag="MICPUN_56798"
FT   mRNA            <452045..>452964
FT                   /locus_tag="MICPUN_56798"
FT                   /product="predicted protein"
FT   CDS_pept        452045..>452964
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56798"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A2"
FT                   /protein_id="ACO61702.1"
FT                   /translation="MWRRLLRGAEVWEDRQRTVLVTEASPGRWIRPVHEEDDLANPCVD
FT                   PCVECELLEDRCVGWVHVRDLQLSAPEPETHALRASRRYRGHRGLLHVPSVVAFVEAHV
FT                   ARTREDRARYKRGGTTGPSLFDASGFVQAAFANASSPRPVFIPRRVHEQHHFAEPVDDL
FT                   NEATPGDLVFFGVQPPNAFKGCVDVRHVGIITAVRCISGSSASCVELAFASVTDPIAGR
FT                   GIVARDSVIVPSRSSTPGARGGNWSTTWEFGRARPGPEHEGDAASERLAQTVLSVGRCR
FT                   RGVEGADDLPRGRTASSARCGGSSR"
FT   gene            complement(<453141..>454427)
FT                   /locus_tag="MICPUN_79467"
FT   mRNA            complement(<453141..>454427)
FT                   /locus_tag="MICPUN_79467"
FT                   /product="predicted protein"
FT   CDS_pept        complement(453141..454427)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79467"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3747 - translation release factor
FT                   activity; GO_process: GO:6415 - translational termination"
FT                   /db_xref="GOA:C1E1A3"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004374"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A3"
FT                   /protein_id="ACO62136.1"
FT                   /translation="MNRGWTAERAPPFTSRAPTLLARASADWDGETLGVLRRRANALET
FT                   RVKDALDVVDVERLAATVADLDAAASEGTLWDDPIKAKAVMAELADAKEQLATARGFEN
FT                   LLGDAAVALEMIDAEREDDSLSGAAANDASAGPDPTILAELSDACDNLERQLDKWEVRR
FT                   LLGGKYDAMPALVNVYAGAGGTDAQDWAEMLERMYRGWCNSRGFTWRTVERSEGEEAGL
FT                   KSVTFEVQGRFAYGYLRSERGTHRLVRQSPFKKDATRQTSFAAVEVTPVLDEGSVEELT
FT                   LRDSDLEISTMRSGGAGGQNVNKVETAVRIKHVPTGITVRCEEERSQAANKAKGLARLK
FT                   AKLVAVAEEQRAADVAAIRGDAVRAEWGQQIRNYVFHPYKMVKDVRTGKETSDVDGVMS
FT                   GDLDEFMDEFLRWKRKTEAEEEAALAANT"
FT   gene            <454797..>457436
FT                   /locus_tag="MICPUN_99376"
FT   mRNA            <454797..>457436
FT                   /locus_tag="MICPUN_99376"
FT                   /product="predicted protein"
FT   CDS_pept        454797..457436
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99376"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A4"
FT                   /protein_id="ACO61703.1"
FT                   /translation="MDGAYESARARLKAQSKREPGADPGATRFGATRSRSLLSGGTKPK
FT                   ASSDGRERATTVEVVQGADDNIVDAQGRMTRALLHDATGCRDLSSATVADLHNADLTAL
FT                   ASGDLDACPNLVSLDLSFNQLVDIDGDALAPLTNLRALIVYNNRVASVKAVARVGQSLQ
FT                   TLQCQNNAITSLDGVEHLRRLAVLNASGNPLGDCKLIGRCTTLTRLDISRCGLEKLEGF
FT                   ATLHALEELNVSGNALTEISAVAKCAKLQELDVSHNALPPSALRDLKALKRLDVLNLEG
FT                   NALDHLNSMPRMEELTELNCAKNPLRTLPDDFPAKCPELQILDLGECQLAGDVASVVKA
FT                   LCGLDTLTELRLKFNPCAGGGSGGGHRPGRTHRRSSAAATAGRSTAPAASRPPARSAPT
FT                   AAGRRIRTAGPGTTGATMSARPPAPPPRAPARPPPPPQPDVSGDVWTPAADPWRGLDRA
FT                   AAAAATLGYRREVIRALPRCLYLDDVAVGDAERGGEEGGAGPRTRPDVPDVTDVTAGDD
FT                   GDERDENDVDALLKRRPQSARRPKAADMSAKAATADGHYEDVAVKFIKEMEDYKTKMSG
FT                   LIGKIRDGLKETRQEAVAALRSDGTLEAESDAVPSGRLPSAPIVGSVPTKKVGVLNKVD
FT                   EDKVGREAEAADSALRRGAEPPAAAVVQASPSPGKRPASARAKLVEAQDATRAVLEQFD
FT                   RLFSDKLFLDDVDGVGSPEGDEGITRTPEDRRRWIVRPPSARGGRPRSARGAGGIAEKV
FT                   AAAVAAVDAQLAAEVRDQKRAASEEEGTRATALAGTSKARPRSGGGNGGAGLGDDKDGR
FT                   RLRPPSLAGGSTGTLGKVLERTRTSSAAVAASRRPPSSGRLSTSGAAGGRGVPRATFRK
FT                   PPASGERR"
FT   gene            complement(457435..>459027)
FT                   /locus_tag="MICPUN_93665"
FT   mRNA            complement(join(457435..458161,458436..458529,
FT                   458803..>459027))
FT                   /locus_tag="MICPUN_93665"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(457689..458161,458436..458529,
FT                   458803..459027))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93665"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:43626 - PCNA complex; GO_function:
FT                   GO:3677; DNA polymerase processivity factor activity - DNA
FT                   binding [PMID 30337]; GO_process: GO:6275 - regulation of
FT                   DNA replication"
FT                   /db_xref="GOA:C1E1A5"
FT                   /db_xref="InterPro:IPR000730"
FT                   /db_xref="InterPro:IPR022648"
FT                   /db_xref="InterPro:IPR022649"
FT                   /db_xref="InterPro:IPR022659"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A5"
FT                   /protein_id="ACO62137.1"
FT                   /translation="MFEARLVQGSLLKKVLESIKDLVTDANFDCSNNGFALQAMDSSHV
FT                   SLVALLLRSDGFEHYRCDRNMTMGMNLSNMSKMLKCAGNEDIITMKADDTGDVVTFMFE
FT                   SPDQDKISDFELKLMDIDSEHLGIPDTEYAATVKMPSSEFMRICRDLSSIGDTVTISVS
FT                   KDGVKFSTTGDIGQANITCRQNTSVDKEEQTIIELQEPVTLTFALRYLNSFTKATPLAP
FT                   TVQLQMSKELPVVVQYLIADMGYVRYYLAPKIEDDETAEAA"
FT   gene            <459532..>459873
FT                   /locus_tag="MICPUN_80228"
FT   mRNA            <459532..>459873
FT                   /locus_tag="MICPUN_80228"
FT                   /product="predicted protein"
FT   CDS_pept        459532..459873
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80228"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E1A6"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR008111"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR033744"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A6"
FT                   /protein_id="ACO61704.1"
FT                   /translation="MDDDRGGRFESIPENDSGAPGPAKSVEGWIVLVTGVHEEAQEDDL
FT                   HEHFADYGEIRNMHLNLDRRTGFVKGYALIEYETKKEAQAAIDGANGSSMLDQTLEVSF
FT                   AFSKGPINK"
FT   gene            complement(459862..>461536)
FT                   /locus_tag="MICPUN_105261"
FT   mRNA            complement(join(459862..461014,461189..>461536))
FT                   /locus_tag="MICPUN_105261"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(459947..461014,461189..461536))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105261"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="GOA:C1E1A7"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR003137"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A7"
FT                   /protein_id="ACO62138.1"
FT                   /translation="MVEVGAPGAAAHAVAFCRACTCAFPVVLLVFLAAFTSLPGRYDSH
FT                   VVVRSYAGYLPVVKDEPAVFGPRVPADGVTARLEEASPKEACEALTNKYEGRWIALVQR
FT                   SFGTEKCDFVTKVRNAEMAGAVAVVVFDNVDGPLIPMAKKNEDNDVNVPSVFVSKESGE
FT                   ALETLLNDPKHGKTVVVTLESPDSPFDDWPNVATSACVTFGALCVLLSVVLVLKRREQA
FT                   HLAAMAAQRPPETRLLSAEEVAAVAKTAVFSSQERVLSFLRGATCGGAHASAGDGDGED
FT                   DKLVVDNGTGDTCAVCIEDYESGDELRALDCGHAFHKDCIDPWLITKRACCPVCKHVIA
FT                   PPPPPENVPDSRRRRRSRWSVLSNASVATVGGAESADESDLEAPLLPASSPARSLRRGV
FT                   MRWLTRRTAAGHPDASPAVSPDSDADDSDPGGVDDGGDESTGPGGGEEGPAGGDLEAGE
FT                   ARAGGADGTDGEQ"
FT   gene            461748..462336
FT                   /locus_tag="MICPUN_107890"
FT   mRNA            461748..462336
FT                   /locus_tag="MICPUN_107890"
FT                   /product="predicted protein"
FT   CDS_pept        461794..462027
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107890"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A8"
FT                   /protein_id="ACO61705.1"
FT                   /translation="MFSTRLFLVALLAVFGALTLAPAPCEGKITYIRPLWQPTSEWSPP
FT                   EEREEPAELHSAAMKLYSEYVEKSGIQPCTYC"
FT   gene            complement(<462361..>463203)
FT                   /locus_tag="MICPUN_70927"
FT   mRNA            complement(join(<462361..462445,462554..>463203))
FT                   /locus_tag="MICPUN_70927"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<462361..462445,462554..>463203))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70927"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1A9"
FT                   /protein_id="ACO62139.1"
FT                   /translation="KPAVVVLPGLGNCTEDYDEFASELELRGFSATVAAVGRPDWLRNA
FT                   AGLTQLAYWQGTLEPRPTVDWYLSRIADAVAAAKEKSGADRVALVAHSAGGWMSRVYMQ
FT                   DFGVDDIRCVVTLGSPLNAVPKDVPGVVDQTRGILTYVEANCAKPTELGVPVTCLAGKW
FT                   LLGVETLGGAGDAAGFLVGQGYKQVCGSAAAWGDGITPVATAHLDGADNVTLEGVFHTP
FT                   IGSSDERPWYGTPKVLDQWVDKL"
FT   gene            complement(<464529..>465057)
FT                   /locus_tag="MICPUN_79707"
FT   mRNA            complement(<464529..>465057)
FT                   /locus_tag="MICPUN_79707"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<464529..465057)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79707"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B0"
FT                   /protein_id="ACO62140.1"
FT                   /translation="MRTKLTVLPAAVARLSGLRTLILSDNSLTSLPAEIGELSQLRVLE
FT                   AERNQIASIPDEIANCKNLENIRVGYNKITDLSALADCDNLVTLVVDGNALDSLESLNL
FT                   REKQRLVTLSAKKNGIESVPADLGKCQLLAEIFLNDNKIGDLPMSMGELKEKKVRAIEL
FT                   DGNPLNDPKVKKM"
FT   gene            466126..467010
FT                   /locus_tag="MICPUN_90229"
FT   mRNA            join(466126..466238,466379..467010)
FT                   /locus_tag="MICPUN_90229"
FT                   /product="predicted protein"
FT   CDS_pept        join(466161..466238,466379..466948)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90229"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B1"
FT                   /protein_id="ACO61706.1"
FT                   /translation="MALCMSTSASVAKVARPAVRASAEEKPASVPRRVTNALAAAALSA
FT                   SIALAGPVSSANAEIRLPPLDPDPERCERAFVGNTIGQANAVSDRILDLRQCNYVDKDL
FT                   STKTLSGALMVDATFKGANMTEVVMSKAYAVNADFTGANFTNAVVDRVTFDGANLSNAN
FT                   FFNAVITGATFEGTNLAGAQFDEALIGKEDVKKLCENPTLVEETRFQVGCRN"
FT   gene            complement(<467081..>468481)
FT                   /locus_tag="MICPUN_56808"
FT   mRNA            complement(<467081..>468481)
FT                   /locus_tag="MICPUN_56808"
FT                   /product="predicted protein"
FT   CDS_pept        complement(467081..468481)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56808"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B2"
FT                   /protein_id="ACO62141.1"
FT                   /translation="MAAQIRAATATGIAHARRRRMPSRCARAFRAAASGSISGARSESD
FT                   ERTDAVRARLMRELARGRTGSVPRVMGPIVSEPRPDDGVVIDRLTLAPESRNEGLEHAV
FT                   PVAVVRPHGDWDDALPVVAFLHGTGGDTEGLMPQLMSIAARGYVAVGVDAPCHGRRLEP
FT                   GSAAHVADGDDDERSHHPSKSSAGAPAAEGLGHGSGNSRERTFERYGAALVAAWRRGNI
FT                   EGENGTGSGGNEGSRRGDARPFLFDGAWDALRALRFVTRGDEYGDLTDPSRVGIGGISL
FT                   GGMYAWLAGAADPGLVTGAVAPIVGVQHFAWGLLNDSWRARADSLPPALFAAAAEELVG
FT                   DPSAVDAGIVGAVYRRICPGLIDELDGPATLPLISPRPLLVVNGELDPRCPFPGLMNAV
FT                   TETRAAYASVGKTSLFRTLVQRRTPHRCTPEMVDVVNRWFDETLRPARPDVALPTRGHL
FT                   DPNTWIEL"
FT   gene            <468580..>469839
FT                   /locus_tag="MICPUN_56809"
FT   mRNA            <468580..>469839
FT                   /locus_tag="MICPUN_56809"
FT                   /product="predicted protein"
FT   CDS_pept        468580..469839
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56809"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1B3"
FT                   /db_xref="InterPro:IPR005097"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B3"
FT                   /protein_id="ACO61707.1"
FT                   /translation="MADRKYDIVLFGVTGFTGKLACEHLLSKGYPVRWAVCARTEAKAR
FT                   SVLASIASRLGVPDDVLPPILVADLQPSNSDPEHARLRGVVRDAAVVITAAGPFEKYGE
FT                   HLVRMCAEEGTHYADTTGESDFFRRCIDLHDATARATGATIVSHCGNDCVPWDLAVLAA
FT                   AELARDRFGPRTTLSAASTFTELPPGVGASGGTLATAIYQLGKKRGGSRTAFDPLLRLP
FT                   DGSKSKEATKVRSPKSDVYYEEFGAYAGPWIMQPVMGNCVRRSNALLGYNAGEEFAYSE
FT                   AQLRHPSFIRWIADSSYNALIGAAIYVPPLCALLPAPGEGPSREEMIAGYLKLHLRAEG
FT                   KAPDGKKFKVKGLMTFDEDTGYLCTGRMLAESGMELLEAAKAGGEKKAGVLTPATAMGT
FT                   SLLRRMERELPMKWEVEIAD"
FT   gene            complement(<470440..>471108)
FT                   /locus_tag="MICPUN_69262"
FT   mRNA            complement(<470440..>471108)
FT                   /locus_tag="MICPUN_69262"
FT                   /product="cytochrome oxidase biogenesis family"
FT   CDS_pept        complement(<470440..>471108)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_69262"
FT                   /product="cytochrome oxidase biogenesis family"
FT                   /note="60 KD inner membrane protein OxaA homolog; Oxa1;
FT                   GO_component: GO:16021 - integral to membrane; GO_process:
FT                   GO:51205 - protein insertion into membrane"
FT                   /db_xref="GOA:C1E1B4"
FT                   /db_xref="InterPro:IPR001708"
FT                   /db_xref="InterPro:IPR028055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B4"
FT                   /protein_id="ACO62142.1"
FT                   /translation="HLAHDMEWWAAIMATTAIMRVFVMPFMVMQQRVAARMHIAKPEIE
FT                   ALNARIKGMGGDQQVMAEAQKEIFAIWKKHNCNPAYMMLPIAVQAPLFISFYFAISEMA
FT                   KGVPSFASGGPDWPLGPISMHDLTAADPTYIMPVLSSATFLATVELGGAGNPETSGAAQ
FT                   QTMMTKWGLRALSVALIPMTAGFSKGVFVYWITTNMFSLGQTLAFKVPLIKKIVAIPEI
FT                   P"
FT   gene            complement(<471802..>474087)
FT                   /locus_tag="MICPUN_80021"
FT   mRNA            complement(<471802..>474087)
FT                   /locus_tag="MICPUN_80021"
FT                   /product="predicted protein"
FT   CDS_pept        complement(471802..474087)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80021"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:50660 - FAD binding; GO_process:
FT                   GO:8033 - tRNA processing"
FT                   /db_xref="GOA:C1E1B5"
FT                   /db_xref="InterPro:IPR002218"
FT                   /db_xref="InterPro:IPR004416"
FT                   /db_xref="InterPro:IPR020595"
FT                   /db_xref="InterPro:IPR026904"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B5"
FT                   /protein_id="ACO62143.1"
FT                   /translation="MSLANLARASSGPGASVRRPATVQRHAASLSGTAPAKASASKIWR
FT                   RRAPVLLGARAASRDDAGPTGTSPTSSVAGSNDATGAAAASDARIPTYHLHEEEHDFDV
FT                   IVVGAGHAGCEAALAASRRGARTLLLTLSLDRIAWQPCNPAVGGPAKSQLVHEVDALGG
FT                   EIGKMADKCYLQKRVLNASRGPAVWALRAQTDKWEYSREMRLRLERQPNLMIREGMATD
FT                   VLVGSNDEVAGVRTFFGMEFRAPAVVLTTGTFMSGQIWVGRKTLAAGRAGEAPSEGLTE
FT                   SLCDLGFETDRLKTGTPARVDSRSIDYSLLEAQPGDEDERWFSFDPRAHVAREQMACHL
FT                   TRTTAATHQLIRDNLHETPTYGGWVGAKGPRYCPSIEDKIVRFADKESHQIFLEPEGRS
FT                   CPEVYVQGFSTGLPERLQLALLRTLPGLEKVNMLRPAYAVEYDFLPAYQCDNTLETKKI
FT                   RGLFFSGQINGTTGYEEAAAQGLLAGANAAAVALDGAKLVLPREGSYLGTLIDDLCTKD
FT                   LREPYRMLTSRSEYRLVLRSDNADQRLTPIGRECGLIDDERWGMFTDKMHAVEDELERL
FT                   KNTRVKSDSEVVQAILNAGAGGAKKPSRQSFTLEELLRRPEVDTAMLDGFGLGGGLTRW
FT                   DAEAVEVKVKYEGFIKRQEGQVAKVAGKMNKKIPEGIDYGAITTLRMEAREKLAKMTPR
FT                   TVGQASRIGGVTPADISSLLVHLEVGNRQKGVGKDARRAAKADRKAAVEAAEKERSETQ
FT                   SQSVAPPR"
FT   gene            <474231..>475892
FT                   /locus_tag="MICPUN_56811"
FT   mRNA            <474231..>475892
FT                   /locus_tag="MICPUN_56811"
FT                   /product="Drug/Metabolite transporter superfamily"
FT   CDS_pept        474231..475892
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56811"
FT                   /product="Drug/Metabolite transporter superfamily"
FT                   /note="drug/metabolite; GO_component: GO:16020 - membrane"
FT                   /db_xref="GOA:C1E1B6"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B6"
FT                   /protein_id="ACO61708.1"
FT                   /translation="MNTTVGLPTASVSSWRCHDRSRVQPIPSTSPRCAPRAGCPDPTFR
FT                   NSRRRVEFNTHRGGRDVSAGAKPGKGGVGGPEGPRRPSRVGSLSNGDSKRMPNKDWMEE
FT                   LSKMFPAEMAETRKKVRKEVERSIKAAKFLVAAQVCFVLAIVLVKQCIDHFTPAGFTAV
FT                   RALVSLPFILALAKSDAKSWREFVGSWRELFSSGYLVFLGILVSLGQMLLVLGLERVSV
FT                   GNTVVLGQLVPVYSATIAVFQGVESPSVGKFTAIAAGVIGAAVMLDPSQMWLSLGNMLL
FT                   LGRAAVFAAYLALQAPVLRAYLPVTVAATCQIVGAVIAIAVGIPLALTGKGGAVGVMGG
FT                   MRGTPGVAWIMAIAVAALSAAGYTLTARAERRTTPVVTACYNTLQPVIALTIMIALGES
FT                   PGIRNLLGSALIMIGGFAAVALSTNDKKRWKQSYPPGDVGVDRNFKPEDAKLATGKTGG
FT                   FGADGANVDDDGSSGTVRIKRTRGGERGFDPDTPTGTVRMTKLPGSLGAGARRPVKVGS
FT                   VVWTVAWASVMSLCALAGGGYLTWFLVYLHWKYFLG"
FT   gene            complement(<475970..>477390)
FT                   /locus_tag="MICPUN_56812"
FT   mRNA            complement(join(<475970..475986,476028..>477390))
FT                   /locus_tag="MICPUN_56812"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(475970..475986,476028..477390))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56812"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B7"
FT                   /protein_id="ACO62144.1"
FT                   /translation="MPPSRRSKGIRGWSLVIFVLAANVAYQGTRYLWRPTTGATPVSGH
FT                   QREKLEIRHRDDRRGGALLHHGHGASHGHGFHDAGVHRNDDDVEVIEEVVYEDVVVEDE
FT                   GHHGSSRGGASSGGGEGGGDPEPSGIHVMATSNGSPYQNWQTRIMYRTFLDAAKGSDMK
FT                   HFTRLLHRRTDDELMAEVPTVRVDSLHAECDRWCEFPVADRPDAIKKWLATADSRRGEW
FT                   ILMIEMDYVWKKAVPMPEPGSPAVAFHFNYINPNYPRLPEVMRSLMPPEKRDEIKMEDI
FT                   PCTGPAPTMIRRDDLVPLMDEYERIAAAIEADPVAKNRLGWVREMYAYDLAAAIAGVIH
FT                   VVQDPGETIMIAQPPADAKMGRASMYHYTWGAEYFKNGAKVWSWDKRPYVETKHVRQPA
FT                   KFKPELPPADGSEGVYNLQDGKKVSKGTDELLRDMLTLIRGAIDRLDELPHQPGCARKA
FT                   L"
FT   gene            complement(485158..>489355)
FT                   /locus_tag="MICPUN_56814"
FT   mRNA            complement(join(485158..489198,489271..>489355))
FT                   /locus_tag="MICPUN_56814"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(485735..489198,489271..489355))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56814"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B8"
FT                   /protein_id="ACO62145.1"
FT                   /translation="MKGPPLPHVRDWLGAQSLYLFGVWATIVGIQSGSSQSVIRTLNVR
FT                   DSSAIGTPTATTVGSEGARMLVRAGRRVSRESGGVIRPWLAPWFSASDSVRSGGGARVD
FT                   AAGAAGSIRPGAGDGFLGGPTTGTIAGPILATISPRSFWRSALEALERAIEPSATPTPG
FT                   TPVTVSDDAQRDDSHDATDAVSADASDDFLAHLPNRKSRYESDARWPRPLSAHPKVEEL
FT                   LKRKGLFAKRTGSGAISSWWPKRIIKALRRCGEDRSQADRWNRDDVLWLLRNAKGHPRL
FT                   SSREETEKCWKDKSTVHEYIAMLSLFAGRGSPLALAKSMGSDEVMEAVRQVPLGWTGLA
FT                   FRDRSGHGPERVPFGPKELSTERWRKYEKDGTREMEEPTHRPVLTERLSYASRFRKNRK
FT                   VDINEATGDNLRAYRFRWWDATHLVAITRLWGTISRKHDFIPAPQAAVLGSYTHLALAA
FT                   DAAVALSRHIEIDDGIDDDGTRFVSDEKTNPPQTVFIRKLSEPFDQYTNRGTQDGVVKL
FT                   IQYGVRGWLDMATLWGPEEPWPNGFGVDHTRSGAPGADAASRQTFHAMVPPVELAAMTN
FT                   AFIHFAGLDPKLDKDQLSTWARLNSLWSRCTRASGTNWYYANLWYPGGQGKQHYPGTHL
FT                   TRNVGIDKRKGPVDVWDACAVTAHPSGKQVTVRKSRTLEALLGVTRETATAWQATDILC
FT                   GAADAYCFAYFGGYTYPAPMSALASHVLGVADHLGTLADAGALKPPDALRSLVSIAQFQ
FT                   QAMAMAGGETSGAAGTWLKIMDVVVEAAAADGLSPTELSRALLCWGKYLEARGVEKVDG
FT                   TVPLDPIADDEGDLRRLNALVDAFARSVTEATPEDLHGVAVALDRFIDRYSDNPHALAF
FT                   TDGGDSIRAIAREAAARIVPTMAREATRRKSAHELVKTIHRGFGRRLGELPQFRQRPLP
FT                   IEFKHAMNHARDQLALHAAATADACALQAYALRFLGEDASGTPPPAPEEFLARSSAVAA
FT                   AARDGLLPTIVLARAMRAWARVRAATAGGLIADEADVAAVHEALEASSSEGGLHEETVR
FT                   MLEEAEALFRQTIAIETNAGGGTGDDVEDEDPEVEVEVDEEQDEEQDEDHDANPDLSDD
FT                   AAIEFEAVKDDWLARLPKTKAAKLLEAIDACADDLEVMEAVAASAEEDATKVRAGARAR
FT                   VLEATAKLRVARSLFR"
FT   gene            489428..490965
FT                   /locus_tag="MICPUN_107893"
FT   mRNA            join(489428..489505,489994..490965)
FT                   /locus_tag="MICPUN_107893"
FT                   /product="predicted protein"
FT   CDS_pept        join(489452..489505,489994..490830)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107893"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1B9"
FT                   /db_xref="InterPro:IPR001852"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR033755"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1B9"
FT                   /protein_id="ACO61709.1"
FT                   /translation="MATEAQKGTFAVKVGLAQMLKGGVIMDVVNVEQARIAEEAGAVAV
FT                   MALERVPADIRKDGGVARMSDPTMIKAIKEAVTIPVMAKARIGHFVEAQVLESIGIDYI
FT                   DESEVLTPADEINHINKHNFKVPVLCGCRDLGEALRRIAEGSSMIRTKGEAGTGNVVEA
FT                   VRHCRAVMGDIRRLQSMDDDEIFVYAKEIRAPLELVKQTKTLGRLPVVNFAAGGVATPA
FT                   DAALMMQLGMDGVFVGSGIFKSGDPAKRARAIVQAVTHYNDPKIIAEVSQGLGEAMVGI
FT                   DCKEMHFTSYAARSE"
FT   gene            <491157..492885
FT                   /locus_tag="MICPUN_56816"
FT   mRNA            join(<491157..491222,491319..492885)
FT                   /locus_tag="MICPUN_56816"
FT                   /product="predicted protein"
FT   CDS_pept        join(491157..491222,491319..492827)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56816"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C0"
FT                   /protein_id="ACO61710.1"
FT                   /translation="MTVIPDTEDKVINAELSYAGLEITGLTEESIAAKRAATELRDALA
FT                   VSYSFKNICKIQYLGAFEKLTKLKLDNNFITRIENLDHLVHLQQLNLSFNRITKIEGLN
FT                   ALTKLKDLSLFNNEIQKVEGLDAQVATLEHLSLGNNKLDSLIDAFAGLRPFHGLRILTL
FT                   QGNPIHDDPDYKLYALGRLPWLKYLDHRRTKQDELEKARDLYVDEILEIEDRENDQRLK
FT                   AEDAAKAEAKRVKIEASNLTGVPDLFERMLAADPEYEKLRYIPNKEAPELCNGLELFKD
FT                   KYQQRCEAFTELMDDQLERKKNERAEWQAVVDGELRQKDVEAREWVTEFETLKKHALRD
FT                   CDKSEAGVTPELESRLRDLLDKSEELYNKLMAQEQWTAVVIDDLVTNYDLQLGEIVDES
FT                   KKHVMDYFEYARGLEETYFDGFNEAVGSVLMRLGQDELDEADEEVKDFLGDKDRFMNSC
FT                   QNHHDSHVNTIDTAEETMSKEEKRRHEAEVEELREWQATRNRGRVAEMLAMRKRYRGEI
FT                   EEYLEGE"
FT   gene            complement(<492895..>494346)
FT                   /locus_tag="MICPUN_56817"
FT   mRNA            complement(<492895..>494346)
FT                   /locus_tag="MICPUN_56817"
FT                   /product="predicted protein"
FT   CDS_pept        complement(492895..494346)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56817"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; zinc ion binding - nucleic
FT                   acid binding [PMID 8270]"
FT                   /db_xref="GOA:C1E1C1"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C1"
FT                   /protein_id="ACO62146.1"
FT                   /translation="MGSSVNAEKKAKKEKKDKKDTKDKKEAKSDAGKKDASKKTAAAAA
FT                   QPMGKAAKKKALLDWFHGALKGDTDGARADFLKARDYVAVANVIRKHARDPKLKGAHAD
FT                   AIKLLDNKGHFLNIVDVVVKDGAADASTHWDKIKAHHRAKFEKAGGKDGVAEKKRAARE
FT                   AKEAFKVLQKERAEREAKQKELAADRKEYRQKMDEVRLKGACLDWCNLGKCKFGDECQF
FT                   KHPDELKGTLVALANKIKAKDVGGKKGKEREETERRKKRKAAKKEKERDGEGGGDSDSD
FT                   ADDGGGGDSESEDSFDRAAQAEDEYDSEDFDSDLDVDVDKSTGAKTKRKKRKDKVLSVL
FT                   PGDDGSDSDGDDEDLPRMVRLRKQKQREEAEWAKAERAAKKAKQAKILEKVKAARAAKG
FT                   LEMPKRQGSRDRSGGRGGGGRGGGGGRGGRGGRGGRGGRGGRGGRGEKRSFDGQASGEK
FT                   RKKKPRHADGRHAKHAAAHAARTAA"
FT   gene            complement(<494473..>495027)
FT                   /locus_tag="MICPUN_99389"
FT   mRNA            complement(<494473..>495027)
FT                   /locus_tag="MICPUN_99389"
FT                   /product="predicted protein"
FT   CDS_pept        complement(494473..495027)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99389"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR010754"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C2"
FT                   /protein_id="ACO62147.1"
FT                   /translation="MAIYVKAFSLVLKTVSKPLAKQVKEMAKSHPFLRELSISMALKAD
FT                   SLYQTIMSPTPLNEPIISSGGRRMKIPKKPPVMTEDQALQAAGDFLAEATVFGIAGGLV
FT                   WWEQSKSAEKDEKKAAAAKEEREQLTTMIALQQRTLQDVTEVLKEFEQHRRETSAALEE
FT                   MQRRARERDSRRWWGWAAAVS"
FT   gene            <495435..499374
FT                   /locus_tag="MICPUN_56819"
FT   mRNA            join(<495435..495616,495760..499374)
FT                   /locus_tag="MICPUN_56819"
FT                   /product="predicted protein"
FT   CDS_pept        join(495435..495616,495760..499306)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56819"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1C3"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR015016"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038737"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C3"
FT                   /protein_id="ACO61711.1"
FT                   /translation="MVSTRRSPNPPPDEEEAAILALQEERKQAEAAAKEQKIAAENAKA
FT                   AAKAAAAAAAKDEGPRKAKLTSFTAPKEVLDDLPVADFQDEEGVEQFGASKRIVDRESD
FT                   YSKRRLNRSVAGDASTYAERVKEAQLEREKDNTMKQIAQKRREEAERAAADARLAAARG
FT                   DDAGGDERDALPSASAEPAAKRAKPAEVEWEDMPVAADAPAQPKPARRNRWDATPVAGD
FT                   VGGTGSWDATPKIDAGAGGGVGPTPKRTRSRWDETPLIRAGAAGDPNATPLGAGAFDGG
FT                   ATPGPGQLAGMVTPDIHGLAAQHMAAANVPMTPEQYNAMRWEREVEARNAPLTDEDLDL
FT                   MLPSEGYKILPVPDSYVPIRTPARKLMATPTPYGGATPGFYAMPDEDRGQAFDVPDTPA
FT                   DLPTMKPEDYQYFAPLLKETEEEELSLEEQKERKIMKLLLKVKNGTPPQRKSALRQLTD
FT                   KAREFGAGPLFNQILPLLMSPTLEDQERHLLVKVIDRILYKLDDLVRPYVHKILVVIEP
FT                   LLIDEDYYARVEGREIISNLSKAAGLATMIAAMRPDIDNIDEYVRNTTARAFAVVAQAL
FT                   GIPALLPFLKAVCQSKKSWQARHTGIKISQQIAILLGCAVLPHLKSLVEIIEHGLQDEN
FT                   QKVRTITALSVAALAESAAPYGIESFDSVLKPLWKGIRAHRGKVLAAFLKAIGFIIPLM
FT                   DAMYANYYTREVMVILIREFASADEEMKKITLKVVKQCVGTDGVEPEYIRTEVMPEFFK
FT                   NFWVRRMALDRRNYNQLVETTLEIALKVGASEIIGRVVEDLKDESEPYRRMVMETITKV
FT                   IEKLGTADVDARLEELLIDGILYAFQEQTADDGDVMLTGFGTVVSSLGKRSKPYLPQIC
FT                   GTIKWRLNNKSADVRQQAADLISKIAKVMKICEEEQLMGHLGVVLYEYLGEEYPEVLGS
FT                   ILGALKGIVNVTGMSRMTPPVKDLLPRLTPILKNRHEKVQENCIDLVGRIADRGAEFVP
FT                   AREWMRICFELLEMLKATKKAIRRATVNTFGYIAKAIGPQDVLATLLNNLKVQERQNRV
FT                   CTTVAIAIVAETCSPFTVLPALMNEYRVPELNIQNGVLKSLAFLFEYIGEMGKDYIYAV
FT                   TPLLEDALMDRDLVHRQTAAVTVKHLALGCAGLGCEDALVHLLNYVWPNVFETSPHLIN
FT                   AVMEAIEGARISLGPGFVLGYLLQGLFHPARKVREIYWKIYNTLYIGAQDALVAQYPAL
FT                   EDEGERQYRRHELDVFI"
FT   gene            complement(<499470..>500141)
FT                   /locus_tag="MICPUN_72415"
FT   mRNA            complement(<499470..>500141)
FT                   /locus_tag="MICPUN_72415"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<499470..500141)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_72415"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR024253"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C4"
FT                   /protein_id="ACO62148.1"
FT                   /translation="MAEGGKTSVSNYDLDGNSFRNTMHSLNYGNVMEAAARNYMKEVKA
FT                   EEAAAANVGPIQYDLEDLEDDPELHQLHKERIQQMKEEQEKRREMQRKGHGEYRDIDEG
FT                   EFLPEVTGSFQVCVHFYHQEFERCRIVDKHMAILAKKYFDTKFIKVHAPDCPFFVTKLN
FT                   VKVLPCIVFFRNGVAYDRIVGFEELGAKDDFPTSRLENMLLTAGIIAVPEKGEDDSEDE
FT                   EE"
FT   gene            <500533..>502227
FT                   /locus_tag="MICPUN_56821"
FT   mRNA            <500533..>502227
FT                   /locus_tag="MICPUN_56821"
FT                   /product="predicted protein"
FT   CDS_pept        500533..502227
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56821"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; phosphoinositide binding -
FT                   protein binding [PMID 35091]; GO_process: GO:7154 - cell
FT                   communication"
FT                   /db_xref="GOA:C1E1C5"
FT                   /db_xref="InterPro:IPR001683"
FT                   /db_xref="InterPro:IPR036871"
FT                   /db_xref="InterPro:IPR039358"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C5"
FT                   /protein_id="ACO61712.1"
FT                   /translation="MSDVEAETAAEVEQEAGPSSPTAPPAYESIVLSDPEPAPAVSEIE
FT                   NNAAASGGNAYPSPPAQPPGARLVARVTEPVKIGDGMTAHAAYVVAVDTDMPVFRLPKL
FT                   SVQRRFSDFTWLRDKLRATFPGIILYPLPDKVVTTSPFNPEFLEHRRAGLDLFLRKTCE
FT                   HPALRESIDLVAFLQDEHGASLGSAASPWYQRGAAGTALAAADSWWQQITTATESFVAG
FT                   AGTESLLMEEDPKYLEATEYLLLLEERLRRAVRSSDDVVGAVNAGGIIVESFAENARVL
FT                   GDCEEKGAKVLLGDAAGGLGQAFRQVGAAAQTLRAPAETQAWRLADAFRAPLKRGLALV
FT                   QAAKEAIDARTDALLKLQTARARCEQKRARYEAVAGGGSNGVNGAAGAPPPVAPAPPPT
FT                   LGSTWMSSLSSITKGAFGGGAAQPSVEELQKEAESAATAKDVAQSRYDALKDRMTTELP
FT                   RLHGELESELNAAFACAAECFKDLAAAQAAAWESVVPGCSDVEPAAPPPLPEKGTDGAT
FT                   EGRVKALWTQYMGGSTTNGGGSSGGSAAAAAAAAAAEGSSPTGVLPE"
FT   gene            complement(<502473..>503750)
FT                   /locus_tag="MICPUN_56822"
FT   mRNA            complement(<502473..>503750)
FT                   /locus_tag="MICPUN_56822"
FT                   /product="predicted protein"
FT   CDS_pept        complement(502473..503750)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56822"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C6"
FT                   /protein_id="ACO62149.1"
FT                   /translation="MSTISTAPARWCRSVRASPGRSLRHAANCFALGSAAFVLRFTALA
FT                   DADATTAMAATPDHLSTAALARDVVDLASASLYTLGSTLWLHQTVLRERLRGSTQSPAA
FT                   VADSMDEQSATRWSQPPTWNEIAELVSGNPVVCSVVLFLCGCALDDALSLSDVIAEEVA
FT                   TRARGGLSNGEIWPPSLDPRQPAQPARISFELVLPFAPGVVGAVAFGVGGAARLVRLVR
FT                   GDGDSFDTRDEANMWLPCERDDECASMVPPPEVTERLDARIANVARFAQWPLNLLASFA
FT                   FIDGAWLAEFGAWSKLAGAQPASGNVLASVGGDVINVASSLSESAARLASENYVVGNSL
FT                   ADLGSIRDDLFGGRNGSPGDATAADGLATGAHRALSSSDAAHALGGGLFLVSSVAWIVE
FT                   LRARRRLRCARRGDDGDGHGDGDGDA"
FT   gene            <504300..>504959
FT                   /locus_tag="MICPUN_56823"
FT   mRNA            <504300..>504959
FT                   /locus_tag="MICPUN_56823"
FT                   /product="predicted protein"
FT   CDS_pept        504300..504959
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56823"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C7"
FT                   /protein_id="ACO61713.1"
FT                   /translation="MRYFMRYLLACSAGESSVGEGRAAERAESTRKTPPTMMTTRVLLA
FT                   PTTRSSIAVGKGKAFANDSTSRGATRVVTTALPSTASRAKITISGGALALALAFTPPAL
FT                   AALDPYGGVGLEIYVGPDRLPAIVEFLPTKTTGPAHDAGLRLNDKILEVNGVAATELGG
FT                   LQGVAKALRGEAGTDVDVTVGRGRGRAPLAVEKVRMKREEIAPNPRSCFVASCARV"
FT   gene            complement(505018..506056)
FT                   /locus_tag="MICPUN_107894"
FT   mRNA            complement(505018..506056)
FT                   /locus_tag="MICPUN_107894"
FT                   /product="predicted protein"
FT   CDS_pept        complement(505082..505972)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107894"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5737 - cytoplasm; GO_function:
FT                   GO:8119 - thiopurine S-methyltransferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E1C8"
FT                   /db_xref="InterPro:IPR008854"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C8"
FT                   /protein_id="ACO62150.1"
FT                   /translation="MKHKNSLLGEGVTSPPELSKRVFVPLCGKAVDMLWLASCGHRVYG
FT                   VDLSGVAARDFFDEAGLPRTTTPADAMVAERWSAGVKRVHTSGNIAIVEGDLFSIRPDP
FT                   DPRPDEDDARSYGWFGVMPRVDSGGSIIARSSSNIANEDGPDTSSALDARVGAQGSISF
FT                   REEALRFASGGGPAMDAVWDRGALVAVEPSLRDRYASALVARLAPGGRMLVVSLSYDPN
FT                   AGCAGPPHNVPHEELVRLYESRGCEVTLLGSEEVIESAPPRMREKISSMTESAYLVRKP
FT                   HRRGKGGFHLPRPRL"
FT   gene            507050..508499
FT                   /locus_tag="MICPUN_107895"
FT   mRNA            507050..508499
FT                   /locus_tag="MICPUN_107895"
FT                   /product="predicted protein"
FT   CDS_pept        507274..508422
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107895"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16636; cobalt ion binding -
FT                   oxidoreductase activity, acting on the CH-CH group of
FT                   donors, iron-sulfur protein as acceptor [PMID 50897];
FT                   GO_process: GO:10024 - phytochromobilin biosynthetic
FT                   process"
FT                   /db_xref="GOA:C1E1C9"
FT                   /db_xref="InterPro:IPR009249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1C9"
FT                   /protein_id="ACO61714.1"
FT                   /translation="MEFLFRTLDRSLGPLTPVHLPPELASASVPGKVRSETWVYTSPFV
FT                   RRARFTYVDGGEKTQIFNCVVYPRCVDDSTGEESHLGDAPLLGVDLLSLNGGKKILVGV
FT                   DLQPLSRSEAYLGRYVDALASLRDARFAELNLVEPSDRFYEDAQFFSPAMLFARPVPVD
FT                   VAVDCAVAAAKATGALQDLGTITAEDVCGVEWAEPNSGCGVPLVEAKTLDAVKAYAAKW
FT                   LELMDARNDDWAKAWDQGGRAGGGATSALGSRAGSFSQMLANNIKSAVGAKSEGGEDEP
FT                   AAEAADAAEGDPPAPPAEKTEEPKRAAEVRAGKYARVLTAAESAAAQDFHDMWQRSHDP
FT                   AIPMFAGWFGKEWAERLASEVLFPEDKAKEELKAWEAQQRGG"
FT   gene            <508566..>510212
FT                   /locus_tag="MICPUN_80230"
FT   mRNA            join(<508566..508691,508806..509182,509597..509891,
FT                   509946..>510212)
FT                   /locus_tag="MICPUN_80230"
FT                   /product="predicted protein"
FT   CDS_pept        join(508566..508691,508806..509182,509597..509891,
FT                   509946..510212)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80230"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:6464; ubiquitin cycle - protein
FT                   modification process [Evidence 15031] [PMID 6512]"
FT                   /db_xref="GOA:C1E1D0"
FT                   /db_xref="InterPro:IPR008883"
FT                   /db_xref="InterPro:IPR016135"
FT                   /db_xref="InterPro:IPR017916"
FT                   /db_xref="InterPro:IPR037202"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D0"
FT                   /protein_id="ACO61715.1"
FT                   /translation="MPVSAQVQYYLNAKLTATGASALPYDERLKFAVRDQLLAVVERYP
FT                   SLSVRDDPFTHNDGRTVHLLRAEGTIPIYYMGVKYNIPLKMFLPEAFPHAQPICYVTPT
FT                   SNMIIKPGHSCVDGSGLVRSPYGDRWSYPRSNLTELAGLLSEAFGSEPPLFAKPAGYVP
FT                   PPPRTSPHVLAGGLSVAEGTFKARAITALSDRLRSELDVLRAQSGEEAERLLTLQAELA
FT                   RRREDIERSLREMRAERGAWEHRIGGMQAATVALEEWVSENEGKRKETEIADAAFRPED
FT                   PLSEQILEEMAKDLALEDAMDCLDEALSAKQIELEPYLELIRELSKEQFFARATTMVAR
FT                   KEQRERGVSQGVTF"
FT   gene            complement(<510294..>512000)
FT                   /locus_tag="MICPUN_56827"
FT   mRNA            complement(<510294..>512000)
FT                   /locus_tag="MICPUN_56827"
FT                   /product="predicted protein"
FT   CDS_pept        complement(510294..512000)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56827"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:4198 - calcium-dependent cysteine-type endopeptidase
FT                   activity; GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1E1D1"
FT                   /db_xref="InterPro:IPR000169"
FT                   /db_xref="InterPro:IPR001300"
FT                   /db_xref="InterPro:IPR022684"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D1"
FT                   /protein_id="ACO62151.1"
FT                   /translation="MGCLSSKPADSPSSGRAHDYDPNLAPEAPKPVRPRPPAPATADVS
FT                   PIGDDEEFAPMPPQPAQPAGRKTLRSGDTPSAKNIHMESTTKMLQFMKHAESMDWPGPE
FT                   SRKWNYTSVETSGSYSFTKMGNKEQVNGTIASGLSTLHSNPGKYIGCMYQTDMVDWPED
FT                   QQQYTLIEREGTVGLKYKPGEAFTVEMANYQALPHVTEVDIDSIDDGVTMQMTSHGKLL
FT                   HGPRNVPLCPGRGMGVLDRPGIKIIQNVDPGDIHQGSVGDCWLLSAISALAEFDGAIFE
FT                   LFKKTPDMHQMPRAGPNRYHVTLYDLKTWQPVDVVVDERLASNPSNPGSLFGAKPSDDG
FT                   ELWACYLEKAFVAHCGGWDHIEGGVPPHAWAMLTGCKDQYTIEMEKSGKDKGKWNCWGN
FT                   YNKDRDFYNELANSSKEKQPPMWQQDWPEVGGGGEGAITGEELFRKVVAWDAADFIIGC
FT                   ASEGDNDTVKHDGIVDGHAYTVLQAFSNVAGSGVDLVQVRNPWGSGEFEKGMWTDINGL
FT                   ASGWQKYPKVKALLQPKVAEDGLFWMSKEEFYKYFKTVYLCAKSMRDFKVD"
FT   gene            <512146..>512826
FT                   /locus_tag="MICPUN_71958"
FT   mRNA            <512146..>512826
FT                   /locus_tag="MICPUN_71958"
FT                   /product="predicted protein"
FT   CDS_pept        <512146..>512826
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71958"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR024253"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D2"
FT                   /protein_id="ACO61716.1"
FT                   /translation="HVVYRGPEGETTVWDDVQRRFGNKPPLPEKFVPRAYAPEEDRGLR
FT                   AAVERDGRAGGVAHVDAAGGTDALEAMEDEDAFADDGFLEEYRRKRLEEMKTAAAIPRF
FT                   GAVVEITRDSFMAHVTDPSSEHYVLVLLHRPNCPECELLNVAYRELARKHPFTKFTSIP
FT                   GKECIPGYPDRNMPTLLVYRNRDPVRTFMGLGHFGGRHMTPEGLELALNECGRVCAGAR
FT                   GGEDE"
FT   gene            complement(<513056..>514030)
FT                   /locus_tag="MICPUN_56829"
FT   mRNA            complement(<513056..>514030)
FT                   /locus_tag="MICPUN_56829"
FT                   /product="predicted protein"
FT   CDS_pept        complement(513056..514030)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56829"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1D3"
FT                   /db_xref="InterPro:IPR026183"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D3"
FT                   /protein_id="ACO62152.1"
FT                   /translation="MGGKAKGKTSGTEGTAPTASNPAEDALNSVLDGLDTPEEKLAALS
FT                   AKFLELHKDLRRTSRRCDEAEGKVGMALVERDAARQELTKNAEVNDKLQALCRTLQGAN
FT                   KETSALLREREEAQLKLREDLEAKFDEGLGAVSKRIEESASVRDDLLKENDTLRDHLKK
FT                   LVARGDLQQETYAKAKDAFDLEKQLLEARLAEAVAFNDQLTAKLQQREEESKGYLEQLS
FT                   GYADKFDTFQGVISQSNETFTQFKTDIADLSKKLIESEAAKREMEAKTLKSDVAMIKLL
FT                   EEREQLTAQCVSLKAKKDKLEGLCRALQKQTISGDKENAKAAA"
FT   gene            <514161..>519729
FT                   /locus_tag="MICPUN_99395"
FT   mRNA            join(<514161..514658,515308..515494,515855..>519729)
FT                   /locus_tag="MICPUN_99395"
FT                   /product="predicted protein"
FT   CDS_pept        join(514161..514658,515308..515494,515855..519729)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99395"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1D4"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D4"
FT                   /protein_id="ACO61717.1"
FT                   /translation="MFAVTQTASKALLAVPSKASKTRTGRVVVAAAVPHSAVESGKKAM
FT                   LTGILAATFAVGSVDPAQAATVFAGKYIDPNHPHCPREIDADGVISGVDPVPFAKGRGC
FT                   RGYKKKNEAAAVEAGKISLWSIKGVVSKDDATILIDFNQKDGSGESFTGKWNGVGIEFP
FT                   DGNASAPYFSMNAASGSSDVSASISRPFARSSMRCWYRFGGCHGKDGPAAVISLGLRAS
FT                   SKIPMALFGFAGADPKPEPKPEAPPAVANDAPGAVPARGGGAGAIGFSTASGTDRKPRG
FT                   GFRSASLAMAGASKAGVGSSLFTSASSMMVNPDTVDLTADDANEDESPGKRHKTSPEEG
FT                   NEEGKRKETRRYDPVEYREKQRIKREKDERTKKKRQECRQTSIFDAMAGANAPNLRGSA
FT                   DPIPKEVWQRILAHAPVSSLRDMRLVCKTLMNAVDDEGFLPFTKIAQQTRRMRTIDADR
FT                   VIAESAAGRRKPPAVSAAAGGGRVSIGDDRPARDDEDHAAGIIQRIARDKPFATPMSAS
FT                   ALAREVEIGVERAEARDGRTPVPGHVPGEGLAATVRELAGWKIVGSHGWALLAAAILVA
FT                   AEDYGTIALLLDAARRACARADREPDGDLNGGDTAGDNERRHHYTGDYCAREDLTEFIS
FT                   LLAIALTVPSRWTRGAVDAEDVVLREPSASRLAHLDAAAGYLELIPHREAAGDWGADRG
FT                   SFTSRLTHEQLSIVSADVKKDEVLLVRAFAGTGKTTTLLEYVKRRPGYQFAYITFNRSV
FT                   MEEASTKFPKLNVKCLNFHKMAYAKFGFLYRGEKFLRGTLRQYHVSKAIGVNDSRALFA
FT                   IRVLNEFLKSADLAVELKHAEAIRAEVSTKDWNKVYGKSNVKAKLGSQSPEENLVELVK
FT                   NLWDKMLNPEDSSFPMTDAGYLKRYQLACRREHNPVRLDVNFDILMLDEAQDAAPVMAD
FT                   IILSQKECGKILVGDPHQEIYSFMGAKNAMATVAATVDKSKIVERRLTRSFRFGYEIAD
FT                   VANTLLRLKGETTCLIGSRRDLPDPVWSSWSDQEEVSAVHCLPRPKDADGVTLTLQSYA
FT                   PGYAATLRTRLGDRPIREQGRQLVVLCRSNASVFDVASRILNLGIKDLKLGFIGGLEGQ
FT                   RLGQLMDIWRLAVQSDDELDAITDYFVSRFVKEYLKAKENGVKDPEPPLQALKSSAKLS
FT                   NDLEMQTKISIVEKHRGNLPELIEKLKKVDVGTNPSNLKCANYLLSTAHRAKGLEFDHV
FT                   LLWEDFLAVDHCSPVEWDSNGHATLFQIGNMFGDSEIVGADELNLVYVAATRAKQRLIV
FT                   SDALKHLITAPRCNFAATWYLRDRGTNLPLTGMTEVEAAEDWAANEVLAQRRGGPAHFA
FT                   TLRCATNTCDRCGDQSYMFQLPEGSFQADEVDNAPTLGMEVRYGRIRQGMADTDIGMAN
FT                   ADPHAVSTVPMIAPSESYAFRHNRRMCGRCVRTFAVSRRGAERYLDDDTAGAGVERTWV
FT                   DDTILENFVRHSNRVNNIDPIEGMSMMDIASVCAAERRARGEPWRGKDAAGQPRRMAD"
FT   gene            <520294..>521292
FT                   /locus_tag="MICPUN_80015"
FT   mRNA            join(<520294..520470,520585..>521292)
FT                   /locus_tag="MICPUN_80015"
FT                   /product="predicted protein"
FT   CDS_pept        join(520294..520470,520585..521292)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80015"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3723 - RNA binding"
FT                   /db_xref="GOA:C1E1D5"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018664"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D5"
FT                   /protein_id="ACO61718.1"
FT                   /translation="MRALEKGEPVSGRVEVANRGGLILRIFNGRFRAFLPLSQMTSSRT
FT                   LDVKRSRKKNAPKSAQVGKVIEVKVTDVNDKKIVVSERALVQERGVKRLKPGVRASAQV
FT                   VSLSDFGAFVELSQDDPQAPRLEGLIHISELSWSRVAHPRDILRVGDEVDVKVLDVAPA
FT                   EGRRPARVTFSLKQLQADPLLETLDTIMPVAMPEPSVDEDELLDTPLPGLMDICSNLLT
FT                   EEGIDAVIPGRQAVEQRVVSQDLELWLTNVVVEDGYNLLARAGRQVQEIHVVTKLSRDS
FT                   IKMAIKRATSALK"
FT   gene            complement(<521409..>522164)
FT                   /locus_tag="MICPUN_56834"
FT   mRNA            complement(<521409..>522164)
FT                   /locus_tag="MICPUN_56834"
FT                   /product="predicted protein"
FT   CDS_pept        complement(521409..522164)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56834"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1D6"
FT                   /db_xref="InterPro:IPR013583"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D6"
FT                   /protein_id="ACO62153.1"
FT                   /translation="MVAALGGDARAAGAAAPKPEINVAKLTKAEEAIFTLQPGKDAFVK
FT                   LAAALAPFRPVVDHVADALSWRSTRKAMAAQAAFTYAVLYPYVIIPGILLTLGTCTLTN
FT                   RKEDEGSGDEDDGETRSEPAKKKPTPAEPKGASWRSKARKLDARDVQRALENVATRLER
FT                   IIALTTWEDPVVTGAFVAGCLVAALFLASHSFQVVLLCVGLYATRPPSWRVVPGPLESL
FT                   LGRMPDKGEAYARLMQETGNGGKGAASGA"
FT   gene            <522478..>523869
FT                   /locus_tag="MICPUN_56835"
FT   mRNA            <522478..>523869
FT                   /locus_tag="MICPUN_56835"
FT                   /product="predicted protein"
FT   CDS_pept        522478..523869
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56835"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1D7"
FT                   /db_xref="InterPro:IPR005338"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D7"
FT                   /protein_id="ACO61719.1"
FT                   /translation="MTRRVGIGLTAGPSLATIDAALVEIDPNPIRLKPVELIEFLPVPV
FT                   PPDLRARLVVARSGAAATPAAMSELDTEVGKLLADAAKKVAGARLGEVEFIASCGMPVV
FT                   RTSASSEESKSDDGAGAPPEVVRIGDAAVLARDTAKCVVSDFVPAESDETGVFSTADAV
FT                   LFRHLLDDTRTVEWHRKPTADTSCALVVVHFGAMASMTALSGTGRVLRSFDCGPGNMVM
FT                   NLIVQNAAALGLEPKDPKDEALAEKLQQPGGMRFDEGGKIAKGGRVYHGRTKDAPIDFA
FT                   WTAPFFTRSPVRRGSEADFGMEFTKTFVNRFPKEPPVRFAEVGKEWRNVNDVVRTALEH
FT                   AALCVMEGIASHVGAVSGSGNHLMGHSGSTGRVLISGGGAYNWALMARLRELGWKNLRF
FT                   ETSTECGIRADAAQAMRAATLGYLTLSGVAGPGDGEAAEGAGGAALGKVYTPGGDPAPV
FT                   FEPVK"
FT   gene            <524138..>525628
FT                   /locus_tag="MICPUN_113552"
FT   mRNA            <524138..>525628
FT                   /locus_tag="MICPUN_113552"
FT                   /product="pfkB family carbohydrate kinase"
FT   CDS_pept        524138..525628
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_113552"
FT                   /product="pfkB family carbohydrate kinase"
FT                   /note="pfam00294, PfkB, pfkB family carbohydrate kinase.
FT                   This family includes a variety of carbohydrate and
FT                   pyrimidine kinases."
FT                   /db_xref="GOA:C1E1D8"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D8"
FT                   /protein_id="ACO61720.1"
FT                   /translation="MQSLQAPTLALGVSEGAKRRAVAGSRLARPVSVRHHRRVAIRNNA
FT                   VFADADQAQRWIDAWKARLNAPRVVGVGSAGVDYLASVAAFPEPDQKLRTDAFETQGGG
FT                   NCGNALTAVARLGLRPSILTKLSDDGAGKAILDELRDDGVDTAHVVIEPGKSSPFTYII
FT                   VDREGSTRTCIHTPGPEFTPKEMPLAAIERLLDGASLCYFDGRLTEVAIEVAKVAKARG
FT                   VPVLVEGERLRDNLPALLALGDYVCTSANYPQDSNPDAPGFEAAMVAMASKLPAAKAIV
FT                   TTLGSRGAVCLVRAPAQAGKAPSRAESLADVVSKLEKDAAVGMPAGSRGVPVPAWPVVS
FT                   DAVVLTDAGDEAAAALGAVEVIFAPAVKLQKSSVVDTTGAGDAFIGSMCYGVATGMELK
FT                   DAMRLGAYVAAKKCGSLGARPGLPDISEVPEAVFQGKEKPKVAAAAVNKTASRPPAVRK
FT                   AKAPREMTDIDKEFADGTRKSIAPGLSKWMLKLGRRYQ"
FT   gene            complement(525627..>527570)
FT                   /locus_tag="MICPUN_113551"
FT   mRNA            complement(join(525627..527331,527477..>527570))
FT                   /locus_tag="MICPUN_113551"
FT                   /product="calcineurin-like phosphoesterase"
FT   CDS_pept        complement(join(525695..527331,527477..527570))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_113551"
FT                   /product="calcineurin-like phosphoesterase"
FT                   /note="pf 00149: Calcineurin-like phosphoesterase This
FT                   family includes a diverse range of phosphoesterases [1],
FT                   including protein phosphoserine phosphatases,
FT                   nucleotidases, sphingomyelin phosphodiesterases and 2'-3'
FT                   cAMP phosphodiesterases as well as nucleases such as
FT                   bacterial SbcD Swiss:P13457 or yeast MRE11 Swiss:P32829"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1D9"
FT                   /protein_id="ACO62154.1"
FT                   /translation="MSAFAMTGAAAPAKIAAKYNLGRNSKALNAKATLRAARPASMRVQ
FT                   ASATPTSLTITPGDPSNYTLAILGDLHMDPRDTEHSYEGRDHIKKILDESPNPFLVSLG
FT                   DLGESKDVNESKQLFAGTTDCFKMVREFLDGFGHKYDIVGGNHDLEGIDEFATDAENLE
FT                   AYLKYMGKETPQFCYEVAPKTLIVGLGSTQFRDAQYTSHEVAIDQEQLDWFVKTIEEHP
FT                   FEDGWQIFCFSHAPIIGSGLRVLQECHVVNGCCWLNHNDKRNSKLFIETVRKSPQIKGW
FT                   FSAHFHLSHDYEDSITFPGGNNRGSCVFAQTGVMTARSSRDGRRQSRLVRGNSQGFEVC
FT                   TVDHSKGGVVRLDATVMFSDECEVNLDDPTPADEQDIRGCSVMTFAHEHEDYDHDLWFS
FT                   AYVPKEDDGCRVNEPCASGTLGVVEGDFSSRDPVKWWYMKDGAVLGGHNGMIIEYDPST
FT                   LAPLGMVVSRDELENRRVAVIDDEWGGDCLCLFDDETGDVTVVQPNEDGSYWRKVVRNK
FT                   MYRMKEMRRVKAAKNYFQKMKGEEVELNVLSSYGPYTGTAGQVMGISTRAINPKAVVKN
FT                   "
FT   gene            <528027..>528515
FT                   /locus_tag="MICPUN_56838"
FT   mRNA            <528027..>528515
FT                   /locus_tag="MICPUN_56838"
FT                   /product="predicted protein"
FT   CDS_pept        528027..528515
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56838"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E0"
FT                   /protein_id="ACO61721.1"
FT                   /translation="MKIRAAKKKQNKKVKAAKARAKHAREQRKKAAAGAGRDGDDDHEM
FT                   DAADAEVNAADEDVAIAEAASENPKLSGRAARALAVQARRTLKQKLSQLKDQRQKIAKK
FT                   SIARRDERKALGAKIKAAFQVSKNSTGDAEALLRAAEDLPDDDDDDNWADEDVEMAMD"
FT   gene            complement(529522..529971)
FT                   /locus_tag="MICPUN_107897"
FT   mRNA            complement(529522..529971)
FT                   /locus_tag="MICPUN_107897"
FT                   /product="predicted protein"
FT   CDS_pept        complement(529619..529954)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107897"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E1"
FT                   /protein_id="ACO62155.1"
FT                   /translation="MTEVFCEEQGEGATGTFRTLGVSGALNAAVAVAAETANAPPAARG
FT                   RGGSAAKPTGGESVCQSERDSRPGYEYLTAAELRRVGAKMSVGGRGLERVERSGGQYYL
FT                   QSARDYD"
FT   gene            <531669..>532547
FT                   /locus_tag="MICPUN_56841"
FT   mRNA            <531669..>532547
FT                   /locus_tag="MICPUN_56841"
FT                   /product="predicted protein"
FT   CDS_pept        531669..532547
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56841"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E2"
FT                   /protein_id="ACO61722.1"
FT                   /translation="MNTIWHPLLLNRDPIVVKEESDDDHHNPPAVNVEPPADDHGEDEK
FT                   TEDLAGKMSTIWRPNLGRLYASVAEMEGSESEEEKEDATKKGVKRKRAPRTKGPCEHGV
FT                   KYRSNCKVCGACPHGKWRSRCKECGGSGICEHGRQRSKCKECGGASICEHSRQRSQCKE
FT                   CGGSQICKHGRRRSRCKECGGSGICEHGRQRSKCKECGGSQICEHDRIRSQCKECGGSQ
FT                   ICKHGRRRHYCKECGGSQICEHGRQRHRCKECGGSQICEHDRIRSQCKECGGSEICEHG
FT                   RRRSECKECKK"
FT   gene            complement(<534147..>534443)
FT                   /locus_tag="MICPUN_76642"
FT   mRNA            complement(<534147..>534443)
FT                   /locus_tag="MICPUN_76642"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<534147..>534443)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_76642"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E3"
FT                   /protein_id="ACO62156.1"
FT                   /translation="LETVRNLVFLDLYANAVEKIAGLECVPQLRVLMLGRNRIRSIGAG
FT                   LARLQRLDVLDLHNNEIASTSGLNSLASLRILNLAGNRLVSLGDLGNMTGLHEL"
FT   gene            <535341..>536705
FT                   /locus_tag="MICPUN_99400"
FT   mRNA            <535341..>536705
FT                   /locus_tag="MICPUN_99400"
FT                   /product="predicted protein"
FT   CDS_pept        535341..536705
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99400"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E4"
FT                   /protein_id="ACO61723.1"
FT                   /translation="MGKLGELMGDSWDNAVKNNPIPVITKKMRKPGETAAYVRAQGSSL
FT                   FGIAEGLGLQYRMGAYTQVDDDLLDEDPGLNQLLVSTGSSISQLFTQDMWERHRGVSRY
FT                   WRHLATITKSTVFNRIVEPVLLIAAWATFWCLWNGTLVPVVQAFGEATLEASSGVAIVE
FT                   RIAGITGGVKFTHAVAVLASLAAPVCVPSTAHALAGTALGLVLVFRTNSASARLNEARV
FT                   LLGNMVRLVRDLTRLCQYIPEGDRRCEGVRRSVVRYAAAIGLAIEAHMRKGRTRVDPDD
FT                   PTAFKVDPSRNLTRIFGETEAKRIVNLPGASHNLPMVMNAQASKELRRALKAGMPHMIH
FT                   RECEEMVAELGKISGGAERIISTPIPLSYTRHTSRSLMIWLLTLPFALWETFHWATVPA
FT                   VFALTYLTIGLDEIGIQIEEPFSVLPVKPLADVCERDVRALDQLLELGGFPEGDR"
FT   gene            <536937..>539837
FT                   /locus_tag="MICPUN_56844"
FT   mRNA            <536937..>539837
FT                   /locus_tag="MICPUN_56844"
FT                   /product="o-methlytransferase"
FT   CDS_pept        536937..539837
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56844"
FT                   /product="o-methlytransferase"
FT                   /note="pf02409: Omt_N O-methyltransferase N-terminus This
FT                   domain is found at the N-terminus of polyketide synthesis
FT                   O-methyltransferase proteins."
FT                   /db_xref="GOA:C1E1E5"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR007213"
FT                   /db_xref="InterPro:IPR011610"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E5"
FT                   /protein_id="ACO61724.1"
FT                   /translation="MGFGRREAAREVEKVEVGAGKLKRRLLADDERTAPAPRPAASSSR
FT                   RVALTRAIGGAAFVYLAHRAWPRVRQDGGRVLRALKRGLGGLNPLKGRRGRGGRRGRRR
FT                   GASGDAAHDAGREGGNSSRDEAVEKISRSAARRDGRERDDASPPSARELPVAVSDSSKS
FT                   IAALRALEEDARRPLFDDPFAAALAGPDAIARVRSRDGDKGRIAIRTRFFDDAVLDAIE
FT                   SGTRRQREWQVVLLGAGLDTRAWRLAPRAGDKVAAVFEVDVPEVLGHKAKVMAETFGVD
FT                   FPLSLGNTYASVAANVAKRGWFERLRDAGHDPARPTVWVLEGLLYYLSQEAADELLRTC
FT                   AGASAPGSRLVASAVNGPSLARARARGNRGGAKATWASAIDEPVEPFLRRLGWAAATVR
FT                   QPGESGCEYGRWRGEPPPPRDPVERPDDAPPRTWYVVAEVSREAAATKTSAITRSDDRS
FT                   FGRSRPPHRVRGDHSSGEDGGGGSYARRFDFRRDDSKERGGRDDSRGGRWTTREGSERP
FT                   AGRRSRNDDDDEDDDDEEDGGRSRERAPEPAETSSSFGSDERDGSDEHDGPEDAEVDSL
FT                   RRRRLERRYSSGAASARSSEGIRGSTRQDSAFGSYGDIGAQHVSRAHTHRHRDEAIGSP
FT                   SPSPSKVVSVAASAAARLREIEADRERRRRAEEESELRRRAREMAEKKRHRKEEEDERR
FT                   KRVEAAAAAAGRVGRRVSPGAPGSGSDRASTLAAGATSSSNGAVVRSDRLDFRRPDRAF
FT                   DARAGEILRDDDDLPNFGALTDAGFARWRDGTREDWAALCRPTEHLSPSTCVFDVFERS
FT                   SGTMIGVAGFHVLDADASRAYLAVCIERPSRRRGYARECWEAMADFARSDLAFHLGVET
FT                   VCARVPTANEPALFFVKDTRGFASPFSSPTGKAGGVHAQTFRRRALSKAAGARRCPGLK
FT                   RSLDDPNAPVFGADAADAGTCQTFYLDVRYWGGGAA"
FT   gene            complement(539855..>540919)
FT                   /locus_tag="MICPUN_56845"
FT   mRNA            complement(539855..>540919)
FT                   /locus_tag="MICPUN_56845"
FT                   /product="glycogen synthase"
FT   CDS_pept        complement(539975..540919)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56845"
FT                   /product="glycogen synthase"
FT                   /note="pf00478 IMP dehydrogenase / GMP reductase domain
FT                   This family is involved in biosynthesis of guanosine
FT                   nucleotide. Members of this family contain a TIM barrel
FT                   structure"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E6"
FT                   /protein_id="ACO62157.1"
FT                   /translation="MSAGASGVLHEWASTGRRAGPAFARAHPRSRASPFRRLAPRRGAA
FT                   VVVGTGLFSSGASWNPATDLALETNYDLYMRPGDVEYNTTIEREVYDHVVGKAANKLVT
FT                   QREYGLDEDHRAPLVGFIADLANERHTSSGDPTASGTDVLLALVPHLVADGFQIAVHVS
FT                   PGDERLEALVRALAATHPGRAAGAVVARRDSCESPKSNDVADDDAARRRVLAGADLLAV
FT                   LGRGPDVADARAVACRYGAVPVSRGKSGWGLSRSVPWIRNAIKGKRKKDGFVYDADADV
FT                   DGARAAFAEAAASFGDENEWATIVAGVMEETRR"
FT   gene            541059..541678
FT                   /locus_tag="MICPUN_56846"
FT   mRNA            join(541059..541089,541348..541678)
FT                   /locus_tag="MICPUN_56846"
FT                   /product="ribosomal membrane protein"
FT   CDS_pept        join(541087..541089,541348..541554)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56846"
FT                   /product="ribosomal membrane protein"
FT                   /note="pf06624: RAMP4 Ribosome associated membrane protein
FT                   RAMP4 This family consists of several ribosome associated
FT                   membrane protein RAMP4 (or SERP1) sequences"
FT                   /db_xref="GOA:C1E1E7"
FT                   /db_xref="InterPro:IPR010580"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E7"
FT                   /protein_id="ACO61725.1"
FT                   /translation="MAASKRVFAASSAKFHKNIHKRGLVDIKAKEKSKYGFSVGPVMLG
FT                   FFVFVVIGSSLLQIIRTASAGGPM"
FT   gene            complement(<541686..>543254)
FT                   /locus_tag="MICPUN_56847"
FT   mRNA            complement(<541686..>543254)
FT                   /locus_tag="MICPUN_56847"
FT                   /product="major facilitator superfamily"
FT   CDS_pept        complement(541686..543254)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56847"
FT                   /product="major facilitator superfamily"
FT                   /note="sugar; GO_component: GO:16021 - integral to
FT                   membrane; GO_function: GO:5215 - transporter activity;
FT                   GO_process: GO:6810 - transport"
FT                   /db_xref="GOA:C1E1E8"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E8"
FT                   /protein_id="ACO62158.1"
FT                   /translation="MLFMIASLAALGGFLFGYDLGLIAGALLYMEPDLRLTEASEELIV
FT                   GMAKLGAVFGTFVGGALMQEHGRRKAIAWNSGFFLLGPFIMAVGDDAATVSLGRFVVGM
FT                   GVGASAVVVPAYVAEMAPKDRRGSVVTVYELMVCLGMITSGLVDWGLRGVEHSWRWMVA
FT                   MPMFPAVLMLAGSAALPESPRWLVIRGRLRDALDVIHSLREGSGVDRDGEDVSTAAVEA
FT                   ELMELWSAVEKERAQVGEPAGEPDASAAADVGAAADVPAQKSATSSGIHGRGMLAVGIQ
FT                   MLRDIRGLTSGPERNAFAIALWLAFFNQATCSTSVINFAPEVLERVGVDSKDDAVLLAS
FT                   AVSLCKLLGVSASMFLVDRAGRRTLLLVGSHAAAAAMAGLAIAYDAGDAFGSLLCMCVF
FT                   MLAFSASWAGVFWVVLSELFSMRVKSAAVSAAAATLFATGAFTDFVFLSAARAMGGWAF
FT                   GAVACVCVCAGVYVQRNLPETAGKSLAEVQAVMAAGTGARGEGPGWLTRLRRGPAAGGR
FT                   YVEMS"
FT   gene            <543380..>544528
FT                   /locus_tag="MICPUN_56848"
FT   mRNA            <543380..>544528
FT                   /locus_tag="MICPUN_56848"
FT                   /product="hypothetical protein"
FT   CDS_pept        543380..544528
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56848"
FT                   /product="hypothetical protein"
FT                   /note="putative uncharacterized protein"
FT                   /db_xref="GOA:C1E1E9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1E9"
FT                   /protein_id="ACO61726.1"
FT                   /translation="MSGSPPLTPSRAEGDVKGLRRGMNALATMNGARAMAPSGAVARAR
FT                   APDTRATASRVYARRVGTSRGTLLAKVPSRLGRPHSWRPQLPPKRRRAITRAADDPERR
FT                   RPGFNKKRLASPKFSEEAQTWALLGGIATSLTAIVAVVVAANNEAAYFGSPDDFSYMGD
FT                   DFTGGPSLDVSPGNVAAAAIWSFGLFFKSPLQILLVFLGRTDTERPSDWLLRKSSGVTE
FT                   ETRTWEEASAPQKAALIAFFTVCGCGVVSGIDALFAGEETWALSAGLGFTMLAFVAELG
FT                   SPRRYSRAELDVLEAQYDDFVAFADEALERRGRCHGSEVERAFRRRFGKYTEAVLSDRD
FT                   LRTMILNWHPNAERTSSGYYKNLSVKEGVDRRNPVTVKDLGL"
FT   gene            <544717..>546186
FT                   /locus_tag="MICPUN_56849"
FT   mRNA            <544717..>546186
FT                   /locus_tag="MICPUN_56849"
FT                   /product="RNA binding protein"
FT   CDS_pept        544717..546186
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56849"
FT                   /product="RNA binding protein"
FT                   /note="[3x] PFAM 00076: RPM_1 RNA recognition motif.
FT                   (a.k.a. RRM, RBD, or RNP domain). The RRM motif is probably
FT                   diagnostic of an RNA binding protein; GO_function: GO:3676
FT                   - nucleic acid binding"
FT                   /db_xref="GOA:C1E1F0"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR006529"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F0"
FT                   /protein_id="ACO61727.1"
FT                   /translation="MPEERERSRDRRDRRRDDSRDRRRRRSYSRSRSRSATPPPRQRRR
FT                   PTGFSDAPPPGFSGADGAVGGAGVPPGMGIGGADIPPGMNVSVAGAPSGFSGPPPGYAN
FT                   AHPGNLGLNPVPNQQATRHARRVYVGNLPGTVTEPKVAAFFNNAMHAIGGTVAALPGDP
FT                   VLNVYINYEKKFAFVEFRTVEETSNCMALDGAVLEGIAMRVRRPNDYNVMAASSLGPSQ
FT                   PKDGLNLEAIGLNPAAAGGGGAGAANASLTEEDLQHRLFIGGLPYFLTETMVKELVEAF
FT                   GPTKQFQLVVDRETGNSKGYGFFVYQDHSVTDVACQGLHGMKMGEKSLTVQRAMQGGAG
FT                   APKPTAASVGPGHTALPGADEVAAHLAGASGAPAGLSVPPPPSEHPASRVVSLTEMLDV
FT                   EELRDDVEYGEIMEDMREECGKFGRIESIVIPRPGDADGAAVPGLGKVFVRYEDDAGAA
FT                   AARNALHGRKFGGNVVKADFIDETVFASRAF"
FT   gene            complement(<546291..>547241)
FT                   /locus_tag="MICPUN_56850"
FT   mRNA            complement(<546291..>547241)
FT                   /locus_tag="MICPUN_56850"
FT                   /product="predicted protein"
FT   CDS_pept        complement(546291..547241)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56850"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:3676; 3'-5' exonuclease activity - nucleic acid binding
FT                   [PMID 8408]; GO_process: GO:6139 - nucleobase, nucleoside,
FT                   nucleotide and nucleic acid metabolic process"
FT                   /db_xref="GOA:C1E1F1"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F1"
FT                   /protein_id="ACO62159.1"
FT                   /translation="MSGGFAVLLDDVEDLAQDLARFALADAPASCSDRDASGSDGDDDG
FT                   HPRPRGADIVRVAPSTVAPPERPLTSTPPRVILLDDPGSCADAMRELIARGEPCAVDFE
FT                   GVALSRTGAISLAQVAPPNGPVYLVDVACMGAAAFDEGRLGELLGATHPLKLVFDCRGD
FT                   ADALHHQFGVRMRGVFDVQVAFCLKKDVDHGGKRGAYLMGLRKALKECPGLDDEARHEL
FT                   DAVKSAGASLFAPELGGSYDAWTKRPMHPDLVKYAAADVTYLHHMHRTWRGFCGEKKMA
FT                   AVTERRMRERIESPEGLEQGTEAAKRRGSRREKFF"
FT   gene            <547768..>550143
FT                   /locus_tag="MICPUN_56851"
FT   mRNA            <547768..>550143
FT                   /locus_tag="MICPUN_56851"
FT                   /product="hypothetical protein"
FT   CDS_pept        547768..550143
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56851"
FT                   /product="hypothetical protein"
FT                   /note="expressed; putative uncharacterized protein"
FT                   /db_xref="InterPro:IPR011043"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F2"
FT                   /protein_id="ACO61728.1"
FT                   /translation="MPRKRPKKNADDDGGSDECPLLSLAHQVMTPIAAHLDGDDLSALA
FT                   RTCVAMRRLCDGPQGRIWWRDACVRLLGKTHCAVHLRAWGGPDGGYDDARLWRQLHRHA
FT                   SFPVSFSWHAGLGGSLWEGVQNKDEAARREALRRAEARLGPLEEYDEDVDWVEQDDDTS
FT                   YTGAAILPRSDRARADVAERGPLAVAPQLSPDLARSGHTSTLIDELGLMVVVGGMMLVS
FT                   MVAGDNEHPPAPPDFNGGDEGDVKVHAVRLPEMQVVAPDVMNWTSASEARDEEDPMSAK
FT                   EPCEVPASRFRHQTIDASLPLGSRLSWNAFGDDGRGWGADGTDYSKGATLLVHGGYDGI
FT                   SRCFEKVYLLRVARDGSRCLWGDPGAPTNLVNGERMPRVFHHTLTRLRNSPRAISIGGQ
FT                   TDEDQRTQDDLGHGAVHEMNLDTWTWTRRETNGWPARQVGEMDVTLTSRWLHIAALRPP
FT                   RERRVYRNWTQWNRNSYLYAPVPRDTRVRKHSYKEAMAVMSPYMTKLERAQGEQIVIVG
FT                   GYDDSPDSAIGTMEPWVLDVESWTWHRSYWGPDNYESHTPDGEFIQYIPDGRHRAGSCM
FT                   IGQNLLLVHGGMGKSLMFGGINMLDESDSCVLDLSTLTWIHPDQGLHPRDSGLMFDDAW
FT                   QSVRLRSVAGHTLEGMLAFGGCELGFMRQPTPIAKMDFLILGPTPGVGCSRSPRNKLLY
FT                   YAAAPIGKLQRDSWRSLFRTASERVSKYRVRGFHRIVIDGRERRVMLLEHRDGSKGGLV
FT                   SVRHIGNHGSFCDERWSFWYEDSDSDFHSSSASDEDSD"
FT   gene            complement(<550283..>551188)
FT                   /locus_tag="MICPUN_79714"
FT   mRNA            complement(<550283..>551188)
FT                   /locus_tag="MICPUN_79714"
FT                   /product="predicted protein"
FT   CDS_pept        complement(550283..551188)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79714"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1F3"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR020847"
FT                   /db_xref="InterPro:IPR020848"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F3"
FT                   /protein_id="ACO62160.1"
FT                   /translation="MRWDVTDPPLPPRAPRLDRALHPSKLTVLSWNVNSIRALLDKDPD
FT                   ILDEVAASEDADVVLLQETKLQEKHVPEMDARVLAKYPYRTWNCSTSRLGYSGTAMFLR
FT                   LEPTRAPWHDPFEMDEFEGEGRVVCAELPNVFVVGAYCPNSGEGLARLRARTKEWDPRM
FT                   SAYLSSLQASAGGKPVVYCGDLNVANEPIDLWGNHAANSLASGYTPEERDSFKRLLLGP
FT                   IRDGGAGLVDTFREAHGTDAKAFTYFSYRAGARPRNRGWRIDYALVSESLRGEVHDAFI
FT                   RGDVGGSDHCPIGVVVKLRE"
FT   gene            <552359..>553516
FT                   /locus_tag="MICPUN_97136"
FT   mRNA            join(<552359..553129,553181..>553516)
FT                   /locus_tag="MICPUN_97136"
FT                   /product="predicted protein"
FT   CDS_pept        join(552359..553129,553181..553516)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97136"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:8270 - zinc ion binding"
FT                   /db_xref="GOA:C1E1F4"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR013536"
FT                   /db_xref="InterPro:IPR036443"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F4"
FT                   /protein_id="ACO61729.1"
FT                   /translation="MGARLPEPTEGPGACKVWEIKTLGRADDERARDMLEKTAWQVQPI
FT                   MRKRGWKVQELCEMKPEQRDRMGDNLNMGQRVRLKLRKNNSGDWFDYDHVVLVMLHELC
FT                   HNDIGPHNAKFFKLLDEITVECEELMAKGIGGSGAGFDAKGQRLGHRGGWGGIETRDPR
FT                   KAAAEAAARRAGYQAAMGPAGGRKLGGGGTGAATQLGPREAAAAAAERRLRAERFAREN
FT                   GLMNDVVVIDDEDDDDGGDGDGAGEGGGMAKTAPARNEGAEVVVLSSPQEPGTRDAGKR
FT                   KRTSGRRADEDDEEEAEKEETDDDDDVVFVQAVPAPRPGVDRPERRWTCSQCTLVNPER
FT                   ATHCGACERWRFGRGAPAASRPTVGVDD"
FT   gene            complement(<553601..>554744)
FT                   /locus_tag="MICPUN_56854"
FT   mRNA            complement(join(<553601..554533,554616..>554744))
FT                   /locus_tag="MICPUN_56854"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(553601..554533,554616..554744))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56854"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1F5"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F5"
FT                   /protein_id="ACO62161.1"
FT                   /translation="MRAAPARVGPPVRVARGPRRAAGRRSIRGVRVECRNRILFRREVD
FT                   ESDDGAESITLALGDSRSEHVRGVLKLAAGDSLRVGVVNGSPATAVVSTMDATSMTLTW
FT                   RPGVETDDGDTARRSLTAPLVDVDLLLAMPRPKVMTRLWAPLASIGVRNVYLTNASRVE
FT                   RYYWDSTALDEAKVIAELTRGMEQSGDVRMPGVCVVRRFPAAVDAVREMTGAPRRDGGQ
FT                   EPRGRGGREGGGNGGGMPREGSAFWLVKPPPADENDDDAEVVMLTAHPGAAATVGDAFG
FT                   DLSSSSSSSSSGRPRRTRAVVAVGPEGGWTDFERRSLLDAGFVEVALGRRTFATDVACV
FT                   ALVAAVRERTSSW"
FT   gene            <554850..>557468
FT                   /locus_tag="MICPUN_99408"
FT   mRNA            <554850..>557468
FT                   /locus_tag="MICPUN_99408"
FT                   /product="predicted protein"
FT   CDS_pept        554850..557468
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99408"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR021622"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F6"
FT                   /protein_id="ACO61730.1"
FT                   /translation="MEPRGEAIGGTPPQRSERRFGVLGPQRIDRDGVGFASHENLAEVV
FT                   PYLNRSLNDLGYPGPLELEAPSVGDLARVANVLFLILRDRQQDAASREQWGRERRRLAA
FT                   DKARAETFYERARAELAAKDEELANSLAKSDGRVDKERRRLDDATAECASLKQRLLKSQ
FT                   QRCATLENESRRREKEREKLSARLEKFVNDRRRDVANATPVGVMRVTTGGPDDVGPAVE
FT                   QKVSFGGLNAANATSRVPNVHATGRHKTVAAAAATSKAAALDAAARVAASLASPFVSQE
FT                   LHHQMMGAYEAKMRSLMHDVNDLRELLAANGVDPETGERIGDPERRQTAGGYLPSPAEA
FT                   RGDLGGAGPDAMASGAMALGDVEDETAAAARDAALIAAATEAEIGVGDDAFTFNLGALR
FT                   RRLGDDGSARSPPRGFGATTTTTTTRASTERLPTAPPAALASGRAAPNETQPAGALASG
FT                   GSAGSVPSAGAPSPIEVALAWHEREHARLRGVLSHPPRELRDAPTPELAFEVEKTILSP
FT                   AKSAASGGGGGVAAAREDLRGAVAAARAAAAKASPARQQLHWNEPPSPARAPAPIYESS
FT                   PSVSSAEEDDDAPTPRTTPPTPAFGAAASRAYDNPMADDAADLDGEELAREAAAAAAER
FT                   EAEAAAAVFAERVDRAFNSVQHEASRGSIDDAGEDLVELDVGLMADDDDDVYVADDDSH
FT                   VQRVQREAAGTPTGRVTVEPRSDTIAAFVDGSRRLPEFEGVGERDRGGAFGSPADVPAD
FT                   RTTGRPEAGVSAGAGAGADFGARMAQLSTPRAQPPAPAAVAPPSPAPPASPLDELLARH
FT                   LKLGRGRPTAGGGEGDAKEDWRERYRRRRANPFASFAANDAKLAVDASQQTPGFAMLHS
FT                   G"
FT   gene            <557675..>558502
FT                   /locus_tag="MICPUN_56856"
FT   mRNA            <557675..>558502
FT                   /locus_tag="MICPUN_56856"
FT                   /product="predicted protein"
FT   CDS_pept        557675..558502
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56856"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1F7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F7"
FT                   /protein_id="ACO61731.1"
FT                   /translation="MAAIYASRVMPRSGAAAARSPRRSRLSPGPRLIASPRRQISSRSG
FT                   GSDSSGGVGESARDAALRMEQEALDARTAIRLASLRAQKDEERAIQQRAVELQKEMAIR
FT                   EEGRRRAEETGGRRPTQRKAVPIFIAGVQCTAMSLASLTLTNRAAAFLVDGDVPVANRT
FT                   LLVNLSVGGGVAVTATLIISTLILFTVAIKEGLGVINNTPVTFYRCDGQGPTCCKNGPH
FT                   NLGYAAKFTYLANGRGFETRQRDSMRRHLLVSRKCRELKPIVIYPKEEGWKLW"
FT   gene            complement(558564..559600)
FT                   /locus_tag="MICPUN_107900"
FT   mRNA            complement(join(558564..558991,559115..559600))
FT                   /locus_tag="MICPUN_107900"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(558650..558991,559115..559588))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107900"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:6511 - ubiquitin-dependent protein
FT                   catabolic process"
FT                   /db_xref="GOA:C1E1F8"
FT                   /db_xref="InterPro:IPR001012"
FT                   /db_xref="InterPro:IPR004854"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR033043"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F8"
FT                   /protein_id="ACO62162.1"
FT                   /translation="MRRLGASSAYTAVPTDLHSEGAEGAEGAEESPAESPAESPADDAP
FT                   TDVSLDVKLSFRRLPKGTWVKLQPRSADFQGELATDNSVDLRELLEATLHRRCALTVGD
FT                   DVSVRAHGDREYALRVVEVLPDDADGAVSLVETDVEVDIAPSEDYEDAMRRLAEAAAAA
FT                   RAERYRAAVSERLPVEPDADAAGGCVPCRFQLPDGRTVTRRFAPTDPLAAVFDYVISAG
FT                   GAGEGEAFRLVTRWPRTVTELDDGARTVRAAGLKPADTLFVEKLEKTAA"
FT   gene            <560601..>560996
FT                   /locus_tag="MICPUN_72902"
FT   mRNA            <560601..>560996
FT                   /locus_tag="MICPUN_72902"
FT                   /product="mitochondrial protein translocase family"
FT   CDS_pept        <560601..>560996
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_72902"
FT                   /product="mitochondrial protein translocase family"
FT                   /note="inner membrane translocase (import) Tim21"
FT                   /db_xref="GOA:C1E1F9"
FT                   /db_xref="InterPro:IPR013261"
FT                   /db_xref="InterPro:IPR038552"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1F9"
FT                   /protein_id="ACO61732.1"
FT                   /translation="IPEKPVSAVEAGGYGIVIAAALAVALGAIWFSFKELIFEPKEQTV
FT                   FNRALDKIAVDPRVTVRVGTPMTGYGREGRSRSARQHVPHVVHVDGAGREHVRIQGAVR
FT                   GPQGKATVHADAYKGDSGEWEFAYLLVD"
FT   gene            <561239..>562222
FT                   /locus_tag="MICPUN_56859"
FT   mRNA            <561239..>562222
FT                   /locus_tag="MICPUN_56859"
FT                   /product="predicted protein"
FT   CDS_pept        561239..562222
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56859"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3723; pseudouridine synthase
FT                   activity - RNA binding [PMID 9982]; GO_process: GO:1522 -
FT                   pseudouridine synthesis"
FT                   /db_xref="GOA:C1E1G0"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G0"
FT                   /protein_id="ACO61733.1"
FT                   /translation="MLVARRWWSRIDVCAHAPRAASAVSWVLHRDADVLVVDKPAGVPM
FT                   RSVHGVKGVDAFLADLRFDLAHPPMTVHRLDRDTTGCLILARTREAQRTLAGYFQDRAR
FT                   VARRGSGRSTKTTSPESLGDVRRVYWALVSATSTLASRGTIDAALVTTHAGVTLKPGAG
FT                   AKPAATDYEVISRASPDSCAPTAAGRVPAVLALVPRTGRKHQLRVHCAGALDAAIVGDY
FT                   KYGYRDVSRTGGVADDWRRVLRDIDERSTRRLNDAGTADGEVRGAGVPLHLHARCVEFT
FT                   HPSSGERVRVVAPAPSHMSLACEALGLALDGGDDDGLGLLLHFNRR"
FT   gene            <562307..>564067
FT                   /locus_tag="MICPUN_56860"
FT   mRNA            <562307..>564067
FT                   /locus_tag="MICPUN_56860"
FT                   /product="predicted protein"
FT   CDS_pept        562307..564067
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56860"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1G1"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G1"
FT                   /protein_id="ACO61734.1"
FT                   /translation="MTAGEERPVVVKTRWVSAEEDEPSAPPRGNATAEERPSGGCFEAE
FT                   VSLPGVTSAESIVAEIVTAAEAGAPPSLYVRAKADGGGGASLSADVPLPDGCDHREISA
FT                   VKWSRKRSTLRVRFAASSPAAAGGAEDDGDDEDGAGPLAEYLRMLGVRDGEAGGSEPEL
FT                   EEDGDPRDGVRDPAGEKRENPSRADGKTPQPTEPTKQTPPGRAVRASGNKKKRRKNAAG
FT                   RGVAATPGRQLETPGRQLETTRPGVSLSELSDDLAAQLHARGFAHAQFITRDAVCVVRD
FT                   EIKRVAPLYTDGEIWLGKHDAGAQIAVKSVRGDRVFWMDPATADGGRFDAMRSMLRAID
FT                   ELVLDHLARACPKRLGGLADRTHAMLAEYPGRGSRFVRHVDNTGRDGRRLTVLCYLNPD
FT                   YAGEHGGALKVYDADDADGSRGVEVAPAAGTIAMFYADETPHEVLPSARSRHSFTVWYY
FT                   DETEFKDAETRRGEAAAADSRAAHMPSVDGSGGSDPGATLAALDASDREAQAFVRRMMT
FT                   QRLTPAGAAAAARGLGERALRTVATVFGAPDPASFVVALTQMSQSDLDELRMEITSMGM
FT                   DNAPDAELVA"
FT   gene            564252..565340
FT                   /gene="GPX3"
FT                   /locus_tag="MICPUN_112671"
FT   mRNA            join(564252..564705,564745..565340)
FT                   /gene="GPX3"
FT                   /locus_tag="MICPUN_112671"
FT                   /product="glutathione peroxidase"
FT   CDS_pept        join(564397..564705,564745..565116)
FT                   /codon_start=1
FT                   /gene="GPX3"
FT                   /locus_tag="MICPUN_112671"
FT                   /product="glutathione peroxidase"
FT                   /note="Glutathione peroxidase. Shows DB homology to both
FT                   GPX and PHGPX, but more plant hits to GPX"
FT                   /db_xref="GOA:C1E1G2"
FT                   /db_xref="InterPro:IPR000889"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G2"
FT                   /protein_id="ACO61735.1"
FT                   /translation="MLSTSPDTTPPQARLGAGASYRRAGEFALRERKLEAAVSLDVPGE
FT                   RQPALRLSDVDTEAPADLGSGDSDAPGAPGVYALTADDIDGRPVHLSVLSGKPTLMING
FT                   LEELGEAYGDRLQIMAFPCNQFGGQEPGDAAQIKQFAKDHGFPSDGYLMAKVNVNGPKA
FT                   SEVWKYLKAHARPKPVKSVMWNYEKFLVDAAGEPVKHYGSGFDSSAISADIQALLGETP
FT                   GELH"
FT   gene            complement(<565542..>565943)
FT                   /locus_tag="MICPUN_99413"
FT   mRNA            complement(<565542..>565943)
FT                   /locus_tag="MICPUN_99413"
FT                   /product="predicted protein"
FT   CDS_pept        complement(565542..565943)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99413"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:7155 - cell adhesion"
FT                   /db_xref="GOA:C1E1G3"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR033558"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G3"
FT                   /protein_id="ACO62163.1"
FT                   /translation="MTDMASPGAGASVVMATCSDERHPPHNALDEDERSFWVTTGLFPQ
FT                   EIVVKLGKTSQVTKVRTLTANVRKFSLEYCDDDEPIGFKPAFEVELGDKGPARLQTEVH
FT                   QVNCRAKFLKFVIGSGWGDFASVHRISVF"
FT   gene            <566677..>567828
FT                   /locus_tag="MICPUN_79944"
FT   mRNA            <566677..>567828
FT                   /locus_tag="MICPUN_79944"
FT                   /product="predicted protein"
FT   CDS_pept        566677..567828
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79944"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G4"
FT                   /protein_id="ACO61736.1"
FT                   /translation="MENNGRVVELELKEFGLTGAVPAELGRLSALMDLNLGGNQLTLLP
FT                   AEIGQLASLESLELGYNELTSVPVEIWQLASLEGLYLGGNQLTSVPAEIGQLTSLEDLS
FT                   LEANRLTSVPTEIGQLTSLTQLDLRDNQLTSVPAEIWRLTSLTYLNLNDNQLTSVPAEI
FT                   RQLTSLRELWLSANHLTSVPAEIWQLAALVKLSVTENQLTSVPAEIWQLTSLTELYLHG
FT                   NQLTSVPAEIGQLTSLTALSLYDNQLTSVPAEIGQIRSLVKLSLHGNRLTSLPAEIGQL
FT                   RALVEFELDRNLLTSVPAEIGHLTSLTELSLHGNQLTSVPSEIGQLTSLGELSLSGNQL
FT                   TSVPAAMRELEAAGCYMDLDLDSDPEPEPEEEEGEPLDFDLFD"
FT   gene            567859..568466
FT                   /locus_tag="MICPUN_52198"
FT   mRNA            567859..568466
FT                   /locus_tag="MICPUN_52198"
FT                   /product="predicted protein"
FT   CDS_pept        567862..568251
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52198"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G5"
FT                   /protein_id="ACO61737.1"
FT                   /translation="MNGRFALIRFKHPSTSREYRRTESRGGATRKNRKKRKVHPDSRAA
FT                   AARVEVADAVSTRSSPASASVHPARLLLFITRGSPRPRPPRARAPRGTPAPRTAPCPSP
FT                   VRWRWSRPSTGVSAARTRRRRCTCP"
FT   gene            complement(<569675..>570538)
FT                   /locus_tag="MICPUN_71782"
FT   mRNA            complement(join(<569675..570145,570206..>570538))
FT                   /locus_tag="MICPUN_71782"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<569675..570145,570206..>570538))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71782"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding; GO_process:
FT                   GO:16070 - RNA metabolic process"
FT                   /db_xref="GOA:C1E1G6"
FT                   /db_xref="InterPro:IPR003890"
FT                   /db_xref="InterPro:IPR016021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G6"
FT                   /protein_id="ACO62164.1"
FT                   /translation="RAFKSILNKLTPQNFEKLLEQVLAEGIDEAQTLIGLIGQLFDKAL
FT                   TEPTFAELYAMMCQQLSNRFLAENIEFVDPDCDPDAEGGPRMINFKRVLLNKCQEEFEK
FT                   GDSAIKAEEKEEGEVPAKPKTPEELELDERRKIQQREDRMRQARRRMLGNIRFIGELFK
FT                   KEMLTARIMHTCIMKLLNEKKNPDEEDVEALCKLMATIGRLIDRPDAKSHMDAYFKRIQ
FT                   GLSVNKSISSRHRFMCQDIMEMRSKGWRERRKQEGPKKIEDVHKDA"
FT   gene            <573237..>576526
FT                   /locus_tag="MICPUN_79594"
FT   mRNA            join(<573237..574382,574702..575210,575665..>576526)
FT                   /locus_tag="MICPUN_79594"
FT                   /product="predicted protein"
FT   CDS_pept        join(573237..574382,574702..575210,575665..576526)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79594"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3723; 3'-5'-exoribonuclease activity
FT                   - RNA binding [PMID 175]; GO_process: GO:6396 - RNA
FT                   processing"
FT                   /db_xref="GOA:C1E1G7"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G7"
FT                   /protein_id="ACO61738.1"
FT                   /translation="MRARAPRIGAARSAGVQPCPRVVAPNGRRRPVRCAAAGAPDDPYA
FT                   ALDRTPKTLTLRIGESEVTVETGRIGRQANGAVMVTEGETVIYATICAGRDVTADGGFV
FT                   PLTVNYQERYSAVGRTAGGYRKRDGGVRENETLIGRLVDRPLRPMIPKGWAYDTQILEW
FT                   VLSYDGARSTDALAITAASCAAAISDVPLKKPIAGVRVGLLPGETEPLINPTCEQMERS
FT                   RLDLVLAGTEDAVMMIEGFGDFLTTQEMLYAIEKGHEAVANACRDIDAWAKDVGRVKNE
FT                   AAVLVAPEGVDDAVRALVGAELAEAMAISVKQTRGAAVEGIRARAIESLAGGDDAKFTV
FT                   SAVRRPAQSLRFAFCALLLFSLFPPGPRAFSRPFVRLPPPALENDVRLACGRCESNALR
FT                   SMIRANGVRQDGRDTKTVRPITCSGGLLPRTHGSSLFTRGETQAIAAATLGGATDAQKV
FT                   DGLGNDKDRRFYLHYFFPPSSVGETGRVGAASRREVGHGNLAERALMPVIPPYDDFPFT
FT                   VRLESTITESNGSSSMATVCAGSLALQDAGVPITRKVAGIAMGLILGDESAGEAPVILT
FT                   DILGSEDALGDMDFKVAGDGDGISAFQMDIKVEGITLAVLREALESARVGLVHILGEMD
FT                   KADPAPAGRMSAYAPQVEVVEVPTKYIGKVIGKGGEQIKAICEQTKIDTIDINEEGVVT
FT                   LTGSFGCDMPKAVEIIRSLTVEPEVGKTYRNARVTKVLDFGAFVEILPGVEGLCHVSEL
FT                   DVTRVANVRDVVEEGQTIDVKLLETNERGQFKLSRRAVLLDEGGEKVRRELAEAKVAAG
FT                   GDDADDAPGRGRPPPKARRGRSRLRE"
FT   gene            complement(<576679..>580467)
FT                   /locus_tag="MICPUN_56867"
FT   mRNA            complement(<576679..>580467)
FT                   /locus_tag="MICPUN_56867"
FT                   /product="predicted protein"
FT   CDS_pept        complement(576679..580467)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56867"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="GOA:C1E1G8"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR004274"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR039189"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G8"
FT                   /protein_id="ACO62165.1"
FT                   /translation="MAGSFEATLSVSDRPELTSLAVTAVPIDPPAVERAAAGDGTTDRR
FT                   DPEHGVGGKGKNNGNEEDASTGARPEKQRKSSEREESVSDDEDQPDDDGLHAAAKKGMN
FT                   VVGWWRAKLNANHGLDKEILAALHLLAGARGPCMRLAFSHPVLSQPGDSDARRRNKEGL
FT                   TKLHREMRAEQKSAVMFLDDPATGRRREVHLAAVWVHPADTAGDTAGDAVGSNGADEAA
FT                   LTTNDEAAPTTNDDGDKADAREPQFLAFEVQPNAPAVALEPLLHKQLMVVFDLDETLLQ
FT                   AFTLRAMERRARELDAEDAGADGGADGGADGGADDAATSGWGGGGRGDPGKNTAGVPGA
FT                   VGGDARAATRDAKELAARRDEDRRRLRRDAELLTQFRDGDCVKMPVPGSATGTTQTVRA
FT                   KMEPVLVLDEERYGPSPVTVARPVIRVKSPHVRGGEMVFTRIDPKNVDTSMIVHVRPGW
FT                   NDLYAYLTGEASQAQAPNAVRGVNKENPAHRPRRPKCKAFVCTMSERQYAHEMWRLLDP
FT                   RGALLPLNDVHALHKRIVCVEHGRGEKKSLAHATRGATHVPELSVIVDDRTNVWERRAQ
FT                   KNILAIAPFMPYNTDTGPGLQSEVAGKGGVMGMVQSMLNEVRFKFSQQWTRWAQRCDRG
FT                   DPLRPGGERPDAGEILAPLMASWAEDNTATIVRQGGAARAAAGAGSSLNAVLKSLGRSK
FT                   SNAEEAQRRRDAEAKAKAEEEERAKAEEERAREEERVREEEKQRRWLEEAQAKLKEEER
FT                   ARAEEQRRLLQETEAKVEEQRRLLQETEAKFKEQTRLLKEAEAKVNRARMDDALAAITY
FT                   ESLAATPLEAKGKRPVKAKTEVKTATAGDVDGLGTDSDDSDDAPIAAMAAEPKRPTAED
FT                   EKRRSDEEAKRKKQVRNCQQCSQWGIRAVDHFKSCKMCPFHKDYVHPKHDDDARRRLFE
FT                   RLVELRWSSSAEKAIEGATRLVEKFQPTAIKDGNIEVGELEDAVATRLLRFVLTRQGNP
FT                   AAAPPAAAAPPAAAATLAAAAPAEESEGKSVKKPEPKKRKSGEISKQPKGGGKEAPLLG
FT                   VADGYVKKHKSLKEIIEMKEKSEVVEIEEEQEEEEEEEEIDHGPCVLCGIKDQNEMLCD
FT                   GCDRPFHNSCVNISDEELEIMIEAEEDWFCEDCVKSGKNAGANDEMREHKLKKMDKADS
FT                   DFNLDARDEVEFIKGTRGNPGAASRVRQEKKKASGQAPGPAPAEGAREVHPKDEETGET
FT                   EELAPKPSPSKSVASKYKPGTQREAMMKKLKKIGKRR"
FT   gene            <580947..>582185
FT                   /locus_tag="MICPUN_99418"
FT   mRNA            <580947..>582185
FT                   /locus_tag="MICPUN_99418"
FT                   /product="predicted protein"
FT   CDS_pept        580947..582185
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99418"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1G9"
FT                   /protein_id="ACO61739.1"
FT                   /translation="MSIASGVASVPVGVPHATPRRGGPRNATAKPHIPRRPRLDAPSAW
FT                   AETSPSAPSSASSATASDARDDLPVRVYIEHTDAYQVVYHSNYFKFLWRAREAYVFGGG
FT                   LASALRHRTGAPFDPTAAGWDHLDVVAIDDCVFARSAVLGDDLLVRTSLRGIGETTLAM
FT                   RQEVVFADGGELAFAATAVVAPASATGATTIPREIRGWRAGDEDGIDGVDVGTGYEDPA
FT                   WLARASASASVEDAGDCSEDDEEANEDPEARVSSIATKTRVTLFESELSLGRARGASDA
FT                   DVLRWFERDRTEAIGGSSALSALKENDGVAVVVSSMDGFRCRPGNVVGSAGIGAGGASG
FT                   GRNVRPAVASARSTIEMRRRNIQVAFIQRLFDEAGACVARAEVVCTCVTRDGGKPTRCP
FT                   AALAEKFEAMRRG"
FT   gene            <583818..>585401
FT                   /locus_tag="MICPUN_79438"
FT   mRNA            <583818..>585401
FT                   /locus_tag="MICPUN_79438"
FT                   /product="predicted protein"
FT   CDS_pept        583818..585401
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79438"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:5975 - carbohydrate metabolic
FT                   process"
FT                   /db_xref="GOA:C1E1H0"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005999"
FT                   /db_xref="InterPro:IPR018483"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H0"
FT                   /protein_id="ACO61740.1"
FT                   /translation="MAPKLVGAIDQGTTSTRFILYRVVGDGVLQPLASHQMEHKQIYPK
FT                   PGWCEHDPEEIYANTLTCIASALEAVPGGATASDVACVGITNQRETTVAWSKRTGKPLH
FT                   NAVVWLDMRTSDLCESLTSEVMGGDKDAFREVCGLPISTYFSGVKMRWLLDNCDAVKAA
FT                   AAENDLAFGTIDSWLLHRLTGSAGTHVTDATNASRTMLMDLRTQTWHEPTAVKLGVPMH
FT                   SLPRIVSCAEEYGVITEGALKGVKLTGCLGDQHAATLGQRCDAGRAKNTYGTGCFMLLN
FT                   TGGNVVESKHGLLTTMAWRLGKDATPAYALEGSVAIAGAGVQWLRDNLGLIRSAADVEP
FT                   LAASVPDAGGVYFVPAFSGLFAPRWRPDARGVCVGLTQFTTKAHLARALLEAICFQTVD
FT                   VLEAMRKDASDLDMTALHVDGGATANGLMMQTQADLLGLRVFRPANVETTAMGAALAAG
FT                   VGAGLFSERAVFEDTPADESIADAEWLRDEMANRAYFEPAIGEDERARRYAGWCDAVER
FT                   SLNLAPQQGK"
FT   gene            complement(585415..587091)
FT                   /locus_tag="MICPUN_107903"
FT   mRNA            complement(585415..587091)
FT                   /locus_tag="MICPUN_107903"
FT                   /product="predicted protein"
FT   CDS_pept        complement(585505..587073)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107903"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4222 - metalloendopeptidase
FT                   activity; GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1E1H1"
FT                   /db_xref="InterPro:IPR001590"
FT                   /db_xref="InterPro:IPR001762"
FT                   /db_xref="InterPro:IPR036436"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H1"
FT                   /protein_id="ACO62166.1"
FT                   /translation="MKTLHEETLHVVNLVNLLFRKDIKTPVTIVVKRLYDAKDPWKDEV
FT                   PIQADGEAVSLKLLDAFTNWRTKLYDDLPSHDSAHLFSGHDFDGETVGLANQIGDTGVS
FT                   ICSDYYCGWDVGGQKLKPGFCFCEQLNGVCQDKLNCCSMASTGISMVRKEKLASDATTV
FT                   AHEIGHKLGFPHDGVKEGGVDTTRCDKTGYIMAASSSSTDEFDSWSQCSVDKFAAALEG
FT                   DEYFCLAKGDHAVCGNMVVEDGEECDCGGSDCTAGMHPDPCCDGKTCKLVAGAKCSAGL
FT                   GDRGCCDPSTCSTRAAGHTCRPVDGLCDIEEKCDGVESTCPMDLHKEIGRGCEDSNGDV
FT                   GACLGKHCANRNHVCTSITQVRSDGLLYGGKSASQAAGKSYGGKKLWLFDSTSCDNGFV
FT                   CFDDANSVSQSTYWTLSNYGALPGFPCGSSTTVTRTTNGTNETYEIFENVCDGGPTLNG
FT                   QSSKCVTRPKMIPPPPAPFPPPSPPKAPWPPPAPPLPPYAGSPGVSTFRSTLFGVIAAL
FT                   ALLAH"
FT   gene            <588253..>589380
FT                   /locus_tag="MICPUN_56871"
FT   mRNA            <588253..>589380
FT                   /locus_tag="MICPUN_56871"
FT                   /product="predicted protein"
FT   CDS_pept        588253..589380
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56871"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H2"
FT                   /protein_id="ACO61741.1"
FT                   /translation="MLAWIGARKNRAHRGGASTLAARYDLAVRASTSARGAKHERDEDQ
FT                   LACEDEELRPSVRRKASAALASSKPAATSLDVLDLHVLCHLMECERESSREKDKDDEAR
FT                   AALKPAEASRRASRSPCVKRAREESGDGDDDMELALEGLALSPSPPSPFGPTQGRPHTA
FT                   SSPCSPPEQLRTPGAFTLPSPPRKKIKPGLAPSLAPFASSPGRSWTTLGLDAGLGSILG
FT                   ARRTRPKACRSLDFSLPTLSESAGAERGTQLSSQDEGSFDEKDAIDVVMSHKYGRPEDV
FT                   MDADETDDAAADDDEEADATDAMEEDAENRRLRAVSLVDVDTRGGGVRQSARVDRGALM
FT                   EVMSAVGGGRTNASIGAVPWRVMKLMQIEEEIFII"
FT   gene            complement(<589574..>590731)
FT                   /locus_tag="MICPUN_56872"
FT   mRNA            complement(<589574..>590731)
FT                   /locus_tag="MICPUN_56872"
FT                   /product="predicted protein"
FT   CDS_pept        complement(589574..590731)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56872"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="GOA:C1E1H3"
FT                   /db_xref="InterPro:IPR011016"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H3"
FT                   /protein_id="ACO62167.1"
FT                   /translation="MAEREPPSSPPGYVPGDSDSESPDIATRRRDPPPGPVVESVSPGE
FT                   RARGRGDSGEEGRDLDDYDNSGGGSGDPATPGTISFRSGLELIHNVKEGSECRICLMDH
FT                   TPFCKPCRCQGTMGHVHPECLARWCRETGVTKCELCHSTFPQYFIDAGKRTRRVREREQ
FT                   ADAQEASERLAAQTANFQVAYGRPPTTAMDYAVINLNSMLEAEAAMRQRQRENNGVEDR
FT                   QFNESMRVVVIDSSGRPQAVSMGELRGASGGGGGLGLQPVGDQNYDLDRAIVNHQLSFW
FT                   ARIVVSTLCVFLVLYIIVAIVAASSDAGRDSYPVFIFRLLGFMLPLLLIARAVYVFRRR
FT                   REQAMINTVNDMFIRHHAQTAEVRPAAGGGNGAREQRGTRRLLDV"
FT   gene            <591004..>594900
FT                   /locus_tag="MICPUN_99422"
FT   mRNA            join(<591004..591053,591270..591425,591582..>594900)
FT                   /locus_tag="MICPUN_99422"
FT                   /product="predicted protein"
FT   CDS_pept        join(591004..591053,591270..591425,591582..594900)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99422"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1H4"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H4"
FT                   /protein_id="ACO61742.1"
FT                   /translation="MPLVRSNDAPDSADPVRSGAIFGLVPSTGAPPHDAHPGSPGGGFG
FT                   GSPYGGGGSYGGDTRETQQYTDYQNMGNGWVQRTRRSTVERVIERVHTDVDEMVPMRGG
FT                   AGGAHLHGGGGGGLVPHGGPGSNGWLNGELARQVHSKFEDMVRQSPAPTRAERSAYDEL
FT                   VRSFPPPESRGRLALGDGSGIEREPQPGIVSPTGGYAAPWMNGGGGGGGAGGDGRYPSR
FT                   LGHNTAGDGDNTAGGVDANGSPAERSIFSDLKSPPPSMRRASGGGGSGSGFTLDDLILR
FT                   KKGPDAAAARGAIFSPPPSPPGGRGRGRGRRGRKPGAGAGAKKPSPPPEPSESSSESED
FT                   ADEDADDDYVSPAGVEGGRDASSPLEKLARAAEKRGATRAGASPRVTVGKSPAKSPASL
FT                   TARAARRSYRIGDSDSDDDGNKIAAVRAGRTKPSTGVGGNKRGSREARQLLIAAQRMAR
FT                   VTGGGGAGASGVVATATTPAAASPSALRGAGTPASVGGRSGGRSTRERRAPSAFWLNED
FT                   AKRKDPFATTATPAATSAAAESKKTAARAKPGPKAKKPAAKRGRPKSKAKPAAKRRRDD
FT                   DDDDDDDDGESSSSESESESESEESEEEETLEARAARTSAVKKSVAKKSAVKSPAKRPR
FT                   GRSPTKGPTRARPAKKPSKSLAVYSESEDATDEDEDEEDEEDEDEEDEDDDVPPPKGDD
FT                   DTEESDGDDTEESDEDSEDDTPLASRYKGKPSKAAASPKGKKPPPAAKPKPKPSPKPAK
FT                   PSPGKGNRRHSAEHAAALVSAEIMGRKTSMARRFGLNVARVVDSEAESSDDDEEEGEDD
FT                   DDAGPPGSTPTDRSSDRTEASSPATATTDADGGAADTTDADDTPATKGSAGGQPPRSIE
FT                   KGKRGGWRPGAGRPRKVYDPNDPTPRKRRRLPGEPPRKRGRPRKHPTAEDIEAGHIRRK
FT                   PASAEEKAAALRRLAGGIGGIFGQDVAAPKPRGRPRKDGSSKSAPPKPSGADNKPARET
FT                   PAPAVRANAISTERWAARVKKAFAGGNAEASHPDSPPRRREVSFPENEGEGAAGAEPRD
FT                   GAASAPRSAPPAPPPSGRYGSDRENEQVSAAKSSRRKSILRTLGKSLGEENERDARRNA
FT                   LDRRYSDVPEFEVFGFQGTPEKGGAASPDFGGSPGLFTAKSPGGLISQLDTDTPVTSPV
FT                   RSSPRLRG"
FT   gene            complement(<595008..>596393)
FT                   /locus_tag="MICPUN_56875"
FT   mRNA            complement(<595008..>596393)
FT                   /locus_tag="MICPUN_56875"
FT                   /product="predicted protein"
FT   CDS_pept        complement(595008..596393)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56875"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H5"
FT                   /protein_id="ACO62168.1"
FT                   /translation="MARRADVLLASVLGVAVTLTLASLVVDATDARAREPRDPAEKPGA
FT                   SPCWARSPTNASRLVPKEGGCDGFDADEVGGVDRARKLDECACVYAQAVCDVQPGLVCS
FT                   VPDGRYVCRDEATGAVGGTAGQELRVPCLQSLCTSVTCPLDPRTLPLGDDGASAAKVCD
FT                   VCEMYGYAAGTGELRAQEGSRCGGEVRAQGLRFGPKAALLAYSAFMFVDFTMAAAAAGK
FT                   PLPQDLPTTSQYPEYHHGQPSAPVLLPEILEQDTGGDWQTTTTAYEYPPTTTTYEYPPT
FT                   PPTPPSPSQHPSRPPPLPSLCDVDDLMDVLPSALPSLVPCLSGSTSTCCQNVANIVGES
FT                   TDADMTDCLCNRDAFDALAGLLMDNVGLDLASRLGECVAKGYRINFPADEGGGGGCDRY
FT                   EKRETRAYVRPRTERKGVEESGDPDAVARDRPRASVTAQSRARNAAGPRAGSDEAPARG
FT                   DDR"
FT   gene            <596525..>598483
FT                   /locus_tag="MICPUN_99424"
FT   mRNA            join(<596525..596819,596940..>598483)
FT                   /locus_tag="MICPUN_99424"
FT                   /product="JmjN/JmjC protein"
FT   CDS_pept        join(596525..596819,596940..598483)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99424"
FT                   /product="JmjN/JmjC protein"
FT                   /note="Predicted member of the JmjN_JmjC protein family.
FT                   ChromDB ID: JMJ20104"
FT                   /db_xref="GOA:C1E1H6"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR003349"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H6"
FT                   /protein_id="ACO61743.1"
FT                   /translation="MVAADGGAIASEPPTGRRAKRTIRAPTKFVDEDGFNDADLQRALK
FT                   ASMKHVRRVSSTTVPECPVFRPTAEQFADPFAYIKSITPEAMPYGIAKIIPPEGWKPPF
FT                   NEEAGGDGIPFDTKLQTVNRLQEGLHFEDGERYTRDSYRDMADAFKRKYLETHRRVADE
FT                   TERLRRENRGWSDDACEARALEEEFWRIVETDVEKIRVEYGSDLDADVYGSGFAKVPLG
FT                   SASAAAGATPDSDSDEDGGVPHAWDFGELIRHPSNLLRVVGGDIPGLTRPWLYFGMMFS
FT                   AFCWHVEDHYLGSVNYMHAGAPKTWYGAPTHAADAFERAVRDIVPGIFKDAPDLLHRLV
FT                   TLVPPAVLGEGHGVPVCQTLQRAGEFVVTWPRAYHAGFSHGWNVGEAVNFGTADWVPMG
FT                   RAAVNDYQHGVGKRDSIFSHEKMILDTAKAFVRRYGYGDGSSREDQSLRAPWIARMADA
FT                   LRAELQIIEKEQRAGRAVVTSKGVKEVAGKENEASKHEDEDENCALCKAMPHLAVVHCA
FT                   RCFEIAEKIEFEQAVARARAEGRSAAGAAWALQGGSSSERLRRMGRYHRRRRRNRPVFC
FT                   LGHALDGNCGHGVTELVMTTNASMDELERVLGALQK"
FT   gene            complement(<598588..>600120)
FT                   /locus_tag="MICPUN_56877"
FT   mRNA            complement(<598588..>600120)
FT                   /locus_tag="MICPUN_56877"
FT                   /product="predicted protein"
FT   CDS_pept        complement(598588..600120)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56877"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H7"
FT                   /protein_id="ACO62169.1"
FT                   /translation="MAPDVSARIRAGHDASPRTPDAIKRPDGPAESSLAGPLRRAVLDD
FT                   RAAEVRALMKFRSVSENRAPDGDCTAADALLLAIERGSFASTVELVKMRATPLDAACLL
FT                   AAAASPNPECAAFVIDGCTAAGVSPDSRDHSGRTPLEIATRHRADLTAPHERSPTSHFS
FT                   PAHRHGDDGGAGAVASSLLRCGAGANVEFSDGATPLIAAARAGRHTVAAALLAHGADPL
FT                   AVDRSRSMDAVAGGTALHAAAMSGHAECVRVIVDVLRAIMEDDEASAGAFKGANGGDGH
FT                   MNCLNPFAAFSRIFSSLGPAPPSPGLKGTDWSELTGEDDEKNGGAGSSVAAPSSPVMGS
FT                   DDDDDEKDEKDGERKPSLLDAGDSIGRSALLLAIAGGNIAAASVLCDAGADRRQRVGDR
FT                   TLLHVAVERDEPEICEILLRRRDSLTPRALYRSDSFGGGGVGPFGTGVGRGALAGPPAE
FT                   VDARDSGGRTALMLAAEARKSQCAEVLADRGADQDAAPGLRRKVETLLNVYI"
FT   gene            <600465..>601186
FT                   /gene="LC1"
FT                   /locus_tag="MICPUN_80279"
FT   mRNA            join(<600465..600551,600659..>601186)
FT                   /gene="LC1"
FT                   /locus_tag="MICPUN_80279"
FT                   /product="outer arm dynein light chain 1"
FT   CDS_pept        join(600465..600551,600659..601186)
FT                   /codon_start=1
FT                   /gene="LC1"
FT                   /locus_tag="MICPUN_80279"
FT                   /product="outer arm dynein light chain 1"
FT                   /note="Synonyms: ODA-LC1, DLC1; GO_function: GO:5515 -
FT                   protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR025875"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H8"
FT                   /protein_id="ACO61744.1"
FT                   /translation="MATPKPTTCKEAIKKFETAKGVKAAEEVKVLLYAQVPPIEKMDAA
FT                   LQTLTACEHLSLSTNNIEKIQPLTGLENLKILSLGKNLIKKLDNLDGVAETLEELWISY
FT                   NLVEKLKGVQQLTKLRVLYASNNRIEDFDELNKLTELSKLEELLLVGNPIFTEAEEPNA
FT                   EGSDYRLMVLKRVPQLMKLDGIPVTSEEREKAATFEPAPEE"
FT   gene            complement(601320..602203)
FT                   /locus_tag="MICPUN_56879"
FT   mRNA            complement(join(601320..601755,601933..602203))
FT                   /locus_tag="MICPUN_56879"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(601606..601755,601933..602154))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56879"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1E1H9"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR018265"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1H9"
FT                   /protein_id="ACO62170.1"
FT                   /translation="MASFVMSASAVKAPAVKVSGLGFRKAVSAVAMPKAAAKPVQAHAA
FT                   FSVVCGKPGAKAKTNKSAAKRFKITASGKVLHRRPGKQHLNGHKTTERKTRLSGERQIG
FT                   AEQIPLVKGLLPYSRKRIR"
FT   gene            <602704..>603614
FT                   /locus_tag="MICPUN_75681"
FT   mRNA            <602704..>603614
FT                   /locus_tag="MICPUN_75681"
FT                   /product="predicted protein"
FT   CDS_pept        <602704..>603614
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_75681"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:5488 - binding; GO_process: GO:6810 - transport"
FT                   /db_xref="GOA:C1E1I0"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I0"
FT                   /protein_id="ACO61745.1"
FT                   /translation="KSLVAGGVAGGVSRTAVAPLERLKILQQVAGSTTTAYNGVLRGLT
FT                   HIMRTEGMVGMFKGNGANCIRIVPNSASKFLAYETLESWLLSRARESDPNAQLGPLTRL
FT                   TAGAGAGIFAMSATYPLDMVRGRLTTQVDGKYKQYTSMTHAARVIVREEGALALYKGWL
FT                   PSVIGVIPYVGLNFAVYGTLKDVVAEWQGLKSGKDLSVPLGLACGGVAGAIGQTVAYPF
FT                   DVCRRKLQVAGWAGAKALAEGEAKHLAEMRYTGMVDCFVKTVRHEGVGALFHGLSANYV
FT                   KVAPSIAIAFVCYEEVKKLLGV"
FT   gene            complement(<603965..>604297)
FT                   /locus_tag="MICPUN_76741"
FT   mRNA            complement(<603965..>604297)
FT                   /locus_tag="MICPUN_76741"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<603965..>604297)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_76741"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:49 - tRNA binding"
FT                   /db_xref="GOA:C1E1I1"
FT                   /db_xref="InterPro:IPR002547"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I1"
FT                   /protein_id="ACO62171.1"
FT                   /translation="DPICKARLAIGKVIEVSHVENSDKLYCCKVQVGPEEVRQVITGLR
FT                   KFVPEDDLKNRMVLTILNLKVAKLAGQTSEAMILATESETDGNLSVKLVNVPDGAVVGD
FT                   VVAAEGV"
FT   gene            complement(<604839..>606470)
FT                   /locus_tag="MICPUN_56882"
FT   mRNA            complement(<604839..>606470)
FT                   /locus_tag="MICPUN_56882"
FT                   /product="predicted protein"
FT   CDS_pept        complement(604839..606470)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56882"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I2"
FT                   /protein_id="ACO62172.1"
FT                   /translation="MPEKDGSWLLGVVVCSKTGTCLVNACSDAPLRVRELCRMLPALHS
FT                   LAAGVASPTSHLDLSTCSVALCESRVGYIVAALTSPGADWRQRRTSASFVAETVSRAFA
FT                   WHGGEHLESFIARDMDDAVMDATFDAGEDADDGDDDDATTHPQFRSFELEFLRPALARE
FT                   FARPAHVRWLEPLVGCVTARVAHAHVLIPRSRDDDASHGSGHRPATNDDVAAAVRDDRE
FT                   FDDSALSDAVRTKELGARATWECHVVASARGTEASHPLARLCDVDAVGCGEIWRETRER
FT                   CLAMAESRARRCAATAEVGGTFDGDGVGLSGHRRVSSRVKGAGVVRGAFAKREASTPPE
FT                   TAVLVFRNVGGGGGKKDGDVGRDRRTLRAVIHAFSCHPGSAIGTACAVAFCVSPPVGDS
FT                   PGGDSPGGDSPGSPTGRGWPDDLDGWDPPEVSGGYVSRRVAGGTGATSSVMPTDLARAM
FT                   FRVADAVRTTLDPHFDWSNHRSSSDGATEAKKRWGGLDGTGLEEGHTERSGRGDGVPAV
FT                   GKDAGWVVVKGAGPPTGRGVRRVVPA"
FT   gene            <606648..>607781
FT                   /locus_tag="MICPUN_56883"
FT   mRNA            <606648..>607781
FT                   /locus_tag="MICPUN_56883"
FT                   /product="predicted protein"
FT   CDS_pept        606648..607781
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56883"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I3"
FT                   /protein_id="ACO61746.1"
FT                   /translation="MGSGLLAAAPLGIAASAPRSRRRTRRAPVNVAATSASGEDGLERV
FT                   ENCSGCLRPESCPCPKAIRRAKQKQQQRRRETSRRDEDDAAPGRRAVLSALGAVAMGGG
FT                   GAVVPGNPAVAMENGLISEAWSAISGAPSDLTFPEDFLGTWLCYSTLTRVDTLQGDELV
FT                   QDIAVVNRARKDVGQQIVYPMRFIKNDQGRVVMDRAYNVVRMAEATARAYNVIDSVEWD
FT                   VNDPNVLRGRIGADGRSVFFRVNQRSEEYPAPDRIETSEVAQIVFDGGDNGGYAPTPTD
FT                   DSVPAAIPAMALGPDGTRDPSGAAKATKVKSSRTFTKWKFRSAEAAGDGPAIVAGQTVY
FT                   DYLTSFDPGFIESRGQPVTQYTYKLALFRANKYNLEN"
FT   gene            complement(607878..>610962)
FT                   /locus_tag="MICPUN_104770"
FT   mRNA            complement(607878..>610962)
FT                   /locus_tag="MICPUN_104770"
FT                   /product="predicted protein"
FT   CDS_pept        complement(608056..610962)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104770"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3994; protein binding - aconitate
FT                   hydratase activity [PMID 5515]; GO_process: GO:8152;
FT                   tricarboxylic acid cycle - metabolic process [PMID 6099]"
FT                   /db_xref="GOA:C1E1I4"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004406"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015929"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR015932"
FT                   /db_xref="InterPro:IPR015933"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="InterPro:IPR036288"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I4"
FT                   /protein_id="ACO62173.1"
FT                   /translation="MMRKAVNGRALRRLLERAAPATSSTAGSRGFASTARTTGAIAAPL
FT                   ARRAPLASRAPAPPRAGSLLPAASLASIARSARSASTFLAEYDAHVAERAAQNIAPKPL
FT                   DAKQVAALCEQLESPPAGDEAVLMDLFENRVPPGVDEAAYVKASWLAAIVEGKARSPLV
FT                   DAAKAVRILGTMQGGYNIAPLVQALDDPALGPLAADQLTGTLLVFDAFHDVEAKAKAGN
FT                   EHATRVMRSWADAEWFTRRPPVPEKITVTVFKVTGETNTDDLSPAPDAWSRPDIPLHAL
FT                   AMLKNPRDGIHDAPAQIEELKTKGFPLAYVGDVVGTGSSRKSATNSVLWFMGDDIPNVP
FT                   NKRTGGVCVGGKIAPIFFNTMEDSGALPLEMDVTNMNMGDVVEIYPYQGVAKRHGSGEE
FT                   LCRFSLKTDVLLDEVQAGGRINLIIGRGLTSRARESLGLPASDVFRLPSNPPGSGSKGF
FT                   TLAQKMVGKACGVDGGILPGTYCEPKMTTVGSQDTTGPMTRDELKDLACLGFSSDLVMQ
FT                   SFCHTAAYPKPVDVVTHHTLPDFIRNRGGVSLRPGDGVIHSWLNRMLLPDTVGTGGDSH
FT                   TRFPIGISFPAGSGLVAFGAATGVIPLDMPESVLVRFKGTMQPGITLRDLVHAIPYYAI
FT                   KEGHLTVAKQGKKNIFSGRILEIEGLSHLKCEQAFELSDASAERSAAGCTIKLDKEPIA
FT                   EYLRSNIIMLKWMIDQGYGDRRTLERRIAGMEAWLADPKLLEADPDAEYAAVIEIDMDQ
FT                   IKEPILCAPNDPDDARLLSEVTGDKVDEVFIGSCMTNIGHFRAAGKLLKEFDGQLPTRL
FT                   WVAPPTKMDEAQLTAEGYYSVYGSVGARTEMPGCSLCMGNQARVAEKSTVVSTSTRNFP
FT                   NRLGKGANVYLASAELAAVSAILGRLPTPAEYLEYAGKLDATASDTYRYLNFDELPQYV
FT                   ESADKVTMEDEAYAGLGPAMREQLLKVAREKKAAKAAA"
FT   gene            <611512..>612834
FT                   /locus_tag="MICPUN_56885"
FT   mRNA            <611512..>612834
FT                   /locus_tag="MICPUN_56885"
FT                   /product="predicted protein"
FT   CDS_pept        611512..612834
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56885"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I5"
FT                   /protein_id="ACO61747.1"
FT                   /translation="MFAVAPILGAGAVGLGRARTLPTSTRISTSPRSTNRVATVVRAAR
FT                   KGSPQSAQGRKKMSKGKIAKKNQEFIEQDTEKDAQIEAMRKAAAASRASVDEGEQASSM
FT                   PPGKLDGMSFEDKLKAVKEEGAAKRQQMAEAEAPRKLMDEMLTGKAPVMRSSIYDDAPA
FT                   KPGGITFAQAGGKTPDDELNVFVKIGAGLLSLGLLVVFIPSDFVFSTNVSSAPQGELSP
FT                   EIVEQVKKQASIYEEALASTPEDVDKLRGAAESYVVLEDYTAAIPLLKRLLEIQPSVEN
FT                   VGNLADVYAANGSLAKAAEVYRDAVNAEWSGASLKPPALVKGLVDALDKDGRYGLSLEY
FT                   VKKFREKGQVDDVDGALLEARVYSGWKGHSKEAEKAYQDVIDTHGDDFRGYLAKGVFYR
FT                   EIGKPDAAEGMFRQAKALVPGEMREVANAVIAQAKAQGALQ"
FT   gene            <612975..>613447
FT                   /locus_tag="MICPUN_56886"
FT   mRNA            join(<612975..613002,613198..613271,613385..>613447)
FT                   /locus_tag="MICPUN_56886"
FT                   /product="predicted protein"
FT   CDS_pept        join(612975..613002,613198..613271,613385..613447)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56886"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1I6"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I6"
FT                   /protein_id="ACO61748.1"
FT                   /translation="MGAVQYFGNAAKVYVGTEIAIGLGLGLVAGAVWKNWHWQTRAKEQ
FT                   AYFASIKGK"
FT   gene            complement(<613643..>614983)
FT                   /gene="PEX12"
FT                   /locus_tag="MICPUN_80117"
FT   mRNA            complement(join(<613643..614428,614513..614698,
FT                   614732..>614983))
FT                   /gene="PEX12"
FT                   /locus_tag="MICPUN_80117"
FT                   /product="peroxisomal protein importer family"
FT   CDS_pept        complement(join(613643..614428,614513..614698,
FT                   614732..614983))
FT                   /codon_start=1
FT                   /gene="PEX12"
FT                   /locus_tag="MICPUN_80117"
FT                   /product="peroxisomal protein importer family"
FT                   /note="peroxisomal protein import (Pex12); GO_component:
FT                   GO:5778 - peroxisomal membrane; GO_process: GO:7031 -
FT                   peroxisome organization and biogenesis"
FT                   /db_xref="GOA:C1E1I7"
FT                   /db_xref="InterPro:IPR006845"
FT                   /db_xref="InterPro:IPR017375"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I7"
FT                   /protein_id="ACO62174.1"
FT                   /translation="MQFQVDAGDSRPTFFELVATDRLVPSLRAALVYSLRTLAERRPGV
FT                   TRILDHEAEAFALLMLLVEAHSFATSDGSLAEGLYGLQRRGGRGGRGGRAAVARGGLLR
FT                   SGDDDGGNGARRSRRIGGKQRLLSVLVLVGLPYAREKLDALYPPGRSSRDEGARDGDDD
FT                   DARGGRRARGGSSPTPAAPSSSSSASAVSGASVRAGAAAAFVSAYPWIHAGWEAVVFWC
FT                   WLRYLLKDGTTHDPSLATLRLAVVRASPSEVTARRARVESARASRVNRLSSSPSWMTRV
FT                   VGPTALRAGHFALDHAQGGLMAAVVGFKLLEWWYGSAEDAVFRDRSHPPPPPPPRTAPH
FT                   PRARCVVPRDPALCPLCRRRCSQPAVVRTSGWVFCHPCVVDEVRRFGRCPVTLAAAAEG
FT                   DVVRLFSE"
FT   gene            <615284..>618490
FT                   /locus_tag="MICPUN_79480"
FT   mRNA            join(<615284..616504,616637..>618490)
FT                   /locus_tag="MICPUN_79480"
FT                   /product="predicted protein"
FT   CDS_pept        join(615284..616504,616637..618490)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79480"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; helicase activity - nucleic
FT                   acid binding [Evidence 5524] [PMID 4386]"
FT                   /db_xref="GOA:C1E1I8"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I8"
FT                   /protein_id="ACO61749.1"
FT                   /translation="MEDLVNDPHAEEIVVRENYGRDGAAEIGAIARGLRLHFRQYGKGT
FT                   NTALVASKVPLPDYRADLDGRRRAEHEVDMSPDTMAIVARALHDSPSVEDLSANLGSLT
FT                   HASQSKRQRGDGDRSRSRVDEASHLLRRDAAVDAAAQKAELERLESPHVAARMAQRARL
FT                   PAFERRDELLAAVDACTNVLVVSGETGCGKTTQLPQFVLERALASGDASVTGILCTQPR
FT                   RISAISVAARVAQERGEELGESVGYQIRLEARRSAATRLLFCTTGVLLRRLAVEPTLDS
FT                   VSHVFVDEIHERGMNEDFLLVVLRDLLPRRPDLKIVLMSATLDAGLFAAYFGGAPVAHI
FT                   PGFTYNVRTLFLEDALEAFGTRLVVSPPDARRDGFGGFGGKRRGRFGGGRREPTPGYNP
FT                   DEDEDGGDNLVATLVATCDPADPDGDGAILVFLTGWDEITKVNDLMRADPLLGDRTKCA
FT                   VLPLHGAMPTANQREIFDRPPRGVRKIILSTNIAETSITIDDVTHVVDCGKSKEKTYDA
FT                   LNNLACLQPAWISKASAHQRRGRAGRVREGVCYRLYTKAQHAKMADHATPELLRTPLEE
FT                   LCLTIKSLGLGLCEPFIARALQPPEPKSVHNAIELLITIGALSRRTEELTPLGRHLAAL
FT                   PVDPRVGKMLVTAATFGCLSPALTIAAGMAYKDPFVLPMDKKHQADAVRRRLAGDTRSD
FT                   HIALVRAFEGWTRARRDGGNREGWEYCRRNFLSGNTLELMSDMRRQFADLLHGIGFLPD
FT                   GARSADRVDAAHNRHAADVAMLRAVICAGMYPRLVSVRPRGRRNELKTHEDGKVECHPS
FT                   SVNSEFGVSFPFPWLVYCEKVKTSGVYIRDSTCVPAYAVLLLGGDLDEEPDGTAGDGDD
FT                   DVGIRVCGGHYTFSAPRDVLALVRKLRREIDSLLDAKARNPGLGGFGCGFVDAMRALVA
FT                   DEEHRAYGGDDRGRDRGGGGGDRGGGWGRRGGRGGFGGAPGTSGGDWECSNGCGLVFGG
FT                   KRSCFRCGAPREGDRGDGGRGGLGGGPPAPRHVRF"
FT   gene            complement(<618864..>619457)
FT                   /locus_tag="MICPUN_56889"
FT   mRNA            complement(join(<618864..619010,619272..>619457))
FT                   /locus_tag="MICPUN_56889"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(618864..619010,619272..619457))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56889"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1I9"
FT                   /protein_id="ACO62175.1"
FT                   /translation="MSGLDEYDYLIYPGFMRRPMARWNEDGSVAPMARARGPKGEAFQL
FT                   TLKQSEIDEDIAHIEYEIGIGKKPKKKRTGPPLNPKLEAVKKQEEEERVASESEREEQD
FT                   GDSDKK"
FT   gene            complement(<619591..>619782)
FT                   /locus_tag="MICPUN_56890"
FT   mRNA            complement(<619591..>619782)
FT                   /locus_tag="MICPUN_56890"
FT                   /product="predicted protein"
FT   CDS_pept        complement(619591..619782)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56890"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J0"
FT                   /protein_id="ACO62176.1"
FT                   /translation="MQGDARVSAADIKVTADLDRGCVLGRPKGPTFVSARDADEAGSQR
FT                   HDRRTQAGSRKRFAGKVN"
FT   gene            <619880..>620776
FT                   /locus_tag="MICPUN_70956"
FT   mRNA            <619880..>620776
FT                   /locus_tag="MICPUN_70956"
FT                   /product="predicted protein"
FT   CDS_pept        <619880..>620776
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70956"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J1"
FT                   /protein_id="ACO61750.1"
FT                   /translation="ETTVVSAEWLKANIGRPDVVVLDCSWYLPAMERDPRAEHEAKRVP
FT                   GARFFDVDGVSDPSSPLPHMLPDAGAFAAACDAVGVANGDQVVVYDGAGLFSAARGWWM
FT                   FKVFGHDAVALLDGGMRAWEKLDGATVETKPPAVPIAAATDACARWYDDASKPSSTPSS
FT                   SFRATLRPELVLRRDDVLARCVGAAATETLVDARPKPRWAGEAPEPRAGIRSGRVPGSA
FT                   CVPFFDVLDADDRTFKSRDEIRDVFSAAGADVTGAKKVVASCGTGVTACVLSLGAAIAR
FT                   GDGTPLPVYDGSWTEWGA"
FT   gene            complement(<620909..>622051)
FT                   /locus_tag="MICPUN_56892"
FT   mRNA            complement(<620909..>622051)
FT                   /locus_tag="MICPUN_56892"
FT                   /product="predicted protein"
FT   CDS_pept        complement(620909..622051)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56892"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1J2"
FT                   /db_xref="InterPro:IPR010675"
FT                   /db_xref="InterPro:IPR024160"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR039772"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J2"
FT                   /protein_id="ACO62177.1"
FT                   /translation="MEEAPGAEEAPEAAPASRAATKKRSREDRDAAGASNPPSGLDAWA
FT                   EEATANRGGAGAASSAGGDGRGGGDAAPASHVKFGGANGGGRDANGRQRQCFRYGNYHR
FT                   YYGYRVGESLEDHRIAHLKREWFHRKRCVDVGCNEGLVSLSIAVSFGSTTMLGIDIDEW
FT                   LVKKAREKLRRMRRAAAKAATKAERESEEAARMAAEASAREADAAAGGTLRSHPATRVA
FT                   AATETTDGTGEVGSQLGAKLADSGPSLGGVTFRASNILDETFEPGSVDAFLCLSVTKWI
FT                   QLNWGDAGLKKMFKQIYDALSPGGVFIVEPQPWKSYKQAFRKQKMPEETREHFRGIELR
FT                   PAFFAEHLRQVVGFSSVQAIRSADLHVADEFDRNLLLCVK"
FT   gene            <622478..624280
FT                   /locus_tag="MICPUN_56893"
FT   mRNA            <622478..624280
FT                   /locus_tag="MICPUN_56893"
FT                   /product="hypothetical protein"
FT   CDS_pept        622478..624277
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56893"
FT                   /product="hypothetical protein"
FT                   /note="conserved uncharacterized protein"
FT                   /db_xref="GOA:C1E1J3"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J3"
FT                   /protein_id="ACO61751.1"
FT                   /translation="MSFRKGLVEIWEDMMSYRTLKVVKISDKRLAYVHKSLMASILVYA
FT                   TITMVGAHTYMLKEKPRLYVTTTVDDTNRLSNWTLDSTSGPRGYCNSAYTSFPGDEFVP
FT                   EPAYPQTRCASYISTAQMVSVTDQGAFIGTHMRQQAWKRTCTDETTKLDCVVENKDENG
FT                   AAVDAEDHFAADIENIVLKLQPIYVTSWGVSEPAHRITVVNAAGQEVKEFERYGTDSTS
FT                   QWPTFTLKELLKLAEMDIDAQNPIIVSKNFKGLDAETGQPRLPLYRLTGLRIAVDFTFS
FT                   NFRPMGQMKPFDFTPLAVMTVKATSVGSFVTPRESTIYSGTTSNFDSQGTTLSIRGVKI
FT                   EYQAKGLMGKADGYTGMMALMSCLVMVGVATAIVDVIGAFIYDSFKDDKIEDDSERQHL
FT                   EHMILNIETSGVPFKNDDFEFEPGTSVKKQIDELTRDIQRQATLLHHMSGELAAAGLNS
FT                   HTMHMADLGEGVQSARYECVLKGPNGEDIFLTGGPQTVGRGHGGTQSKRISHKQISVVA
FT                   NTHNGMARVQGLPTKNISGVALGGGPWQPLGPEASVDLKNGDMIALLMDEGADEAETTV
FT                   DGVFRFQATYVEDKQQGGSWFGW"
FT   gene            <624694..>626592
FT                   /locus_tag="MICPUN_56894"
FT   mRNA            <624694..>626592
FT                   /locus_tag="MICPUN_56894"
FT                   /product="predicted protein"
FT   CDS_pept        624694..626592
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56894"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J4"
FT                   /protein_id="ACO61752.1"
FT                   /translation="MRPSIARDPGGGSRFPAPRVRPKSARRSRERSFRFRGRSNPASAP
FT                   RRCPPPPSRAPFRPINSPALSPRPPSSDQHHFPITTRRARGDGWSWNWDAPKPERNPAG
FT                   SRGPGLSVTGGRDAASDVDGRQVGGSQRGQLRLGPAGGRTSIPNRGPGAAPGRVGDGHG
FT                   YPRAGAAAAAAAANDLRGYVPAYGLGADLGGMNLDDINDTAGATAYVDDDDLDSPEQHQ
FT                   THDVIITEIEEINLTDYMQTLQAPTFSEEALATADFGFGGDRTFSGSGLYGAGMNGFDA
FT                   AASPKQGAGGVMGGSDKFPMRSETPGRAGRRVWSRGGNRSTDAGSGGLATATPGIDRPQ
FT                   TGGLDEADVNRPLHTHGLDDDEDGGDPEVDADIFDDSDDDSWGEETHAVDTFGGNQNGA
FT                   DVLSDDEDGGHAASPKAMGAVNPSFGGSAIAARSPGAGGGAGGSFSGFVSGGGASLPGR
FT                   QSPLPGSSSSSSSSFAASREARRRREEEGDFVVMSTPSGLRRVPSARRRPGTGGGGGGG
FT                   ARPGGGGGGGWPSGAGFKDGSGGGKAEVVADVYGAKENASIPPRGASAGGLGLLQRPPS
FT                   RQRPPPEATNLFARRAAAAAAAAAAPVVPGLNKVSRPAGMASNMMFSHRPGQTGGW"
FT   gene            complement(<626801..>627634)
FT                   /locus_tag="MICPUN_56895"
FT   mRNA            complement(<626801..>627634)
FT                   /locus_tag="MICPUN_56895"
FT                   /product="predicted protein"
FT   CDS_pept        complement(626801..627634)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56895"
FT                   /product="predicted protein"
FT                   /note="This gene contains a 3 prime TPP riboswitch (not in
FT                   model but 3 prime of model)"
FT                   /db_xref="GOA:C1E1J5"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J5"
FT                   /protein_id="ACO62178.1"
FT                   /translation="MRTHAFRLGAVLFLALATTGAFAGDCTGLLNCNDCASIAAISNHK
FT                   CLNGGTCNAAYASSDDKVCICPSSTEGVECQTPGVTRCAGGSWCGNNGECGTNFRCKCT
FT                   VGFTGNRCEESQPPDNCVIPSNHQCLNGGKCTNNTNTPCNCPPNVGGPSCEKVDVRVCV
FT                   DGTYCENGGDCKVSGGCACDEGFIGATCGEVDREWFQARYNSGGGSSSSKKEVVNVAAA
FT                   VAVPLVLIIAAGGGFMAYMVHKERKGAPLFSKIDDVPDVEMSARNALPAPAVAKA"
FT   gene            <627909..628445
FT                   /locus_tag="MICPUN_56896"
FT   mRNA            <627909..628445
FT                   /locus_tag="MICPUN_56896"
FT                   /product="predicted protein"
FT   CDS_pept        627909..628442
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56896"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1E1J6"
FT                   /db_xref="InterPro:IPR000456"
FT                   /db_xref="InterPro:IPR036373"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J6"
FT                   /protein_id="ACO61753.1"
FT                   /translation="MKHGRHFRKLGKDASHRWAMMRTMVTQLIEHERIQTTVAKAKELR
FT                   RVADRVVTFAKEGSLRARRKAAAVVRTDAMVNKLFTELAERYKERPGGFTRVLQIGQRK
FT                   SDSAAMAYIEYVDRDGELRPARPATGFGLSWAAKEYVNSQLASKKRHGDVRAVLSPAAD
FT                   AAAKAAAEPPKEEK"
FT   gene            complement(<628656..>629258)
FT                   /locus_tag="MICPUN_56897"
FT   mRNA            complement(<628656..>629258)
FT                   /locus_tag="MICPUN_56897"
FT                   /product="predicted protein"
FT   CDS_pept        complement(628656..629258)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56897"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1J7"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J7"
FT                   /protein_id="ACO62179.1"
FT                   /translation="MAPTDVPKKERSLSYRLHDALNVPLVGGLAIMCILGLLGLMDAHL
FT                   ITKIFISYIAVDTIWIVLSPSAVPRFAWAIVLHHVLTFLILLHPLRFPEHAIETCRDGI
FT                   VELNTFFLIARRQLTRGSLLNRACDLMYHLTLSIRFLWQPYLIYHFRIITHMNSTDRPG
FT                   GYTFREHYMVMVSQVLLCVFNILIVLPGLLPKKKKKA"
FT   gene            <629589..>631954
FT                   /locus_tag="MICPUN_56898"
FT   mRNA            join(<629589..629651,629765..>631954)
FT                   /locus_tag="MICPUN_56898"
FT                   /product="predicted protein"
FT   CDS_pept        join(629589..629651,629765..631954)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56898"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039663"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J8"
FT                   /protein_id="ACO61754.1"
FT                   /translation="MGDDVVNVFADEFEHPPGETLDILRDESIVKTVVEPAPAGGFKTR
FT                   PSVGDQVSFTVRRVHAANAPTAGTVAQDAELERYLLGCGAQCRAVEVALETMREGEVAT
FT                   FLCKERHLPAPNIESVYPEEVTIRLAKIFRDVDLTPRPSPGGKLIKRRTRWGDAKTHGQ
FT                   TLYEPMTLSHSPRPGYGSDTGRDVARPGCRVIVYTKHKPTAVNANTGLDAEPWTPMEFT
FT                   LRSTAVDAPPCPDGVHEALELSLTLASPGERFEVTFPASVYGFADDRVDGTVESDAVAS
FT                   ARFAETYDTGGDLVTTEVHVRAVHPPAPFAPEHAGPGGWGGTKDVGLDGEDLWTMPKWE
FT                   RAHRAKAAKERGVALFKAGRHRAALRAYDVAIRLLTAPFAPLDLSKVEMPEWDPPSEQD
FT                   PLGKDPHLKLAERYGSNAWRGLADSGLGEGNENQVLLKATILNASLAASRRGDHATCEW
FT                   YCSKALAEDPMCVKGWFRRGRARVAMHRWDEAEDDLNRAERLQGDDEIAKELDVERKKL
FT                   AAGRKKSESGGAVAKAFRAVFGGGGGGAGEYPKPREMRRLVTGDLGIEAGPAHPTGRLD
FT                   TDEPGAQLDELLDETSPHTRMEHAFNKALHYEQIGLNEFVDSGMPIELYSEAELAPVGE
FT                   GHPTAQAVEKREYVVPFGEAEAAELDAEIAEREHDEELYDKMLNAAKRGNRVQRGTATH
FT                   NPWDRDGTKAVDELNMQFVKEYNEQKMEEAKEEMEAHKKQWHERKKRATGDDIALD"
FT   gene            complement(<632468..>632772)
FT                   /locus_tag="MICPUN_56899"
FT   mRNA            complement(join(<632468..632539,632692..>632772))
FT                   /locus_tag="MICPUN_56899"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(632468..632539,632692..632772))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56899"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1J9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1J9"
FT                   /protein_id="ACO62180.1"
FT                   /translation="MAEADDDKKWYSKPNKRESLWGLGGMAIASSVAGIIYLVKREKDE
FT                   KVDKK"
FT   gene            633112..633599
FT                   /locus_tag="MICPUN_107904"
FT   mRNA            633112..633599
FT                   /locus_tag="MICPUN_107904"
FT                   /product="predicted protein"
FT   CDS_pept        633364..633537
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107904"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K0"
FT                   /protein_id="ACO61755.1"
FT                   /translation="MDAMGPVVVNEDGSLSRIANWPMLTDREKEVTQRRIAKRNKERLD
FT                   RLREAAKENERA"
FT   gene            complement(<633625..>636048)
FT                   /locus_tag="MICPUN_56901"
FT   mRNA            complement(<633625..>636048)
FT                   /locus_tag="MICPUN_56901"
FT                   /product="predicted protein"
FT   CDS_pept        complement(633625..636048)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56901"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1K1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K1"
FT                   /protein_id="ACO62181.1"
FT                   /translation="MVQRRAHPLPPRLLLLVVALLPALASAAAPTSVNPLAAVAESPSL
FT                   PRELVARVRASGAELAAGGLAPLAAAAVDARGGGDALARTLASTRAAVLALCGSAAVLE
FT                   RSADDTTPRADEAGDPAPAPPALLEDAENLAALFHWLAVELDAALAVAPDAPASPTARR
FT                   EGGTWSLADELREARAVLAARLETSSSSPSSSSSTSSSSNSGFSCYRWSGYIARSLAAR
FT                   NALSLPFDELVEATSTWSDAELDACGLRHARLAFLATEINERETADDAGGGNDSRNEHL
FT                   VHGLNLTAFGAVVETCRVGGGNGLAQLVGPGAFAAAATRLARLKSHLSAMDTALRSQTA
FT                   IDGFRCLSDASLAPAMDDEADAPPGSRLATATAILSFLAGAAEDVLVADRGCERARESS
FT                   STGAYYPVPVFDRIAQELAQCGVGDAYGRAWLRARYPNGGTAGLASRLDQVAAAVDACS
FT                   EGSSLNREDVKAARSKTPPLTRVDLDALAATIRHFRSADAAMFGCRRGAYAHSAAGALA
FT                   HALDGYRAVLASCPAATADSTGSDPTEIVHPEIVHPSSSSYVVIPVTEAAARGEGVKGR
FT                   GRFEPGGGAGFVGVVSASCVLAVGGVAFCVARYLQTRRDRSVRGPWRKMDAAGGDLGRP
FT                   PRVPPSGPGPGGRAPFAFSARRFYRHLQAGSVGDLPLVEDLDRASGVSTESEGNDRVDT
FT                   PPLRMGNVVDLPSPRTNRRSNSISEPATRPPPAVTPDDLVLRGFAGGISEPKPRHPSRH
FT                   STPYHGLRSVGELRVNIPVGAFRETADGRRPTTPPAGASGAAPFFGGEKRLTHP"
FT   gene            complement(636169..637755)
FT                   /locus_tag="MICPUN_90239"
FT   mRNA            complement(join(636169..637396,637691..637755))
FT                   /locus_tag="MICPUN_90239"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(636263..637396,637691..637729))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90239"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K2"
FT                   /protein_id="ACO62182.1"
FT                   /translation="MDGPTDAEKLPVTIVTGFLGAGKTTLVNHILKGDHGKLIAVIENE
FT                   FGAVSIDDALVGENIKEQENIITMDNGCVCCTVRGDLVRALLTLKDKTKKFDHVIIETT
FT                   GLADPAPVAFTFFINPEIADHYRIDSILCLADAKHIGLHLEEEKPDGAVNEAVQQVAFA
FT                   DRILLNKIDLVSDTELAAVMEQVRSINGVAEVIKTTNSVVDLDKVLGVSSFSIEKTLEV
FT                   DPDFLEDEEGHAAATAAHDGAAADGGDHGHGHSHDGGKTECHEDHGHGHGHGEPAAKKP
FT                   RKKRHDLTGVSSVGILAEGELDFNQVNTFMMTVLQENAKSIYRSKGVLCFKDQGNTKFV
FT                   FQGVHEHINFGPSSVEWGADEPRVNRMVFIGRNLNRKELEEGFRACLVKD"
FT   gene            <638407..>639578
FT                   /locus_tag="MICPUN_99437"
FT   mRNA            join(<638407..638465,638665..639161,639319..>639578)
FT                   /locus_tag="MICPUN_99437"
FT                   /product="predicted protein"
FT   CDS_pept        join(638407..638465,638665..639161,639319..639578)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99437"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003774"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K3"
FT                   /protein_id="ACO61756.1"
FT                   /translation="MGDDSHSDTVEVKGDWRAFRAALVNQEHAHRQRFNQQQQANHVVT
FT                   NLSAASTAYSRRQASKITPGDWAHVLPEAETGCLLLAPETEEGWWRHSVVLVLNHDAEG
FT                   STGVILNRPTNAQLKNVVPEIDYSAPHHRVLANRHVSMGGPMGTEKGARCLVALSHTRL
FT                   DGATSEVFPGLWHVSDFSAVKPEHEPSLMVFVGYCGWMSGQLNAEVAANGWTVAAASAA
FT                   NTLALVNASARAGDVMGESMWATMRGRLGYPRPGNLGYDTPNFGAEGPL"
FT   gene            complement(639681..640617)
FT                   /locus_tag="MICPUN_107906"
FT   mRNA            complement(639681..640617)
FT                   /locus_tag="MICPUN_107906"
FT                   /product="predicted protein"
FT   CDS_pept        complement(639847..640569)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107906"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K4"
FT                   /protein_id="ACO62183.1"
FT                   /translation="MSDGYAAAQARKEAYLASLILQDVEKRGEAVRERGVTAWAHRPRE
FT                   REQVNERFLRNTLRGVDSSNRRVEQQAVRSGSPAPGAGGAKRVRPEDVVVDHGRGGAGS
FT                   TRRGSEGTSSSSSSAAASSSDSEPDAKPSAGNGKGGMRDDELAEFLSRPRVKRGRGAVG
FT                   SRADEPGPFLPGGGAEHKVGGYSLVLANEETRRNDARIAAMRDEAKRKERKKAEKREKK
FT                   ERKRERKEGRSEKKKRRR"
FT   gene            <641175..643080
FT                   /locus_tag="MICPUN_56905"
FT   mRNA            join(<641175..642533,642617..642647,642802..642810,
FT                   643063..643080)
FT                   /locus_tag="MICPUN_56905"
FT                   /product="predicted protein"
FT   CDS_pept        641175..642533
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56905"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K5"
FT                   /protein_id="ACO61757.1"
FT                   /translation="MARGTGPSRRSNRPSSRALGNSALNTRGIARGERGTRGKSSRVAS
FT                   RATSNEDDEPPAPEPLLVIVEVDGVLCDVHCDLHRLAFNEAFVELGMEGASWSEERYLS
FT                   LLRTGGGTAEGMVERYFHFYGYPTPELRDPTAHIPDEVGQAAMSGSIRPEGWNAEGASV
FT                   AAQAAAIQAAASRNPLNRELLARRRLEWIDEVVAKKDERLRAIVSEGRLKLRKGALDFI
FT                   DECLLEDGAQVVFVGATASAPEEGVLDAVLEAIGPLRAAAITQCGGHEQIDGCEFQSFE
FT                   NYHANNIVKDITANGEVAAREEQLQAVNGDVDVRKEMQAMMKQRKGELLAEEIGGDLQR
FT                   QRFDSNVVVDSGVFCTSTRSVISAEAVRGMLEAKGFGKDRAIFVGASRTTCAEAGAAGV
FT                   FNVLARTAHQADSQITDVACVVDGFGGGGGLTLRYIKRRAAAWDGRAATMDET"
FT   gene            complement(<643871..>644852)
FT                   /locus_tag="MICPUN_99439"
FT   mRNA            complement(join(<643871..643923,644174..>644852))
FT                   /locus_tag="MICPUN_99439"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(643871..643923,644174..644852))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99439"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K6"
FT                   /protein_id="ACO62184.1"
FT                   /translation="MVIRVSNDVLVVPPFDCAWLSSPDAESLTTASSEGGEGIVVSFDA
FT                   KADSDVTVILKGRRTSKSELDSRPARRLDHWSGRQDDPAKVDASTYLVIIGSHRNSACV
FT                   IEKNGRVVELAKGPAVPLLPARGRDAFTRCFVSWYPKRGALVVGVGEHLRHAWVDPEPH
FT                   TDPICEIGLSTWDDYAQYRDIEVRALDPDGGSRVNSWSATPADSPRGGRRPAPPPAVAD
FT                   VENLRGATRCARCCRTFGSPR"
FT   gene            <644995..>645621
FT                   /locus_tag="MICPUN_56907"
FT   mRNA            <644995..>645621
FT                   /locus_tag="MICPUN_56907"
FT                   /product="predicted protein"
FT   CDS_pept        644995..645621
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56907"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K7"
FT                   /protein_id="ACO61758.1"
FT                   /translation="MAMKTTIWRPNVRVTLDEYGEVEDTERGGEEVTKQGTKRKRAPRP
FT                   KGPCEHGVKYRSRCKVCGACPHGKRRCYCKECGGASICEHGRQRSHCKECGGASICEHG
FT                   RQRHQCKECGGSGICEHGRHRFSCKECGGSGICEHGRIRSACKECGGGSFCEHGRQRSI
FT                   CKECGGAGICEHSRRRSQCKECGGGSICQHGRRRSQCKDCRGERL"
FT   gene            complement(<645707..>649054)
FT                   /locus_tag="MICPUN_56908"
FT   mRNA            complement(<645707..>649054)
FT                   /locus_tag="MICPUN_56908"
FT                   /product="predicted protein"
FT   CDS_pept        complement(645707..649054)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56908"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1E1K8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008907"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K8"
FT                   /protein_id="ACO62185.1"
FT                   /translation="MSTGAADPERVRTSITSMNALLDPLKHLYLNLADADGKTTRARCL
FT                   FALADTGILDDLPCADVGADLGHGFSDDVEVEWTYEDFVNVLGAAIAHRTAHRKPLPAA
FT                   PRGVAQRQLRDLFHLCCNDFDRARPKSNASRLTLHQWLVVCDGADLLTRRFTRDAAAVV
FT                   FARCRRGAETDLGLDQFITCLASLAVETGKTFEAVVSAVSTSPLCTGGAENVAPAKDIA
FT                   PGAAKDTYKTPGKVRVPTVFGGAKPKTPGAALKTPGASLKTPGASLKTPGASLKTPGAS
FT                   LKTPGASLKTPGASLKTPGAPNDVRYTAALESAVESPDAKSFETHDADGDGLLNRHELA
FT                   SLLAQGDSASVDGAIELVSKLFDDVDLDRDGRVCLAEYEAFCKKARRTLRRRTMSSAHG
FT                   PTASAPVPATYATDARLEEMFVAYCVVGAAKTPAKERTTNEGSVHVNNQNAFAAKRTID
FT                   ERRFLRVLKDAKLTGPGFLSQQQAQLCFHSQCARNERKLDHAGFLRALGAVVAHSGPGA
FT                   TYESIADAVKSLPIPDKLSAAVIERTIAPQPPARAGTGVGPRPHSARAGIGSFSTSSSS
FT                   SSGDSGFGARANAAVRTRPKSAKPRVSVSFADDDDVKSDVKSDVKSDVKSDVKSDVKSD
FT                   VKSESTAPDALLAAFDRRDAEANDGDVTGVASIGVCRLALADVAGLNGADAAAVADAFR
FT                   DVFEAFAVRAKLRREKLGEFKRKFDARVANLALAGAPLVPPVQVPPMSAPQSDAISGVF
FT                   DSTVGTSAGAPDFMTAAEFASLLSAAGLIDTDADADAVEVTFCRCVGGKPRGDADFASF
FT                   VTALAAIAGERRLTFFQVAAPVVDAAMRARAARGKEKEAGNETGDAAEPEAEPEPEAEP
FT                   EPEAAPEPEPEAAAAPEPEASEPEKAEAAQTAAPPLTEEERAVWAQEFKSHDEAESKSG
FT                   FVDVERVSFALAKLRLLEDVDVALAASELEASVKIVDPSGVGALDLDAFIAVGAAVRAL
FT                   KLGGRAKPSAKPVPVQREYVFDDSHPFAAKFRAVADVNGEIDGDSYRALLDRAGLLHDG
FT                   SRGSSETPETRLTNAGAAVVFARAKARHPGHGRRVPYRIFLGALSLSAGHLGMSFAEVV
FT                   ERIMATEL"
FT   gene            <649408..>650736
FT                   /locus_tag="MICPUN_52211"
FT   mRNA            <649408..>650736
FT                   /locus_tag="MICPUN_52211"
FT                   /product="predicted protein"
FT   CDS_pept        649408..650736
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52211"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:30131 - clathrin adaptor complex;
FT                   GO_function: GO:5515; protein transporter activity -
FT                   protein binding [PMID 8565]; GO_process: GO:6461;
FT                   intracellular protein transport - protein complex assembly
FT                   [Evidence 16192] [PMID 6886]"
FT                   /db_xref="GOA:C1E1K9"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR018240"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1K9"
FT                   /protein_id="ACO61759.1"
FT                   /translation="MALFGAGGSPAVCSSLYILDSNLKTLLMRDWRGDTNPSMVERFVS
FT                   IVNNAESESELKPIIYDDEIQTSFTYIRHRDLYFLALTRTNANAVALLTFLHRLVDIFT
FT                   HYFKELKEESIRDNFVIIYELLDEVMDNGYPQFTEAKILSEFITVGAHELQAPKAPMAV
FT                   TNAVSWRSEGLRYQKNEVFLDVVESCNCVVNANGQIVNSEVNGALRMRTQLSGMPECKL
FT                   GLNDKVMLQAQNKSTRGKSVELEDIKFHQCVRLARFESDRTISFIPPDGQFDLMNYRIT
FT                   TPVKPLIWVEAKVTRPSRSRVEYSVKLRTQFKSRLNATGIEVKLPVPGDATTPEVKAAL
FT                   GSVTYAPEQEAMLWKIKTVPGEKVVEMRAKFSLPSVSALEDDGPRQKKPPVMVKFEVPY
FT                   FTVSGVQVRFLKVIEKSGYQALPWVRYITKAGTYEFRLDHQSS"
FT   gene            complement(<651137..>652086)
FT                   /locus_tag="MICPUN_56910"
FT   mRNA            complement(join(<651137..651209,651282..651488,
FT                   651599..>652086))
FT                   /locus_tag="MICPUN_56910"
FT                   /product="fasciclin family protein"
FT   CDS_pept        complement(join(651137..651209,651282..651488,
FT                   651599..652086))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56910"
FT                   /product="fasciclin family protein"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L0"
FT                   /protein_id="ACO62186.1"
FT                   /translation="MPHTKRPLLLAALALVAFAALFNPAAAGDTAAVGTMDPPKEDALL
FT                   MPTDAEADPAATDAAAKEMDMAPDMDMEPAAEEDAELKPLGETLQADPEFSTLVALVTA
FT                   AADESGATAEDLAAEGPFTLFAPVNEAFTKFLETSGLSVEDVLASPDLKEILSHHVVEG
FT                   KYTAADVLAMELPAEVPTLDGHTIKIDKTTDGDVLIAGNKVVAPDIEASNGVIHGIDGV
FT                   ITETTPEPEDTTTNEEVTSTALLGTLYAAVLVM"
FT   gene            complement(652284..>654591)
FT                   /locus_tag="MICPUN_56911"
FT   mRNA            complement(join(652284..654194,654574..>654591))
FT                   /locus_tag="MICPUN_56911"
FT                   /product="voltage-gated ion channel superfamily"
FT   CDS_pept        complement(join(652305..654194,654574..654591))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56911"
FT                   /product="voltage-gated ion channel superfamily"
FT                   /note="potassium ion channel; GO_component: GO:16020 -
FT                   membrane; GO_function: GO:5216 - ion channel activity;
FT                   GO_process: GO:6811 - ion transport"
FT                   /db_xref="GOA:C1E1L1"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR003938"
FT                   /db_xref="InterPro:IPR005821"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L1"
FT                   /protein_id="ACO62187.1"
FT                   /translation="MSKVTPIKGAPPPADDEPEMTEEERQLADGVAKLAELTAKYEQSP
FT                   YLLDPRSRLMKRWDLIIGIALVYTATITPYEVAFLDSKAGGSTHPSLPTFPIYIINVIV
FT                   DLLFFADIVAHFNLIYYDDQLANGTYVTDRRKIVRRYMRGFFVVDVVSIIPFHEMESAG
FT                   GLKALKLLRLLRLVKLLRILRSGRILKRLEDNLNVDYNVLSLVKFILGTLMIAHWLACL
FT                   WKLTARTVAEKDDWVTRYYSNFVDADLFATCYAETELNNELHACMNLSPWNMYIAALYW
FT                   ALVTMSTIGYGDVTPTRTEERFFVILAMLIGTSVFAYVVGSVCGIVASMDKKSNEHHER
FT                   MDTLNAMSREMQVGDELQMRLRDYFRYRHTSTNIEEWFELLELMSPSLRGEVALKQCGS
FT                   WINNVPFFSGAPDGFIVDIALKLKTETFPQGEEIVHAGQISTKMYIVERGVVGGKGRVF
FT                   TSGKVFGEEVLGGGSQAAFTARAMTYCDVFGLLGTDLDDTAASYPAMQKRLRVAGCRGM
FT                   IKDSLLAFAQAWGHIEKGIKVNPNGGVEDAERDPHVSVAELAVVRRKDDIFRFALSVAR
FT                   DGSAKPTLPSDPAGAFKAINRTFIDDSSGAGAGGDKVDRVLSAVERLERKLAALEARIK
FT                   "
FT   gene            <655294..>657002
FT                   /locus_tag="MICPUN_79903"
FT   mRNA            join(<655294..655437,655620..>657002)
FT                   /locus_tag="MICPUN_79903"
FT                   /product="histone deacetylase"
FT   CDS_pept        join(655294..655437,655620..657002)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79903"
FT                   /product="histone deacetylase"
FT                   /note="Predicted Class I RPD3 type histone deacetylase
FT                   protein. ChromDB ID: HDA20107; Rpd3/HDA1 superfamily"
FT                   /db_xref="GOA:C1E1L2"
FT                   /db_xref="InterPro:IPR000286"
FT                   /db_xref="InterPro:IPR003084"
FT                   /db_xref="InterPro:IPR023696"
FT                   /db_xref="InterPro:IPR023801"
FT                   /db_xref="InterPro:IPR037138"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L2"
FT                   /protein_id="ACO61760.1"
FT                   /translation="MSGKPKISYFYDPDVGNFYYGQGHPMKPHRVRMTHNLLLHYGIYK
FT                   EMEVFRPALASAEDMTKFHSDEYIEFLRLITPDNQHEHMRQLKRFNCAEDCPVFDGLFN
FT                   FCQIYTGGSVGGAVRLNHKQTDTVVNWAGGLHHAKKNEASGFCYVNDIVLAILELLKVH
FT                   QRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKFGEYFPGTGHLQDVGQHRGKYYSVNV
FT                   PLKDGIDDEAYVALFKPVMAKVMEMYQPDAVVFQSGADSLTGDRLGCFNLSIRGHGECL
FT                   KYMQTFNVPLLVLGGGGYTIRNVARCWTYETGCLLGHDLDNKLPVNDYSEYFGPTHELQ
FT                   IQPSNMENQNTPEYLQGILNKILENLSKIPPKPSVPFHDVPPDAIDQDAMRVKEDPDAK
FT                   GGGAEAEAARRSDPRELEPEDGDVDDKPSRHDASMRDVEDVDGGEKKVKEEKVEGADAV
FT                   KAELGDAADVDDPDAAVKAEKGGEGATDANDGDAANAGGPGIMASDHGDQ"
FT   gene            <657228..658973
FT                   /locus_tag="MICPUN_56913"
FT   mRNA            <657228..658973
FT                   /locus_tag="MICPUN_56913"
FT                   /product="predicted protein"
FT   CDS_pept        657228..658970
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56913"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR015353"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L3"
FT                   /protein_id="ACO61761.1"
FT                   /translation="MSTASAGSSGSIVIGARHGYARRTALRSSPGRRRLRTCAGKLSQR
FT                   KTRGSRGLSVVAEQHGISLEDARALFSKRFCKGSGVHLELQETPTGRGLVATAPVAPGD
FT                   VLITVPWREAIHVLEDGYSDGDDLRLALELLHVLDDGDEDGYIDGEYDARVKTWRKYRP
FT                   MLPVSTGAAAFWCVDNIRELQFPEAVEKTLAQRAEFTAGAMRHSNDSRTKERIMWALQQ
FT                   VHSRSFSVMTPQGRARCLVPYVDLFNHRPESPKEARMTDELLQRALRKAFTKGSEEGIN
FT                   DGEWAGAEPWQVVGPDPEDLENWEDAAVFQMRSIWAYEPGEEVFITYGHETSAELLTSY
FT                   GFFPEPNDGEFIRVYENVQDLIDDDRFVDEELNSPALQMEKEQFMWSMLAVEAPLAIRP
FT                   GGVRESAHLLSALRVVHARENQLAAMRDDDVPRIGHSTFVWTEGDEPCGMWDPDRFLSC
FT                   FFDESCDSDEWLWDDDDARDRDATDRAALAQACARCEEILRDDFATTLEEDQVMLDEIE
FT                   EAIRGLSPEEADEDPEGHLEYVAALRYRMSVKRILRDFISECKRAYGVEAEALKAEPEF
FT                   EYIE"
FT   gene            complement(<659196..>659642)
FT                   /locus_tag="MICPUN_72663"
FT   mRNA            complement(<659196..>659642)
FT                   /locus_tag="MICPUN_72663"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<659196..>659642)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_72663"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8168 - methyltransferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E1L4"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L4"
FT                   /protein_id="ACO62188.1"
FT                   /translation="FHDPRGTLVEIGMGTGPNMRYYEGLNVVGVEPNEESHSYAYENAN
FT                   RNGVKSIECVRGFGESLPLGDASVDTVVSTLVMCTVDDVERTLAEVRRVLRPGGAYLFL
FT                   DHVAAPPGTPLRTMQEMLNPLNRAAYEGCRLTRDPEAAVRAAFGD"
FT   gene            <660248..>661375
FT                   /locus_tag="MICPUN_56915"
FT   mRNA            <660248..>661375
FT                   /locus_tag="MICPUN_56915"
FT                   /product="predicted protein"
FT   CDS_pept        660248..661375
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56915"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L5"
FT                   /protein_id="ACO61762.1"
FT                   /translation="MAHFQHTCNACLKPICEGDVYITRCGHRFCERPRDRDLLASSPSS
FT                   LLAPLPSSRARARRLTTSAPPAVCTQATTTREGCVRRASARRAARRSTGRRISRCGACS
FT                   DRPRPSCAFFDRPFNRQAFAVRPGEEVSEALRGFDPGTIMTAAFNGINWWCEQAALVQE
FT                   MSSRRVQEEGRAHAEGYKSKLLEVHSAYKRAKAKAEALWQQMQQLELDKKELQSKYEQK
FT                   SGEKRRIEASYRELQSRGGVAGGGGGGGGGGHPRAPPSMPPPSRHAYQHMSSPPVHLGS
FT                   PPLDRNISRPASRPSMANFGGGNRPLLSGFPAGAAQTRPISPYSGDLMSPPQDYLDDRR
FT                   EWRRGGNRGAPRASRGGYRPPHSPTRSHHTFSIGN"
FT   gene            complement(<661547..>662323)
FT                   /locus_tag="MICPUN_99445"
FT   mRNA            complement(<661547..>662323)
FT                   /locus_tag="MICPUN_99445"
FT                   /product="mitochondrial protein translocase family"
FT   CDS_pept        complement(661547..662323)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99445"
FT                   /product="mitochondrial protein translocase family"
FT                   /note="inner membrane translocase (import) Tim23;
FT                   GO_component: GO:5743 - mitochondrial inner membrane;
FT                   GO_function: GO:8565 - protein transporter activity;
FT                   GO_process: GO:15031 - protein transport"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L6"
FT                   /protein_id="ACO62189.1"
FT                   /translation="MGLRDLLGLRRGDKGNNAAAAGRDAYSSEIISEAVPEQGASGSSI
FT                   LDEPVTSGFSTPAGMVSRADLAKMGTGASGVAYNPYTGLGGPFDPQMSKALYTITDSPE
FT                   LLFDEERRAKTRSWGENITFLTGVGYLGGIIAGGGLGAYKGLSSVPEAGLVDTQKLKLN
FT                   RVLNAAGSRGTSMGNAWGCLGLYYAALDSLVGHYTSHEYPALGAVVAGAGAGSLYKSAH
FT                   GMRAAAVYGVLGAGLSAANQAGQFLVGYGAATRPRW"
FT   gene            <662781..>663746
FT                   /locus_tag="MICPUN_80010"
FT   mRNA            <662781..>663746
FT                   /locus_tag="MICPUN_80010"
FT                   /product="predicted protein"
FT   CDS_pept        662781..>663746
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80010"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5524 - ATP binding"
FT                   /db_xref="GOA:C1E1L7"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L7"
FT                   /protein_id="ACO61763.1"
FT                   /translation="MHGPRGPPPDIAVEILASLIVSTVALLAGTVAVKALDPNRGAKKK
FT                   ADAMKRDIARRLGRPNIVTTPYEDMIATDVANPNAISTTFDEIGGLGETKRALQEIVIL
FT                   PLLRPELFSGGSLLKPVKGCMLYGPPGTGKTLLAKALAKECQACFINVRSSTLQSKWFG
FT                   DANKLVAAVFSLAWKLQPSIIFIDEVDSFLGARKGSEHEASTSMKTEFMTMWDGFQTNE
FT                   NARVMVLAATNRPWEVDEAILRRLPRSFEVGLPNLEQRIDIIKVILKDEHMEPGFFGPG
FT                   PDPPVLKIAKATDRYSGSDLKELCKSAAMGPIRDLLASEAR"
FT   gene            complement(<664379..>665470)
FT                   /locus_tag="MICPUN_56918"
FT   mRNA            complement(<664379..>665470)
FT                   /locus_tag="MICPUN_56918"
FT                   /product="predicted protein"
FT   CDS_pept        complement(664379..665470)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56918"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L8"
FT                   /protein_id="ACO62190.1"
FT                   /translation="MDPMGLSAGPNILELYQKPVNITTYDTKWIPTSARFVVLGSYARA
FT                   TGCLQIYSLDTENEGVKLNKELEKKAAFKCGTFGASSLRERHLATGNFEGYLQLWDLQR
FT                   PEKPLMDVKAHTSIVNAIDGAGGQRSGYGPPELVTGGRDGCVRVWDVRQKDAPVAIFEP
FT                   AEGVKARDCWSVAFGNSFNDEERCVLAGYDNGDVKMFDLRTGTVRAEHNVRNGVCSVEF
FT                   DRKEIAMNKFVVTCLESAFTVFDARTQHPAKGFSSVTEKVPVSATVWGAKHLPQNREVS
FT                   MVLGGDGTLMLYKYQYPDQRVVKDKDGVKMGVAGTMNLVNSKNVSTQPISSWDWSPDKE
FT                   GLAVCGSFDQTVRVVCATRLNTL"
FT   gene            <665607..>667811
FT                   /locus_tag="MICPUN_56919"
FT   mRNA            <665607..>667811
FT                   /locus_tag="MICPUN_56919"
FT                   /product="predicted protein"
FT   CDS_pept        665607..667811
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56919"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1L9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1L9"
FT                   /protein_id="ACO61764.1"
FT                   /translation="MNRRGGVAALIALAMVTFVYLAYVSGVGNMYLPSESVASTTSSPV
FT                   GRVAIPARIANPSPPAPAPLVDERPEPAPEPRASPAPTSPAVVRDDRKDEGRKLPMECP
FT                   MVDVADPENVAAVARSLGDASDVVVFATQDIEHWRAEFLVNVILNLMSVNVTSVVTVGR
FT                   HKHTCESARRDNPDVVRCCVYSTWLDGHDALKRWTLAEDHAYVLWLIRYRFALDIMRAG
FT                   EVGVLVSDSDMWFERDPFELLKDAATGLGTHSVVANVEGEPFPSMNGGLVYFRADLPGK
FT                   GGRYLLEVFNDHVDDLLADESPPECHKEQGVGTQVVWGAMMDQDILRDAAETAVAGAPL
FT                   WWSYTHHVCLFKGGYDEATKAKMEIKSKHPETLDWSRSGRSLPRPFQSHPAVEALGDEH
FT                   PLNESEEKYGIMKVPNYETWRNLTILAAPKWMFANHGDGDGWFALRPRPGAAFHCMSQN
FT                   QGIKPRMLRAYDMWHWDVLGAGRGIRVGQGRYLSLASAAFGHFTKRGEFAMQAHRLAAL
FT                   AAATGRIPVLPMIPCASPWLDDWRRPDDCYAGVLERINVLAGTCPVTALRQFQGPDAAY
FT                   PGDPAAEGSVGSPCCYFVPPGDDCEEKFAAWGAEMTGEDPHNRPGRTVRLDAIIDAAQL
FT                   VVDAGDATEYADRSWVLGDDFPPDNAKHPTDVFVDFGRVVKAIEGDGDQNTPWVEIDMR
FT                   GKDALPRVVTQRGVDDKSRRKWFMDYNAACPLVNRVSPMV"
FT   gene            complement(<667974..>668336)
FT                   /locus_tag="MICPUN_56920"
FT   mRNA            complement(<667974..>668336)
FT                   /locus_tag="MICPUN_56920"
FT                   /product="predicted protein"
FT   CDS_pept        complement(667974..668336)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56920"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1M0"
FT                   /db_xref="InterPro:IPR008381"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M0"
FT                   /protein_id="ACO62191.1"
FT                   /translation="MMNEAARPIVSLYRQILRAHYKCLPPPMRVLGDGYAREEFRRHLD
FT                   SKSMTNDRWIEFASEWSRYLANVAPKEEGAGPKFTGELSKETIDAMSEEQRMMLRKLKE
FT                   EAQSFGESVKADEETK"
FT   gene            complement(<668395..>668649)
FT                   /locus_tag="MICPUN_56921"
FT   mRNA            complement(<668395..>668649)
FT                   /locus_tag="MICPUN_56921"
FT                   /product="predicted protein"
FT   CDS_pept        complement(668395..668649)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56921"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1M1"
FT                   /db_xref="InterPro:IPR005683"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M1"
FT                   /protein_id="ACO62192.1"
FT                   /translation="MEIQPAAEPNRSSKPFGAADAWHVSKKLAWHTGKAAWQFGTSFLI
FT                   LVVPLVIQLHREEQMMALEQEQMGVLQSPTGNAEPTPTA"
FT   gene            <669430..>670904
FT                   /locus_tag="MICPUN_56922"
FT   mRNA            join(<669430..669562,669808..669979,670325..>670904)
FT                   /locus_tag="MICPUN_56922"
FT                   /product="predicted protein"
FT   CDS_pept        join(669430..669562,669808..669979,670325..670904)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56922"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1M2"
FT                   /db_xref="InterPro:IPR006861"
FT                   /db_xref="InterPro:IPR039764"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M2"
FT                   /protein_id="ACO61765.1"
FT                   /translation="MANMANMFALLDEDAPKAAPAKENKPAAAAAPAKKAPAKTGDKPA
FT                   GNRNNGNAKRAPRAPREFEGSVEGTEGGRSRPRNADRRKPKDGEGGRRDRADRSGRGHE
FT                   GPHRGGAGKGGWGKPGDELNAPKEGDDAEPEPEPEEPDNEISIEDFEAAKAAKKAALNA
FT                   AMAKGATAKEVDSSAFASMTLAAKSEDVNEFSLDGAGPKAKRERERKAKEAAKLELGFK
FT                   SAPTAPAEDRPARGPGGRGGRGDRREGAGRGGRGEGRGGRGGRGGDRPAGGRGGSGLNV
FT                   KIEDSSAFPTLGK"
FT   gene            <671829..>674036
FT                   /locus_tag="MICPUN_79742"
FT   mRNA            join(<671829..672601,672665..672710,672744..>674036)
FT                   /locus_tag="MICPUN_79742"
FT                   /product="predicted protein"
FT   CDS_pept        join(671829..672601,672665..672710,672744..674036)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79742"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5694 - chromosome; GO_function:
FT                   GO:3677; DNA topoisomerase (ATP-hydrolyzing) activity - DNA
FT                   binding [Evidence 5524; nucleic acid binding ] [PMID 3918];
FT                   GO_process: GO:6265; DNA modification - DNA topological
FT                   change [PMID 6304]"
FT                   /db_xref="GOA:C1E1M3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M3"
FT                   /protein_id="ACO61766.1"
FT                   /translation="MPSRGASSSVTPREAIAVGDEEAGGAPRDNTGDIIAAKAAAKAAA
FT                   AAATGGSDAYGASSIQVLKGLEPVRKRPGMYIGNTSTKGLHHMVWEVLDNGVDEVQAGH
FT                   ASLITVTVEADGSVAVEDDGRGIPTDVHPATGTSSLETVLTVLHAGGKFGGDESGYHVS
FT                   GGLHGVGISVVNALSDSTEVTVWRGDREYRQSFSRGAALAPMTEGSQDVANVGKKKGTR
FT                   VRFKPDPSIFKERQDFDPNIILARMKELAFLNSTATDEASMDEGDVKKTEEYYEEVLSF
FT                   PGGLKDYVVDLNEGAEPLHEPITFRAEVDGVQVEGALQWTKEAYTDTLLGYANSIRTSD
FT                   GGTHLDGLKQSLTRAVNTQARKAKLLKEADANLGGEHIREGLSAVIAVWVPQPEFEGQT
FT                   KTRLGNPEVRKVVESVIGEQVSEHLEFYPNTLGSIFSKASQAQKAAEAAKRARELVRRK
FT                   SVLRSGSLPGKLSDCSVSDPESTEIFLVEGDSAGGSAKQGRDRRFQAVLPLRGKILNVE
FT                   RKDEASMYKNTEISSMVTALGLGLKGEPFDESQLRYSKIVILTDADVDGAHIRTLLLTF
FT                   LFRYQRGLFEQGKVYVAVPPLYKVESGRAGKNNPPTYCYDEAQLQAHLATLPEGASRSI
FT                   QRFKGLGEMMPEQLWSTTLNPETRLLKRLTVDDAAMANKTFQLLMSDKVAPRREFIETE
FT                   GPKLEDIDV"
FT   gene            <674186..>674542
FT                   /locus_tag="MICPUN_56924"
FT   mRNA            <674186..>674542
FT                   /locus_tag="MICPUN_56924"
FT                   /product="predicted protein"
FT   CDS_pept        674186..674542
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56924"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M4"
FT                   /protein_id="ACO61767.1"
FT                   /translation="MASLRLSSVTGSGLLLRTGGGSGGGRAGGGRWQSHWQPTTRSTSS
FT                   SSSSSSSSSSSSSSCSTTTTSSSSSGIRSSLCARRPRMFCPQNNPERQPPGRSCSCLSL
FT                   RRLITLYSYCSPSS"
FT   gene            complement(674808..676329)
FT                   /locus_tag="MICPUN_106801"
FT   mRNA            complement(join(674808..675555,675803..675961,
FT                   676280..676329))
FT                   /locus_tag="MICPUN_106801"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(675001..675555,675803..675961,
FT                   676280..676282))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_106801"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1E1M5"
FT                   /db_xref="InterPro:IPR005998"
FT                   /db_xref="InterPro:IPR012988"
FT                   /db_xref="InterPro:IPR016082"
FT                   /db_xref="InterPro:IPR018038"
FT                   /db_xref="InterPro:IPR023106"
FT                   /db_xref="InterPro:IPR035808"
FT                   /db_xref="InterPro:IPR036919"
FT                   /db_xref="InterPro:IPR039699"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M5"
FT                   /protein_id="ACO62193.1"
FT                   /translation="MPAVPETALKRRKRDEAWAANKAKAAAEAKAKAEANKKEIFNRAE
FT                   KYVKEYRDQEADLVRLKREARAKGGFYVEPEAKVMFVMRLRGINDMHPKTRKIMQLLRL
FT                   RQIHNGVFMRVNKATINMLRKVEPYVMFGYPNLKSVKELIYKRGYGKVNKQRIPLTDNS
FT                   IIEKALGEKGIICIEDLIHEIYTCGPHFTACSNFLWPFKLSAPLGGMTKKRLHYIEGGE
FT                   AGNREDKINALIRRMN"
FT   gene            <676751..>677823
FT                   /locus_tag="MICPUN_56926"
FT   mRNA            join(<676751..676843,676963..677072,677214..>677823)
FT                   /locus_tag="MICPUN_56926"
FT                   /product="predicted protein"
FT   CDS_pept        join(676751..676843,676963..677072,677214..677823)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56926"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1M6"
FT                   /db_xref="InterPro:IPR005491"
FT                   /db_xref="InterPro:IPR033485"
FT                   /db_xref="InterPro:IPR036142"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M6"
FT                   /protein_id="ACO61768.1"
FT                   /translation="MGAGVGEQVRKLELDAYQAFLKVTAVTGMSWERDDLATKLRQELN
FT                   ISNDDHTRIREKLSDDERIKTIRENWKQREINQAAKKARIDAGGFTGAKTPKAPASAKP
FT                   KAAPKAKTPKGPAAAPIVVNELICRRVQRFWPDEGGWFDAIITDYRPTTNEHCLTYEIN
FT                   TPNETFEWADISQFDGREFKLLEDRVNIEDLKFYSQGMKVGAETATHNQAIVATHAAVG
FT                   DVNKIVQKAAKTADVDKIVEAKGTLSAQEEALRAQLAALDSDSDSDED"
FT   gene            complement(<677928..>678767)
FT                   /locus_tag="MICPUN_79533"
FT   mRNA            complement(<677928..>678767)
FT                   /locus_tag="MICPUN_79533"
FT                   /product="glycosyltransferase family 2 protein"
FT   CDS_pept        complement(677928..678767)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79533"
FT                   /product="glycosyltransferase family 2 protein"
FT                   /note="distantly related to b-glycosyltransferases"
FT                   /db_xref="GOA:C1E1M7"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR026461"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M7"
FT                   /protein_id="ACO62194.1"
FT                   /translation="MRLSVVVPALNEERNVARAVASAREGAGAADHFEVVVVDGGSDDA
FT                   TVSVAHSAGADAVLVSPERGRAAQLARGVERCSGDVIVFLHADSTLPDGYAEKLRDAMK
FT                   PEHSWGAFGFRLAPEERDDDDDAADPSTAARGSKGPGGGTARRFLEWCVDKRTKWLGAP
FT                   YGDQGVWVKRHALDSVGGVPQQCFMEDYELVKRLRRRHGMPCVVDAAVTTSSRRWDAMG
FT                   VARVTALNQLIVFGYAMGVAPERLARWYTAGRNMGGGTKRWDTRAEANAEATKVEER"
FT   gene            <678958..>680428
FT                   /locus_tag="MICPUN_56928"
FT   mRNA            join(<678958..680351,680392..>680428)
FT                   /locus_tag="MICPUN_56928"
FT                   /product="predicted protein"
FT   CDS_pept        join(678958..680351,680392..680428)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56928"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M8"
FT                   /protein_id="ACO61769.1"
FT                   /translation="MRLTCALLVMMFSVTRAVGASSVSSWAAVACPSRVVTKEDVGKPI
FT                   VLLGAWVRAGNGTDGSKDRHPSIASLRITSNPRHGALYWRAKPVLEGDAVPAEMGWERC
FT                   SEVSSRAFADAWPVGDPPLATPEWPCDVVVNANAPSPTHAAAAAAGVVVQPICAEVLYA
FT                   PDANYHNWPSGVDALGNRRVPGSNPTRDEAPDAFGFEFDLVAGDASAAGGAGGAADAMS
FT                   SSAASAASVLVAAVPDAPALTYTAAPIEDGDVAREGDRPALHAALLTRTRVRGIALRDV
FT                   DEGSFAVTVRIQSAVGNYVSVAGAGADVLARAVNPFRLGDGVMDAGVMEFTALPEDAAR
FT                   MLAALEYVHVVDDVYDERGYATDTVTVTATGGACLRSDDSFDDFSDAGEVTRCPRAADV
FT                   GATSVYVKVIVSGRVKDLGERSDPAWRRGFSSLLPIAASLAAATAWSAFAMWSGCAWAL
FT                   ERAGLGGAALGRRRARGA"
FT   gene            complement(<680971..>681759)
FT                   /locus_tag="MICPUN_70072"
FT   mRNA            complement(<680971..>681759)
FT                   /locus_tag="MICPUN_70072"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<680971..>681759)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70072"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5677 - chromatin silencing complex;
FT                   GO_function: GO:3677; zinc ion binding - DNA binding
FT                   [Evidence 17136; NAD binding ] [PMID 8270]; GO_process:
FT                   GO:6342; regulation of transcription, DNA-dependent -
FT                   chromatin silencing [Evidence 6476] [PMID 6355]"
FT                   /db_xref="GOA:C1E1M9"
FT                   /db_xref="InterPro:IPR003000"
FT                   /db_xref="InterPro:IPR026590"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1M9"
FT                   /protein_id="ACO62195.1"
FT                   /translation="LEEREDPPEVMMEHVAVLVELIRQRGTFVMHTGAGFSTAAAIPDF
FT                   RGRDGIWTQQAKGRAVPMPRFENTKPTKAHLAAVALHDAGYLTHVVTQNVDGLHQRAGM
FT                   PQHAVSELHGSVFRELCRNEHCPMGPTPRDRTYHRAFDVTSTKRHNGRHRHRTGRRCDA
FT                   CGGDLHDVVVQFGEHLDDETLKTAIAASEASPLALVCGTSLKVPPASTLPRRSGALVVC
FT                   NLQWTSQDKHAALKIHARCDDVMLAVCGHLGIDVPEYDPSR"
FT   gene            <682105..>682584
FT                   /locus_tag="MICPUN_56930"
FT   mRNA            <682105..>682584
FT                   /locus_tag="MICPUN_56930"
FT                   /product="predicted protein"
FT   CDS_pept        682105..682584
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56930"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:30529 - ribonucleoprotein complex;
FT                   GO_process: GO:16071 - mRNA metabolic process"
FT                   /db_xref="InterPro:IPR001163"
FT                   /db_xref="InterPro:IPR010920"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N0"
FT                   /protein_id="ACO61770.1"
FT                   /translation="MAGTTAEDEDRDRRPRKSPFQKLRREQRSLLCFVQALVGHLVVIE
FT                   TRDDVTTRGTLVEVDERMNCTLEGAQRVTVEQALEKKNSKFDRMFVRARLIRYVHVPAR
FT                   VDPAELIERRRQEEFDASRHYQAKVVFGPINPSPYDNSEEAQKIRAERAKGYAKH"
FT   gene            complement(<683015..>684607)
FT                   /locus_tag="MICPUN_66542"
FT   mRNA            complement(<683015..>684607)
FT                   /locus_tag="MICPUN_66542"
FT                   /product="ATP-binding cassette superfamily"
FT   CDS_pept        complement(<683015..>684607)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66542"
FT                   /product="ATP-binding cassette superfamily"
FT                   /note="(Uup homolog/duplicated ATPase); GO_function:
FT                   GO:5524; ATPase activity - ATP binding [PMID 16887]"
FT                   /db_xref="GOA:C1E1N1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N1"
FT                   /protein_id="ACO62196.1"
FT                   /translation="RNVDIALNAGQRVAVVGPNGSGKSTLLQVLAGKDAGREDGELWVR
FT                   KGINTAFLEQEPPFDEELNVLEAVYTRDTPLFRLLRRYDGMMAKVAAGEEVSENAMANI
FT                   LEEMDSNNAWDTENKAHMALEMLGCEEFMNRKMGELSGGQRKRVALAAALIEEPDLLVL
FT                   DEPTNHLSVEGVEWLENRVNEMTNTAVLLVSHDRAFIDNVCPDILELDGVGGSHRHRGG
FT                   YAAYLEGRAARWAAEEQARAAARNTLRKEQEWMRRQPKARATKEKARIERFYNLTERAA
FT                   DKGSKTKMVDLVESRQLRMGDIIVEFDMATLAFGDKKILDDFTYSFVKGDKIGLVGPNG
FT                   AGKTTFLRTIMGEIALDSGWCNIGETIEFGYYSQMPEFRDPTQTVVDFVKEVESDAKGY
FT                   VGSYGGEGGKMSAYKLLERFNFGGPKQMTRIGDLSGGEQRRLQLLSVLAKCPNFLILDE
FT                   PTNDLDLDTIEALEEMLEDFDGCVIVVSHDRQFVNNLVDHIFVFEGDGIINDWSGDYTA
FT                   LREFLRRLEEERES"
FT   gene            <684953..>685579
FT                   /locus_tag="MICPUN_56932"
FT   mRNA            <684953..>685579
FT                   /locus_tag="MICPUN_56932"
FT                   /product="predicted protein"
FT   CDS_pept        684953..685579
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56932"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006917"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N2"
FT                   /protein_id="ACO61771.1"
FT                   /translation="MSASLRAAAPVARPRAPVRFRRRAPAVIRAATTADADSPPYQVAA
FT                   RKDLYELRIYGGHYVCRAPYNNREKGLAALMSYIEGGNEESKTFPATQPLIMRYECAPG
FT                   TEDVVGKTMELSLGAGVADPPASAEPEAVGVAAAGGELVAVVGFEGVATPELAGEYRRL
FT                   LTAAIRSDGLELAEPDGFRLATYGQLYSLKPRLNELMLKVKPPGA"
FT   gene            complement(<685629..>686441)
FT                   /locus_tag="MICPUN_99453"
FT   mRNA            complement(<685629..>686441)
FT                   /locus_tag="MICPUN_99453"
FT                   /product="predicted protein"
FT   CDS_pept        complement(685629..686441)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99453"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="GOA:C1E1N3"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="InterPro:IPR039577"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N3"
FT                   /protein_id="ACO62197.1"
FT                   /translation="MEVPHSPHWSPLKDLTRISDAGATEDERTVHASVELKSTETEIKS
FT                   HRCPICYQTMLMPKRAPNILMPCGHTFCNACLNARDDPRCRTCGDRWRHRVPNHQLQTT
FT                   IQAYVDATATAAASFEDSVIWTSGDRGAPVASSSFDAALARAHVRCEQLRERMREGEAA
FT                   QTAALHREDVEARHLLVLQCDEDNARVRLAEVARELREAHAAVEAQRAVCAGIANEVRI
FT                   HGSSVRSAGEALAAVERGRERLVAEAEGSADGRTKPATLPGTHTAVSR"
FT   gene            <686953..>687696
FT                   /locus_tag="MICPUN_56934"
FT   mRNA            <686953..>687696
FT                   /locus_tag="MICPUN_56934"
FT                   /product="predicted protein"
FT   CDS_pept        686953..687696
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56934"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N4"
FT                   /protein_id="ACO61772.1"
FT                   /translation="MVANKPGNLDGETAGSTVWTPPNELVVAAARARDAVAPSAERSAL
FT                   LKEKERQRSKRRRENATAEQRAKERARSARRRNALTPEEKQAQALKRAERRKERKANGT
FT                   LPAPKRAHRPLALAGSPERPLALRAAGEVDPATPGELGTFVEAVTAAAGAKATGAHIGK
FT                   GLTADDDAGDLRAVVPQIASATERRTPKKASTEEQRAAERNRSKMRRAAMTDEQRKKES
FT                   QARAERRRRSKALAAGGGGDGATAE"
FT   gene            <688189..689904
FT                   /locus_tag="MICPUN_56935"
FT   mRNA            join(<688189..688287,688443..689904)
FT                   /locus_tag="MICPUN_56935"
FT                   /product="predicted protein"
FT   CDS_pept        join(688189..688287,688443..689825)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56935"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:151 - ubiquitin ligase complex;
FT                   GO_function: GO:4842 - ubiquitin-protein ligase activity;
FT                   GO_process: GO:16567 - protein ubiquitination"
FT                   /db_xref="GOA:C1E1N5"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR013915"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR038959"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N5"
FT                   /protein_id="ACO61773.1"
FT                   /translation="MFCSISGTTPEDPVISSKTGHLYERSLITKALQETGECPVTKTPM
FT                   TLEDLLPVKSSTTVKPRTTAAASIPGLLSIFHNEWDALMLETHELRVDLHGTRQELSHA
FT                   LYQHDAACRVISRLMKERDEAREALANARAAGPSAAPGKRAMSSDAMDVDGDAPGGDGK
FT                   KQRSGVPPEAIDAMTAKSKELSKARKKREISPTLASAEDIGKMEVGAIAPCHATKAKGI
FT                   RAVCVNPLNADEVATGGADGSLALFDAAKGKRGALMTGHKKAVTDVAYAGDAILTSSAD
FT                   KTVKIWRGGAEVAALAGVHEGEVVAVSAHPTNAYAVSIGGDGAWAFVDVGAAECLSVQR
FT                   DADSEYTCGGFHPDGLILGTGAADSSVKIWDVKTSKVAAKVEGHVGAVSAMSFSENGYY
FT                   LATCANDGVKLWDLRKLKNFKSVEAAGVRCVRFDHSGHYLAVGGADACVHNVKAEWEVV
FT                   KRWEASKAPVNALEFAADAKALYAGCSDHNLRVIA"
FT   gene            complement(<690471..>692339)
FT                   /locus_tag="MICPUN_99456"
FT   mRNA            complement(join(<690471..692117,692259..>692339))
FT                   /locus_tag="MICPUN_99456"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(690471..692117,692259..692339))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99456"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N6"
FT                   /protein_id="ACO62198.1"
FT                   /translation="MTTDGDPRGLPNSHVEGISEGQILSMEGDELAAHDNLEEALDRYD
FT                   RALLADRKQHGDTHPDVAARYCSIGGLYKATGDNEMAREYFAKALEVEESTGTDGRRTA
FT                   RASYMSNLAAVSRAAGDVDLARDQYCTALDHLRGMIPDSNEAVETALSREEASLFRVSG
FT                   DTSTSGYGIGGEGVAAPSPKLLGEGGVLNVAASILNNLGLLLKSIGRLHAARRCYVRAI
FT                   SLGAVALGAHSPAIALRVRNLGAVLLQLGYVDLAVERLTRAHGACVLGHGADHPETIMC
FT                   AEWLQAATETADLDAHAHAHARGVGSDPDETLPEAAEWFCERLRCGVLEPTPEPSLPGE
FT                   ERAIEAIDPAPIGLEDAMVPAVEHATRDAEAAGVGHSHAGTGKTFGVGTPGLDASESQT
FT                   RFNPVEPPPGEDMLSPYAAPVTSRELKRVGNAETSPVWRAVALEHEAIVSGKSSMPRGQ
FT                   DYISAYLRQAPGYANLITPFQEMPSDLLMPYASFRGYGAPLKSGAARQGKGEPRRHQLP
FT                   KRTLDERGVASSAGTAPRPRAIEVREEEEETTPVAQVGLGGRAGESRSGGRNMYAYPD"
FT   gene            <692526..>695225
FT                   /locus_tag="MICPUN_99457"
FT   mRNA            <692526..>695225
FT                   /locus_tag="MICPUN_99457"
FT                   /product="predicted protein"
FT   CDS_pept        692526..695225
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99457"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N7"
FT                   /protein_id="ACO61774.1"
FT                   /translation="MASSFKWDHPNGRGVLLPGQTHCHTGKLVPFDDYDLDATCELVCS
FT                   PCGRFPDPDAPVRVKGTAHLAGAMVGKSADKENRDARTNVPPMETAGWALMGCKPCGSA
FT                   KRWSCCGTCAGGCRMWSEEGYVMTGGPKPPDDDADATDDDDGAPKLGGPLEGTPDAAEF
FT                   ASWDGCVAIPTPAVVPLPEPRLEGAHGERIARLTVGRGAVTCIAVSGCGTRMACGGSDG
FT                   SCVVYAIDPSADDLAPEFLCAAYPGKPLTKPRTRRQKNANAVVCLDSDSDVEDPTEAGL
FT                   DADELAEKRERDAAEAARVESEVTEGGHAGAVSCVAFHPDAASFYTASADGTCKRWKIP
FT                   VVSNSAHATALMSTYAHKRTEERGAVRCLRVSDDGARLYVGGEEACLAVYDAGSGDVIA
FT                   RTYSPRWPEKDKDGLGVPPVDDEDEDPEAAEKAAKAAEARAEREAAMTPEELAAVLDAE
FT                   AAAAEAKAKYLEEKRYRNKPKGFGGVNTVLCIAGGAGESGDLVFTGSRDCNVRRWAVSG
FT                   DAPVVERVIPGHKAPVTAIAVSRDGSELVTGGARGDGELRHYRWQPVAGVDAEYVDGKL
FT                   KSSAGSYVRVRTIRRGPEGFKESAHPAGVLAALISPDERYLYTVGANEGGVEVAISRWS
FT                   VETGAEDKDFRIETNHQGGVTSLCLFPDVAPPGSDAAVGVAAVTRATAARAGGRILTGG
FT                   ADGCVDLWTAERHDDGAGQQLAAEIAQQEAAMTATEYQRAQVKLTALSPELSRPAMAAR
FT                   GRKELPALEAAKFPIDEETGTKKDLEDFTVEDFEPFTSKELISMCCAHGLLFIDPKKPP
FT                   ESKRAIAERMVAFFREEKEKARIAAREERMGLAQPAKLRARPRIPGIESPEEKKKPTSG
FT                   DEESEASETEVSETELSETEEEAKKDDE"
FT   gene            complement(<695284..>696183)
FT                   /locus_tag="MICPUN_99458"
FT   mRNA            complement(<695284..>696183)
FT                   /locus_tag="MICPUN_99458"
FT                   /product="predicted protein"
FT   CDS_pept        complement(695284..696183)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99458"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR012668"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N8"
FT                   /protein_id="ACO62199.1"
FT                   /translation="MAPEKEPLEPSWLAQVKELLGPHKRYHRAQTEDALPSGVKVEQAS
FT                   RFPKEVAHFTRWKIIHIECSRWDADAMMKRAEVHVVDLVDAATIKLNPALHSHALELEA
FT                   ADDGLVVSNRGGFHSKPDAVQKLSDCGCEEATQIMNLVRSCVMYEPGKKARHENDAKVT
FT                   TAWINVCRNGHTHGLHSHEPAKFSAVYYVSVPESKEEEEEEEDSLSGHLVLRFGSGGNE
FT                   GDPALGLEDDSWCLWDHVEPKEGRLVIFPSSMPHGVLKVSTAADEEKPRISIAFNTGEK
FT                   NVNLEKYGKKNKKRKKTE"
FT   gene            <696428..>697309
FT                   /locus_tag="MICPUN_56939"
FT   mRNA            <696428..>697309
FT                   /locus_tag="MICPUN_56939"
FT                   /product="predicted protein"
FT   CDS_pept        696428..697309
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56939"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:3824 - catalytic activity"
FT                   /db_xref="GOA:C1E1N9"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1N9"
FT                   /protein_id="ACO61775.1"
FT                   /translation="MKTGPPAWAVDASIVFALVYLAGSLELVEPFERYLVPETLPKYSY
FT                   PFTTDQSVPTWTLPFLGVFIPLGLIVSVAAFTGAGWLEIRRSIAGLCVSVSLGWAVTNL
FT                   LKVSIGGYRPDFLYRCWPDGNVAWASPGVPACTPTNPRHVIEGRKSFPSGHSSMSFSGL
FT                   AYAAAYATARLEVFSPYDYGVVGVHPRDRASMLRMALAWWPLALATYVALSRWRDYWHH
FT                   SEDVICGSLLGTGAAYLAWVTKQPLAGAGARGAGGLRREGRDYAPIGAESGEGSADSAR
FT                   LDRMEGRGPRSE"
FT   gene            complement(<697428..>699731)
FT                   /locus_tag="MICPUN_99459"
FT   mRNA            complement(<697428..>699731)
FT                   /locus_tag="MICPUN_99459"
FT                   /product="predicted protein"
FT   CDS_pept        complement(697428..699731)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99459"
FT                   /product="predicted protein"
FT                   /note="Encodes a protein with hydroxyproline-rich
FT                   glycoprotein (HRGP) motifs at C-terminus"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P0"
FT                   /protein_id="ACO62200.1"
FT                   /translation="MSDPEDEEPAMEEEEEEELEVEEGDEEQFEEGEEGEELEEGEEGE
FT                   MEEGEEGEEDLEEGEEEPEEEPEEGEYEEEDDGDVADEFSEERPDASPEGRKSKSSKGG
FT                   RSSKGPDPEYPTEPESDSDDDALSRRRRKNKLSKAARDPYRFVRDSDDESISSGRDRRG
FT                   GEPWRTKMDGKTEYNTLANEVRNYSMHRPPGPDGRAHRMEDLPVKLAFEHLSSLAGMSE
FT                   KVQNAINLSRNLFQRRVDKMEKGVMFKAWRGWLLVQHDFNNKRNILTRAVNKMKRRRLY
FT                   KAFSKWAELHNKAHRPSHFDKAARAVVLGGCRRRTFGAWREHTKDVRRQFKMAAHTARM
FT                   REEFLERLVEAGLRQVMHKRIRRAWDAFDKFSEVRRAKRNKARQVIGRAMNREQARAFG
FT                   RWREYVAQLNKQHGQLKRAVARMSKATMARAFDAWQGQQLHKKRCLMKIIKGTQARAFA
FT                   KWQDNLRLLRKARIVFARWNQRTRYAAFNGWWLNVEEKRRQTEMCSKICKRILNRAVRN
FT                   AWAQWMYCVEQSFGCTLEQVKALRDQNARLRRDNERFVRLVDSGEWGRGRVEELSEAGR
FT                   LLRDERKQLEDLIRSIKDEKDGFVKDAELQAREARALKDRLVSGNFVQRNKLNVRGGSA
FT                   FNSMQRVLKQDLIDSGAAARQRHMLGGAVHNVDRLAMDKVSVFADGEIQMQAVKRAPPP
FT                   FARGGARRPAPPPLRAAPPPVPMPRTTAPRPASAPRDEEGENVLVEALSSLTADEVDAL
FT                   EDILKRGRTDAALV"
FT   gene            complement(<701033..>702871)
FT                   /locus_tag="MICPUN_52217"
FT   mRNA            complement(<701033..>702871)
FT                   /locus_tag="MICPUN_52217"
FT                   /product="predicted protein"
FT   CDS_pept        complement(701033..702871)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52217"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1P1"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P1"
FT                   /protein_id="ACO62201.1"
FT                   /translation="MSRKYEPDAVADTPAAASWTHALAGYDETLRSRGSTFRLTFPLDQ
FT                   FKRPIHDPRSTSRATALASAAWYLGVFAFAAFAVYAHVTRPTVTNLVLLPSTALPPLPL
FT                   TLRTRCSSPWACTPGATPLPGATHIGPCRYENPYNRTYACAKHAHNILDGPELDANGAE
FT                   VWPNLTDTPTSAGAGGRRRLLNDHLWTWTRAATATQAYKSPTSRCDAERVATVTSWGAE
FT                   ASALDLTDADPRVYAGFDPDAMARRARDPNAAVDELFAALDEDASGFLDGAELDVLGPF
FT                   ARIMLKLNNFGDYHEGNATFAGGFKDIEDFTGPGSTTGVIERGVVDEMRTYLAGFGYEC
FT                   TWCVTVDDYRNALRYVWDSTKANWNGFVANVDPLYHPWSYVLSGDAFYPTTSVGVDAFP
FT                   KDGRVSPAELREAFRYMLAHQTVTPWAVAQAVSAALDANPDAAESAAMQLCSADVAAGD
FT                   DALGGILVETTFPPGCPYGSESCDTRLTIELGDGKANGMALRLDLEPGQRKAVQVGVTV
FT                   RRERGKPDAYELRADDLFYVGKNDDRRASLRVGVKQYAEALDTARPGTWLTVFAAVGGF
FT                   ASLSLSILSLGVGAIAALAERSESACACLGDAFGRG"
FT   gene            <703032..>703430
FT                   /locus_tag="MICPUN_56942"
FT   mRNA            <703032..>703430
FT                   /locus_tag="MICPUN_56942"
FT                   /product="predicted protein"
FT   CDS_pept        703032..703430
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56942"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P2"
FT                   /protein_id="ACO61776.1"
FT                   /translation="MNGDDILLKPSAETMSRSTTGDVMPQTEARAYALSLPPAQRSEIS
FT                   GCYCLKCVPCGSFPVAAHCVCGGSSLCWGCGTTPFACFAIPMPFIDPYFRSIKRDCVVM
FT                   VVNAEDQTLACYPGEQAEDPICIWSKLW"
FT   gene            complement(<703561..>704031)
FT                   /locus_tag="MICPUN_107908"
FT   mRNA            complement(<703561..>704031)
FT                   /locus_tag="MICPUN_107908"
FT                   /product="predicted protein"
FT   CDS_pept        complement(703561..704031)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107908"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:3824 - catalytic activity"
FT                   /db_xref="GOA:C1E1P3"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="InterPro:IPR039666"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P3"
FT                   /protein_id="ACO62202.1"
FT                   /translation="MPSSHAQLAAFVATMMTLQYVRRREEFRVFCKWNKRGTSGRAGHA
FT                   DAMTAALVVLAWPLAWTVGISRVYLGYHSVEQVVAGACVGCVFGAAYHELVCLAATKSF
FT                   ARLDVNDGGLGGAVARAVIGARMRDSSLVPDPLEVERVALQVNVLDFKEKSF"
FT   gene            <705048..>706004
FT                   /locus_tag="MICPUN_80272"
FT   mRNA            join(<705048..705256,705359..705587,705834..>706004)
FT                   /locus_tag="MICPUN_80272"
FT                   /product="predicted protein"
FT   CDS_pept        join(705048..705256,705359..705587,705834..>706004)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80272"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P4"
FT                   /protein_id="ACO61777.1"
FT                   /translation="MLREKADMGDPKAMSDLGATYFQGDELPRDHSTAFAWFERSATAG
FT                   YTLAFVNLATCYREGLGCPKDERKAEGAYWFRRGAEAGSLECSYRWGVCCATGTGAERD
FT                   FGNAAEAFRFAAERGHAGAALDLGHCLMNGLGIIGGAKKSMAAWYERAVALGVTDAAAA
FT                   LGRMHRDGVGGDETTRDLDEASKWFRISAAGGDDASAQAL"
FT   gene            complement(706251..>708724)
FT                   /locus_tag="MICPUN_56945"
FT   mRNA            complement(join(706251..708115,708218..>708724))
FT                   /locus_tag="MICPUN_56945"
FT                   /product="pyruvate kinase"
FT   CDS_pept        complement(join(707003..708115,708218..708724))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56945"
FT                   /product="pyruvate kinase"
FT                   /note="putative pyruvate kinase. ChloroP predicts a 17 aa
FT                   transit peptide, but with a low score. Reaction: ATP +
FT                   pyruvate = ADP + phosphoenolpyruvate; GO_function: GO:287;
FT                   pyruvate kinase activity - magnesium ion binding [Evidence
FT                   30955] [PMID 4743]; GO_process: GO:6096 - glycolysis"
FT                   /db_xref="GOA:C1E1P5"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P5"
FT                   /protein_id="ACO62203.1"
FT                   /translation="MANIQVDDILAGTPAVQCKTKVRAPSAPTTRDPPARFLTRLANYG
FT                   IPLAPEQIVCTLGPKSAELSIMEDLLRAGMSVARFNFSHGSHEYHQGTLNTLRQAMLNT
FT                   RLMCAVLLDTKGPEIRTGMLKGGKPVLMEAGREVTIHTDYTLHGDEHNIAMSYKKLPND
FT                   VAPGAEILIGDGSIVMVVLSCHPENGTVRCRCANTAMLGERKNVNLPGVVVDLPTITEK
FT                   DRDDILGWGVPNGIDFIAASFVRKGSDVRYIREVLGEEGKSIKIISKVENQEGLVNFDD
FT                   ILEESDGVMVARGDLGMEIPTEKIFLAQKLMIEKCNAAGKPVVTATQMLESMVKNPRPT
FT                   RAEATDVANAVLDGTDCVMLSGETAAGAFPVDAVRVMSKICREAEVSIDHYQLFKSILA
FT                   QVPIPMQPLESLASSAVRTAQKVRAALIVVLTHGGSTARLVAKYRPAVPVLTVFVPTLT
FT                   TDSLTWQCSGESPARQANLTRGLIPLLAEGSARATDTDTTDEILHAAIDHAKAAGYCAS
FT                   GECIVALHRIGNASVIKIVNIP"
FT   gene            complement(709112..710939)
FT                   /locus_tag="MICPUN_105273"
FT   mRNA            complement(join(709112..710307,710404..710939))
FT                   /locus_tag="MICPUN_105273"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(709621..710307,710404..710784))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105273"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1P6"
FT                   /db_xref="InterPro:IPR000637"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="InterPro:IPR017956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P6"
FT                   /protein_id="ACO62204.1"
FT                   /translation="MHPPPEGLSQAPAKRGRGRPRKDAPKPIPAPKEAPAKRGRGRPRK
FT                   DAPATEKTAPEKKPAKPNAAVKRRAPPAVKEVGQHSDDESLDELIAAEKAKERAPPPPP
FT                   EPAVENWTISMATPMGTLPVEVTSLVTVTDIKQLVTAKTGGRLPPDRQIIKLNERLIDD
FT                   FGPNATLANHGLKHRSMLTLTFIRNAKSPAKSPTVDRTREHSRALQTVPSPPREERPAK
FT                   ERRTGWQPESVTRRVGPRERDQSAQGTKHKWTREESELVAEGVAKYGYGEWAAIQKELF
FT                   AESARTSTDIKDRWRNMLKAASKPNDFKFRSFMDDDLREQINEAQNKADEYQQKKLMEV
FT                   ERQRQEMIRVRGQIA"
FT   gene            complement(<711058..>712947)
FT                   /locus_tag="MICPUN_79957"
FT   mRNA            complement(join(<711058..711630,711736..712143,
FT                   712198..>712947))
FT                   /locus_tag="MICPUN_79957"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(711058..711630,711736..712143,
FT                   712198..712947))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79957"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1P7"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P7"
FT                   /protein_id="ACO62205.1"
FT                   /translation="MTAARAAASALGAKTEIPAPRRPVGLSRAVRARPRRALAEDRDVS
FT                   KLSSPGRPRTLGWGRKRGSVGPDEDLLADPDTHGYCVYSHADWSYAYKSVAGEFDSIRD
FT                   GGDVVGTIPDELIGGVLYRNGPGLFERGGREYNHMLDGDGYVLRFEFSDAKTARFASRF
FT                   VRTKEFRAEEEADDVLYRGTFGTMRAGGPLRNALDLHQKNLANTNILAWGGKVYALYEA
FT                   GRPVELDPKTLETVGEVDLNGRLSGGMFAFTAHPHVDPNTGRVVGWGWTSAVAKRSVEA
FT                   TFWEWDKNWGEVASTEYSMSGCEAAPHDFAVTESWYVMIQNCLRVDPLLYLAGVKGAGE
FT                   CLVSQPEDPVTVHLIPRRDAGFDGGADKSGRAAVAAAGPRESFEIHLEPGSFLGEWSQS
FT                   AGWDFDIATSLSPDFNNIPRTLLWRYRINARTGTVFREPAPGCEDLCIDHPHVNPMFEG
FT                   RRECRYVYASISNEVRCSGPPLGYVRIDVATGKTQRWWAGNRTFCEEVVLVPKKGSDGS
FT                   PGSDDRCWVLGMCVAHDAEGAGRSSLVVLDGEDLGKGPVARVWLDNQIPHGLHGMFVPA
FT                   "
FT   gene            complement(<713118..>714548)
FT                   /locus_tag="MICPUN_56949"
FT   mRNA            complement(<713118..>714548)
FT                   /locus_tag="MICPUN_56949"
FT                   /product="predicted protein"
FT   CDS_pept        complement(713118..714548)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56949"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P8"
FT                   /protein_id="ACO62206.1"
FT                   /translation="MADPPPIRGILKKGRFSQPMPAVGAVDVGDDSTDVGNGRQNSDPP
FT                   TATSVDEQLPPGAQRAMTSSVAGAETSGGSDDGASCPRYFGSKSIRDSIAKHVGSVTKS
FT                   SQEVLELRKQFAGLAAAYDDDSESESGSDAANVPDDAFTLQEDRVHGGERGAALALLSP
FT                   VHPKMQPRAFGGEIQADEDPPAPPPPPPPAAAASAAPIGSRRSDGSTARGSSGRGLSRF
FT                   SRDLDVEAKDFPDVSVHSGEEPSPLPTPEVSKHGTNEAWLFIKDQSQQQRQREGRPPLH
FT                   LMNSGRSEATSSIGAESDDGSSAPTSRAGSARRSGSGMHRSASVVSFRGDGGSEESLHD
FT                   VHVIGSVSDLKKEKKGKKSSTFKWLKKEASALAYEFGLKKKKKACLEVDAKLKESRRNM
FT                   VDNLDDASVHNEGRRAWETRDVSLRGGGEFFHADVMRRSASSPKLQGGTTGLGDGDEAD
FT                   SPMSLPDGLERFTREENE"
FT   gene            <714866..>715874
FT                   /locus_tag="MICPUN_71399"
FT   mRNA            join(<714866..714985,715104..>715874)
FT                   /locus_tag="MICPUN_71399"
FT                   /product="predicted protein"
FT   CDS_pept        join(714866..714985,715104..>715874)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71399"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E1P9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1P9"
FT                   /protein_id="ACO61778.1"
FT                   /translation="MGGCLSQPANIQAPASVEIVFDRKVEDDYDIGPKLGEGVQGVVFS
FT                   GVCKSTGTKVAVKRTHIGSYGSSASRASAFAEIELLSYCDHPNVLRLMGAYQTGGDINM
FT                   VCKKVEGWNLIQYLIQLDKEEAAGRSAEDIAAEKMSLMHQLVDAVAHVHARDIVYRDLK
FT                   PANLMISEQKPRQLTLIDFGRATHLDRAARLEKEQPMGTSLFQAPEVEERAAYGQQSDM
FT                   WAVGVLVYLLISGGMPFEHSIAGLYKVLAGQYRPMDESFSPEAKDLVSRLLVVDPDKRL
FT                   NAAQCTQHPFFTREGL"
FT   gene            complement(<716984..>717385)
FT                   /locus_tag="MICPUN_56951"
FT   mRNA            complement(<716984..>717385)
FT                   /locus_tag="MICPUN_56951"
FT                   /product="predicted protein"
FT   CDS_pept        complement(716984..717385)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56951"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Q0"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q0"
FT                   /protein_id="ACO62207.1"
FT                   /translation="MVATRRTPAKGKAEPAAKTPAKKSAAGKKGAAGAKLDPDGNEMTP
FT                   VYYLRQYVGLFFTLLSFAFIAFAGYATQYGFSSANIFLYPGCAIGFVGLAFHELRPYKT
FT                   KAQMTFDPAAVEYRKKEIAEAEKRAKKSK"
FT   gene            complement(723369..>729780)
FT                   /locus_tag="MICPUN_93685"
FT   mRNA            complement(join(723369..725445,726241..726994,
FT                   727082..>729780))
FT                   /locus_tag="MICPUN_93685"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(723904..725445,726241..726994,
FT                   727082..729780))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93685"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8415; catalytic activity -
FT                   acyltransferase activity [Evidence 48037] [PMID 3824];
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E1Q1"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q1"
FT                   /protein_id="ACO62208.1"
FT                   /translation="MAGAASEASDLTTPLISGNQPAATFSSRGGNRRSGRRRASGESGA
FT                   GAHDSDGGSPAPRHSHVESPLAAADHEGITVEPLAPLADLLVEATNTRVRQGYLSGDWL
FT                   AERLPAYSSISDLIANSSRPAITPVDARASLTHTQLKDLIYRVDDELKTWGVTQAGSRV
FT                   GVAVPNGPELMSVLLSVIDRHTCVPVNPATTPQEMHEELRATGVVALVYQGGNEMAVTM
FT                   RKLCEKLKIVPLAITPDPNVGGLFSISSDAGDASGSRAGPGTYAPPDSDKNRTALVLHT
FT                   SGSTGKKKIVPISLHQLVLGATAIGASSGLGQNDVCLNFMPLFHVGGICRNLLAPIFAG
FT                   GSTVAMPFFDADDFWQTAVQKQCTWYYGAPTMHLLVVNSAKAMPTDQIPETKIRFIANA
FT                   AGPLLPSVAIELRKVFNGAAVLTSYGMTECMPIACPPPGYALERAGSSGQAICPEIAIV
FT                   DDSGERVANGRVAHIVVKGSIVTRGYENDPEATKASFHPGGWFKTGDMGWMDADGYLYV
FT                   TGRSKEVINRGGEIISPAEVEEALQSHPGVADVVAISIPHATLQETVAVVVVPTRGIQE
FT                   PGLRQLCQHASDRLPPAKWPQCLVLVESIPKLATGKVSRSAIAKSLDIQEIRDGMWELD
FT                   VTFEASLEVNAGRGSSGVAGHRAIATRDEATKRVAEALSKASGVEDTAACIDTTGSNAL
FT                   IGAVTPADADTEKVMSFACRCLPGFLEPKDVIAVDEIPRAADGKCDAQALLALWKGQKA
FT                   AGVNGAAFTATQRAVAEAWANTLNCDARTVGLDDDFFQVGGSSIVAGQLAADIRRKLSS
FT                   NLTGADIFRYRTVKEIAAKVEKEGGGTKDGNKTEGGLPPSMASKPLGPMEWTRSYSSTS
FT                   FFALLFQSLPLLVFAPMQKILRWTIFLNMAAGVDPENEHFHHLRLVAFFVALVFTGLIS
FT                   FVLFPVMTVMLKWTVLGRLKPGLHPLWGSVYIRWWLSNKAVEVSGFGIFGMSDGLFRIY
FT                   LRMMGARVGRGAKIGRLVRIADFDMLEIHTNAAVDDYAHLRAAEVRRGALRVAPVYLGP
FT                   GSTVCTRAVVGPGGVVPQGATLGPYMSWRELDVTNPKTMAQMEEHRKIARMRQPQPGFG
FT                   SQMLAWPIVFVCEVVAWIPWIFVFVVLIRSQGLYLSIPGQGGLHDCITWFMDPFRLGVI
FT                   FAARVGHNIFGPLLQLIWIVLVKWIVVGKFKPGPLPRTYLAREWELTRRWLMNKLLPKG
FT                   DFRGALAVLGKHYEYTSIVYRMLGAKIGKRVFWPGSGVLVADGMYDLVDIGDDVVWGSR
FT                   SMVFPADCTSSLPVSICRGANVSDRCVIYAGVTLMDDACLGSGAVAPRKMKYDYGSIHV
FT                   GSRNGACVQLDPGSKPDDSVPREPKPFGRAVYQRKATYFLPHWQVMPFVFSFFIALRTA
FT                   YSVMPIWVSWYLVAIITWDLGNNFWTEMPEWRYLLLLIFVYLWVNMIHVVVRFIIDTGL
FT                   KWLIIGRREPGLYPWDRSSYCIRWKIFESLCSDTLHSLRLIGGSAFLPFFYNIMGSRIG
FT                   RRVCLYPTGADPPMVEPDLVVIEDGACVNFTHIICHTNTLGSFALNHIVIKSGATLSTE
FT                   SRIMGGVVIGEDAVLLEHTMAMVGDVVEPGDIWQGWPVQAIAKADEVAKSAKDSAEKAE
FT                   KVHEGKVLPLGLKEMPKPHKSYGSHR"
FT   gene            <730852..>732429
FT                   /locus_tag="MICPUN_52223"
FT   mRNA            <730852..>732429
FT                   /locus_tag="MICPUN_52223"
FT                   /product="predicted protein"
FT   CDS_pept        730852..732429
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52223"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Q2"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="InterPro:IPR036893"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q2"
FT                   /protein_id="ACO61779.1"
FT                   /translation="MSPRRAAAKHAETETVDATPEAMENPAEEVVAEQSASGDPTKAET
FT                   VDGSAEVAKQGTKRKAEAGARMDDPSPKNEPTGSPEYNREDEMGGSKSRVCRVDGCDVV
FT                   FSTAHECRARACQKHCSALFVRLKGARPDEQFRFCYQCHKFHPLDNFRGPDGTLLARHN
FT                   CSQSQVQRLERRKRKDALKASKKMAEALGLNHPAQIEAVNLIGASNVGQLLLANQLVMH
FT                   ERLLAAIGAGGGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGL
FT                   GAAQGLGAAQGLGAAQGLGAAQGLGAAQGLGAAQGSGAAQGLGAAQGLGALQALIGAQG
FT                   VGAAGSAQANALNQQLGKQQLPQQLEALAALRQREQLAMLNQAAGVKGLAGTQLSGLGP
FT                   AVANGGLHGGAGVSAMLDAAVRQEKLNMLSATMANMVPSPAVGPAAASGLQGLQGLQGA
FT                   AAGLQGLQGAAAGLQGLQGAAAGLQGAAAGLLWLQGAAANAPGANLNGDILKSLMGQLG
FT                   HNGQNQPQ"
FT   gene            complement(732590..734089)
FT                   /locus_tag="MICPUN_107913"
FT   mRNA            complement(732590..734089)
FT                   /locus_tag="MICPUN_107913"
FT                   /product="predicted protein"
FT   CDS_pept        complement(732650..733906)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107913"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Q3"
FT                   /db_xref="InterPro:IPR000717"
FT                   /db_xref="InterPro:IPR013586"
FT                   /db_xref="InterPro:IPR035267"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q3"
FT                   /protein_id="ACO62209.1"
FT                   /translation="MADVAEGGEASATKDDTAGDNAGDGANAVPPTPPTPAQRELPETE
FT                   AYSHLLVLLLLLDANDPECKAASVAALNRLSQFNRRTLDALQARIVFYYSLAHERFGEL
FT                   AEVRPSLLALHRVAALRFDEMGQETILNLLMRNYLHYNMYDQAEKLRSKAQLPASRSNQ
FT                   QQCRYLYYLGRIRAIQLEYSDAKECLTQAHRKAPKLAKGFALELTKWITVVRLLLGEIP
FT                   EKKDLTTAVSGGAAAQRALLPYLELTGAVRLGDLEKFRAVQEAHEAAFRADKTTNLVTR
FT                   LRRNVIRTGLRRVSLAYSAISLDDVAQKLGLGEGDGDVEFVVAKAIRDGGIDATIDHDA
FT                   RTMHSSDATDVYSTGEPQAAFHARIAFCLDTHNEAVKAMRYPDKVKKGKGDGERKSAKD
FT                   RDLEELAMHIMDEDEMDEF"
FT   gene            <734863..>735816
FT                   /locus_tag="MICPUN_71596"
FT   mRNA            join(<734863..735075,735229..>735816)
FT                   /locus_tag="MICPUN_71596"
FT                   /product="predicted protein"
FT   CDS_pept        join(<734863..735075,735229..>735816)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71596"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR007085"
FT                   /db_xref="InterPro:IPR035929"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q4"
FT                   /protein_id="ACO61780.1"
FT                   /translation="IALVTSGGTTAPLERTAVRFVDNFSSGSRGAASAEYLLRAGYAVV
FT                   FLHREGSLRPFDRKIPDAARWFYDSLIDLGGHFDMINRGTLLAVPFTTLFQYLNLLRAL
FT                   CTEMSSVPKPRRVMVYLAAAVSDFYVPWERLPTHKIQSREAGDAGPSNLPGIDATDDGG
FT                   VVIRLSQTPKMLGHVRSAWCPNAFVVGFKLETDPDILLEKANRSLVKYRMHLVVANEMH
FT                   RRKDRVALVEPEGKSTWVNRPADVADIEELLIGELARRHAKFVEE"
FT   gene            complement(<735908..>739852)
FT                   /locus_tag="MICPUN_56957"
FT   mRNA            complement(join(<735908..739612,739742..>739852))
FT                   /locus_tag="MICPUN_56957"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(735908..739612,739742..739852))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56957"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR024761"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q5"
FT                   /protein_id="ACO62210.1"
FT                   /translation="MPWERVLRETPSPYPGAVAWSHENLIAVGQERSVCILNPADIDGP
FT                   AGCVSLVDDARAKPANANDEDADDHGDDGDGGVPFPELTRPRRSTSLLSTRVVIHPNHR
FT                   PEVVARDLAWSPLGLAPPAVSPSGILGDGCLLAIASSAHRVTVHAPPRAESDAEWAKVC
FT                   DVSEMFASVAEAEGWLDDGGDAFDRSAFETNRRPRLPSPQYARLLLRAREAPLALPAVA
FT                   NGGGGRGEKRTALPAAGVGEGSSGGGGGGCWPTEPAKFPADSLRVGAAVEVRRRASSGA
FT                   DSRGADSGAAGGWRPGTVQSLVSAFNFRVRVCFDEPVRGAPRCVWLVCENDGEFPALRL
FT                   DGEGASAAGCHEFPSQSLGFEGASGVFELRPAQSGWKDGVVGEAEVAMTRRGGWVPAFV
FT                   DKGGAWIKLGVRGEGERSNVPPGTIRSRPRMAWIGEGCAHGAWRKATDSDYSGYKLSDF
FT                   TFPEDEEDDEEDEDEEGEEDKEGEEDPVAPKPEPTVAKVTIPKETDVVEKEELPDAAPV
FT                   AVAHRPAASATGKTRGRKPGEHFAAAYANELRASAKAAAAKTAAECGANDAPVKAVEAV
FT                   FTAAKVGDDVFAAVNDVTKANKSRRNAGLKDIALRVCDAFLAARAGAGITRLYPQGKHL
FT                   DKNDDKPLLEKVEKLVWEKVAPRVQKNKDKVRKELKPPTQNGYQLEIRENITQADDNDE
FT                   EEDVPIARRARAARARPILPADEDEDEEDDEDDPDASNASSSDDDEEDDDEPKPKRQRG
FT                   RRASITAASSADPASAAAAARRAAAAAALSVAWSPRLDRRPDEPPASVLAVGCKSGAVT
FT                   LWLVRRPATAGDGGAVDVEAMGRFRACDGCATSLAWTGDVRLGESPPGESPQNGESPQN
FT                   GESSPGESPGGGGFALVVGGSDGSVRTFTVSRKSLLAAAGAEGGRRGRRATRAVPLTPG
FT                   AELSPADGDPVTRVAVADSVKIDSDNRAHARPVIAAGKASGTVAAWRLAAHDSTSAEAT
FT                   WSARCHVQPVSGLAWCAAPEIENCAAVRLVSMHTTGAAVAYTVPTDPRARHDDWTLTDA
FT                   CVEDLTVASIDGLDLNGNTAGGGAKLPVSSHAGLASSPAGVLVATAAGFVASTYASGAT
FT                   MIQSRARRGRVAVAPPAALAAGRVKSHSMTEISGDAASGKLDDGAADESLSVACAARRL
FT                   PFLASDRGVSLWDVRAAAKHAGAGGARALESAAGEMQSTGGARASQLAKSLLCGAPEMF
FT                   VGFEPLSCEGCGRGYPRGEGWPGCGDCGLLLRPEDVTRAALSRAMI"
FT   gene            <740045..>740311
FT                   /locus_tag="MICPUN_74510"
FT   mRNA            <740045..>740311
FT                   /locus_tag="MICPUN_74510"
FT                   /product="predicted protein"
FT   CDS_pept        740045..>740311
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_74510"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Q6"
FT                   /db_xref="InterPro:IPR005336"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q6"
FT                   /protein_id="ACO61781.1"
FT                   /translation="MASAIRAWINSPTGPKTTHFWGPVANWGFVLAGLNDTKKPEEQIS
FT                   GPMTGALTVYSGLFMRFAWRVQPRNFILLACHTANASVQVRALS"
FT   gene            <741564..>742499
FT                   /locus_tag="MICPUN_97151"
FT   mRNA            <741564..>742499
FT                   /locus_tag="MICPUN_97151"
FT                   /product="predicted protein"
FT   CDS_pept        741564..742499
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97151"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8235 - metalloexopeptidase activity;
FT                   GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1E1Q7"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001714"
FT                   /db_xref="InterPro:IPR002467"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q7"
FT                   /protein_id="ACO61782.1"
FT                   /translation="MPEFKWTGPLRPMKVSPKRSVPKIGWLCPLPDYARTGWPEAEFAS
FT                   SLQHKLEVKTPEQLAKMRAACSLGRAVMDAVAAAIKPGVTTDQLDRICHAMTLMNGAYP
FT                   SPRNYMGFPKSLCTSVNEVVCHGIPDARPLEDGDIVNLDITVCLDGYHGDLNETYFVGT
FT                   GSSDPERAERAKALMKCALECLELAMARCTPGARFRDLGEAIQTHANGRGYGVVKDFCG
FT                   HGIGALFHCAPNVPHYAKNKAVGVMKPGMTFTIEPMVNEGTHRTKHWPDGWTAVTADGG
FT                   RSAQYEHTMAVTETGLDVLTKRTANSRPFY"
FT   gene            complement(742571..743497)
FT                   /locus_tag="MICPUN_107914"
FT   mRNA            complement(742571..743497)
FT                   /locus_tag="MICPUN_107914"
FT                   /product="predicted protein"
FT   CDS_pept        complement(742671..743453)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107914"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Q8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q8"
FT                   /protein_id="ACO62211.1"
FT                   /translation="MALPQCLSKDKASKLRGQENMAINSSAYQFFGTLFNVIGLAMGIV
FT                   GSLMYSPTVLHAMFGADMNENREWEWMRNWANIIWAVSFFMFPIGVGMFLVERWECISA
FT                   HNEAVGKPPPSPWDKNMRILVWAEIMLGICAAGGVFFCFDDDPGAYFIACALFTLAGGI
FT                   KVSLLVYEICEMSGCCCGTGVFDEEHGMPAKGADEKTPLLNDGDGYPVGGGNWKGEQGS
FT                   AGKGRRDSTGSPQGSDIAPSSDTSSLLGDPHVAQGSPR"
FT   gene            <744189..>746138
FT                   /locus_tag="MICPUN_56961"
FT   mRNA            <744189..>746138
FT                   /locus_tag="MICPUN_56961"
FT                   /product="predicted protein"
FT   CDS_pept        744189..746138
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56961"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR021897"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Q9"
FT                   /protein_id="ACO61783.1"
FT                   /translation="MDDRSRETAVDVVRRCREAGIELDPVLAAYHCAALRYQGVPWDDA
FT                   FTQTAAERIVAPRSRLAVDTMAMQVAADEIRATMTAAIAADRRDREERAAAYEREVLTV
FT                   AASFPRMTQREQADFMEHMWKNVFFRYVCVKGGMESALGINDEVGREETFAAFKSVFPK
FT                   HETTRFLTQTAPEISAQLRELASIVLGIRVFNRRMEELSRGGNGPSPSGSVPDPAPGYL
FT                   NLGAKMREDLAGRAHSAARLCAQYRCVSSHQSLRRDPGDELLTRLADENNNRVAYWSII
FT                   RALIEDNAEGIERVDELTRRVHDGCEEVRELIEDAEGLTEGLGGGVRRDELYPILQSVG
FT                   ANHSALLDEAAAQEVIHAVSARMTDFSKPFETSLTNELLHEGIRVEKMAKERYGPHAVV
FT                   GVPKVDDAKDVPKTVVEPHLSRKLGESGAEITHGGVTTLEYGGYDVFALCKRRGLALPA
FT                   SMSAPDTAVVFQGKTYGFADEYAAKQFASQPAKYVRAMHATLFRMPELVRITHPSGEAT
FT                   ARAFPNLDVAKLAAGMSVPSPTEFGTQTDTHPVERHVDKDYEWNEWALRRRALHAANLL
FT                   RKATHGSQTHSSHFRRENTTQVWLPKRNETQTVVTKGTTMPQKKRYIGGMRGAPDVKLN
FT                   VVNVELDLGQPYEH"
FT   gene            complement(746434..747400)
FT                   /locus_tag="MICPUN_107915"
FT   mRNA            complement(746434..747400)
FT                   /locus_tag="MICPUN_107915"
FT                   /product="predicted protein"
FT   CDS_pept        complement(746990..747214)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107915"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R0"
FT                   /protein_id="ACO62212.1"
FT                   /translation="MLRTMLSICLPVLKFSARALGLTKTEMDPNARTIEDPVRARPDFT
FT                   PILTLLHLRSTRSPRPLSCTLCPLLRNAC"
FT   gene            <747474..>748358
FT                   /locus_tag="MICPUN_79723"
FT   mRNA            <747474..>748358
FT                   /locus_tag="MICPUN_79723"
FT                   /product="predicted protein"
FT   CDS_pept        747474..>748358
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79723"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R1"
FT                   /protein_id="ACO61784.1"
FT                   /translation="MSSTWNKLVNLVIRPPRAQYDPNEHLPGPRFRIAGVTHVRRDIDL
FT                   AGADGLTLKCSHYEPEVRGNDPLPCVIYLHGNSGSRCDATEAIRLLLPARITVFAVDLG
FT                   GSGMSEGEYVTLGVRETKDVECIVNHLRDQGLTSKIGLWGTSMGAVTAIMYANRDPSIA
FT                   GVVLDSPFSSLPKLMLELVAQFTKGSRVGVPKMAARMALSFVRSSVKSRAKFDINDLDL
FT                   RKVAPSTFCPALFAHGKDDDFIPPHHSETLHELYAGDKNYIAIDGDHNSPRPAFFFDST
FT                   VIFFCNVLDPPPTS"
FT   gene            complement(<749410..>751131)
FT                   /locus_tag="MICPUN_97152"
FT   mRNA            complement(join(<749410..750624,750727..>751131))
FT                   /locus_tag="MICPUN_97152"
FT                   /product="H+-translocating pyrophosphatase family"
FT   CDS_pept        complement(join(749410..750624,750727..751131))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97152"
FT                   /product="H+-translocating pyrophosphatase family"
FT                   /note="proton (vacuolar); H+-PPase; GO_component: GO:16020
FT                   - membrane; GO_function: GO:4427; hydrogen-translocating
FT                   pyrophosphatase activity - inorganic diphosphatase activity
FT                   [PMID 9678]; GO_process: GO:15992 - proton transport"
FT                   /db_xref="GOA:C1E1R2"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R2"
FT                   /protein_id="ACO62213.1"
FT                   /translation="MFGRVGGGIYTKAADVGADLAGKVVAGIPEDDPRNPATIADNVGD
FT                   NVGDVAGMGSDLFGSFGEATCAALVIAAQSHDLVSAGWDTLIFPLYISSVGILVCIATS
FT                   FVATDFRPVRSEASIEEVLKTQLTLSTVGMTCVTMGPMSAFCCIAAGLWGGLIIGFVTE
FT                   YYTSHSYSPVREVARSTETGAATNIIYGLALGYKSTIIPVGILAGIVFVAFSLMDMYGV
FT                   ALAALGMLGTLSTCLAIDVYGPICDNAGGIAEMAELPEAVREKTDALDAAGNTTAAIGK
FT                   GFAIGSAALVSLALTAAFVTRTEVLENGVNLLNPTVFAFLLVGSMLPYWFSAMTMKSVG
FT                   IAAMEMVKEVKRQFDTIPGLLEGTPGHAPPDHARCIKISTDASLREMVPPAILVMTAPI
FT                   LTGMFFGVEAVVGLLAGGMASGVQLAISASNTGGAWDNAKKYVEKGGLYIDMPKRDEVT
FT                   GEIMRDEFGSPILVSVRQRKGSECHKAAVVGDTVGDPLKDTSGPALNILMKLMAIISLV
FT                   FADFFMSINNGQGYFNIPRRVF"
FT   gene            complement(<751351..>751641)
FT                   /locus_tag="MICPUN_80332"
FT   mRNA            complement(join(<751351..751455,751489..>751641))
FT                   /locus_tag="MICPUN_80332"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<751351..751455,751489..751641))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80332"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:4427; hydrogen-translocating pyrophosphatase activity -
FT                   inorganic diphosphatase activity [PMID 9678]; GO_process:
FT                   GO:15992 - proton transport"
FT                   /db_xref="GOA:C1E1R3"
FT                   /db_xref="InterPro:IPR004131"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R3"
FT                   /protein_id="ACO62214.1"
FT                   /translation="MADAGEAEADSYQKLRQIYRDIQAGAKAFLAAEYRMCLAFLAVFG
FT                   VAMIFFIGTLTAFSFFVGGITSMVSGYIGMMIAVFTNARCT"
FT   gene            <752397..>753743
FT                   /locus_tag="MICPUN_99477"
FT   mRNA            <752397..>753743
FT                   /locus_tag="MICPUN_99477"
FT                   /product="predicted protein"
FT   CDS_pept        752397..753743
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99477"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR039986"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R4"
FT                   /protein_id="ACO61785.1"
FT                   /translation="MRRQAEERRAVVLTNTEKDMLKELSEARKGTWNNTLEAQRKQREA
FT                   AKAQRLEDEEEAKCVLDREEASIRATQRQAQIMRANKMLYDQTDRVKSFNSSLLLSDVL
FT                   QERDLQIDLKKRVEEVRDRHEAAFVKEQEKAWEVADYAEAAKASERKQAAMQQRDAQLL
FT                   QIEQFKEQILAEMREDRRDGELIRRRAAEEEEEERLRELRRREEAMRGAMETAKANAAL
FT                   KEYKAGEAAAEAAMDRKIEQFARAKERMDAARRVHAEAKNREKAAVRDAMVARMEADLI
FT                   ARQKKAVEAEDNAAERAEAEREAAEALKAAERLEDLRVIELSRQQQLAIKAAERERERE
FT                   REELFVRQWAQRNEQLQREEEEEKLETFARNKRLQQAHVRQIARKIKKANAERELDLRA
FT                   SLAATRRLEEEDELFDHYARVCMDEWESRGKSLRPMMVELGKFDPNRVT"
FT   gene            <754190..>755478
FT                   /locus_tag="MICPUN_56966"
FT   mRNA            join(<754190..754322,754463..>755478)
FT                   /locus_tag="MICPUN_56966"
FT                   /product="predicted protein"
FT   CDS_pept        join(754190..754322,754463..755478)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56966"
FT                   /product="predicted protein"
FT                   /note="bHLH domain containing protein; GO_component:
FT                   GO:5634 - nucleus; GO_function: GO:30528 - transcription
FT                   regulator activity; GO_process: GO:45449 - regulation of
FT                   transcription"
FT                   /db_xref="GOA:C1E1R5"
FT                   /db_xref="InterPro:IPR011598"
FT                   /db_xref="InterPro:IPR036638"
FT                   /db_xref="InterPro:IPR040217"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R5"
FT                   /protein_id="ACO61786.1"
FT                   /translation="MDDHPGGLAPLFDDAGKDRTYTDTELQELLSFVENMDNATSADEL
FT                   AGGLNHVGLGLAPANAGLSHPVPHAPVLPMRFNEQGISLQFQPGPTSARGRGRGGRGGG
FT                   RGAAPAVGNFEAPMSASPAIEDDGSQRVSHGASEKQRRDRINAMIDELRMLVPGQAGGG
FT                   EGRRSKYIVLQDTINMIAALKAKCQAQERELVALRAAGASEGASGGVQTQDQQQQMMML
FT                   MGQDGQGLDPVREESIRNPANGTNSTLNSGQTISVAVEMGEEICYVKIKAPDRQGLLQD
FT                   ILNALHALPMTVQRAVVTTDSENGVVFVTDIFELKINTAIPVEQRISPEDVKTHIHQSM
FT                   HASFLAYENPELYARKRKGTQGGVSGSDSGGSGIGSGVRAAG"
FT   gene            complement(<755725..>756288)
FT                   /locus_tag="MICPUN_72375"
FT   mRNA            complement(<755725..>756288)
FT                   /locus_tag="MICPUN_72375"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<755725..>756288)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_72375"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1R6"
FT                   /db_xref="InterPro:IPR008501"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R6"
FT                   /protein_id="ACO62215.1"
FT                   /translation="EEALIKKRLLTQTTTARPGADPPVKKLTKKYVAYVNALAEDDANG
FT                   DGADAERAREAWLKEIALYEFNMGRYRAVASANAREMEQYASASAAVDGEVRGTKDEIA
FT                   ELKTDLDGARLDRQHKEEYEALRRLCTQFPSRSDTTARLASLEAEIAELETESEATASK
FT                   LDLRKKQFALLLHLVNELQGELAEE"
FT   gene            <756876..>758516
FT                   /locus_tag="MICPUN_93687"
FT   mRNA            <756876..>758516
FT                   /locus_tag="MICPUN_93687"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT   CDS_pept        756876..758516
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93687"
FT                   /product="phosphoglucomutase/phosphomannomutase family
FT                   protein"
FT                   /note="Has PGM_PMM_I and II domains; expressed;
FT                   GO_function: GO:16868 - intramolecular transferase
FT                   activity, phosphotransferases; GO_process: GO:5975 -
FT                   carbohydrate metabolic process"
FT                   /db_xref="GOA:C1E1R7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R7"
FT                   /protein_id="ACO61787.1"
FT                   /translation="MVTTQFIPHATAAEDGTPVLVTTTTPAILKKLQNGSDVRGVALEG
FT                   VPGEPVTLNEEAAYLIGAAFVDWLADKKGKKPSELSIAVGRDPRLSGPALANAMFAGFG
FT                   SKDVGRVVDMGIATTPACFMATVTPGVAYDAGIMLTASHLPFNRNGAKFFTSDGGLDKA
FT                   DIKRICEDAAAACQAAPDGHAIPLDGDDAVESVPFLEDYAAQLRDLIKKGANHPTAYDE
FT                   PLTGMKIIVDAGNGSGGFFAKSVLEPLGADVYGSQFLDPDGKFPNHSPNPEDAEAMDSA
FT                   VEATVKAKADLGVIFDTDVDRSAVIDGDGNPINRNKLIALLAAIILDEHPGSTVVTDSV
FT                   TSDGLAEFIEGKGGKHVRYMRGYKNVINEGVRRDKAGEPCHLMIETSGHGAMKENYCLD
FT                   DGAYIAVKIIIEAVRRRLSGGKGISDLLSELREPLEEKEVRLKITCDDFKAYGGDVLEQ
FT                   LKEAVGSMKGYTPVDVNYEGYRVNRDEGDGKRGWFLLRQSLHDPVMVLNFESEIPGGVD
FT                   AMAKDVVAWLKEKDFASLDASAVYAILDK"
FT   gene            complement(<758643..759604)
FT                   /locus_tag="MICPUN_90249"
FT   mRNA            complement(join(<758643..758957,759082..759155,
FT                   759279..759387,759594..759604))
FT                   /locus_tag="MICPUN_90249"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<758643..758957,759082..759155,
FT                   759279..759330))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90249"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR005326"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR037447"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R8"
FT                   /protein_id="ACO62216.1"
FT                   /translation="MLIPKKNRKEVYKYLFREGVIYAKKDFNLPAHPEIKEVPNLQVIK
FT                   LMQSFTSKELVKEQFSWRYYYWYLTNEGIEYLREYLNLSADVVPNTLKKSTRPPTRPMA
FT                   DERAPRGDRGPRGGREGYRSERPGGFGRGGDKAGPGGNFNPQF"
FT   gene            complement(759745..760741)
FT                   /locus_tag="MICPUN_107917"
FT   mRNA            complement(759745..760741)
FT                   /locus_tag="MICPUN_107917"
FT                   /product="predicted protein"
FT   CDS_pept        complement(759802..760710)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107917"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1R9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1R9"
FT                   /protein_id="ACO62217.1"
FT                   /translation="MIGTSPVLVLYLAYTVMAGAFTLKLSSDCASSAPAPGVLEPPSPP
FT                   PPPSPPPGTAYVSSGETNYWEMASAVALGVAMISMSCTSFAAVYYMEDTVENKRKECEA
FT                   FPVDEEVEAREKKVQAKKHAYKAVTSWNALPKLDKCLLGASLFLMTLACHIAGNFGSLC
FT                   FATFSVTCSVALADVVLPLGWVAIGLFTAGCLTFYFYGKGASRRARKVLEAESNADMVT
FT                   ADAVTEIGGAIESGGRRGRGAVNAVEPAGTTAQDPARLPGAVTEQVTRAANWSDDETPP
FT                   GSVSSYGEEEDVEEGKPWDRM"
FT   gene            <763187..>764254
FT                   /locus_tag="MICPUN_99481"
FT   mRNA            <763187..>764254
FT                   /locus_tag="MICPUN_99481"
FT                   /product="predicted protein"
FT   CDS_pept        763187..764254
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99481"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S0"
FT                   /protein_id="ACO61788.1"
FT                   /translation="MGDENDAVADEGDWYAALVAGEHVGDWLDTVRNAKIPPGRRTRAA
FT                   RQLAEKVAADRTYADEAREGDAADVCEAAARDIPEGDDDERLVAMREAFESCAAACRAA
FT                   AQDGGARERSFSFEGGREVVVREIALGVGVGAKVWRAAIMLGDELAANPGWCEGKRCLE
FT                   IGAGVGLCGLLASKLGAASVTLTDFERPLLDSLVLAVDRNRELDARDAVGTTTTALTLV
FT                   RRLDWIEECERPHATGGDADDPKKPTDFASGENGWKEMDHNSTFDFVFGSDLLYEEVHA
FT                   LTLPGVIKRRVASPSGRCRIVGAVRNRAMLDALVENMRKEGLAVVETHLRDNDTNAADW
FT                   YEDGYCALEVTHDVE"
FT   gene            complement(<764340..>765656)
FT                   /locus_tag="MICPUN_56972"
FT   mRNA            complement(<764340..>765656)
FT                   /locus_tag="MICPUN_56972"
FT                   /product="predicted protein"
FT   CDS_pept        complement(764340..765656)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56972"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S1"
FT                   /protein_id="ACO62218.1"
FT                   /translation="MAVKDELSPIVVNAWLPHKPLPGEDEEAIDKKPIDQILRGIPYRL
FT                   VNSAPKKKIVELKAALEAERAKIKEAGEGEELSEEQTATNAAAEEAIAPMEEELAAAEA
FT                   AYEELTGILCKGQLSTLPWIDSLMRYVDLGGSCIVPGGAVAADDAFRSVNGNLTDVNGM
FT                   LTEKQLAESKAWAEYITQAKLEKPGGYTIVCKYAPNPYLSAQAAIDAFPAWVERQITLG
FT                   FGVELEEGADPILPHVMLAWPDPSVPGVAEVIAKMLGPLTEDAEEGKVKAVSLDLSGDV
FT                   SCDPRPLRECLERGGTSKPSGVVVPGIHALDKVGAQLVADATRSDVKVIAGDALLGGLV
FT                   SERYLRVPAPTLAELKGTAAFAGLARVLASPGGWDGFQATLEALEATGRGVATALVQAF
FT                   ADAGMKVEIETELEKGPAFEIGEPLGEEHTAAIVAAMSA"
FT   gene            <765945..766837
FT                   /gene="SSRbeta"
FT                   /locus_tag="MICPUN_112669"
FT   mRNA            join(<765945..766061,766272..766837)
FT                   /gene="SSRbeta"
FT                   /locus_tag="MICPUN_112669"
FT                   /product="translocon-associated complex trap beta subunit"
FT   CDS_pept        join(765945..766061,766272..766829)
FT                   /codon_start=1
FT                   /gene="SSRbeta"
FT                   /locus_tag="MICPUN_112669"
FT                   /product="translocon-associated complex trap beta subunit"
FT                   /note="This family consists of several eukaryotic
FT                   translocon-associated protein beta (TRAPB) or signal
FT                   sequence receptor beta subunit (SSR-beta) proteins"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S2"
FT                   /protein_id="ACO61789.1"
FT                   /translation="MFPRTAVRATLVALFVAAALFQGVVADNAPTSAHLIVHKLIIGRN
FT                   MTIEITLYNAGETAATGVEINDPGWDSSSFAMLGPSTSAKFASIPPLTKKTHRFVVVPK
FT                   VTGQFSAGPSLVSYTAGAGHQASGTSNALDPLPILTPWEAKVEVAMKIGSYLTLGFCNN
FT                   AEEWTKAAIITTVLVGLITVNWIALKGKRAVAEAQRKQAMKSLGINPKDVAVSKKQKQK
FT                   KK"
FT   gene            <767031..>767714
FT                   /locus_tag="MICPUN_56974"
FT   mRNA            <767031..>767714
FT                   /locus_tag="MICPUN_56974"
FT                   /product="hypothetical protein"
FT   CDS_pept        767031..767714
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56974"
FT                   /product="hypothetical protein"
FT                   /note="expressed; conserved uncharacterized putative
FT                   protein"
FT                   /db_xref="GOA:C1E1S3"
FT                   /db_xref="InterPro:IPR019258"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S3"
FT                   /protein_id="ACO61790.1"
FT                   /translation="MATDEEVAWCAELRRAVTSLQDSIDAARSFDHVRLPADGPVSAAD
FT                   VVEYARRISYTTFAPAGYQPGAPLHGIMPPAPQDEHFAASHLAAHAAQARQREEARRAR
FT                   EKAAEEARKAASRGEMPPIETVIKLLSAWKPGQPWPAGIPAPPPGWKPGDPLHLGAPKP
FT                   KDDGGKGSVRVEPPARVVPAAVTAPPVKPAKPVMPKVPFVKIDLHSDSDEFEEVSASDY
FT                   SSDSD"
FT   gene            769260..770548
FT                   /locus_tag="MICPUN_107918"
FT   mRNA            769260..770548
FT                   /locus_tag="MICPUN_107918"
FT                   /product="predicted protein"
FT   CDS_pept        769359..769808
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107918"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S4"
FT                   /protein_id="ACO61791.1"
FT                   /translation="MRRKAAAGRAANADKENKESGNFALWMERGERGYTRTPGDLREVY
FT                   TAGDNAVGERGNNLYRRRHVDLLGGAASAASGIDARADRYRTTASEVSATAEEVRWEEE
FT                   NSRASEGSGLSDMASMRDAIKSASRTASERTTRSRSHLSSHVGII"
FT   gene            770787..>772287
FT                   /locus_tag="MICPUN_56977"
FT   mRNA            join(770787..770918,771034..771120,771242..771497,
FT                   771609..>772287)
FT                   /locus_tag="MICPUN_56977"
FT                   /product="predicted protein"
FT   CDS_pept        join(770813..770918,771034..771120,771242..771497,
FT                   771609..772287)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56977"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1S5"
FT                   /db_xref="InterPro:IPR014854"
FT                   /db_xref="InterPro:IPR027786"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S5"
FT                   /protein_id="ACO61792.1"
FT                   /translation="MPRENGVTPDGEDKESKVFRRKLRGKMRNLHKTLHESKDEIIDLT
FT                   GPVSKLGEVIEILEDIHEDVVKPREQLLDAEVMATAADLGVEMAKKMGGLGAITPAQFM
FT                   ARLCKQFVVGVDPDAQAERDEGAFNWTLFGSSVGKHFHDAPTMAFMNGAMDTQIKERRV
FT                   AQRIRRDPVGPAVAPDSVADTKADQQTDQAMKRMVKILRNKKHQNETLTVEQLSANPKS
FT                   FSQFIENIFTLSFLVKDGEAGLTPPPEGLDGPNVEKCPQVRKMKKPEEQHMDRSTFVLH
FT                   LDMEGWRRLCEANDRMEGAIPHREEVTEMDLTEGNGIGGPGAAARAEDGEEVESPGGAE
FT                   NPKGKAKPRGRGLTRPRDSTNSEERAAALRRKVAV"
FT   gene            complement(<773246..>774585)
FT                   /locus_tag="MICPUN_79984"
FT   mRNA            complement(<773246..>774585)
FT                   /locus_tag="MICPUN_79984"
FT                   /product="glycosyltransferase family 22 protein"
FT   CDS_pept        complement(<773246..774585)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79984"
FT                   /product="glycosyltransferase family 22 protein"
FT                   /note="related to Dol-P-Man: a-mannosyltransferases"
FT                   /db_xref="GOA:C1E1S6"
FT                   /db_xref="InterPro:IPR005599"
FT                   /db_xref="InterPro:IPR039521"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S6"
FT                   /protein_id="ACO62219.1"
FT                   /translation="MKAETTDLRTVFAACVLFRVVNALCVRTFFSADEYWQSVEVAHKL
FT                   VFGYGHLTWEWTHGLRGYLHPLIFAIPYKIAQTIGLDSTAVTVWSPRIVQAVIAAAGDV
FT                   HVYKLAHRWFAGAKRKAKDEKSEGAASPDAAARWALFCSLACWFNFFCAVRTFSNCTEA
FT                   ALTVAALAYWPWTGAASENDDVKNVNRPLSLALAAASCVVRPAAALYWLPMFVEESVKS
FT                   VSRVRFILKEALPIGAAALAISTCVDRVFYGRWEIVPWNFFRFNALDGGGALYGSHPWH
FT                   WNLTQGYPAIATVFLPLAAIACRDKKRWAPLAVVGWTVLGYSVPAHKEFRFLLPALAPT
FT                   LAAAGAQLASFSCRKRVAAVALILLTQIPAALYLSLRHQSGTVSVMSVLTAAVDAGETH
FT                   SAGILSLTPCHQHPWTTHVHRPNVGMRFLRCDPPGFGTPKGELDEAD"
FT   gene            complement(774864..775819)
FT                   /gene="PDI"
FT                   /locus_tag="MICPUN_112673"
FT   mRNA            complement(join(774864..775618,775655..775819))
FT                   /gene="PDI"
FT                   /locus_tag="MICPUN_112673"
FT                   /product="protein disulfide isomerase"
FT   CDS_pept        complement(join(775130..775618,775655..775798))
FT                   /codon_start=1
FT                   /gene="PDI"
FT                   /locus_tag="MICPUN_112673"
FT                   /product="protein disulfide isomerase"
FT                   /note="Protein disulfide isomerase percursor. Catalyzes the
FT                   rearrangement of -S-S- bonds in proteins. Contains a
FT                   thioredoxin conserved domain"
FT                   /db_xref="GOA:C1E1S7"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S7"
FT                   /protein_id="ACO62220.1"
FT                   /translation="MVSSRVSGALRALIFAALIALASAAKGVVQAGDSNFDRLVLGSGK
FT                   NAFSMKPDWDKLGGHYADHPSVLIVDVDCTADGQGTCQRMGVQGYPTIKYFMSGDKKGK
FT                   DYQQGRDFNSLKSFAESKLNKPVCDAATKKGCAKNEIAFIEKHEGKSADALKEVAKEKA
FT                   DELKEIRKARSEAESELKQKQREWKKRENALNRATNILKQMQKTASA"
FT   gene            complement(<776150..>777319)
FT                   /locus_tag="MICPUN_56980"
FT   mRNA            complement(<776150..>777319)
FT                   /locus_tag="MICPUN_56980"
FT                   /product="glycosyltransferase family 4 protein"
FT   CDS_pept        complement(776150..777319)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56980"
FT                   /product="glycosyltransferase family 4 protein"
FT                   /note="distantly related to glycosyltransferases;
FT                   GO_process: GO:9058 - biosynthetic process"
FT                   /db_xref="GOA:C1E1S8"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S8"
FT                   /protein_id="ACO62221.1"
FT                   /translation="MILASPDDLPPTAANPDEVGDLEQYLDAADVAVVGVLHAFKCGDV
FT                   LDQLADIKRRRGADFVPTVLVLGGTDVNVDAGDKADVLTRRAHAVDKVVSFSASMIAAA
FT                   PPGSLPSDGRTAVVPQGVSLPEEAKGVPSVEEVPSGGFEEEGFEEEGFDVADDAPSPPP
FT                   PLPLHEACGVPTSTPVFLLPAGLRPVKDVLWAVDAVDAVGAGSANASPPFVLAIVGPSL
FT                   DDKYRDAVVERLGRSKNVVLIPPVDRAHTVGYMRAATAVVNTSKSEGQSGALLEAAAAG
FT                   VPIIARDIPGNRALLDLLLDATGETPDGERDEEGFESHPCGLLCPTPESFAAALVGSAA
FT                   VRRRRSTDRAALGAGCLARNERDRWRGIIRELIGDTPEDGCGSDMAAAA"
FT   gene            complement(<777446..>779152)
FT                   /locus_tag="MICPUN_56981"
FT   mRNA            complement(<777446..>779152)
FT                   /locus_tag="MICPUN_56981"
FT                   /product="predicted protein"
FT   CDS_pept        complement(777446..779152)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56981"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1S9"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1S9"
FT                   /protein_id="ACO62222.1"
FT                   /translation="MEARDRWFHGIHAHSVPVPGASPLNKSGSAPGSSSDSRILALATP
FT                   DDLVKLDLYGTLAEKHVGLTRRQVRLMYRDVRERTERVFAGLTPEQLRGKIESSLNPMD
FT                   WGLGHIAHFYEFMILRLLAPGSEPVLPGHDVHALFDSFRAAHDDRWKPKEVCGSDPTLG
FT                   EIRRYIADVTDRLVNLVGPDDDTRLDPVSTYLHVYGVVHEHWHVEDFIQTRHTLGYARP
FT                   NPLPSSPDPAVANVWGDTFAPPTFANIDSIGGIAQGAHSGFVSIPAGTYSLGATKDEPW
FT                   VFDAERWAHEIEVPAFRIAKAATTNAEFAAFIAAGGYHKRELWSHEGWRWLSRNRSEQK
FT                   SRGMSDEDAAKAGLNSEAPRYWVRKGSGEGGGFSKVAGGWHEHLFDAAPAPVRPHAPVL
FT                   HVSWYEAEAYCAWVGGRLPTEAEWEVAARTEPGNYGVVKGPRRRAYPWGDSPGPDPSRA
FT                   NLDGFRGNSVDVGSLPDGDSAWGCRQMLGNAWEWTSSAFLPYPGFQMDFPYRENSAPWF
FT                   GYRKVCKGGCWATSAPIARAGYRHSFWPEMNAVYTGFRVAVDGAPGAIGKL"
FT   gene            <779353..>780187
FT                   /locus_tag="MICPUN_56982"
FT   mRNA            join(<779353..780098,780169..>780187)
FT                   /locus_tag="MICPUN_56982"
FT                   /product="predicted protein"
FT   CDS_pept        join(779353..780098,780169..780187)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56982"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T0"
FT                   /protein_id="ACO61793.1"
FT                   /translation="MPSGAEGFDTNGRPDDLLKRITYNANNYGKGAFLFADADAGPEDE
FT                   SRARRNRFPKRENLELEQKLYETMERQADEVVKARLAEAEKAAKEFNWDVYVDPDANAP
FT                   VEADARPGISRPNGDGCGAAMRAALPPAEPVEPESALAAEFGARCSAKEARGALEAAGG
FT                   DLEKARKLLESLASGRGRDGLRLERKRSKDGDKGKRSRKSKKRRRKRTKYDSDSDSDSD
FT                   SSSRSSSSSSSSSSSSSSRRRRKKSKNLHIYS"
FT   gene            complement(<780264..>783820)
FT                   /locus_tag="MICPUN_56983"
FT   mRNA            complement(join(<780264..783407,783539..>783820))
FT                   /locus_tag="MICPUN_56983"
FT                   /product="resistance-nodulation-cell division superfamily"
FT   CDS_pept        complement(join(780264..783407,783539..783820))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56983"
FT                   /product="resistance-nodulation-cell division superfamily"
FT                   /note="Dispatched segment polarity protein (cholesterol
FT                   release)"
FT                   /db_xref="GOA:C1E1T1"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="InterPro:IPR004869"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T1"
FT                   /protein_id="ACO62223.1"
FT                   /translation="MHRVPRVTYPGRAACRPWLWFGSLQLPESWPGKSHFLAVESPKSP
FT                   VFTRGLLSAGRRRFQDMSPFDTIAKAVYRRPLTVYLLSILVPVALTLALLNFRIELDTG
FT                   ILSFRARDEPYAINYDAVLSAVQWGKGHTQYLHGPPSPPSPANASPPTPLSERLQSHAS
FT                   YWLTMVYETRPPGGNVLTEERLAYIAEVERKVRAVSGFEDFCHLGVPLASLNDTSCRRW
FT                   VPSSTRDQHPPACPGMQCVPAMSLMSFEGMIRRWFIELVEAGSGAANSTAGAEAVERRL
FT                   EAVGFDPAQASAMAEALAASGWDTAEAYAEMPLTELLALVPSGALTRDFFHIGHEPGWF
FT                   FDKWYATGESDGSSSGEGVRAVALRSGFEFALPLAGYATNHDRQWEQDRKYRKWAEEFT
FT                   RMLADGGEIDRGAEKVGLRVLHAGGGISEDEAAALVLGDLLWCTAAFALVTACLFAYSR
FT                   KLWWTVNAIVGISLSFPVAFFFFRAASASPYVSFLNMLVPFVLIGIGCDDAMLMFDAFR
FT                   AAIRDDCGDDDGILLPSEDVFAARYAPAARAMLATSLTTAVAFGSNFFSFIPPVRALGM
FT                   FAALTVCVNYLLVLTLLPAALVIGAKGFKNSFMDAMDECLGLFTRRGYTPRQVNESAPP
FT                   TPAQKATYSQLDTRDTEPSGGEVELQTVRGKTDDDDEADWTEVGVHDDGFFAPSTAEAK
FT                   DGGDASIVRVKKEMTCSCADLNASIRANTAAATTWLGDFVIRRKWAIIAAGVLCAVVSS
FT                   AVIADSLVVARTPPPLLREDQNLQRIQHLLFDVFYTENWSNVRVAFGVAGVDRSGADPN
FT                   DPTQFGDPVWDGSFARFNDDEYTQLAVLAACDAVTAANETLQLTPSSGSTECALQAFVR
FT                   DSGGVDSVDWGPGLPSALARWSRDMGRNWRENLGWAGEEGSSELKFITADYFVDLHPVS
FT                   STTEEIRRVHDAWEAVVAAARTAMASRLPPGSPVPLVIQACDVWNRMGVEESIGYTARI
FT                   SPAVSAAACSLIMLVATRSWRVTVAAVGTIAIAVLGMLAALVSLGWEFGVVEELCVTLL
FT                   VGSSIDYCIHLAMAYAEEAPSGAGRDERVKAALAHMAPTLTGAAMSTAASSAMLLACVV
FT                   EVLVKIGATIVANTAVGFALSLFLFSALMAAFGD"
FT   gene            complement(784715..>785670)
FT                   /locus_tag="MICPUN_56985"
FT   mRNA            complement(784715..>785670)
FT                   /locus_tag="MICPUN_56985"
FT                   /product="predicted protein"
FT   CDS_pept        complement(784798..785670)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56985"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5198 - structural molecule activity"
FT                   /db_xref="InterPro:IPR006843"
FT                   /db_xref="InterPro:IPR039633"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T2"
FT                   /protein_id="ACO62224.1"
FT                   /translation="MSSASTLSARVAHSAGVRAPGGARRSFRATRIVSRAVAEDESSSS
FT                   AVYQPAVAPEQPSGADVNAAAKKRLLAVAAASGRGLDATPAQKTAASSLIAELIAANPN
FT                   PEPATSPTIDGDWELVYSDTFLFRSSPFFWAVGSMMGDTADFFYQAHSHQTGIFGGGVG
FT                   RVVQTVDTKGGRLISDCVVKASVGIPLLGFSPVFAGYGSVITAGRCAAKDGTRLAVTAE
FT                   TTTVRQDDANVLPQLNFLNGTTVPVEDVMKQVGGGEAGPEVYLDTFYLDDEMRISKLED
FT                   GSVFVYQRC"
FT   gene            787031..787739
FT                   /locus_tag="MICPUN_107920"
FT   mRNA            787031..787739
FT                   /locus_tag="MICPUN_107920"
FT                   /product="predicted protein"
FT   CDS_pept        787115..787555
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107920"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T3"
FT                   /protein_id="ACO61794.1"
FT                   /translation="MAAAAAALMAQDTAKAKAGETAANDGDANSRDANNRDANDANNNG
FT                   DATTETDDAAAKERRRSGDRARIDAEIERRRRRHEAARAAAAMKREKLLEEDPLDLRGA
FT                   AHRLERAKSDAKALSRQVREAKEEARRRREEREARARDDSEL"
FT   gene            <790154..>790432
FT                   /locus_tag="MICPUN_76840"
FT   mRNA            <790154..>790432
FT                   /locus_tag="MICPUN_76840"
FT                   /product="carbohydrate-binding module family 20 protein"
FT   CDS_pept        <790154..>790432
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_76840"
FT                   /product="carbohydrate-binding module family 20 protein"
FT                   /note="candidate a-glucan-binding protein; GO_function:
FT                   GO:3824 - catalytic activity; GO_process: GO:5975 -
FT                   carbohydrate metabolic process"
FT                   /db_xref="GOA:C1E1T4"
FT                   /db_xref="InterPro:IPR002044"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR013784"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T4"
FT                   /protein_id="ACO61795.1"
FT                   /translation="IRDDGSSTSNVVEFNVVAHLTVGEHLVLVGNVAELGGWKVDVGRR
FT                   MTWSEGDVWKTSISIPNAEASVEFKFVRYNDNNGVLTWQEGDNYACEL"
FT   gene            complement(<792329..>797464)
FT                   /locus_tag="MICPUN_56988"
FT   mRNA            complement(join(<792329..796698,796895..796958,
FT                   797357..>797464))
FT                   /locus_tag="MICPUN_56988"
FT                   /product="aminotransferase"
FT   CDS_pept        complement(join(792329..796698,796895..796958,
FT                   797357..797464))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56988"
FT                   /product="aminotransferase"
FT                   /note="contains two pfam domains for aminotransferase clase
FT                   I and II PF00155.11; GO_function: GO:16769; pyridoxal
FT                   phosphate binding - transferase activity, transferring
FT                   nitrogenous groups [PMID 30170]; GO_process: GO:9058 -
FT                   biosynthetic process"
FT                   /db_xref="GOA:C1E1T5"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T5"
FT                   /protein_id="ACO62225.1"
FT                   /translation="MDYDAYVPDSSRWAKSGLAYRVLGHDAATYYQYAIYVAEGLGKNS
FT                   FNALRGIKDWRTDDQNGEQNDLPALSKGKLKDFFYIRNLYGNIEDVFNRPVYSSPEDWI
FT                   DVAIREPESERGYFSKLVTTPQSRRCLNLGSYNYLGFGGLNTHCTPLVAKSVMDYPVTS
FT                   AGSAAELGYNPLIKEVEETTAKYVGKEAAVVVGMGFATNSTVIPAICGKGDLIVSDALN
FT                   HNSIVEGARLSGAKVRAFKHNCVGDLELILQDAVAGKQRYNKILVIIEGIYSMEGELCC
FT                   LPEIVEVCKLYGAYVWLDEAHSIGAVGPTGRGVCEELGVDPKDVDIMMGTFTKSFGAAG
FT                   GYVASDYETVARIRQYAAGCTDACSMPPAVCTQILSSLRVISGEDGTDIGAKKLRQLRE
FT                   NSKFFREGLEALGLEVLGHHPSPVMPVMLYQPYKIGDFSRLAFNRKLAVVVVGAPATPV
FT                   NYPRIRFCVSAAHSREDLADALAAISDIADELSIKFKVAPPNAWCPGSIHDKEEKEKQL
FT                   SIKRVAKARAARSAALDSASKLASGTNRARFAPLHSVGQPLGDDIGPPRSSSGPIDAYK
FT                   LSGVTEKQPKWNQYKIMLSSSDVLGLTNDPVMKEACAATVEKLGLGSCSPRGFYGTFPP
FT                   HMDLERTIADFLGVQEAVLYSYGACTVSSVIPALGHRSDVAVVDRGVGYGVLAGLRLSK
FT                   MDVRWYNHCDAADCARVFAQLETEDGVHSARLARPGRRRWLITEGCFQGTGRLAPLPDL
FT                   VALKDKHHARMIMDESVSFGAMGESGRGLTEHFGVNPKSIDVISASLENAGASVGGFCA
FT                   GDTGVVAYQRLMGAGYVFSASLPPYLATAAAHAIRRVSAEPRLVERAQASAAALRDAAL
FT                   SGRVPGFTTDADAGSPIVPLRLAVGASVADENALLADVAARARRRGIGVCVARVNPLVP
FT                   PDNAPPRALRCFGSAAHSREDLAAAFQVLAEESAKVLPSHALSAGVDASPGAKNKARLG
FT                   ADPGSMVMNPPGQVPPKSGGYGSPKNAPGAKINLDGTISLNKDSVRRDIFAKGDEAKAS
FT                   AGKRNGLHNRSASWSVNSMNGNSDNAPEMFEALSPVKESPMANGSASIGAPRRMFSDHD
FT                   SPQSLSVPLLVVLLYWHNIFRRYILNQIDITTHMVPRWLARIGLHPTESRGPVRFFYCA
FT                   AGYIGSRNFHSMALPLLVWTYDCGFTRLVMVFYCMTSGVGCLLKGALATNTSSSRPANS
FT                   SLGSLMPHRVHAWPSVAGCNATALPFLILRWRHGDVWLWDMEEPKAVAREYAAAFAYMF
FT                   AISLARMGNGDSPANVQGGVVVGAIMLRVLLPHIDWCIGGLEASTVFTAQGFALVGMVL
FT                   AAILLFPMPLNARGEILYASSTCYRRMWRTFFYMLFFAAGSVWREGPATRATELPTTPA
FT                   GWAGVLAAKFFVGHVISQFSVWAISYVAQLFVECWLRAYVKYFKPWSVGEHRRGKEGGE
FT                   EEGESKTYGTTHMRLVAITVVELAQDITGALVTAHGVPRLFDTLRPYTSLRI"
FT   gene            <797905..>799170
FT                   /locus_tag="MICPUN_56989"
FT   mRNA            join(<797905..797997,798118..798206,798333..>799170)
FT                   /locus_tag="MICPUN_56989"
FT                   /product="predicted protein"
FT   CDS_pept        join(797905..797997,798118..798206,798333..799170)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56989"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR026480"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T6"
FT                   /protein_id="ACO61796.1"
FT                   /translation="MASRRLLRAASAGDIDAVDALIREGADPGFQDRKGTTPLMLACEH
FT                   GHVDVVRSLLAAGAPWNELDNEGHCAGEYASAGGHAELTDALIDHAVSAEMVLGAVSRA
FT                   RPREADLTYLSQPVRYDGDDKLLDTENDAVMMDWEAPLMRIHAQVMCAGKGDTLNVGFG
FT                   MGIIDGYVVNENETRSHTIIEAHPDVHAHMLRRGWDAKRGVRVEFGRWQEVLDRIIREN
FT                   ESLPDGEKRLFDGVNFDTYGEDYDDLREFHALLPKIMRPGGVYTYFNGLAPDNIFFHTV
FT                   YCRLAQAELASLGFDTKFDVVDIDTRDPEIWRGVKRRYWWGDKYFLPTCTLTGAAGSE"
FT   gene            <799328..>802796
FT                   /locus_tag="MICPUN_56990"
FT   mRNA            join(<799328..801076,801114..>802796)
FT                   /locus_tag="MICPUN_56990"
FT                   /product="predicted protein"
FT   CDS_pept        join(799328..801076,801114..802796)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56990"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="GOA:C1E1T7"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR011869"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T7"
FT                   /protein_id="ACO61797.1"
FT                   /translation="MEDPGAPDWSRCRRVAAIHAHSASVKCVSGGRWPAGHPGESGRMR
FT                   GDDSRTTVDGFATAGLDGAARVWTLDGTSSSGFRCVAAFGDHTAGVRAVAMPPPRGTGR
FT                   DRASSSSSSSSGIPRTAPEMLAATGSYDRTARLWHASRAVPPVPPLANGHSDYVLCVSF
FT                   GPDARTLVTGGADGRICVWDCDDAAAGNPAPAACLRPGSNAAVRSVDASLPPPSEDEPG
FT                   DVLSMTGGEDGTLRVFSHASGGGAVCEVVFAGHGGAVTSLALCRGEERGWGSPPRARKE
FT                   NVPGTRRIRIAAGHDGGVLSVHDAALTSEAGGDENARASVKVKVREAFVGRVHANGAAR
FT                   ATLLLRPDARIVASASEDRTVRLWNMQKGNCLSVLVGARCTVESVSFSALGDLLYAGLA
FT                   DGHVWVYLEESGEEEDDACAGGGIERRVIESRLALAMEALRDPKDPRASSASESERCAS
FT                   GAAPSARRFQDAYEEMECDALGLLPRVDRSNVALVGEVAGGSLGGGGFAWSERGNPTLS
FT                   CSVCRGELELGFEDPGGDWPAPLPCGHVFHARSCLVPWLRHSPACPLCRANALGSGEPP
FT                   PAACLPVEPKRSCWSSLRARGSREVAGYSGFVPIESSTMTGDASSTAAEGARGEPVPGG
FT                   EPAAQEEIPEYHDPVDASTYSAALDAKVAELERLFSPLMQQASIPILNAKGVDRSVSVR
FT                   PEVFPSPPLNFRSRCRFQVMWEDAPVTAESTGITPGESVEPGRRLSYRMWNKGKPTVPI
FT                   TEFPMALREIEELMPAVLREAEAHPELGDGLQAIHFLASRGIRGGMLVTMVYGRPIDEA
FT                   WKMAAEGPRARLKAAMVDIRERVYGGGDDDGFDGFAGPRGDDEELDATALNILGRSRGT
FT                   QIVVGDACHVFETLALRDGRRLRYRQAEGAFSNPNSFMAESTLDWLCDCAATTVREALG
FT                   GTSEHSAEAAPPSLLELYSGNGNHTVALAKYFDSVAAVELSGVLCEAARENLERNGVEN
FT                   AKVLHSPSESVARGMLRRKKRHEEGRVGKAAMAAAATGAGDGSKRGDGSGMEFDINAYD
FT                   VVLVDPPRAGLDPDTLDLVSRFDVVLYISCDPRKGLLENAVGPHAARALDTGEFEGEFK
FT                   GWSGLARTHDLVRFAVFDHFPYTRHIECGACFVRRR"
FT   gene            complement(<802878..>804866)
FT                   /locus_tag="MICPUN_99494"
FT   mRNA            complement(<802878..>804866)
FT                   /locus_tag="MICPUN_99494"
FT                   /product="predicted protein"
FT   CDS_pept        complement(802878..804866)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99494"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; zinc ion binding - nucleic
FT                   acid binding [Evidence 17150; FAD binding ] [PMID 8270];
FT                   GO_process: GO:8033 - tRNA processing"
FT                   /db_xref="GOA:C1E1T8"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR001269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR018517"
FT                   /db_xref="InterPro:IPR035587"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="InterPro:IPR041367"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T8"
FT                   /protein_id="ACO62226.1"
FT                   /translation="MSEFTGPDGKPWVPPTADDLIAKGSAAVKTEYLRPVPPLADTNAN
FT                   VVDDDKAEAGKRGDGGVDKKRTGKSRRALAREKKQARESGADLCSAFSKGACTFGDKCR
FT                   YSHNVESYLRAKQPDLPGACPFIAAGKDKCPHGIMCRYLGTHPPVPDTEENKLLPALTP
FT                   QTTAELKERNAAPGVNEGVLELPVPESPGGPFGPDDEMNQFCGWLKVRLRKGQVRFDKA
FT                   DAVLKELGVESSWRYGKEGDEKLRKKYGEKKDVVDPGEGGGDETREDDDEGGGKRSKVD
FT                   PDNTAEGVDVKLRPVEKKTIDFRGKLYLAPLTTTGNLPFRRICKRYGVDITCGEMAMVT
FT                   NLLQGQPAEWALLRRHPSEDIFGAQVCGGYSDSMSRCMQLLEDEVVSKGGLDFIDINMG
FT                   CPIDLVCNKGAGSMLLEKPARMEQLVRASAPLLSCPLTLKTRMGYFDNKRVAHEIIPKM
FT                   VDWGLAGMTLHGRSRQQRYSRLADWDYINQCARASPIQLIGNGDVFSYHDYVKNVEGQG
FT                   VATCMIARGALIKPWIFTEIKERRDWDISATERLDMLKDYAAFGLEHWGADARGVANTR
FT                   RFLLEWLSFLHRYVPVGLLERMPVGIHQRPPNYVGRSDLETLLSSPNSEDWVKITTMLL
FT                   GPTPDNFSFQPKHKSNAYSKESDQVQG"
FT   gene            complement(<807347..>808056)
FT                   /locus_tag="MICPUN_71484"
FT   mRNA            complement(join(<807347..807859,807920..>808056))
FT                   /locus_tag="MICPUN_71484"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<807347..807859,807920..>808056))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71484"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:6284 - base-excision repair"
FT                   /db_xref="GOA:C1E1T9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1T9"
FT                   /protein_id="ACO62227.1"
FT                   /translation="SPFPNLARPTVDECWAARDALAKLHSSFFQQFETQQAAGGDAIGP
FT                   GKTVLDSLVGTILSQNTTDTNSHRAFAILKHRFPTWEQVRTAKPAKVEDAIRCGGLAEV
FT                   KVSRIQVILNTLKEERGECSMEYLRDMSDDDVKAELSRFKGVGPKTVSCVLMFCLKRPD
FT                   FPVDTHVWKIAKDLGWIPKGAGREDAYEHLNRRVPDDCKFDLHVLLVEHGKVY"
FT   gene            <808814..812617
FT                   /locus_tag="MICPUN_93697"
FT   mRNA            join(<808814..808970,809076..812617)
FT                   /locus_tag="MICPUN_93697"
FT                   /product="predicted protein"
FT   CDS_pept        join(808814..808970,809076..812455)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93697"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3677; DNA-directed RNA polymerase
FT                   activity - DNA binding [PMID 3899]; GO_process: GO:6350 -
FT                   transcription"
FT                   /db_xref="GOA:C1E1U0"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR007646"
FT                   /db_xref="InterPro:IPR007647"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U0"
FT                   /protein_id="ACO61798.1"
FT                   /translation="MSEENVAVEEEEEIGQEDAWTVISSFFEEKGLARQQLDSFNEFIQ
FT                   HTMQEIVDEMSDFTIEPEEQHMPGEEADGKGKKKYKVEFKQIYLSKPMVTEADGMTSTL
FT                   FPKEARLRNLTYSAPLYIDMAKSTITTTDEIDATTGKYIETIDTEEYPKVFFGKVPIML
FT                   RSQYCSLHDHTDKELTELGECPYDEGGYFIINGSEKVLIAQEKMSTNHVYVFEKRQPSK
FT                   YMWVAECRSSPESGARAASSCMARLCHAPGTKDEAGVISVTIPYIRTEIPLFVVFRALG
FT                   FVADKDILEHLVYDFEDHEMMQLLRNSIEEAQVIQSQDVALDFIGKRGSAVGVTRPKRI
FT                   QYAREILQKELLPHVGVNEGCETKKAYFLGYIVNRLLLCALGRKKEDDRDHFGNKRMDL
FT                   SGPLIAMLFRQLFRKVTKDVRLYSQRCIDSGKDIQLTLAVKAKTITSGLKYSLATGNWG
FT                   AQGAQDIRAGVSQVLNRLSFSSTLSHLRRLNSPIGREGKLAKPRQLHNSHWGMVCPAET
FT                   PEGQAVGLVKNLSLMCLVSVGSPSAPLLEFLEEWSMENLEEISPSVIVNATKIFVNGVW
FT                   VGVHREPAQLVQTLRNLRRKLDITIEVGVVHDIALRELRLYTDYGRCIRPLFIVEDNHL
FT                   VIKKKDIQMLYEKEITGYTWNDLVATGCIEYVDTEEEETTMIAMTIDELVGQRINAEPG
FT                   GVKHMYTHCEIHPSMILGICASIIPFPDHNQSPRNTYQSAMGKQAMGMYVTNFQIRMDT
FT                   LAYVLFYPQKPLVTTRAMEHLHFRELPAGVNVVVGIMCYTGYNQEDSVIMNQSSIDRGL
FT                   FRSIFYRSFKDEEKKQGSLTKEELERPSRDTTLGMRHGTYDKLDDDGLICPGTRVSGED
FT                   IIIGKTSPLPEDDPSAVSKRFTKRDCSTGMKNSETGIIDQVLLTTNDQGLRFVKIRVRS
FT                   CRTPQVGDKFSSRHGQKGTIGMTYTQEDMPFTCEGIVPDIIVNPHAIPSRMTIGQLVEC
FT                   LMGKVAAMMGKEGDATPFTPVTVESISDMLHMCGYQKRGNEVMYNGHTGRKLEAKIFLG
FT                   PTYYQRLKHMVDDKIHSRGRGPVQILTRQPMEGRSRDGGLRFGEMERDCIISHGAAAFL
FT                   KERLMDQSDAYRIHVCETCGLIAVANLKNQTFECCKNPSERTKVVQVMMPYACKLLFQE
FT                   LMSMAVAPRLVT"
FT   gene            <812765..>814126
FT                   /locus_tag="MICPUN_67496"
FT   mRNA            join(<812765..813451,813545..>814126)
FT                   /locus_tag="MICPUN_67496"
FT                   /product="predicted protein"
FT   CDS_pept        join(<812765..813451,813545..>814126)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_67496"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16787 - hydrolase activity"
FT                   /db_xref="GOA:C1E1U1"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR033308"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U1"
FT                   /protein_id="ACO61799.1"
FT                   /translation="ILLIWAPAIFYRERVAFNLAGASCQWPAVDEGNGARSSDPSVHVA
FT                   VVADPQLTTYLSYRELGRGNPGLIAVEGISDAYMSRAFRRAVLSNDPEHVLFLGDLIDQ
FT                   GEWIVNPEEWDQARGRFDRIFRWPRRAWSGDVHATGPLDDGDDGVPRDRERPVSYRTVH
FT                   GNHDVGYSRHAVRLRHLHARHEEYFGSTNFVRRLGGVDLVGVGAMALDGADDPGARSAQ
FT                   TNETWAFARRCVGEPARPRVLVTHVPLSKRSYEPGTCGDQRTSEVIRDKTHMSSTAGGR
FT                   RIEIPRHDGLGCYYQDYLRPATSRRLLDKVRPTLVLSGHDHDQCVGTHEVFASDATGRA
FT                   CATSGRSATEHTVGSFSFLMGNPRPSFAMMTVRGACGMDDGACPAELGTGGARDAVNVS
FT                   LCFLPSQWSTFKVYGALGVITVFA"
FT   gene            complement(814305..>815450)
FT                   /locus_tag="MICPUN_56996"
FT   mRNA            complement(814305..>815450)
FT                   /locus_tag="MICPUN_56996"
FT                   /product="predicted protein"
FT   CDS_pept        complement(814356..815450)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56996"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1U2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U2"
FT                   /protein_id="ACO62228.1"
FT                   /translation="MFKREEPETERLLASNPRQKLTVHRGQLYFNDPRVAGAAAPASSS
FT                   GQSHSARIAEKYGGRRYFGGGFSDNTLVDLNQSSSEGDVTSGTEYSDYDYVTDERAQQM
FT                   ERGMRGASVPAGIQTRTAVSNRRGRSGSSSYSNMINASTAMIALVVCAVLVALGLFATG
FT                   AVSTDVVSSMFSVERESLAPQADVSESDDHAHGHRASTRSARDEKEEEEDKVYPVEIGA
FT                   DADAIGPRAAARAAEEAARKRAAASAKLGDDAKKGARRASSKGASSKRAFSRKASSLGD
FT                   AARMRPKGVSGEDASSFATRSTSKGPESAGTAKAADAGAKLGDFQKAEEAAARMRNMGF
FT                   ASPEVPNREEPAAETEEASDESRR"
FT   gene            <816125..>817258
FT                   /locus_tag="MICPUN_67316"
FT   mRNA            join(<816125..816938,816978..>817258)
FT                   /locus_tag="MICPUN_67316"
FT                   /product="predicted protein"
FT   CDS_pept        join(<816125..816938,816978..>817258)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_67316"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1U3"
FT                   /db_xref="InterPro:IPR005654"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U3"
FT                   /protein_id="ACO61800.1"
FT                   /translation="SPLGAYERLSKQGVLRWDEAQHRALKTLNELHAKLVGDMDGGAAA
FT                   AKRKSEAPKKEGSWFTDLFTAREEDDEGGYASHGGVYLFGGPGCGKTFCMDLFYASLPG
FT                   TDGKEKRREHFHSFMLHTHQTLHKLGKAGHTEDTVAIYAQRVAKKTRVLCLDEFQVTDV
FT                   ADAMIIRRLLDQLWERGVTIVTTSNREPDELYKNGLNRVQFLPCIEAIKARCVVHPMES
FT                   VRDYRLTGRGIAGEDTTGGESGGFKGTWRVRREGESHEEGERWLERRLQPMGGRRIQVP
FT                   RAGGGVALFRFDEVCASAMGAGDYTAVASTFHTVGLSRVPRMTIERVDLMRRFITFIDV
FT                   MYEHKVKLLACAPTSPATLFESSGG"
FT   gene            complement(<817779..>818204)
FT                   /locus_tag="MICPUN_56998"
FT   mRNA            complement(<817779..>818204)
FT                   /locus_tag="MICPUN_56998"
FT                   /product="predicted protein"
FT   CDS_pept        complement(817779..818204)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56998"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U4"
FT                   /protein_id="ACO62229.1"
FT                   /translation="MARSPHYSHTLVIRYSECDQQGVVFNAHYQAMCDCVMDLWLRDRM
FT                   GLAWVNDVVTNGGGFSMVVASEFKYISPAKFLDDLTISGEVLRWGTTSFEVGYVGEVHS
FT                   RRCFEGKLTYVAVDPDAKPTPVPAEFRERMTAKRSRL"
FT   gene            <818374..>820488
FT                   /locus_tag="MICPUN_56999"
FT   mRNA            <818374..>820488
FT                   /locus_tag="MICPUN_56999"
FT                   /product="zinc permease family"
FT   CDS_pept        818374..820488
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_56999"
FT                   /product="zinc permease family"
FT                   /note="zinc ion transport; Zn2+)-Iron (Fe2+; GO_component:
FT                   GO:16020 - membrane; GO_function: GO:46873 - metal ion
FT                   transmembrane transporter activity; GO_process: GO:30001 -
FT                   metal ion transport"
FT                   /db_xref="GOA:C1E1U5"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U5"
FT                   /protein_id="ACO61801.1"
FT                   /translation="MGPPEGKGVTVGGVFLLTTIMAAMSGLGAIPFFFVGRLSPRIASL
FT                   GNAVACGVMLAASFDMIHEGGPYGGFYVVCGVCAGAVFISIMQGWLHGAEDVKFEMLRG
FT                   ADARKTVLMVGIMAAHALGEGSGVGVSFSGAKGWAQGQLITLAIGVHNIPEGLAVATVL
FT                   AARGVSPWKCAAWSILTSMPQPLVAVPAFVFVETFQALLPFAMGFAAGCMVWITLAELL
FT                   PDALEHAGGGEVATWATVAAAALEGFRMYTSYLENDDGSFDSPFKPAEPARVPDVVLAA
FT                   SDPIPSTLGDATFDGGAPAVNAVPTNAVPVGSSSNDATDPMPRSLPNIHAVVGSTNADA
FT                   LFPAALACLAVPLACLLAAFFLPKLFGPDVLTPRRRRRYGRGTTGTGLGDGLLDRGVDS
FT                   SQVLDVAELMAVAAGASAMTATMRLAGVVHRCRVGDAPWAAALGGACLGYLAYHLAADK
FT                   FTRTSSGRGGRDAGREDRKRRERRNGWADGPESNSAAADDSNGHRDDDLRVNGDVGSHG
FT                   STQDRGDAADGTVRAAAGVLLVALAVFAAAEGQALAAATSVLGGHVALPAAIRGAPRAL
FT                   GAACAAAASGQGRWSVAWSVFGAAALEPVAMFAAAFFGDARDGDGASGVAFLDPSASVG
FT                   IEAFAGAMLMAAAVSTVLPVARKRGERAMKMGEPDRAFGGFGLGTFFSLATVVVVGSLC
FT                   WQTPYCDRRW"
FT   gene            complement(<820601..>821547)
FT                   /locus_tag="MICPUN_57000"
FT   mRNA            complement(join(<820601..821142,821244..>821547))
FT                   /locus_tag="MICPUN_57000"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(820601..821142,821244..821547))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57000"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1U6"
FT                   /db_xref="InterPro:IPR008733"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U6"
FT                   /protein_id="ACO62230.1"
FT                   /translation="MPKPRSRPSSDAQRRPPIRRDSTRVVNRLTTFPTHACWSEILKRS
FT                   DGKDRVVGLIQYVAMVISGGRPGSVLTSIGFALNDARRPFRLYTPVAVLIDTFLAKGKP
FT                   KTKGAMRTLECIKAISTAVYVTCDHVVWAGGAGAVDKRSTLYKVCDKLSLMGWAAGSAL
FT                   MAAGHVPDLIAYTRALRDPLASDNKRDDDVDEWELREELEEKTVASALDVASGLTQALF
FT                   ALSLLGATPLKGRQMQCVGLAMGIVGVMRQLVSVPLPPEKTGMGRMGRLPISPSMPMLR
FT                   "
FT   gene            <821684..>823807
FT                   /locus_tag="MICPUN_80171"
FT   mRNA            join(<821684..822127,822308..822755,822933..>823807)
FT                   /locus_tag="MICPUN_80171"
FT                   /product="predicted protein"
FT   CDS_pept        join(821684..822127,822308..822755,822933..823807)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80171"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019140"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U7"
FT                   /protein_id="ACO61802.1"
FT                   /translation="MSAPLPSCVTDPLGAVASAFDAAIGSGDTAPDQDGDWGIKATLQE
FT                   ALDRPGVMEQIPEINAVGVDNVRPGQLVRFRCMVQDMYNPEYYVGAYKDRSTGGKWRTT
FT                   KFTERISGGNSVNTGESQPDDSAERVIWERRVLYCVPIPGESSWIARDDEDMVAKILAA
FT                   AGERKEGPAAKVDEKVDEKAASSNPVAKHPRADHATCPPASIVPEAAESMDESLNLPLG
FT                   ATDVADGLPRAAPAIVKVYESEDALPVKLNDVLELVGVLQIEPDISNDVSNTNNDQQQA
FT                   AMAAAAAAVNGDPATSGAIEAPAEIRTALIQHLAVPLGGDVLAAEYVLAAIVSRVHTRT
FT                   DSLALGKLSVTLMGVPEGGDLPRNLAAAIADIAPCVAHLPLSIAGLNARSWTPKKDYGV
FT                   NRLRSGPLQLAPGTVVVLDETALTSGQLRETGVRNVQALKQLVQLQELEYDFQYHQMRV
FT                   PVDVAVVVLTSAKQGDSVVQGGECRVPLRMVKDTRVAEQLDPVMARTMRRFVARAWGSD
FT                   HSISEKAGKEIESEMVAARQGERKATELEFHRWLTIARLCALSSGETDLTVKHWKHAME
FT                   CERKTEERLRLM"
FT   gene            <823907..>825292
FT                   /locus_tag="MICPUN_57002"
FT   mRNA            <823907..>825292
FT                   /locus_tag="MICPUN_57002"
FT                   /product="predicted protein"
FT   CDS_pept        823907..825292
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57002"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U8"
FT                   /protein_id="ACO61803.1"
FT                   /translation="MGAPDLLTRSFAPRITFVDMAEKWRDNQPAVSVAFAGVNRARRAR
FT                   AAAADASADAAEASLGRADLMPRDDTVDATRIASGASSSRGDDGDKGSESRAAWSVALG
FT                   TGLERWIADRGIVVSEPKHFVDVEALYDLYVRDVHPEGKAPNLVTFSSMAGKTLRRVLA
FT                   PATLARRVGKLSVTCEALPATRENWPPRMANKKAEKIKKHGPKDPGRSRPHDLVKQDKD
FT                   STGATCARYVSEMLKLACGPELVRLRVFPDAKELTEAFAASNAIRTHLWSRYKPNDERV
FT                   CLIAVGDGNTPRSAALCAFLTRWQCVAVDPEMVPWRDWRRRHKIQDATWSSCEVKEGDE
FT                   IDEEGDTHGWGGVRRLQVHRRKMQEMVVECELALIVMIHAHISLKDVLAAVKTKSGECA
FT                   AVILPCCNWYSRLAHPDGATAPCHEYEDDAVVSPQRTVRVFSSLPCGVSGAGDGVPCPE
FT                   VVA"
FT   gene            complement(825309..826225)
FT                   /locus_tag="MICPUN_52244"
FT   mRNA            complement(join(825309..826007,826121..826225))
FT                   /locus_tag="MICPUN_52244"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(825392..826007,826121..826179))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52244"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1U9"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1U9"
FT                   /protein_id="ACO62231.1"
FT                   /translation="MGGGDFVGDYGSVQDRNAERSRFHADLAESQWHTLGDLLERKRSS
FT                   NPRSMLVAVKKFVTGHGKGLGSAPFLLGLRAFLEAQRGGTECVAWVLSPAVFTQSGGEI
FT                   WMRDAVDAIASGADRRVDLEGDDGNDIPLSDADKRLAWSLPLQFRDGDIDEVLSQIPSK
FT                   ARLEDAGCGPTGEIVRHGAHPPGAPARTAGTGKRRGCRARCCFLPFLFVAATVCCVVVL
FT                   VR"
FT   gene            complement(826368..827149)
FT                   /locus_tag="MICPUN_107924"
FT   mRNA            complement(826368..827149)
FT                   /locus_tag="MICPUN_107924"
FT                   /product="predicted protein"
FT   CDS_pept        complement(826512..827135)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107924"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V0"
FT                   /protein_id="ACO62232.1"
FT                   /translation="MQAITSLFTVKPVTRRPKVAKRGSLQVVAHGGVGGSGGTQYPGKD
FT                   KPYGSDQAPWKKKLILHDDDQADPEANQRSGQRWTPPPPKQESFAAAAPAQSTSSWDSP
FT                   SSGSGGSSNAYSWDSGGSSSYSSAGSAKGRPTHYDPDQYDPDANQRGYMGGGGGGGYSA
FT                   PKPSYGGSTGGGYAAAKPQRVTRGSDGVTYDPDQYDPDANQRSR"
FT   gene            <827449..>829164
FT                   /locus_tag="MICPUN_57005"
FT   mRNA            <827449..>829164
FT                   /locus_tag="MICPUN_57005"
FT                   /product="predicted protein"
FT   CDS_pept        827449..829164
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57005"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1V1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V1"
FT                   /protein_id="ACO61804.1"
FT                   /translation="MGGFSEYRRKKATMLSAAKRLRVEDRGGQERRSARVGRGAEDGTV
FT                   ASDRGLPTRGWQVSVTEPVAGSRRGLSRPLVAGEPIMKKSDRREATSDRRRAGGYGAAD
FT                   GAPIAWDAADDLPMHPRTRGRSSAAASSSSAFPSCAALVTGVALMMMVAVCALAVVHPE
FT                   LARAGATHAAAAWTGRVSSFVSSFRRETVDTQSARLAFLAPHGHDGRHRHAQKTAAKMG
FT                   PGCELLSVEEAAASVAAAFAKGESSIGAACEAAKQFRWDDVDPYVDAAAKDRVGGNEDE
FT                   GKVVVFHAGSRFDPDAVTRAAEMMARDDEVDPKVSPGEGSAGAEKRKEKSGAAHVGKKE
FT                   KSGAAHEGKKENALPLPGGGDEPPPRPTGNLTAPPAPPAPPRPVPALRDSSTAKSKKGA
FT                   GLGEERLPGSNGGVFGVLRGLMRRRETSEERAFRAWQKKHDTGEVGAATAARRLLAVPG
FT                   RDGRSKTTKSRSKDRGEGSKVPGWTCVIVGENARVAQKISRAVADVGLPCASVVNRANK
FT                   TRDGANVRGEECEVKRARAADVKLMSRARHVVATEHNDGAHVAALLRRCARDAA"
FT   gene            complement(<829304..>832814)
FT                   /locus_tag="MICPUN_99502"
FT   mRNA            complement(join(<829304..832625,832753..>832814))
FT                   /locus_tag="MICPUN_99502"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(829304..832625,832753..832814))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99502"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006640"
FT                   /db_xref="InterPro:IPR036910"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V2"
FT                   /protein_id="ACO62233.1"
FT                   /translation="MSSLVSQLTAKTPATGKRSSRRKLGGTVSIVGTDVNEEVVSRALP
FT                   AITPGTKAKPLRKPLGERTNGATTAKKTRGLDDDAVTGLTNALKTAAKAAKKKDGDIAS
FT                   KENGADYSEFADLPTDPLERGLALVRKGVEAMRTGGVDPKEALLKFAKKPKSGPNVREA
FT                   AATVVNRLLETLEAAADDKSDTSRELDYSGGSDDENNESEVVEAVGDDDEEVEEDDSED
FT                   VFATATNSPVKSISGASDSAGVAADDLSAALQGMTVTVEEGVMGCGDESCGSGPDGACD
FT                   PLECMRRAGGPFKMPAKLVKQPSTVSTARSSPPEEKDAPVVGEKEEDEDDEDEEEDANE
FT                   STAEESVLATDDDDEDDADEEDDDESVADTASVAGTDSQEESSMADLAAVEAAAEADAA
FT                   EGSPMMSPGPEVVDVSDLPDGTPLAEPVPDAPIVIDADDTDEECDDDDEVTSKATPPAM
FT                   NATVREKLDSSAEDDAADETGYQEDDDEMPVSARRTPGRRSRAVVDSSDEDEADDEKAS
FT                   SREGEEGEGSGESPSIGTPPAANTPPAQPVFNAPPPTTGRRSILRRIASNMKMRAQREA
FT                   REAAMRAPNFDDDAASSELSAAANAPAPALAATQPKAFPKSALKKSSKYAAAPAPEPEV
FT                   SEEASTAADAVTPARRRPQRRAVIESARKKALAWIDDEASDDGDDDDDEDEDEACSADD
FT                   DFVCDDDDVEYDSDASSNAIAEDMHARSGGVMPNVTPSPEVPKTVSRAPKSILKGRTPG
FT                   KTPGKGSRLTFGDDDVKHMTDSEGEGSSPEPDENDPRLPRTMVAKGTAQDPYGLDDLKT
FT                   PTPPRPLAEVLNEARTPSWAKTPNTAGRKTVGFGASFGNEPPPTHSKALAAALASAAKP
FT                   GKTLNYGKHKETIARALYNEFNADAFDGKLPAKLDISWNAKLLTTAGLTHYKKVTRSTG
FT                   LSEYSARIELSTKVLDCAEKLEATLLHEMCHAAAWLLDHQAKPPHGATFKKWAKQAMRT
FT                   YPDVSVDTCHSYEIFQPYRYRCTQQWCNTEYGRHSKSIDVEAKACGVCNGRLEYLGKFN
FT                   PDGSKAEEKPPTAFSLFVKEHFAATKERMPAGTPHKNIMKELSGLWKSGGGTTGKKTRG
FT                   GDDEALSPDALGESMRTLKL"
FT   gene            <833109..>833492
FT                   /locus_tag="MICPUN_57007"
FT   mRNA            <833109..>833492
FT                   /locus_tag="MICPUN_57007"
FT                   /product="predicted protein"
FT   CDS_pept        833109..833492
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57007"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR008560"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V3"
FT                   /protein_id="ACO61805.1"
FT                   /translation="MSGVQLKAVQDLQAQLTKVMEELDHKVFRPQQKAAFQCSIKCTDL
FT                   RGPQEEMHACLAKCGEPIQRHEAAVMGELQEFQHRVQRCVQQCQDKQATTQDQGKFDKC
FT                   VSECAVFYQKELASLKPQLMKKR"
FT   gene            complement(833595..834342)
FT                   /locus_tag="MICPUN_107925"
FT   mRNA            complement(833595..834342)
FT                   /locus_tag="MICPUN_107925"
FT                   /product="predicted protein"
FT   CDS_pept        complement(833646..834200)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107925"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1V4"
FT                   /db_xref="InterPro:IPR019540"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V4"
FT                   /protein_id="ACO62234.1"
FT                   /translation="MEAAVGQLRQLLGLSPSPPHADIDEPKLNIRSVPASSAGFATWEV
FT                   DVLVRRRAAAGHRAAMDSLDSLAAVVKAMPEMDVPKALAEAAGESLSESRLAREAAVDG
FT                   RLEDAAVHARNSHAHAESAFFHPQIISLLYFPQEYKLAVYIPLFLPTLFPLFTGLMWDV
FT                   KFYVRRTRCAAEHRRRAGKAD"
FT   gene            <836124..>837818
FT                   /locus_tag="MICPUN_57009"
FT   mRNA            <836124..>837818
FT                   /locus_tag="MICPUN_57009"
FT                   /product="predicted protein"
FT   CDS_pept        836124..837818
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57009"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V5"
FT                   /protein_id="ACO61806.1"
FT                   /translation="MSQSNTGAGYDEFTPVPLTAEALAQLASQDHGLGNVARMMDNGVW
FT                   NTDGVQDDIRRESIDRDVDRYHRTLDMGKRVPRNSRRSEDAEPRISCNSNLSGFDAVGG
FT                   SFIAHLAPRYGSSSFTSRATSLAMNAIAAELDCTEVRAVSTRGSVAHETAGVQAFHSDV
FT                   ISALFVGHLDNKLDLARKCDVPTGISCAELVFHLYNDCGAAFLDQLQGFFAFCIVDAGS
FT                   ATVFAAVDRHASIPLYKARSKGGGVFIAHPGGSGSSAIKLSTLGEMSKIPAGSYVHGNR
FT                   HINPHKYARDKFAERALMEMDTLDETASVLSAGPSPFDIMDQNKTGQPAGFSSLFSSGS
FT                   LFSQSMDDLPSMEGGYPERRETTSPPKVKDVLRRRHSVEDLTKFSDGIGTWNARWNMDE
FT                   DDDDMNVVQVDGHGSESRMGESFHRARKNGSAVSNVSGLDTAPGTPSKADVGTFGKPPA
FT                   VPDERRRHVAHVEKKSSPARTRVRKSSWSNGSEEEARGKENMRRVHSDGELNSLSGRSN
FT                   PKAIPSRAKDDASVISMCRSMSTGHVSSSDALSETECYVSLSLGAGA"
FT   gene            <838324..>840309
FT                   /locus_tag="MICPUN_57010"
FT   mRNA            <838324..>840309
FT                   /locus_tag="MICPUN_57010"
FT                   /product="predicted protein"
FT   CDS_pept        838324..840309
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57010"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039941"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V6"
FT                   /protein_id="ACO61807.1"
FT                   /translation="MAGAVTGIPEGRATETIYGLIRDGKHDECAKLLEIQLANAPDSRP
FT                   ALSLLGYCYYYLGNFERAAEMYGQLAKLFPENEDYAVHHAQSLYKASMYQDALRASRAI
FT                   DSKDPAVRQKVSQLQALIAYEEDDLAGCRARLDECPSDDPDVVVNLACCMLKEGRFEEA
FT                   RTRFLDAQQALGFQADIAYNIALCYYRTKQFGPALKHLAEIIERGMREHPELAVGAATD
FT                   ATQTGEEIRSVGNTPALKETALVEAFNLKAAIEYAMGNSEGFREALTDMPPRTEEELDP
FT                   VTLHNVALMNMESDPTDGFHKLNFLLQSPVSPPETFGNLLLLYCKPEHGFYDLAADVMA
FT                   ENPQLVAKHLPQEVHQFLEATILAQTAPEEAYRKFEELVQRNADKLRRLTRKIQEYRQG
FT                   RDDKALKKSLAEYDETLDAYVPALMAQAKIYWDAENYQQVEKILRQGADYCADHEAYKV
FT                   NMAHTCFMQALSNDEKYVDAIQHYEPIVREKLEDESGMGVLNVTAIVLANLCVAYIMTS
FT                   QNEEAEELMRAIERAEEEVQYHDPNRQCFHLCIVNLVIGTLYCSKGNYEFGISRVIKSL
FT                   EPYDKKLETDTWFYAKRCVVALLDLLGKHMITVPDSTMDEVMAFLDEAERHGREIVTQL
FT                   GDDGQGRTLTTEARMIKKMFIKLRDL"
FT   gene            complement(<840761..>842197)
FT                   /locus_tag="MICPUN_67015"
FT   mRNA            complement(<840761..>842197)
FT                   /locus_tag="MICPUN_67015"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<840761..>842197)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_67015"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3840 - gamma-glutamyltransferase
FT                   activity"
FT                   /db_xref="GOA:C1E1V7"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V7"
FT                   /protein_id="ACO62235.1"
FT                   /translation="GAVAADEARCSAIGAAVLDDGGHAVDASIATALCLGVTHPHSSGV
FT                   GGGAFMVIRLANGTTEAIEFRESAPAAAYRDMYVDGSGANGANRSSTFGGAAVAVPAEL
FT                   AGLHLAWERHGRLPWRRLVEPAALLANGFEVGKDLAREIADMAEDLAKFPVTKEVFLKA
FT                   DGSPLLEGETCANTRLAATLRRVANEGPSVLRTGELADALAKDIRDAGGVMESSDLAAY
FT                   RPRIFEPIVASAMGVELIGMPPPSSGGAAVAQIIEFLDGYDLPLASAGTLGTHRTAEAF
FT                   KHAFAMRMNLGDPDSATPDMTAALNDMLSPTFNAELRSMTKDDRTLNVTAYGAKWNQLD
FT                   DSGTTHVSVVDKERNAVALTSTINTEFGSKLVSPSTGIVLNNEMDDFSSPGEVNHYGLA
FT                   PHEANFIAAGKRPLSSMSPTIVTRDGKLYAVAGASGGPRIITATAQLLLNVIARGMSPL
FT                   DAVNAPRLHHQLVPHVAFAEN"
FT   gene            <842783..>843400
FT                   /locus_tag="MICPUN_57012"
FT   mRNA            join(<842783..842881,842993..>843400)
FT                   /locus_tag="MICPUN_57012"
FT                   /product="predicted protein"
FT   CDS_pept        join(842783..842881,842993..843400)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57012"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V8"
FT                   /protein_id="ACO61808.1"
FT                   /translation="MTGWTPIELPPSNPKRTLDIVPKGLEAQEVCELMFKAIETNDCDT
FT                   YLSCCSHSTRAPRTVGSFGLTNWDQGREQWRKYKVTYRFLGESDPDDDDERPPGEWLKG
FT                   AERLVCRYQGQFGKVPGYDHGETVPRPAQAKQRPEQDVAVHLIREPLGGIWGAEREWRV
FT                   FKVEY"
FT   gene            complement(<843511..>845583)
FT                   /locus_tag="MICPUN_80126"
FT   mRNA            complement(<843511..>845583)
FT                   /locus_tag="MICPUN_80126"
FT                   /product="predicted protein"
FT   CDS_pept        complement(843511..845583)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80126"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5777 - peroxisome; GO_function:
FT                   GO:3997; acyl-CoA dehydrogenase activity - acyl-CoA oxidase
FT                   activity [PMID 3995]; GO_process: GO:6635 - fatty acid
FT                   beta-oxidation"
FT                   /db_xref="GOA:C1E1V9"
FT                   /db_xref="InterPro:IPR002655"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR012258"
FT                   /db_xref="InterPro:IPR029320"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1V9"
FT                   /protein_id="ACO62236.1"
FT                   /translation="MITAHQADPTEDLRRERSQASFPSRELAALMAGGEAQLKLRERIA
FT                   DAVRADPVFSKKGKYFMERADLYRTTLEKYLALPRLATAIDPNDPITVGKIIRELIDEP
FT                   GGLDLHLGMFIPTIQGQGDEEQRKHWLPMCTKLQIIGTYAQTELGHGTYIRGLETTATY
FT                   DAEKEQFIIHSPTLTATKWWPGGMGKTSTHAVVMARLITHGRDRGPHAFVVQIRRNEDH
FT                   QTMPGVTAGDIGPKMGYNAVDNGFLRFDHVRVPRRAMLMRYSKVDPDGTFHPPPVAKAS
FT                   YGTMVFVRSDIVMNAALYMKKAVTIAMRYNLVRRQSNPGGEKASGGVGQKGLELQVIDY
FT                   QHSQRSLFPILARAFAFHCTSDFMRRMYFRYEKVSTRKGDFSALPELHATSSGLKAYCS
FT                   WATKDAIELCRLCCGGHGFMMLAGFGTTFGNYAPNATYEGDNNVLCLQTARYLLKVARA
FT                   VAKAAARGGDVRDAEEGAQGTSAYILEGGGGLEPGCQLGKSVGLRDTEAALGAFAHAAR
FT                   RQILAAASRAGTLGADAAMSRDMVAWIKAAKAHCAYVVLLNFVDAVAESKPRVSSATAA
FT                   VMDRLVSLHALATMDDNMGDFLEDGHVSADQAAAIRAEVAVLLAELRPDAAALVDSFAL
FT                   DDYFLNSALGSHDGDVYRRLYDEVQSAPFNASHVPPGYADLLHSRLIKGAGRSRL"
FT   gene            <845975..847525
FT                   /locus_tag="MICPUN_57014"
FT   mRNA            <845975..847525
FT                   /locus_tag="MICPUN_57014"
FT                   /product="predicted protein"
FT   CDS_pept        845975..847522
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57014"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W0"
FT                   /protein_id="ACO61809.1"
FT                   /translation="MGAESKGILKPSRFSAHVDEPAAHADEGDATPSATQTTHYKEFHS
FT                   RVADVFANLGPGICGSGSTGGASDPKGSHQSPAEAVWMPANTTVTRRGARDDYSDDDDD
FT                   DEDEDGRIGRPKRNGNDDSSDDSRDDPSDEDDEEDRPTFDHTASNAEVSEVRRQRQKAR
FT                   WAEDLDCLESDEEGDDDQKKMAKLGRSVGRCSALNDEEEFDCYDTLAMTGMNRRQPMDR
FT                   NGEGGIDVARIRRLVEGDDDEFEEVDKEDVGFTKVLASNEYERRILAREGKDAPDEDED
FT                   EDEDEDEDEDTPDEAAAAAAGVGAATVDPVADGAAAAGRRKRGGFGGAYVPPNKRAKGE
FT                   PGAAPTRGVAWDDSVPEVTRPRFGGSRGRGGGRGRGRGVPDHVKNPHKYTCYTLDEPLT
FT                   VGGGGGVGDGFKEMEAARRAASAAAAARDATPNERSLPAAPTEKPVFQLSAAAAARRDA
FT                   RRGEKKKAGSATVAGVKIDFAHDDEDDEGGAEDGNRSGLGGSKKRARNFRKKAAEDD"
FT   gene            847691..848403
FT                   /locus_tag="MICPUN_57015"
FT   mRNA            join(847691..848164,848264..848403)
FT                   /locus_tag="MICPUN_57015"
FT                   /product="twin arginine targeting family"
FT   CDS_pept        join(847817..848164,848264..848350)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57015"
FT                   /product="twin arginine targeting family"
FT                   /note="protein export; GO_function: GO:8565 - protein
FT                   transporter activity; GO_process: GO:15031 - protein
FT                   transport"
FT                   /db_xref="GOA:C1E1W1"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W1"
FT                   /protein_id="ACO61810.1"
FT                   /translation="MASTTASLVVRPTHAVRTRARSPASSAAPKSAAMSGLSAPAPAFL
FT                   GAKPAQLSAGITAGRSGAGTRSVATMGLFGLGLPELVVIGGVAAVLFGPSKLPELGKSL
FT                   GKTVKSFQAAANEFQDELKSDKEGEEQPPKQIEEGEKKSD"
FT   gene            complement(<848405..>850036)
FT                   /locus_tag="MICPUN_57016"
FT   mRNA            complement(<848405..>850036)
FT                   /locus_tag="MICPUN_57016"
FT                   /product="predicted protein"
FT   CDS_pept        complement(848405..850036)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57016"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1E1W2"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR034220"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W2"
FT                   /protein_id="ACO62237.1"
FT                   /translation="MGIFDEVFGRKIEGDGGGLFSDKYKAERDVIHDPLPASAYVDVLK
FT                   KNDELLEQLAKSGKGMAREEFSDSDGDSDGYSDKDDSSDSDSDSERPAKKPKKKERSKY
FT                   EEMDEAFAEANAMMAEGEPDKRKKSAAAAAEDTSDDESGSEEDDESDSDAGSDDEDDEG
FT                   AGASSDSDSLTDVEAERAARKAARDEAKAKKAAAKQAKEQQPGEEHRPQDDALPRTVFV
FT                   GNLPVTIKPKKLKTLFSEFGAVDSVRLRNVPVDPEGKMPRGGKVITGKLVENRKSTNAY
FT                   VVFKEEKSVEAACKGMNMREVDGRHVRVDRAVAPSAKANETIAKEKGANAGGEVAYDHT
FT                   RSLFLGNLPYDVDEEDVIRLFHRSKEYPELNGAVEAVRVVRDRKTNLGKGIAFVLFRKG
FT                   SDARTGLLLDGTKMGEREVRVTRASKNREALKAQAEKSKKRKADKEAKKEPQGAARRLG
FT                   LDKAPDAKGSAAAWEGSRSRPGGKRQKIAFGGYDAAIERGKDGKKGAGGKGGGKPAAKG
FT                   ARTGKRPAVAARKAKAKAQAAAGKKK"
FT   gene            <852218..>853299
FT                   /locus_tag="MICPUN_80108"
FT   mRNA            join(<852218..852403,852500..>853299)
FT                   /locus_tag="MICPUN_80108"
FT                   /product="predicted protein"
FT   CDS_pept        join(852218..852403,852500..>853299)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80108"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E1W3"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W3"
FT                   /protein_id="ACO61811.1"
FT                   /translation="MPGGLLHLDNSEHILSIGYVHRHRPFEEEYDLGEAIGTGGFAVVR
FT                   KAVHRATGVTYAVKTLRKPRKLVAMSLEEVMNELIMMQQLSEHPSIITIKEFFTEGGAD
FT                   YDHIATKPTTGLDEEEDGIVHVVMELLEGQELVDAITDVGAYDEGQSQIVMSSMLDAIA
FT                   FMHARGVVHRDLKLENLCLAKPNDLNSVTLLDFGLAKALTAREKEENVCGTLAYVAPEA
FT                   LVAGVYGQGVDVWALGVAMHVLLTGAWPFDDDDEDELIDQIVECDLDFDEGEEWQAISP
FT                   QAKDLLGGLLEPNPKRRLGAAQALEHAWFTGQKNNTSERLHHVHARL"
FT   gene            <855288..>856454
FT                   /locus_tag="MICPUN_52253"
FT   mRNA            <855288..>856454
FT                   /locus_tag="MICPUN_52253"
FT                   /product="predicted protein"
FT   CDS_pept        855288..856454
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52253"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W4"
FT                   /protein_id="ACO61812.1"
FT                   /translation="MNRDEKQSALPLPTSSNHIPALRALAESDALSPSLLILSDAARTL
FT                   SRGAFLYLNLASHSLVHLEIRNCEWLESLDFVSELPSLRCLSLRGCVALPSHSLEALAR
FT                   PPKNDDAHAPPRRRGRRRPELAGNRAGARDPPNLVSLDLSGCAAVDDAAGPHLARLPRS
FT                   MRSLDLSTCAVGNLLLDYLTYRGRLTRWRRDRRGIGESENGTSEDGTSDDDGCTATDLR
FT                   LRGTRVSDAGLGHLKTLGPDVALLDLSECRGVSAGAIAELASVLGMSASTSRPGLLVAP
FT                   GTGEGREMCACGSGRESCCELAEEGWRAFLCAVREEEIREEEIREEEIREESQRVAALA
FT                   ASERDESDAVEDDGNIPMFPIGAPLSHSHPSGGESPPHQYRRVSYLID"
FT   gene            complement(<856504..>859397)
FT                   /locus_tag="MICPUN_57020"
FT   mRNA            complement(join(<856504..857033,857318..>859397))
FT                   /locus_tag="MICPUN_57020"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(856504..857033,857318..859397))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57020"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011632"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W5"
FT                   /protein_id="ACO62238.1"
FT                   /translation="MSSRQVQLNQELARKTLAADVLAIVRDSVDEFNLVNCGTALQRLA
FT                   KCPDTHRLLSPTSSALPGVPRVLQEQFARLLDAAARLVSKDPRHVESRQLASMLWACGK
FT                   LELGHRAADLVEGIETAAIMHASKFNPQELANAIWGAAKLGLDPSRSELVRAVADAIAV
FT                   SLPRASAAPGGPQRNPKGAGPGGWRANAPREWTPQGISNVAMSLAKLDADVTHGEGVST
FT                   TGGGFKYGRVFGEVCAAAKARAEDFNPQEIANILHALAKLTAGDGDGDGGGRTIVGPVE
FT                   RTARDATEALASRITRRWIEAQRLEPQHVANMSWACAKMGAAGGDDLAGALATAAATLA
FT                   PRMNTQELSMCAWSAAAFGSGRWPADCAETVARAFGNRAGEATPRQLAKAAMAYAKLGT
FT                   LHPRLMDAVANAVLALEQPFASALNPQDVANLAWSFSKLGFKKKRLFDAISAAFVAHLG
FT                   EDEARFSSQQLTMIVCAFGLLDFKDESMLNAAMGAMSKERVAEFNPRDLTNTSWALAAL
FT                   GVNAEAKPDLVERIGRTARKRLDDFNSQELLKFLGAFERLGGKDSKLAKAVSKQRTLSY
FT                   EFPALSTHAESSFVKLSSKTPTSYQGTDRVRVDDSCGGWGRGNTGVALWEGSFVLAEWL
FT                   SRQSTPTGSDEMAEVMRGAWGPNESGGWRGMTGVELGAGLGLPSIVASKLGLEMVATDG
FT                   DDDVLELLSQNIETNTSPEAKARVSRLVWGCDEPLEHLGLSEPPKLILASDVVYGNDPQ
FT                   KWKLLVKTMCDLSGPSTLVVIGNVQRYPVHHPMAETKFFSEATARDFERTEVPVTSLHP
FT                   DFRRTGGGACVIHLFRRRPESLKRSRSDSDVSERKVKKSKKEKKGKKEKKSSKKERK"
FT   gene            complement(<859804..>861807)
FT                   /locus_tag="MICPUN_57021"
FT   mRNA            complement(<859804..>861807)
FT                   /locus_tag="MICPUN_57021"
FT                   /product="predicted protein"
FT   CDS_pept        complement(859804..861807)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57021"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR008302"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W6"
FT                   /protein_id="ACO62239.1"
FT                   /translation="MAQQQPPPLILFLAGAAAGALIAANGVLSAVRKRAGRSRSRDDGR
FT                   RVRVGLEVAKDDNWKIFRGKKVGVVSNPTGVLPTTLEHTVDVMHASVGTVDIRAVFGPE
FT                   QGFRGVGQNSNPYGSYDSDKENGSDGSFVDQRTGLPVYDTYLKKGPELTAILERSGVDV
FT                   VAFDIQDVGARYYAYVWTLYDVMVAAASAKKPISVVVLDRPNPLGGEVLEGPVDIAVGC
FT                   ESLVGRKPIPVRHGMTVGELAWFLNKKYVAADPDNGSRKSVKLSVVAMRGYRRRMTWEE
FT                   TGLPWVPPSPNMPTPRTALAYVGGALLEGTNCCEGKGTTAPFELVGATWADGRLADFLM
FT                   RRTPASAARSVAPLDASNESPQPRSEEEETEPAPSRRGRSSVKRGLNYRPNYAESSPGN
FT                   SPRKNGARPSPGTPRGGIGKKPRGGKSAKGKGRKKSKSRLSRPPSGKMIRIREGAPVDG
FT                   PAAKYREAYFTPTSGALQGRIVSGVQVYPRGIENALFREGVEILLALRRCYPGEFAWRE
FT                   QATVRARVENARWRAENSAVLRSPAKSTYSNYSRKGGYYPDERSSDDGYSSEDDRGWRG
FT                   DDGEVPWSPESARRPGRRPGLPPRSPVPPAPPPPARWDPKKTPFIDMLTGSAALREAVD
FT                   AADDEKVEGVIAEWESQLEKFAEVRRGFLLYD"
FT   gene            <862127..867688
FT                   /locus_tag="MICPUN_105289"
FT   mRNA            join(<862127..862165,862282..862653,862930..867688)
FT                   /locus_tag="MICPUN_105289"
FT                   /product="predicted protein"
FT   CDS_pept        join(862127..862165,862282..862653,862930..867594)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105289"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:30130; clathrin coat of coated pit
FT                   - clathrin coat of trans-Golgi network vesicle [PMID
FT                   30132]; GO_function: GO:5515; structural molecule activity
FT                   - protein binding [Evidence 8565] [PMID 5198]; GO_process:
FT                   GO:6886; vesicle-mediated transport - intracellular protein
FT                   transport [Evidence 6461] [PMID 16192]"
FT                   /db_xref="GOA:C1E1W7"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015348"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016025"
FT                   /db_xref="InterPro:IPR016341"
FT                   /db_xref="InterPro:IPR022365"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W7"
FT                   /protein_id="ACO61813.1"
FT                   /translation="MAAPPVTVKEVVSLTSSGINPQNISFTNLTMESEKFICVRETGAA
FT                   NSVVIVDMAQPMTPMKRPITADSALMNPAAKVIALKATVAGTAQDHLQIFNIDTKSKMK
FT                   SHQMPESVVYWRWISPSLMGIVTNTAVYHWSMEGDSEPQKMFDRTGNLNGCQIIAYRAS
FT                   QDMKWFSVVGIAAGDPSRPGLVKGKMQLFSKELGRSQELDAHACAFSTHQVTGNSVKSQ
FT                   VIAFAQKTVMPDGNVASKLHVIELGAQAGQTPFQKRQAELFFPPEFMDDFPVNMSISEK
FT                   YGVIYVVTKMGLLFVYDLETATAIYRNKVSNDPVFLACDSPSTGGVYAVNRRGQVLLLN
FT                   LNEPAVVPFISGQLNNVSLALQVAVRGGLPGAESLVKPKFEQLFAAGDIKGAAECAADS
FT                   PKGILRNPETIARFKAIPAQPGAAPPLLQYFGICLQRGTLNKVEGVELARLVLAQNKKQ
FT                   LLDTWMAEDKIECSEELGDLLQSVDADMALRVYIKAKANTKVVAALAARGEFEKMGKYC
FT                   EMADYKPDYSYLLQSTLMSNPQGAVTIALQVSKMNPPPLDYNTVADLFLQRNMIREATS
FT                   FLLDVLKEDREDQAAMQTKVLEINLVTFPNVADAILGQGKLTHYDRPRIAQLCEKAGLY
FT                   MRALEHYTEVSDLKRCCVNTHSIDPQALLEWFGTLSREWALECIKELLVSNPRQNLQII
FT                   VNVCKEYTEQIGADAILKLLEEHNSSEGMFFYLGALVATSTEPDHHQKYIEAAAKTGQI
FT                   KEVERITRESEHYDPEKAKVFLMEAKLPDARPLINVCDRFDMVDDLTTFLYQNKMLRYI
FT                   EGYVQKVNPSNTPVVVGALLDLECDEDFVQNLILSVRSLLPVGPLVEEVSKRNRLKMLT
FT                   PFLENLVAEGSTNADVHNALGMILIDSNTNPEHFLTTNEYYDSKVVGKYCEKRDPNLAC
FT                   VAYKRGNCDLELVEVTNKNSLFKLQSRYVVERMDADLWEHVLAEDNPHRRQLIDQVVST
FT                   ALPESKNPEQVSVTVKAFMTAEMPQELIELLEKIVIQNSAFSNNPNLQNLLILTAIKAD
FT                   TTRVMDYINRLDAFNGPEVGEIAVGNELYEEAFAIFKKFDLHVDAMKVLLENLENLERG
FT                   EEYANKVDLPEVWSQLAKAYLSQDLVSAAVAAYIKAKYTDDYLAVIDVAKRADDFDSMV
FT                   KYLAMVRKKVKEPKVDSELCYAYAKTDKLAELEEFITQPNAAKLDNVGDRCFDEGLYEA
FT                   AKVLFTTCSNWGRLASTLVKLHKFSEAVDAARKANNTRTWKEICFACVDEGEFRLAQLC
FT                   ALNIIVNADELEEISEYYQVRGRYEELLSLMEAGVGLERAHMGIFTELGILYAKFKPEK
FT                   LMEHLKLFSTRINIPKLIRACEEMHAWKELSFLYIAYDEYDNAAGVMMAHPDAWEHVGF
FT                   KDVCVKVANLEIYYKALEFYLVSHPTQLNDLLTVLTPRIDHSRVVALMRQANHLPLIKP
FT                   YLQAVQNTNMVAVNDAVNELCLEEEDFESLRTSIDTYDNFDQMSLANKCEKHELLEFRR
FT                   IAGFLYQKNAKWTKSVELSKKDGLYKDAMEAAAQSGDKDIAGDLLQFFIEQENKECFAA
FT                   MLYNCYDLLKPDEVLEIAWMKGLMEYAMPYMIQVMKDYTNKVDVLVEDKKDRNKEKADQ
FT                   EKEKVEQQMNQNMYAQLLPAALPAPGMETTGGMNNPGMYGQMGGVQPGMYGGY"
FT   gene            867784..869233
FT                   /locus_tag="MICPUN_107928"
FT   mRNA            867784..869233
FT                   /locus_tag="MICPUN_107928"
FT                   /product="predicted protein"
FT   CDS_pept        867909..869153
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107928"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W8"
FT                   /protein_id="ACO61814.1"
FT                   /translation="MRMEKAKALREELDGVRTRSRRLLAKGNRLVERGVQLKAAAERVM
FT                   LGNEINKEDEARRLLVERKKVKDTLDLTTARAEVLAELASKLETAIIVLENATDEESVD
FT                   AAKALAADTLPAAKRASLQEFKTAPVSSRPASMGEDDVSQDSIAERFGRDSLEREFAAL
FT                   EITQLERMLRLTPDDPRISSEDTVVKEDDDDVVVSNTEPAWWQAPSQPKDADGATMTPR
FT                   EALLEVDRARVSSKGVQGHHVVALRKSCAVHGAGTIRVSDRLIGGKKDTAFRAGVGAAM
FT                   TAMETGEGETTGWSSLGGYEPTVFLSDLARDLGVTPERAGVLVANATARKSAAALLQAG
FT                   ASVRGGEAESARVDLKKLTSVLRTFRACAGEYLDLVAFGLEQQLSEAERKIVLGLVPKE
FT                   TSEDVRGAIRCALGL"
FT   gene            complement(871073..>874495)
FT                   /locus_tag="MICPUN_57025"
FT   mRNA            complement(871073..>874495)
FT                   /locus_tag="MICPUN_57025"
FT                   /product="predicted protein"
FT   CDS_pept        complement(871781..874495)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57025"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1W9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1W9"
FT                   /protein_id="ACO62240.1"
FT                   /translation="MCSRQPPGELAWGRAPRRRGGARNALPQPWKLRLDQRISGKSVRA
FT                   RLVTTRAPRGPGRRFETMQAGVASRSWAPDVADRRRGRGTRTSRRQRRVAVRAAQTGTR
FT                   DDSDDVTARDAWADLGPAGHRRGTNRIAETSAATAAVPAVDAPKSGLKVDPITAAAGGT
FT                   ALAAAGVVAALRSNPKATEELVHLKELMEHRAEVLREFGTGTGREMFPVIRRYAEQIQR
FT                   RYDVLLLPNGVETMIYAEIVKTGAIGAYESLYDNVRNVNLLGHPLKLKTIANLGHQPPV
FT                   PKVNMEDCEEFVTSVLFDDEDENVGLGIIPRPLEVQIYRNAMVTAVYLMEDTLEHFNVR
FT                   FFGTQYSFEFGRPDEGWRTSKNHPTLSDSALRRLVREEIQAPAVLRLAPGVEKNAGKVA
FT                   VALAGEVVGSAEINFLGLPLRFSLQPGGDEAFSSDIGRIPSLSEAGKLVPGGGEVLPNF
FT                   NPATAVIKQNVCSETLEIIENYVELYLESRPKQNIITNPFFFSKKLERETYVGFLSAVI
FT                   GSLENSVICELMGMDVVLNVGSAARDKKGKIKPPNLSTFKVSSDFGDNRREIEELVDWL
FT                   MKDPMYNIKAVPDNIERAIYCNVFELVTNILAGALSSLEIEILGRAVRLKLSEANKRDR
FT                   ADLAKLSRFRPSNEVLQKFSENFSAVPALQEVMMNVYAFVLAFVSYELSNVDVNLVGRK
FT                   LQFSLGVPSEVDERLAAEKMKEESEFNARLRQALNTLVEEMVEAAEEISGKEIDVNLEK
FT                   IEEYERDVLANVGLRASKVKDEVWKFASGVFGSRDDSEGAVAPTTGGASSSAVSNDDLD
FT                   SVIYKTFLAHHSPANKEFPFPYLSPKDFRFAVSDLVKIVRPGGGPDDKFTVSAAAVQKV
FT                   ANAADINGDGVIQWAEYYFAAKELSYLFEVKTP"
FT   gene            <874645..>875772
FT                   /locus_tag="MICPUN_79866"
FT   mRNA            join(<874645..875544,875605..>875772)
FT                   /locus_tag="MICPUN_79866"
FT                   /product="predicted protein"
FT   CDS_pept        join(874645..875544,875605..875772)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79866"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16787 - hydrolase activity"
FT                   /db_xref="GOA:C1E1X0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X0"
FT                   /protein_id="ACO61815.1"
FT                   /translation="MVPRVFVVSDIHTDFEENMKWVRGLSDTKYANDAIILAGDVSDDL
FT                   SVLGETLVLFASKFRHAFFTPGNHELWCKRRGPLKDGESEADRETIPDSMTKLERVLRL
FT                   CDECGVETRPRLIGDGERKLWIAPVVAWYHSSFDYEPDITETRVHPPHLVMSDFRLCEW
FT                   PGLDPKDESVAEAMDAVNDARGWGTFLEWLRRPEQSAADASVPIVSFSHFLPRLELCPE
FT                   KRMLFYPNLPKAVGSDFVMRRIQNLRAEQPPGTRRKRMHVHCFGHTHFGWDATIDGVRY
FT                   IQAPVSYPHEWKQRPGSLTPCCIFDWEQHGGFAPKMSARWSDHYASNPRTPQNTELAWW
FT                   VRGSALKGRADDESD"
FT   gene            complement(875799..>876738)
FT                   /locus_tag="MICPUN_57027"
FT   mRNA            complement(875799..>876738)
FT                   /locus_tag="MICPUN_57027"
FT                   /product="predicted protein"
FT   CDS_pept        complement(875860..876738)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57027"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013255"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X1"
FT                   /protein_id="ACO62241.1"
FT                   /translation="MSAAPPAMSNARPLDDVSNIIDLDALHKELEQARSNVEMWMARRE
FT                   LSMKEQVAVHKTNMAVAEEEYVSLVEREKDLATAAEELARRQEYQQAELDALQEEAAQA
FT                   KELGEDLPQQLQVLREQVTTEKDELERESTKVTGDEMVKAQMLQAHLSAVDLYRTRLGL
FT                   RFEIGDAEELRFFYRHVDPADHEREFMVAVRVVDAGGYELMDCDPDMGDAAQRLLAECN
FT                   RTDNLSGFVRGVRKLFRASVAEEEVAAAAAALREKAKVSAPSYAPADEPEPEPVAPRTP
FT                   FNTRPDDMVPL"
FT   gene            878009..880820
FT                   /locus_tag="MICPUN_107929"
FT   mRNA            878009..880820
FT                   /locus_tag="MICPUN_107929"
FT                   /product="predicted protein"
FT   CDS_pept        878017..880236
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107929"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1X2"
FT                   /db_xref="InterPro:IPR003864"
FT                   /db_xref="InterPro:IPR027815"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X2"
FT                   /protein_id="ACO61816.1"
FT                   /translation="MSYFNMVFLAMFAISAFLIPGVQRKLIKEVDANMCTIEDYSVIIT
FT                   DLPDDVKDQELHKFFDKKVGKVQNVVVATNNAELLTLAFERQKAKELFHIQVAKYKKGR
FT                   EDPDVSDKKVEWLHEEAVKAKKGLRACDSAIRALQNDRGGDAKRAICAFVTFQEEADFL
FT                   KMFDMYRPGIFAWLWRPVDLRLRKKHRLRVKQAPPPADIRWENLQFNWAQRSFRQLNIS
FT                   LLTAVVLGLAFVSIAAVQMMAANAATPYDTEECRLNCHYGTDPVTMENEDLRNIYLKCY
FT                   EAEQEGDPKRDITQTPSPPPPPAYGRRLMAQDLVSSQANYVASHNGTCGAFDSFCYACY
FT                   CLEHISAGSVLDESEYCQPYIFGYTMQVVAQSVASAIVVVLNLLLKPLLVFLVRFEKHH
FT                   SASGEQMSVMLKLFMAQFFNTAILLVVLNGSFPWLRAQLEGTPVEGLLFQGEMEDFVPA
FT                   WYNEVGYALVISMVATPASQRIFSIIRLFRFKIGKFFASRNAVTQDQLNKAFEGMEFNL
FT                   AINYGELLNILFVTLTFSPGLPILVPLTSFAYMVRYGFDKYEFARVSKMPPWYSTILGM
FT                   GVAHLMAYACLGYLILAIWANSYYTMAPDPMIEGLIGSALYGFCDAWESLPEPLASVFG
FT                   TMSDPSEMARRALQKNTAIYTLTLFIIVVILFFRGLIATMRSILAEIYPAYFQTDKRQA
FT                   EGNPTFDLAIAGSQLLGARTYSIRDAPQYQAAFERIVWELDDGKL"
FT   gene            <883118..>884770
FT                   /locus_tag="MICPUN_57030"
FT   mRNA            <883118..>884770
FT                   /locus_tag="MICPUN_57030"
FT                   /product="predicted protein"
FT   CDS_pept        883118..884770
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57030"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006797"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X3"
FT                   /protein_id="ACO61817.1"
FT                   /translation="MATKSFAELCEMSASKGGMEKTVKFTYDEHVSVVMAAFRERSQGP
FT                   HPSMPLVHRVDILDERPEKPDSDGTDTESWAMRYRRFFAENDAPPWVKKISGGEYLRGT
FT                   ERIEWSEPAGKMVMYTVNESHSQLVTAEEICIIEADPERPHTGTIKTLTVRARLRLRGW
FT                   WTLGISAIAERFLLGRYVSLVNQGRKIELEEIRKWRHTGKAELVLRGAFERSRTPSSER
FT                   ALGMILAGGTSKLPSLEPEADEGGKVSPKSTLSRLRGNSAPSVDGLEVESLEEFERSIS
FT                   EKDPRETTDEIVQAGMSEVHWLGLRYAKRREEIFDESSTDSDEYAYESTPRPESPLLSY
FT                   ASTDEDEYEYDSTPRPESPLYVPLDTDDEDVEDDENGEETPAVDAVIDDEFRSSGSPGA
FT                   ASPIWSPGDERTVLDVSVDEATIAKSLAKDWKEIEALEHEAIRRKLGLGEEDGDEGGAA
FT                   GALRRWLVRLALVGAGAAILRERRDQLLPLAVRAKKRWTRGRRPVKASASVVDAAAMVD
FT                   ESEEEGEVSAVVEAGEEAAAEAVTPEVDDADDE"
FT   gene            complement(<884893..>886434)
FT                   /locus_tag="MICPUN_99522"
FT   mRNA            complement(<884893..>886434)
FT                   /locus_tag="MICPUN_99522"
FT                   /product="predicted protein"
FT   CDS_pept        complement(884893..886434)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99522"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1X4"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X4"
FT                   /protein_id="ACO62242.1"
FT                   /translation="MRDTNVDWIHDLPFHSFDAGAYGRSVAHVAFTYSTPWLALTAVTV
FT                   VAWAQFHRGCLCGRRSLPRRPVALGMKPAMIMFLIMAWIACSLVPSAYTRFHEGSRDVD
FT                   DALHALDAHATGAMGHAARAKSAAAECSAALAAVDAQFKEHMAAALKVQRARQAAEQFA
FT                   AAAEGVGGVAWKDLDVLRGYDDKWERFDTWFTALSATTYGLLIVASLAPVVARLLMLST
FT                   ASRSTVDAVDAALRFAPFVAMIAAWLFLAASSPATVTFAETCHAWVPTVTRTVPTDSAR
FT                   FYFFCGVGESASVDAIPKIPAPSPAIASMRAASIEFRASVEAVLTLDTSLSNAGRNVTT
FT                   AALKRVERCEASGMEFETSVADSLGGCDPMGANLRTARESACGDAVTGIFWNNIAIMLL
FT                   AFVIFYHALRGWLWELWEWVAMGDVVYGGDSPVRKFSGKGYGSGASPRDVESQMERLEG
FT                   DVRGVKGDVKYVMGKVDEMVPLMRDLEAASRVNSPVGKGSPEEKLKQAAAALARR"
FT   gene            <887243..>889055
FT                   /locus_tag="MICPUN_66493"
FT   mRNA            join(<887243..888371,888693..>889055)
FT                   /locus_tag="MICPUN_66493"
FT                   /product="ATP-binding cassette superfamily"
FT   CDS_pept        join(<887243..888371,888693..>889055)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66493"
FT                   /product="ATP-binding cassette superfamily"
FT                   /note="mitochondrial peptide export (ABCB/TAP);
FT                   GO_component: GO:16021 - integral to membrane; GO_function:
FT                   GO:5524; ATPase activity - ATP binding [Evidence 42626]
FT                   [PMID 16887]; GO_process: GO:6810 - transport"
FT                   /db_xref="GOA:C1E1X5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X5"
FT                   /protein_id="ACO61818.1"
FT                   /translation="LELFAIAGGVNAALDFWNVFLFTFVQNRIVRRLRSTLFAKILGQE
FT                   IGYFDVTSAGSISSRLTADTTEIASNLSWVFRNVTEAVVRVTGIAVYLMLQNWRLGLVA
FT                   CAIIPITTAANRIYGEWMTKNATATQDSLAAANHVALEAIGSIRTVVSFANETHEIKRY
FT                   DSALGRWYALCNRQAVVTGVYFSVIYSFLSQLLVPVALLVYGSHLVMSGRMHPERLIAF
FT                   MLYQGQLQEYVSNLLNAFTSMYKSSGSAAAVFELIDRTPVGNNKGSHVVTPFLGAVELR
FT                   DVHFCYPARPEKVVLNGLALRAEPGEFIALVGGSGSGKSTVFHLLQHFYEPQMGVVALD
FT                   GVDVSLVSHAWLHRVMACVGQEPVLFSGTVLENITYIVDGEVISAAMAANAHTFVTSMP
FT                   RGFHTQVGERGVQLSGGQKQRIAIARAILCNPAVLLLDEATSALDAASEAQVQSALDNA
FT                   MNGRTTLVIAHRLSTVKNADKIFVLHRGAVVEEGTHEEL"
FT   gene            complement(<889191..>890782)
FT                   /locus_tag="MICPUN_68096"
FT   mRNA            complement(join(<889191..889441,889475..889870,
FT                   890009..>890782))
FT                   /locus_tag="MICPUN_68096"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<889191..889441,889475..889870,
FT                   890009..>890782))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68096"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1X6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR010280"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030390"
FT                   /db_xref="InterPro:IPR030391"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X6"
FT                   /protein_id="ACO62243.1"
FT                   /translation="KSGDVLTLECTSLAFGGRGVCKLPGGFVVFCDRAVPGETLEARVT
FT                   SLKGGGRFAEATKVSSISPCEHRTAAPCPHFERCGGCTWQDIAYAHQLTMKRDQVVDVM
FT                   TRVAKVDQTRVQNIVGDCVPSDKTERYRNKMEFAFGPGANGRGVVIGLRPSGNHSDLVE
FT                   IGNPDGCLLQHPVADEVLRGCRAHLDSNGNSSLLDAFNRRTGEGVLRSLTVRVAVDENG
FT                   ETIAAVDIAAATRGDDEDAALRGLAEAIAKVRGVASSGGGDADGEGWSGEDVEVLSGAA
FT                   TLPMKLRGVTFALSAPSFFQTNTDQAEKLVAAVEDACGFSGDGTEVVLDLFCGVGTLGL
FT                   CVAKKAKHVFGWEVVPEAVKDAERNAEANGITNATFRRGDLAKLKASLPGPDIVIADPA
FT                   RAGMDESLVKVLRSIGAERIVYVSCNPATQARDLLRLKGGDGGEGARYDVRYCTPVDMF
FT                   PHTPHVETVVVLDRI"
FT   gene            <891157..>892089
FT                   /locus_tag="MICPUN_57034"
FT   mRNA            <891157..>892089
FT                   /locus_tag="MICPUN_57034"
FT                   /product="predicted protein"
FT   CDS_pept        891157..892089
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57034"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR015940"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X7"
FT                   /protein_id="ACO61819.1"
FT                   /translation="MAETAGPKIGDARSLWNFTPSPGWTKDECATLRLCLMKFGIGRWV
FT                   QIVDSGVLPGKQIQQLNGQTQRLLGQQSLAEYTGMHVDVDRIREDNNEKTGPDIYRKNG
FT                   LITNTGGKLKKEAMQALRAENKAKYGLSETEIAEIVLPDPPSKKKLGADAYMGKNHNKG
FT                   GVAGLTRRMEKRRRTADVLTVDVDALARPAKMALLKALRARLVVLTTAAEEGRVLKENK
FT                   AKAAAKPKPEAKKRAASSKRKSVDSASGEENDAPTPKRDTARRASAGCGGVVGQLVAMG
FT                   FDKKKAAEAVKEVGNDTMECVNWLVVNCA"
FT   gene            complement(<892698..>892982)
FT                   /locus_tag="MICPUN_79915"
FT   mRNA            complement(<892698..>892982)
FT                   /locus_tag="MICPUN_79915"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<892698..892982)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79915"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019367"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X8"
FT                   /protein_id="ACO62244.1"
FT                   /translation="MVCSKCEKKLSRGIHQEMWKDGSRHTIEGGGRKINQNMALSGKKR
FT                   WTPYGGATGGSKCKICKQSLHQQGIYCQKCAYHHGMCSMCGVKVMDTTFY"
FT   gene            <893098..>894243
FT                   /locus_tag="MICPUN_80110"
FT   mRNA            <893098..>894243
FT                   /locus_tag="MICPUN_80110"
FT                   /product="predicted protein"
FT   CDS_pept        893098..894243
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80110"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002791"
FT                   /db_xref="InterPro:IPR016949"
FT                   /db_xref="InterPro:IPR035073"
FT                   /db_xref="InterPro:IPR036075"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1X9"
FT                   /protein_id="ACO61820.1"
FT                   /translation="MATTDEFVPLPQLADVDGYRPTTFDYDPPAGSKDPRGGTPPGKSE
FT                   WVDVFRKSIPEFRKRAAADPRVPDAASLADRFADDFSAALDRIHAGDHADLFEGQPTVL
FT                   KMCRLRDETLRSLGFTDCFKDVKATENERALTVLPAVLAEIDAIADAKDRLLALIQGAF
FT                   AGNIFDLGAAASAKLHEDGGGDFRSTRARLKSRPWLVDDFDSLHQAWTANGATGGELAS
FT                   TWRKCVMFVDNSGADVVLGMLPIARELARRGCKVVLAANEVASINDVTAAELEDLLPRV
FT                   AELDETFAEAVKCGAIAVCSSGSDLPVIDLRRVSKRLAAVVDDADFVILEGMGRAIETN
FT                   LEAAFDCDALRIGMVKHPEVAQCLGGELYDCVCRFEAAGYI"
FT   gene            complement(<894300..>900165)
FT                   /locus_tag="MICPUN_57037"
FT   mRNA            complement(join(<894300..899870,900067..>900165))
FT                   /locus_tag="MICPUN_57037"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(894300..899870,900067..900165))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57037"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR022113"
FT                   /db_xref="InterPro:IPR039877"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y0"
FT                   /protein_id="ACO62245.1"
FT                   /translation="MRGDGRRSRAPWPLLIVLLLFLSWTGPTARAEKDPDQVAQGELSA
FT                   SAYAPSSVGADGQPAAAPPPKPDPGGRGAEIETYKDHDDFGKILYPPPRLPLGPQWAPS
FT                   VSIVPTELKFVETPLCQPTTHVIHVYNMDQRETFKILSLTTDAVYMQPVDFRSVEVPPG
FT                   RGRQLKVAFLPRSLGGSHGSFRLLTSKGSIVISARGVGVESPYKLQPLVGAKVPSGVPF
FT                   MWRLELFNPHSSTVKLVEALSSDHTISLGPPSVEDLESQNKFDEEDKAIMEKANNSGRG
FT                   GVRSFPSTIWELPSKSSKVVLSVKLLAAHAGRHEGSIKLVLNRTKGETYDINDVMERHE
FT                   LHVPVQFDAAHGGVFRSPDQIDFGIATRRLDRLRQTVTLFNSGAEPIRVMDVSLRPADP
FT                   SLRVKYTKGYILQPYTEEPVIQLVYSGKLEGVRMGTLLIRTSNSNIPIEVPYRAKIQHG
FT                   KLSWNEAEMSFLSPATGRKPFPAVSNTVRVLNNFRTPIAFHAVRVVNRPPRSNKNTEHT
FT                   EAQAQIAQGNEKPSEIAGALSTADDEEVCCFEVKDFTGGQVVSPGHPLAPFTIEYTPQD
FT                   KNVVFTATLELDTNLTTLEIPIEVHHGQLTCFDADQAEMRAKAAAEAAAMIAAAVVTKD
FT                   AAGNAPRDSDPAAEDSGDAVPCAVLAEGRKATRVGDDISQMGLIDFGVVGVPAERYRRV
FT                   AVYNPNPMPLTIKSVESSVRSVSVTRVEVSGSSLKTPISHVAPGSLLSTLHQTSHKPPP
FT                   PPPRCMTAEGKNVACKQEFWSVQHKGGSGAVIIPPLHIATVHVLAAPEREETAPKGALT
FT                   FYLDNGRQLIAPVAIKALKGTISVSGMNTPVVELPPTFPGRPILAPLKLRNDFRDVVTV
FT                   IGSRSTSPTFSLDLFAQKLKPGRDTTAGQVAFDPAHLPRQYAYTSLGRVRRKPESEKVI
FT                   DKRRSMFAAMLGADVDDSRTKTKAKTLYPDDVDELRRMTDAWRAVAADHGGHADAGAGA
FT                   FVTQTATVLLKTDAVDPFPIEVRSRLLRPSIFSVVEEEEEEPPKKTMDARFQYSTSKSK
FT                   PKSKGEGQRVLNKDGVVDFGSVQLDRRSPRHRVIATNPLGNQVVCVRIMPFVAAAEKSI
FT                   AEMEGDVDAATISAANLHVAGEYDPPGATGFVLEGGDISMKRKTGAGKGAAALVSDGRD
FT                   TACLEPGESVDLGLLSFKPKEVRKYHAHMCVRNNFTTLECATLSGSADAVKVYVAKKPR
FT                   GTQVVTDVGFRLARIGLGGADMLMQTVHVVNRGSVAVEVAKPYVGAFACGGDGSVGGYT
FT                   VQPCKPFTLPPGGSKQLTVACFTDKAAQAAKYARGVAGVWTALTMEVSSPDGVKTTLVA
FT                   NLHASDGIVTGAYAAGEMARSGPRSLIAWLATMCSGGAACWLFYANRASLQGAYERRKK
FT                   AAAAAAATRQEAVVAAVAAAAVATNGKKAKRRGSQDIGSPASPGATKSGSPKSPIVSSS
FT                   MDTESSLGSSPEKTESVLAKAPEPETSGMDSASGSSPALSPKISSSKLRDEKKPADKKS
FT                   DKEEAEVEKKEAAKSSSKPSSPVSPARKEKANGTDSKIKSVPAPRTAPSTESANGKVSP
FT                   KTTVSPKTSPANSFKQPAEKTSDKAKVIPKPKGGAAPNPFKQPKQQQERLREEQPATSQ
FT                   APRPEQLPTPNVTFAGKPIRTKASFGNEAGDDWITPPKPAAASPTYSEQSLLSPTGLAA
FT                   EATATAAGLSVLSSPYGHDIFASAPSSMQQQHQQPPLPPGPPPSMQHQQPPLPAGPRPP
FT                   NLRQDGTQQMTQQPLGGFAPVGLPGLGSIGGGASGYNMWADHFSQLGQAAAKPSNLATP
FT                   DDVRRLSESAGGSFFGGGLASATDGDALEPDGVGGGDGGGWGLWGSSHKPANSDLDDNE
FT                   WEQKNLDLLNDLELD"
FT   gene            <900514..>901929
FT                   /locus_tag="MICPUN_57038"
FT   mRNA            <900514..>901929
FT                   /locus_tag="MICPUN_57038"
FT                   /product="predicted protein"
FT   CDS_pept        900514..901929
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57038"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Y1"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y1"
FT                   /protein_id="ACO61821.1"
FT                   /translation="MAHPAIASLGAGASSVVSSSARVARRQRAPVRVSGSASDRRAARV
FT                   GESERARQRRGRGIEAVAASTGVKVDRFGASVAADFPPRFERPSSPSCSVGLELDEDFL
FT                   DARDDAPDENEVTTTRQCLDSRKVALGSLALFVLVGGVAAIHPDPALAREVTLELPDFD
FT                   IPDFEVPDIPTTPMEFLEVVTTNPYAAVAASVAAYLVIPKAAELLVKYVLVPALVLLVA
FT                   YEASQNPDETIALVASAINQARDHPTVTSGIILAILALVLSPYILVAAGVGLIVSGVQL
FT                   LPEQLKPVLPAPVREIETQIEELQRAVDPGVKRARALGSQAKARGEKLRQEADAQKARL
FT                   EAERDRRLREQAEAAAQRIEDTRAALVAPVVTAQKAAEEAAKETLERAQDVTEAVAEAG
FT                   EGAGQTVKCTSYPTPQERSSCVDRQREERRQRESKRTEELREKASRLRANSAERERPVP
FT                   DVGKALLGSGESS"
FT   gene            <902562..>902777
FT                   /locus_tag="MICPUN_57039"
FT   mRNA            <902562..>902777
FT                   /locus_tag="MICPUN_57039"
FT                   /product="predicted protein"
FT   CDS_pept        902562..902777
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57039"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR008011"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y2"
FT                   /protein_id="ACO61822.1"
FT                   /translation="MSSAGLVFYREVCRAIRKLPKDTQSYYRVVAREKVVAHRDEDEPE
FT                   RIGKIIQRSREDVAWVLKKYSPTKDA"
FT   gene            <902831..>905368
FT                   /locus_tag="MICPUN_99528"
FT   mRNA            <902831..>905368
FT                   /locus_tag="MICPUN_99528"
FT                   /product="predicted protein"
FT   CDS_pept        902831..905368
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99528"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Y3"
FT                   /db_xref="InterPro:IPR037700"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y3"
FT                   /protein_id="ACO61823.1"
FT                   /translation="MEAFLNPCVRSDGERLDPSLSPAPSLLAEDGRGVLYALGADGVIR
FT                   ACPARLLNAAARGSIADDALPTRVFKPEPPIDFEPRTISVSPSGHFAAVGGLRHDASAG
FT                   SGSIPPSSALAIVSLRTGGDRSGFEALEDGAPGCRCVPLLDDDFDRHPSMRPLRAAWHP
FT                   NSDGHLCVLLSDGTLHVFDAAVGPVAEQAFRLDPWGRGSRPGPYPLRPEIVDFAFAPPH
FT                   GWGALSLVLLGREGDVYVMCPFAPWGARYPRVTLESLQPPDENSEVWLATTFPTLRRNG
FT                   RGADNEDDDDGYDDDAGGGGGVVPSDDDDDDAGGGGGGAPSDDDDAFAGPTVAARPARI
FT                   EGVATALRGPLPLGTDPVDGDGDGGVIGRGAVARSLAAAPFAAGEGGGALLAVAHQRVV
FT                   ADERDERAPNEGRVSATLDVLILPQEPSPAWAALSEEDEAAAYEAAACDGGPVLTLAPI
FT                   AADDDDGSLQPLLAIDRVELASGEPTLRRPKTSVAAAQNELAPFVSVVWDPSCRDRVFC
FT                   CAGGAVHGVTLTWLAAVEGAVDEEEEGEKSGSELSLPTVVTLMDSPEVLLGVAPCGDPL
FT                   AEGLLLAVDATGAAYGLRPAPPLPEGIDAGNEDEAIDSAAASALAGGAEASAELRALAA
FT                   GPPGPPPAPPAGAAALKPGTIEGNAALAAAAIALKERHLRYAHRVHAATKRHSLRLGAE
FT                   IKRQRVEAKVIREGLEAVLARKEILAAKIERSVANHEEIRERLRKLAEAERSLPHPLTR
FT                   AESAFKTTLQANADDLPLLEAKLEELKRRCEAIGEDFATIGALAAGDGDVFERLAASDP
FT                   AIAAEIELQDAATKANLERVKEIELAVGPLDDF"
FT   gene            complement(<905400..>908927)
FT                   /locus_tag="MICPUN_99529"
FT   mRNA            complement(<905400..>908927)
FT                   /locus_tag="MICPUN_99529"
FT                   /product="predicted protein"
FT   CDS_pept        complement(905400..908927)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99529"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y4"
FT                   /protein_id="ACO62246.1"
FT                   /translation="MRSTVWREVAESPNLTGIAGPRVRFQCLDANHKHVVLGANTGSLY
FT                   VFARTRADGPSPFGPDADAPEGPLRFMTVVSPPRQPSDDAAKDDPADDARTPQSAFASR
FT                   SRGVSPAIRRIKLSPRGDRCAIAYATGVLNVVEFRPGVERRGGSPKVIVQIPKAHASAD
FT                   VTWLEWSPDGDRLLSGDDKGVVGVTEFANNSVVANTLSLGSAVAQASFSRSGLMAALCT
FT                   NEAVDLLSVPTGVHPKVGTKPREGPYGGCFHVLARDAAPDGALVSKQPESEWMLAARPG
FT                   RRLWVAEAWLEGGTQGEPRSAVAATLKPDVPKGSRAPGAPEPRPGAKSRKWEFGRLHPL
FT                   GRTCVLSVAERALAVVEVPGGSLLEWCPLGEPGSVGIAAGVASAAAVDARAFLLAAPEH
FT                   GGGVWCLEAPATEAALVACVADVAAVAVASRARDGAGKDAGLAETLHAVSLATKLRVPE
FT                   TRLLEDARALVRDVAARRAVGDGGKVLDDEDDDFVDIDAELASAVEAYERFYAEAVGDA
FT                   PPPPPRPSLDERTTASSPPRPAAALSRSSSFASSAGASLSRGDSGLDATIVGAGEFPAA
FT                   ESGKFFFYNPNANAGERKERKSDKEEKKKKKSAKVVDVGDGTAPVDAPRPKRDKPKKSP
FT                   PAPEPIAETSPTNEDKKTAADMGSIVARLEEDRDDYLAAVKALSDLGEAPPVSPPPFLH
FT                   WTEYREIPALVEVGSAAAAAKSTTGKRREALRRARERRIDAAAVAARALRLSRRSLDAS
FT                   PLIPALRRWRLARAECDEIADEIDDVVEFGGGDETHATRQLSDSTQLAREDMFEALALV
FT                   ERELDVAVVELRLVGAEPAERRVGEAAARVFAEADAAEAAARTTKGTIVEPADDKAPKS
FT                   VDEPFDGDLGALAGSLVGALSLGEEERVERILRAIPPEDGEIVAVESFRRALVDLLSRP
FT                   DSAQPLESLESVTTVVAAALGAENALKALEVAVEDEAIEKKIGCDALETFAGNVFADAI
FT                   TCVTLDLVAAVGDERDRGRAASKILRPLEARVSDPPPSPVGRFPQLRAAIAAEASLKAS
FT                   PGDDAAMRRLPFVKKERGRWELAVTHTKPIEPTLEDPTGGWGVRVPLSTACCARCALPL
FT                   REIRWSGDAGQSSLGRLVTFPCGHTLHECCAIEDACVECAASNAKPLRSPAFITLSAAI
FT                   NAELESLRL"
FT   gene            complement(909181..910308)
FT                   /locus_tag="MICPUN_93705"
FT   mRNA            complement(join(909181..909617,910004..910082,
FT                   910257..910308))
FT                   /locus_tag="MICPUN_93705"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(909283..909617,910004..910082,
FT                   910257..910271))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93705"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1E1Y5"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y5"
FT                   /protein_id="ACO62247.1"
FT                   /translation="MATQSVQTFGRKKTAVAVVHCKAGKGLIRFNGAPIELIQPETLKF
FT                   KAMEPIILLGRQRFANLDLRIRVKGGGHVSQMYAVRQAIAKAIVAYYQKYVDEQSKKEL
FT                   KDALLTYDRTLLVADPRRMEPKKFGGRGARARFQKSYR"
FT   gene            <910598..>913033
FT                   /locus_tag="MICPUN_99531"
FT   mRNA            <910598..>913033
FT                   /locus_tag="MICPUN_99531"
FT                   /product="glycosyltransferase family 60 protein"
FT   CDS_pept        910598..913033
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99531"
FT                   /product="glycosyltransferase family 60 protein"
FT                   /note="distantly related to glycosyltransferases;
FT                   GO_function: GO:31072 - heat shock protein binding"
FT                   /db_xref="GOA:C1E1Y6"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR021067"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y6"
FT                   /protein_id="ACO61824.1"
FT                   /translation="MAPATPNARPSFASSAGEPSDTPHVPGRNHARLVAEIAREFRPRL
FT                   DTEGFSAVRELGSQLRELGVESNDDAPAHTHKRCKMCGNVCHARMNSCSSCCLPFVDRG
FT                   SWEPATMPRPGGDVHSETDSDSDSDSDSDDETEVDHVTEPTAPAVNAASAMERRRRERR
FT                   AAAAVPSGGPVGGPVASDSADATTRPGWHDWFNRTGRLREAPTHERGLDPTLERSYAAL
FT                   GCAFGATEADVRIAYRKCVRRVHPDSGGSRKQLARVHDALEAIDRDAWSHGEGAAALRE
FT                   ALVASESEPVSTETGAKKPRVFVSLAVYRDPEGLHTLKDAFDRASDPSRIFAGVHWQHV
FT                   LAKPSGEEPVVDRLHPAQNMFTRQVEANLGKIQGDEDKVRYLEESMKQQGDNQRDLDEK
FT                   EARLHAKASLDATDGTKWEWAGHVRETRESWECAEGPCRARHMSMRLWGGEEYVLHADS
FT                   RTRFDHGWDDVLIAELERIQTLTNNPAVLTGVPLGYHMRMTPVDNPETYERVGYLPVYG
FT                   RDEEREHELSNLVVPLRRDRTDDAPSIAALGVCGFGDLLCYPAAVRLAPYDAADADEPP
FT                   LPAMLVNPSFVFAPAKALVADAPPDLHAPFLYLGEELITSARLWTKGWRTYLPRHCPLR
FT                   VCYDPRNRIDETREDKRRGAQLYDHPRSEAARGTWDQLEERYFMNLQSRRRVLQVIGAP
FT                   DPDSATRDPRDAVILKEPWAPGSVRPVSEFVKSLGVDFDEREISNTSRYAGLDRDALNM
FT                   THDTRAVKKRDTFAARTDATELGDDVLADDGLPLKWKNGSPLFGDLSAGYYERTERWS"
FT   gene            complement(913026..913815)
FT                   /locus_tag="MICPUN_107931"
FT   mRNA            complement(913026..913815)
FT                   /locus_tag="MICPUN_107931"
FT                   /product="predicted protein"
FT   CDS_pept        complement(913082..913807)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107931"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Y7"
FT                   /db_xref="InterPro:IPR006634"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y7"
FT                   /protein_id="ACO62248.1"
FT                   /translation="MWGALCPIVFGERRWAQLSDAKQYEIRLAFNCAVNGILAPALVYP
FT                   ALTSTPPLNQNGLYATVFPRHEGSVLGCAASVGYLLYDLLAMLSNFTVSIKANGVVAYN
FT                   LYIWHHALSIMFWPVAVLHNSFVFFVNWFVASEASSTFLAARGAMLSLGTINTPVGVAV
FT                   QLGFVASFFMSRIYVMPNLIKSIYYADWGQVPAWQANIARCTVPLPFLLNIYWWMMILR
FT                   SMYKVIFGKKRGGKGKKAA"
FT   gene            <914135..>914920
FT                   /locus_tag="MICPUN_70512"
FT   mRNA            join(<914135..914704,914816..>914920)
FT                   /locus_tag="MICPUN_70512"
FT                   /product="predicted protein"
FT   CDS_pept        join(<914135..914704,914816..>914920)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70512"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR041667"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y8"
FT                   /protein_id="ACO61825.1"
FT                   /translation="CTVDRVHWTEMTADRFDGQYRDHKPVVLTGMRGRNDAFRNACAKD
FT                   VLLREWGDKDIVLSTANTHSYLKVTKTLREYVSSHTAPQRLDRRGDETLIWFGDNNHTE
FT                   WRSHFDLYVPPPFGTSDADVAYSFGVGGPHSGVPLHVHGPGWSETIVGRKRWWLSPPKP
FT                   KPRFHPNATSLEWALGLKPLQEGDEGRMLECTIGEGEAVWFPDGWWHATLNLDESAFIS
FT                   SFV"
FT   gene            complement(<915832..>919867)
FT                   /locus_tag="MICPUN_80084"
FT   mRNA            complement(join(<915832..916045,918633..919309,
FT                   919382..>919867))
FT                   /locus_tag="MICPUN_80084"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(915832..916045,918633..919309,
FT                   919382..919867))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80084"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E1Y9"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001245"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Y9"
FT                   /protein_id="ACO62249.1"
FT                   /translation="MGACVSIDRSNSIDGARDPRVPRFERPRRAGFSGRTAADLHLDRI
FT                   DIDDVRCVEGGNGPDGHTTGDLGGDRRAEAKGTRSPRKAVDEDEIVQSPSREESPRAVA
FT                   EFVGDDDSTEDSEERTIRWQRGELVGSGGFGRVYVGLDLDTGGMLAVKQIAIAPRISRS
FT                   VRRIEQEVALMRRLKHPNIVSYLGTERTREDVFTIFMEYVSGGSIHSLLQRFGSFGESV
FT                   IRVYTRQILLGLEYLHRHQIMHRDIKGANILVDNQGCVKLADFGASKRLAEIVTVDGVH
FT                   KSIRGTPYWMAPEVIKQTGHGRQADIWSVGCTILEMATGKPPFSEFGSQVSALFHIASS
FT                   TGPPPIPEFLSAEAHDFLILCFNRVPRDRPNATRLLRHPFAVPAPSSGSPTPPRCCKRA
FT                   SWSSSTPSARSSTWRCTFTEDLQTRTSVMRSCSCGSFQRRSPSPTWRTQSGRRRQNARS
FT                   "
FT   gene            <920480..>921646
FT                   /locus_tag="MICPUN_68182"
FT   mRNA            join(<920480..920590,920669..>921646)
FT                   /locus_tag="MICPUN_68182"
FT                   /product="predicted protein"
FT   CDS_pept        join(920480..920590,920669..>921646)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68182"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16787 - hydrolase activity"
FT                   /db_xref="GOA:C1E1Z0"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR025733"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR039331"
FT                   /db_xref="InterPro:IPR041792"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z0"
FT                   /protein_id="ACO61826.1"
FT                   /translation="MGPRTPVRVEDLVALANTSTWAEPDAVNYRVVKDADDYQSPIINV
FT                   AHLTGLEGNAHYHYAIPGDTKTHRHFNAPPDSLKESSEDAAAGKEVHASTVFAVVGDTG
FT                   QTEVTAAVFEHIAGMDDADVLLHTGDLSYADGFPPRWDTFGRLAEGVMDRLPSLFVAGN
FT                   HDVTSNGVESQAYHTRYPSPHRSSGSASPEWWSLDVGLAHVIGFSSYAPSKGPGAFDGA
FT                   DAPLTRWLEKDLKKVNRAITPWIIVVFHVPWYNSNHGHFKEAERARVALEKLLYEAGVD
FT                   VVLNGHVHSYERIRAVYDYQPNECGVSHIVVGDGGNYEGPYGESWMNPQPAWSAFREGS
FT                   FGAGRLELHNATHATWEWRRTTC"
FT   gene            complement(<922121..>923411)
FT                   /locus_tag="MICPUN_57048"
FT   mRNA            complement(join(<922121..923217,923318..>923411))
FT                   /locus_tag="MICPUN_57048"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(922121..923217,923318..923411))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57048"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5634 - nucleus; GO_function:
FT                   GO:3700; sequence-specific DNA binding - transcription
FT                   factor activity [PMID 43565]; GO_process: GO:6355 -
FT                   regulation of transcription, DNA-dependent"
FT                   /db_xref="GOA:C1E1Z1"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z1"
FT                   /protein_id="ACO62250.1"
FT                   /translation="MARGGHSHILKVGKSARQKGRVPSHHSASMRTTASSDFAFGHHSR
FT                   GSLDTAPGRTMMVALAQQVSALITSRAAPAGPSRARAPLVARATGPSRFPGAGMSFRNS
FT                   AAAARRWSEAPKRRSVAPRAADDDWEKLFADLKPLAPELSAAQVEVLERALARGRRQVP
FT                   ITDVAKELELRRDDVLAWVKSNAHRVPELAKRYPPQPEKVATVRLRERPDFDRREGRGI
FT                   RDVDRDDEREYDAQTAYLRNAPGAKHVPKGAPAYKGYVKTRLGANNVATLEKVYASDTH
FT                   PSDDMVESVRRATKLPRSKIVAWFKTRREEDKMAKRRAVRERYGGEEEDDGYYDERGGD
FT                   GFYERRGRGGRGGGGGRRGGRGGGGGLREGGAGDAYGARQERGRRDSTGEWSGRRG"
FT   gene            <923611..>924441
FT                   /locus_tag="MICPUN_57049"
FT   mRNA            <923611..>924441
FT                   /locus_tag="MICPUN_57049"
FT                   /product="predicted protein"
FT   CDS_pept        923611..924441
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57049"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Z2"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z2"
FT                   /protein_id="ACO61827.1"
FT                   /translation="MDSSTSLTRTETPKSKPDVKKEVIPPKVQHSFEDIEGLINNLLML
FT                   NTFTLGFSISFLAAFENEALLAMDQRYFNVFTGAFKGSADDSGKLMIKSFGEQHIGEDY
FT                   SLSPSGTILVRGMRSTTCLTFSLIVGLASYVSMCLSDAREDQKFFIKWYSWFKWIILSG
FT                   YCLYVAGFTLFYLMVAASAYALFPMYCGAKRGFLSNSVWLDTKVDFDASGAPQEGCFIK
FT                   GMKDPVGDTTLILNIMMPAILLFCGIVTYAMHYKTKVIKSGRVGADGTLYGRWK"
FT   gene            complement(924446..>926215)
FT                   /locus_tag="MICPUN_105296"
FT   mRNA            complement(join(924446..925914,926060..>926215))
FT                   /locus_tag="MICPUN_105296"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT   CDS_pept        complement(join(924556..925914,926060..926215))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105296"
FT                   /product="H+-or Na+-translocating f-type, v-type and A-type
FT                   ATPase superfamily"
FT                   /note="protons (vacuolar); GO_component: GO:221; peripheral
FT                   to membrane of membrane fraction - vacuolar
FT                   proton-transporting V-type ATPase, V1 domain [PMID 300];
FT                   GO_function: GO:5524; hydrogen ion transporting ATPase
FT                   activity, rotational mechanism - ATP binding [PMID 46961]"
FT                   /db_xref="GOA:C1E1Z3"
FT                   /db_xref="InterPro:IPR004908"
FT                   /db_xref="InterPro:IPR011987"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR038497"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z3"
FT                   /protein_id="ACO62251.1"
FT                   /translation="MIHPTDDLREVLERGARWNALLTSRLVTDEDLQAIQRYELRDEDA
FT                   RADMMDEEGDACARAFLNVLGDVSQTEYVQYVLALVARMLSDDKTRAAHFLAVEKKDDD
FT                   DKGQGGGGGGGGGEAYAVFLRLLAAPDWFTREKAMFCLTRLIDQRPARDKGLRFSEDGE
FT                   PATPAGVAAVRLSRWLCQELSADPPFHPQRAVPSCVTALASLLSIREVRPVATRAGAAR
FT                   AIAPLLKVAAGPHNVQELYEAGLCAWLLTFHPPACDAMARCGVIRGLMEVAGAAAKEKV
FT                   VRVATLALRNLASATGARETRGEEEAEAGSDGTRTAGDGGGGGVVGVSGVVGVSLVAQE
FT                   SALRKLVQNLRLRDFHDEELLAALADLEDGVLARRKEASSWDRYRAEVTSGALDWTAAH
FT                   IDEGFWRENASKLTDNNCQLLRMLVAAASDPGAEPRTLAVVCHDLGEFATHYPAGRFLV
FT                   QDLKGKDCAMRLLAHADDEVRKQALLCTQKLLVQKWQFLGGEVSSA"
FT   gene            929001..930090
FT                   /locus_tag="MICPUN_52266"
FT   mRNA            929001..930090
FT                   /locus_tag="MICPUN_52266"
FT                   /product="predicted protein"
FT   CDS_pept        929164..930042
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52266"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z4"
FT                   /protein_id="ACO61828.1"
FT                   /translation="MWGITQALDLIDSAWGFASLDEDDEFLPSLDEDDIPVPSANFGFG
FT                   GGFYNNAFKRDFGVPIGKPQYDWTAPKAAPSLRSSEAADALELWAGAAGRLFAGEAEPL
FT                   IFRGGVDPSTLLREIPDVGMTIDEDEDEDEDIDLEDTARRDAVDAGFSLGWFSSPLGGN
FT                   DTGAYRFVVRDDEPAGPAAAAVGRDGIAVVIDEELRPVGVLRGSPDAMFFDVDAKVREV
FT                   MGMSPAVIEGDTATVGDVAVVCAAAAHDEPVAITDSEGRLRRVLRQEDLLEPIRSQLRE
FT                   QSESRFGNATR"
FT   gene            complement(<930095..>930757)
FT                   /locus_tag="MICPUN_71655"
FT   mRNA            complement(<930095..>930757)
FT                   /locus_tag="MICPUN_71655"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<930095..>930757)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71655"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E1Z5"
FT                   /db_xref="InterPro:IPR000031"
FT                   /db_xref="InterPro:IPR035893"
FT                   /db_xref="InterPro:IPR039476"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z5"
FT                   /protein_id="ACO62252.1"
FT                   /translation="DFAKLDLGRTARTGLPEVVWGPGKTPEQIAKIMLALRDRQSAVMA
FT                   TRVDPEVYERIRAIEPSIEYDAFARVCTLAGAPDAPPTPVVRGILAVLTAGTADLAVAE
FT                   EAAITARLMGVEDVRLIADVGVAGLQRLLSRLDEVREADVVMVVAGMDGALPSVCAGLV
FT                   DAPVIAVPTSVGYGAAMGGLSPLMATLNSCATGVTVVNIDNGFGATMSAIKMLRAAER"
FT   gene            <931171..>931938
FT                   /locus_tag="MICPUN_72034"
FT   mRNA            <931171..>931938
FT                   /locus_tag="MICPUN_72034"
FT                   /product="predicted protein"
FT   CDS_pept        931171..>931938
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_72034"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3755 - peptidyl-prolyl cis-trans
FT                   isomerase activity; GO_process: GO:6457 - protein folding"
FT                   /db_xref="GOA:C1E1Z6"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z6"
FT                   /protein_id="ACO61829.1"
FT                   /translation="MSNVYQLEPPTEGKVLLTTSHGEIEVELWAKEAPKACRNFVQLCM
FT                   EGYYDGCIFHRIIKDFMIQTGDPTGTGRGGESIYGEYFKDELHSRIKFNHRGQVAMANA
FT                   GGRDTNGSQFFITLERTDWIDRKHTIFGKVTGHTIYNALQIADLEVDGDRPVEPYPKIL
FT                   KTEIVWNPFEDIVPRVMKKLDGDVDDEEAGDTRKKKKKEKKKLNLLSFGEEAGEEEEEL
FT                   AKMAKPKVKSVFDADAAENDGRIAKPGSAEEAAA"
FT   gene            <933660..>936116
FT                   /locus_tag="MICPUN_57054"
FT   mRNA            join(<933660..933891,934045..>936116)
FT                   /locus_tag="MICPUN_57054"
FT                   /product="predicted protein"
FT   CDS_pept        join(933660..933891,934045..936116)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57054"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z7"
FT                   /protein_id="ACO61830.1"
FT                   /translation="MSNGWGVLVAKCDKSRSAKHLDRSVDRSGDVTSEPFREQPDIELR
FT                   LTKTIVGRMLMNAEGTSRAQTQVADILIDMPSVSAKHCVITCDEPEGSDTYVITVTDHS
FT                   RHGVQVNKKKISGPTTLSHGDVLTLPFGMDYEFLVLDDGAKPMAPKPAEPKSAKKTPGK
FT                   RAKSVGKASAGKKKGASEDDDAAAKRAKSGDDDSPSATKKLFADDTNALEEAKQLEDAN
FT                   AKLRDELKAAKETIEERDRTIAEHIESAETTKAQYEEALAAAAKEHKAKLAELTADAKS
FT                   HDANVAAMSASCEAAIKSKEEMQAALDRAVAAREGAEKNAAETAAALEEVKAALKDAEA
FT                   AAAAAAEKAAEGSKELEAENASLRAKLEEERTTTAEKAAEIREAREKLEATEADLAVAK
FT                   NDADQLAIKLAEAKASLAAAVKRADEADTCAAPLRASENEARRVCARKEEEAKAMADRL
FT                   AVARMAHKQAMAALKEVGLRLEYDGTGAAAAEADAEATEAEPNTEPPTMDDGAEDAPMD
FT                   ADGVAGATQAAPGDFETEDAIDEEPRETENEGDRIVGMDVLYASVPASEVPASDVPSSM
FT                   DDGSEDEPVPDTELAAPAEGASPVAAMAPPSPREQPESAARHSVGAATQEAAAVLGGGE
FT                   LGGAPAEEEGEEEKEEKEEEAEDVSSGSDAEEKGSESEDTEEVEEEEPEAAGNAVEEPE
FT                   AEEPEADEPEADEPEAEEPEAEEPVEPALVAKVAVPEEEKENSAPVDASVGKELPFSSE
FT                   VEDVAAVPLSFLED"
FT   gene            <936488..>938596
FT                   /locus_tag="MICPUN_93714"
FT   mRNA            <936488..>938596
FT                   /locus_tag="MICPUN_93714"
FT                   /product="predicted protein"
FT   CDS_pept        936488..938596
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93714"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5529 - sugar binding; GO_process:
FT                   GO:8152; carbohydrate metabolic process - metabolic process
FT                   [PMID 5975]"
FT                   /db_xref="GOA:C1E1Z8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z8"
FT                   /protein_id="ACO61831.1"
FT                   /translation="MCGIFAYVNYGVPTKQKAIVDKLLNGLRRLEYRGYDSAGIAIDNG
FT                   PSLDELSPIVLKETGKIDMLADFITNKENLNSDLFFENHCGIGHTRWATHGPPAPRNSH
FT                   PHTSDANNEFLVVHNGIITNHQALREMLERKGFVFESETDTEVIPKLTKYLYEKFHNRV
FT                   TFRQLVMEVVRQLQGAFALIFKSSHYPGELVAAKRGSPLLLGIVEEPGKNAPHAVLTSE
FT                   GFKTSKEGPIGDEAPRDNGGKRQKTLKNHVEYYFASDASAMVEHTKRVLHLEDDDVAHL
FT                   HNGGYGIYRMERSKPTSGTSSPVHYEPTVQSAEVERTVETLQMEVEQIMKGSFKHFMQK
FT                   EIHEQPESMVQTMRGRMVTCDEGKTAERVFLGGMVNFVSTIRRSRRIILCGCGTSYNSA
FT                   IAVRQLMEELTELPVTLELASDVLDRQCPFFRDDTCVFISQSGETADTLKAMQYAKERG
FT                   ALCVGIVNTVGSAISRSTDCGVHINAGAEIGVASTKAYTCQIVAMVLLALALSEDSISR
FT                   ATRRKEIMQSLLGLPEAVRTALKLDAQMLALAEALKDEQSLLLFGRGYNYATALEGALK
FT                   VKEVALLHSEGILAGEMKHGPLALVDETMPLVVVATRDGSYAKQESVVQQLRARGGRLI
FT                   LIATEGDDQIAEVAGKDATIIWVPEVEDCLQAVVNIVPLQLLSYHLTVLRGHNVDQPRN
FT                   LAKSVTVE"
FT   gene            <938732..940933
FT                   /locus_tag="MICPUN_97165"
FT   mRNA            join(<938732..940451,940473..940933)
FT                   /locus_tag="MICPUN_97165"
FT                   /product="predicted protein"
FT   CDS_pept        join(938732..940451,940473..940930)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97165"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; helicase activity - nucleic
FT                   acid binding [Evidence 5524] [PMID 4386]"
FT                   /db_xref="GOA:C1E1Z9"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002464"
FT                   /db_xref="InterPro:IPR007502"
FT                   /db_xref="InterPro:IPR011709"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E1Z9"
FT                   /protein_id="ACO61832.1"
FT                   /translation="MAFWKPGSKKPEASLPLSAEVDREGPGDSGGRLVVFNRNENLALQ
FT                   AQRERLPIFKTRDAILHLVETRATTVLVGQTGCGKTTQVPQYLVEAGWTAGGRLVACTQ
FT                   PRRVAAMTVASRVADEMGVTLGAEVGYAVRFENVSTPGVTRVRFCTDGVLLRELMEDPL
FT                   LSRYSVVMVDEAHERSLATDLLLGLLKKVQRRRPDLRIIIASATIQAEEFAAFFDTRHL
FT                   EPKPASEASSVNAPSREPGIVSVEGRAHTVLIHYLEKPVPDYVKAAVGAAIDVHRAEGP
FT                   GDVLVFLTGEEEIEAAVSMLQEEAEDNSRRLLGGGAGTNPAGGPERFTVHPLYAGLSPA
FT                   QQMEAFRPAPRYTRKIVVASNVAETSVTIEGVVYVVDCCFVKQKAYDPTRGMESLLTAE
FT                   ASRASANQRAGRAGRVRPGKAYRLCTEKAFRDLPETAPPEMIRSDLAATVLQLKALGID
FT                   NIMNFEWLSPPPAANMIKALELLYALQAIDDDARLTKPLGMHLAELPLEPQLGKALLVS
FT                   GELGCVEEMLTVSAYLQVQTLWVSPRGRQKRLDECRDRFAVAEGDAVTALNIHTAWCGG
FT                   RARSFADKNMLSHRALVRASDIRAQLARHVRRVGLVVSSAGKDSAPVRRAMTAGFFANA
FT                   AALAPHGGGAEGSAFRSVRGGATLFIHPGSVLFRARPAMVVYAAAVRTGREYMRDVTAI
FT                   DPEWLSELAPHFYAMTQRSGNERPADAAAVF"
FT   gene            <941026..>944537
FT                   /gene="MER3"
FT                   /locus_tag="MICPUN_57057"
FT   mRNA            join(<941026..943278,943344..>944537)
FT                   /gene="MER3"
FT                   /locus_tag="MICPUN_57057"
FT                   /product="DNA helicase Mer3"
FT   CDS_pept        join(941026..943278,943344..944537)
FT                   /codon_start=1
FT                   /gene="MER3"
FT                   /locus_tag="MICPUN_57057"
FT                   /product="DNA helicase Mer3"
FT                   /note="Mer3 is a DNA helicase involved in class I
FT                   (interference-sensitive) cross-overs; GO_function: GO:3676;
FT                   ATP binding - nucleic acid binding [Evidence 8026; helicase
FT                   activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1E200"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004179"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E200"
FT                   /protein_id="ACO61833.1"
FT                   /translation="MGSRPWDADYVSGGPPPPLRAPRLRATPVPPSSAPPTGPPPPPPS
FT                   RSPPKDSRDRVRSVEELPPCFQPIFPSFKYFNGIQAEMLDFILSSARSFVVSAPTGSGK
FT                   TVLLELAIVQMLMKHVDRATGAFNHKPGELKAIYMAPLKALVQEKKEEWIAAFGAIGVV
FT                   CKELTGDTDIVSWSELNNVDILLTTPEKFDSITRKNKDRGGMSFFGDCALVMIDEVHLL
FT                   GDERGGSLEAVVSRLKVLSEKPSLRGAPLSSVRFVACSATVPNLDDVGRWLGAPSPDGV
FT                   RHFGEEYRPVRLETKVLGYDPAKNDWMFERRLNERLYEVVLNHFQSKPALVFCSSRDGA
FT                   SSAAKELAEKARNASRNPFVRDERQRESLREAAGRAENRQLKVVIPQGVAFHSASLDWS
FT                   DRELCERLFRDRLVTVMCSTSTLSMGVNLPAFLCVVRGTRQYAGQGEYREIERSALLQM
FT                   CGRAGRPQFDTSGVAVIMTQKHTRVIYDGLVHGTQPIESNLGLAMAEHVNAEIASGIIA
FT                   DSETAMDWLKHSFFYIRVTRNPRHYGIAPGKNPDVACGEIVAENLRKISAAHMCEIGED
FT                   AAAPRGNFVRPLEGGRVMSDMYIRFETMKRIMSVQSPASVPDLLMTLCESDELSSIKLR
FT                   RDEKVLLKGWNLSKDEPAIVRFKVTEIRGKTGKVAVAKTIKTAAQKIYIIAQETMSDQF
FT                   ATVLPPSMRMEVENVFQNGRRIMQGAARYYANVSKKGSFAAYCNALRLAKALDMRMWDD
FT                   TQFPMRQIPKCGKKSVQALANAGLRSLDEVLAQDPRALERIVNKAFPHGNHLHDAIRSL
FT                   PCAMILRIERASEIRGGGITATVTFEPEAGAGGGGGEGTDASVTESSRRWTARLIIGTT
FT                   WNDELLHNERICQRGPAPDNVEAGVPVTRSVSLSSAPPGGQEVTIVATLMFDKCVGRDT
FT                   DAVLRVRATITGGGGGGDAQFERRMGAVEGNVANVVSPKGRNRVAAGKENNLSPAFCRL
FT                   MAAPPVAPKPAPRAIWTEPMIPETATLGSRPVAVSGPSKEPFDAFEDVPEWIPAAAGKR
FT                   RAPDDNDGGWGGCDDADEDLSWGGADAHHGPPPMCQPPTLIVIEDDDDEDGRGRREPRP
FT                   DPPKRVRAAAVFAEPSTPVPDDAGFTDPTSGLTLDLLCDDW"
FT   gene            complement(944645..945819)
FT                   /locus_tag="MICPUN_107932"
FT   mRNA            complement(944645..945819)
FT                   /locus_tag="MICPUN_107932"
FT                   /product="predicted protein"
FT   CDS_pept        complement(944680..945765)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107932"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E201"
FT                   /db_xref="InterPro:IPR010703"
FT                   /db_xref="InterPro:IPR026791"
FT                   /db_xref="InterPro:IPR027357"
FT                   /db_xref="UniProtKB/TrEMBL:C1E201"
FT                   /protein_id="ACO62253.1"
FT                   /translation="MLRRLQKSLAGNCPVGTPITPLPANGGDGAHEGKAHVHIIAVEPV
FT                   YSAMDDDASNSHPNSPANSPKAAKFSGGAVGGEEFPVASAFVFDAPFVPQGAPKPSGPE
FT                   AALRITWRCRTTARVDGKFPGLCARLLVTDESTTEMSPASSAAEMLRAQSRAIAAAATA
FT                   WDELRNGATSSAVVGVVGGVSANAAAVDDAASAAAVAGCLGALQRSLQGSLAAGVNGGV
FT                   PAICRAFFPEEESRKRAMSDQSSQTPEIDEEDEESDNTKQEEAVTGSPKPQVDPRAMTS
FT                   EDRSGLLAALEDFLSACARAVEVHGTATRLTAAGKPRGESGASTIEQMQGMFVRCLAEI
FT                   RRDITVISDREKDVDNDEEYK"
FT   gene            <952641..954582
FT                   /locus_tag="MICPUN_105298"
FT   mRNA            join(<952641..952861,953051..954582)
FT                   /locus_tag="MICPUN_105298"
FT                   /product="predicted protein"
FT   CDS_pept        join(952641..952861,953051..954485)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105298"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E202"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR033562"
FT                   /db_xref="UniProtKB/TrEMBL:C1E202"
FT                   /protein_id="ACO61834.1"
FT                   /translation="MPPVLRPRTPKKGDAPRVKTPGSARPVRREFRNGARAGTGAEDQK
FT                   WSFALSSSGWLFVYYIGVVKALASRGFHRNSKIYGTSGGALTGCLLFLDIDLDALAEYA
FT                   YICAAEARASIRGAFKLRDYCRGAITQFCTANAHEILQGRFEVSITRIFPWYKNLRVNN
FT                   FPTYDFLIQSLMCSACITPLAGFPMWLKGHGLCFDGGVSDFQILKGLARNGTFCKLHCR
FT                   KTNPKDLVVVCPFYSSRANIRPSKYVPIWWAFYPPPPYKLKELFELGQKDAHAWCDKQE
FT                   DAGSSPEKDDSPRATSSEGSRSSDEDDDMEWEWQRKEKAQARGTSDAKDLSRESSVTAD
FT                   DQDMEPPTSPTATNRGFTEWAAECQEWASLSAEAAARRAMSAARAAANKAEAFVHHEAE
FT                   VVHTYASGKFCQAQAAAEAMRRVASKSNLPEIDLIADLDDDDPEEEIPRGRFQAHRLLL
FT                   KSLACMVIYLELVAQTLLNVCGAGAALLLPGVRSGKLREKVFECCRPLPRVLLQPVPGV
FT                   RKVAKIDGKTAKALGNISVAYRVLCYLVHMEVHC"
FT   gene            complement(<954600..>955280)
FT                   /gene="RPIA_1"
FT                   /locus_tag="MICPUN_97166"
FT   mRNA            complement(<954600..>955280)
FT                   /gene="RPIA_1"
FT                   /locus_tag="MICPUN_97166"
FT                   /product="ribose 5-phosphate isomerase"
FT   CDS_pept        complement(954600..955280)
FT                   /codon_start=1
FT                   /gene="RPIA_1"
FT                   /locus_tag="MICPUN_97166"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="Ribose 5-phosphate isomerase [Carbohydrate transport
FT                   and metabolism]; GO_function: GO:4751 - ribose-5-phosphate
FT                   isomerase activity; GO_process: GO:9052 - pentose-phosphate
FT                   shunt, non-oxidative branch"
FT                   /db_xref="GOA:C1E203"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1E203"
FT                   /protein_id="ACO62254.1"
FT                   /translation="MVVGLGTGSTAYFAVERLGEKLKSGELKDIIAIPTSERTREQAES
FT                   LGIPLCTLNEKSVLDVAIDGADEVDPDLALVKGGGGALLREKMVEVMAKKFVVIVDESK
FT                   LCKGLGPGFPLPVEITPFCHMHTLRTIAALPSVAGCEAVLRMGSSSTNKPDGDNIAVTD
FT                   NGNYIVDLHFKEPIKDVNKAAEELKNTVGVVDHGLFVGMSYQVIVAGKDGIKVAGTDGE
FT                   PAWW"
FT   gene            <955861..>959175
FT                   /gene="AE_1"
FT                   /locus_tag="MICPUN_96291"
FT   mRNA            join(<955861..958443,958657..>959175)
FT                   /gene="AE_1"
FT                   /locus_tag="MICPUN_96291"
FT                   /product="anion exchanger family"
FT   CDS_pept        join(955861..958443,958657..959175)
FT                   /codon_start=1
FT                   /gene="AE_1"
FT                   /locus_tag="MICPUN_96291"
FT                   /product="anion exchanger family"
FT                   /note="sodium ion:bicarbonate symporter; GO_component:
FT                   GO:16021 - integral to membrane; GO_function: GO:15380 -
FT                   anion exchanger activity; GO_process: GO:6820 - anion
FT                   transport"
FT                   /db_xref="GOA:C1E204"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:C1E204"
FT                   /protein_id="ACO61835.1"
FT                   /translation="MSESTSEVPGVGEPPRYVRFLQHLVAEGGYGLDESHALTGLKEWR
FT                   EAEVVGALLRNVKERAPDAVVGRIFTAVNQDGLVVLVGEAGEPENGGDAHANGSTEATS
FT                   NGAHHVASNGTEITSANGRAPRHRVLTDCHISVCTLDQPVNLGAPDGRNARAVFLVMVP
FT                   EVDFTAPWAEGLDRYECLRTIKTAFQRFAARGTFLKTVYADERNLEAATARQKLAEFLG
FT                   ERKSGDGDADGDRDPELGKSSGRMAAKATSTRPTSPRMSTGGSNLARQKSIANMLTPGA
FT                   KTTRLRPVDLVEALRASVAAWADHEQRRLLLLADENERETEAASMYQWTGRLCGGVIDD
FT                   VTNRWAPLFVSDWIDGVSVKTVSASLLMFFGCLAPCIAFGALTDISTGGKMGTMEYLVA
FT                   QSVSGVVWSIFAGQPEIVLRTTGPSTVFLIELARACERDGYPFITAFAWTGIWSAMFMI
FT                   AIACLDACTLMLRNCTRFTQEIFGLFVSAIFIQSGGTALVSYFKSDEYDLAHALFSLIL
FT                   ALLTLQLGLWALQVRTSPFLLPTMRELTADFGVAAAIAVGTLTAYGSNVKGMEMLKMTS
FT                   SIEPADGRGSWVVDLHAGPAHLKWLAIVPALLLTALMYVEMNISSLLANKPENKLIKGP
FT                   AHHQNFLVMALITLVFALFGLPPMTGSLPHSPQFIRALSDVEEITVGGETRTNVIWVRE
FT                   NRLAPLLVHVLMSLTIVMAPALRQIPMAVLYGLFLYMGITGLATSQLWTRIKMIAMDPR
FT                   LLPPTHYVRKVPLTRVHAFTLVQMCCCAALLGVRQSPAALFFPLFLGALMPLRYTLTHE
FT                   GVSLFTPEMLKMLDMIAEASNAETAARTGRTDAEDHLTIRGDVADFDRSPNLSTSPSGD
FT                   LKAPPGLGENGVLATCLTNPSGVGVLSGTLVCATDLGTRRILRPKILPLALTSAQAAGT
FT                   PNTSAVATRTVVGVTCGCSASTLPASFMANASTSVNIRIAVASAAVDTAVTPSAKAFAP
FT                   SPARGAAFSKTALADEVAVVISGSVASWSAVASSMTYPGAMVLA"
FT   gene            <960347..>962326
FT                   /locus_tag="MICPUN_99546"
FT   mRNA            <960347..>962326
FT                   /locus_tag="MICPUN_99546"
FT                   /product="glycosyltransferase family 77 protein"
FT   CDS_pept        960347..962326
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99546"
FT                   /product="glycosyltransferase family 77 protein"
FT                   /note="candidate glycosyltransferase"
FT                   /db_xref="GOA:C1E205"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E205"
FT                   /protein_id="ACO61836.1"
FT                   /translation="MQEVDPSKQDHPKWMRDMWSEKVQAVDKNVIDKELEARLESRPPE
FT                   LDHVQPGEELFVTFGTASVTDFVQNWLESADKLGLSPLFVGALDEDMYEWCKKRGVPSM
FT                   LLKGNTVLKNRGQQFITAGDKSFKKMGTVKTKFIQDLLELGIAPILTDADVVWLKDPRS
FT                   YFKRGTYITADVLVSTDCIDVPADRKDNNGCSHVNFNTGVLHFRPTDAAKAFVQTWKTK
FT                   VATSTIAWMRDQPAFNLITHEGVGGHSLEPAVSVPEERRGTEGHRMVYWAANASIRLGV
FT                   LPNWLFGNGHSYFVQWHHLTHPEDGEPFSVHLTYQYGDTGSYAFGKRERMRQAGIWRSD
FT                   PREYFEDGKYLVVSDEGSQVDFSGESPGGEEVGSDRNAYRTAIDRHLREDKLRRTTIRN
FT                   ALALARALNRILVLPEARCYCDKIWNNLNACRAPGAESFKLPYACPMDHIYDLPSWFNP
FT                   GMPDFREPGFLDDPRVPDAIKASVGRVVVDRDGDTRAGKPGWDMNDGKVVKLRHGFTVP
FT                   DAKLALKSLEEKRVIEVDFLGNEGTFCGFGDDAKNKEFDRIVVKPLSASQYYCFTELWE
FT                   DQGSPRGGRNGPYEPQVVLRHCGMMEDDFKRAGKVHAGVVEHIDKPDGGCSCEWGFGLP
FT                   RGLAHISKDESICPRRNSDQPTAG"
FT   gene            complement(<962413..>963198)
FT                   /gene="TIC55-2"
FT                   /locus_tag="MICPUN_57064"
FT   mRNA            complement(<962413..>963198)
FT                   /gene="TIC55-2"
FT                   /locus_tag="MICPUN_57064"
FT                   /product="chloroplast envelope protein translocase family"
FT   CDS_pept        complement(962413..963198)
FT                   /codon_start=1
FT                   /gene="TIC55-2"
FT                   /locus_tag="MICPUN_57064"
FT                   /product="chloroplast envelope protein translocase family"
FT                   /note="inner chloroplast membrane translocase (import)
FT                   Tic55; GO_function: GO:16491 - oxidoreductase activity"
FT                   /db_xref="GOA:C1E206"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:C1E206"
FT                   /protein_id="ACO62255.1"
FT                   /translation="MDSDAAVGPSRSGEWHVVAKSDQLARENARVQVTADGRYLVVARS
FT                   GGRLYAFDATCYHMGAPLLHGDIEDVDGHGACITCPWHHYQISMSTGERLYQDMSRKTC
FT                   TLPKKQRVHEVMEADGEVRVRLSGGGKPPSPPPDVIRPKPHEVDYEWESDRYAFKPPPP
FT                   SQASQKAPRSGKVFNRGGGRFPPGAFGRGSAGLHPGLVGAGVGREVGRMVADSMRGGDG
FT                   KAPWAMSRGFAQPPPKAKPALAGEALAEGEELPDAPGDG"
FT   gene            <963441..>963827
FT                   /locus_tag="MICPUN_99547"
FT   mRNA            <963441..>963827
FT                   /locus_tag="MICPUN_99547"
FT                   /product="predicted protein"
FT   CDS_pept        963441..963827
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99547"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1E207"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1E207"
FT                   /protein_id="ACO61837.1"
FT                   /translation="MADMVQEIVVAKPVSPVQFMIDYLAVGSSLCQQDKYGLSMMRRAR
FT                   LMKIFKAWDKNQDKTVDLKELRAFTRKHGGNAVTQDELKDIFMDMDESGDSKVDEDEFL
FT                   KFFSLSVKRMDDDEFEQMIQDMLQ"
FT   gene            complement(<964030..>964257)
FT                   /locus_tag="MICPUN_57066"
FT   mRNA            complement(<964030..>964257)
FT                   /locus_tag="MICPUN_57066"
FT                   /product="predicted protein"
FT   CDS_pept        complement(964030..964257)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57066"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E208"
FT                   /db_xref="UniProtKB/TrEMBL:C1E208"
FT                   /protein_id="ACO62256.1"
FT                   /translation="MGGGAVTAVRATEDPTSFNQVVLQAGPLLLPLVLSTSAAVYRSSR
FT                   EGGLARLPLGMWGGICLVWLYWLGSQNGIF"
FT   gene            <964543..>965946
FT                   /locus_tag="MICPUN_57067"
FT   mRNA            <964543..>965946
FT                   /locus_tag="MICPUN_57067"
FT                   /product="KH domain-containing protein"
FT   CDS_pept        964543..965946
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57067"
FT                   /product="KH domain-containing protein"
FT                   /note="has two KH-1 domains and a antimicrobial formaecin
FT                   family domain. The K homology (KH) domain is present in a
FT                   wide variety of quite diverse nucleic acid-binding proteins
FT                   and it has been shown to bind RNA; expressed; GO_function:
FT                   GO:3723 - RNA binding"
FT                   /db_xref="GOA:C1E209"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:C1E209"
FT                   /protein_id="ACO61838.1"
FT                   /translation="MGDDAQVKEEEGMSPPRGQSRSRSRSRSPRRRSYSPDRRRRRDSR
FT                   DRSRSRSRGRGRSWSRSRSRSPRGYRRRSRSYSRSRSRSRSPPRRRRRSPPRGERDSRR
FT                   PPPGGPARVKAEAEEAIPCVGYEGRIIGRGGETIRRIQEETGARISIDRASGECMVSGS
FT                   TEQVILGSAAVKKIIAEAGERGGGGGGNGGGGGGFRPPSGPFEAEETIPCAGSEGRVIG
FT                   KGGETIRRLQEETGCRIDIEKGSGLCTIKGTVAAVRAAAAAVRRQIEDGDGGGGGFKRK
FT                   RDSEDEPIDSAAYGRELAQREEDDEPKPPPIEPDFGLSGALAAETNTVNGVTLVYTEPL
FT                   EAKKPTVRWRLYVFKNGELQGDPLKIHQQSYYLLGRERKVVDIPTDHPSCSKQHAVIQF
FT                   RARDVMDDDTGDMVQVVTPYILDLDSTNGTHLNGERIDPRKYYQLLEKDTLVFGQSTRE
FT                   FVILNEDSK"
FT   gene            complement(<966003..>968894)
FT                   /locus_tag="MICPUN_57068"
FT   mRNA            complement(<966003..>968894)
FT                   /locus_tag="MICPUN_57068"
FT                   /product="chaperone, Hsp100 family, clpb-type"
FT   CDS_pept        complement(966003..968894)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57068"
FT                   /product="chaperone, Hsp100 family, clpb-type"
FT                   /note="conserved, found in CCMP1545, CCE9901 and O. tauri,
FT                   has the same arrangement in CCMP1545 being found adjacent
FT                   to a KH domain containing protein. Has two ClpB domains
FT                   whose function is uncertain, but they may form a protein
FT                   binding site; GO_function: GO:5524; protein binding - ATP
FT                   binding [PMID 5515]; GO_process: GO:19538 - protein
FT                   metabolic process"
FT                   /db_xref="GOA:C1E210"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR017730"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:C1E210"
FT                   /protein_id="ACO62257.1"
FT                   /translation="MSAMASNVAGGRVVASAVRRDGNAVRSRRPPGLGEFRPSRPLRSK
FT                   VATRVSADSAKKISQNEFTERAWEAIVLAPEIASNSQQQIVETEHLCKAMFEQKDSFAL
FT                   RILTQAGVDPSAAVGFIDRFISRQPKVSGGAQQVLGRHLEALVEEARVRRSAMRDDFVA
FT                   VEHLVLAICKDERVGNALMAELGLNEDALKNAVTKLRGGTNVTDQGAEGKYESLKRYAR
FT                   DLTAEARAGKLDPVIGRDDEIRRTIQILSRRSKNNPVLIGEPGVGKTAISEGLAQRIVQ
FT                   GDVPLSLQGVQVMSLDMGLLIAGAKFRGEFEDRLKAVMKEVTDSDGGIILFIDEIHTVV
FT                   GAGGSGGSGGGMDAGNLLKPMLGRGELRCIGATTLDEYRQYIEKDPALERRFQKVLIDQ
FT                   PSVEDAISILRGLRERYEIHHGVSISDNALVEAAVLSDRYIADRFLPDKAIDLVDEAAA
FT                   KLKMEITSKPTVLDEIDREILKLQMEQLSLRRPAGSRPSEQANVSARLQRVESELASLM
FT                   VRQDTLTFQWEQEKAKLAAIQQLKEEIDAVQTEVSQAERDYDLNKAAELKYGSLMNLQR
FT                   ELLDAEAAMDAAAAQGGDLLRDEVTESDIADIISKWTGIPVSKLQEGEREKLLNLPAEL
FT                   HKRVVGQDLAVQAVTEAIQRSRAGLSDPNRPIASFMFLGPTGVGKTELAKTLATFLFNT
FT                   EEAMVRIDMSEYMEKHAVSRLIGAPPGYVGFEEGGQLTEAVRRRPYSVVLFDEMEKAHG
FT                   DVFNVLLQILDDGRVTDSQGRVVNFKNAILIMTSNIGSQFVLENMNDNSEGGKAYRRER
FT                   VMEAVRGHFRPEFVNRVDEYIVFDPLDFNQVRKIVEQQVERVRSRLKDRKIGLRVDESA
FT                   IQMLCEAGYDPSFGARPVKRAVQHLLETSLAQAILRGDVAENEQAVVWAHGEGEGRQLL
FT                   VAKEEGQRQEEPAQQELNGADPYAQMSWDQTPQ"
FT   gene            complement(<969086..>969996)
FT                   /locus_tag="MICPUN_70208"
FT   mRNA            complement(join(<969086..969219,969325..>969996))
FT                   /locus_tag="MICPUN_70208"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<969086..969219,969325..>969996))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70208"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E211"
FT                   /db_xref="InterPro:IPR012926"
FT                   /db_xref="UniProtKB/TrEMBL:C1E211"
FT                   /protein_id="ACO62258.1"
FT                   /translation="GALDGYLKPPRNGKFLSLLMGNAVDVTSQRQENRLRIKEEYYSFR
FT                   DRSTFTYVAWPTALLYLNRERQKGLEAGAANTWFSLVTVFPVLVQFYWCWMLYFYAALA
FT                   LRENVLRCNGSRIRRWWINHHYYSMGMCLVVLTMDVQSNACLNYMSRFLVFTALQGVVM
FT                   LTQNRYQRFRMYTRVAMGKASPMDVAGGEMGGNAGQLKLLYPLLFGLQIMQVYFGASVL
FT                   VSFFREWQAPAAGALFVVMGVGNFRATCQTYFTKRKFAKESSRSKA"
FT   gene            <970536..>971945
FT                   /locus_tag="MICPUN_57070"
FT   mRNA            <970536..>971945
FT                   /locus_tag="MICPUN_57070"
FT                   /product="predicted protein"
FT   CDS_pept        970536..971945
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57070"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E212"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E212"
FT                   /protein_id="ACO61839.1"
FT                   /translation="MSGFHTEDGYNGPSLFGQNGAIVGGVRNKLGHVASEEEKQQARRT
FT                   VVVIGIKWLLSPGWRGDDYRDAVFPAEVAQWFEEQIGPVQAVHFKPPVQAWVEFNSASN
FT                   ATAALNLNGATYPRKCKHSPGGRIKVSRATHTELVRGAKDHLRSYHVLIPEKFLKGEVE
FT                   PGAHDGAGDGRAGEKEGEDDEAKVIAALRESNPYFDQDMALYEEHHREKLRAEFDRLAR
FT                   ERSELEEVKRLYRGASAGDVDAIESAIWAGADTDTANPLDGGRTALHYACLAGERAAAQ
FT                   VLVEHGANPSALDALGFTPADALKSGEKDPRGEIAGDLELARAAHAHMASLAMKINAGT
FT                   YDVDEPDAPDSMPPLHEAVAARKGALTRFLLAQGASVEKTGGSDGDTPLHIAARTGQER
FT                   MCRLLVLRGAAPDAPAAGGDGSTPLHEALRGVKRNGSKGAHAKIAKLFMDEMKRLGRGA
FT                   EAAAIIAGTRS"
FT   gene            complement(<972004..>972663)
FT                   /locus_tag="MICPUN_80283"
FT   mRNA            complement(<972004..>972663)
FT                   /locus_tag="MICPUN_80283"
FT                   /product="predicted protein"
FT   CDS_pept        complement(972004..972663)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80283"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:3746 - translation elongation factor activity;
FT                   GO_process: GO:6414 - translational elongation"
FT                   /db_xref="GOA:C1E213"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:C1E213"
FT                   /protein_id="ACO62259.1"
FT                   /translation="MSAVSAAAVKELRDKSGAGMMLCKKALTECNGDMEEAVKWLRKKG
FT                   MASADKKAGRVAAEGAIHSYIHGGSRLGVLVEVNCETDFVARGDKFKELVADIAMQVAA
FT                   SPGVEYVSPEDADPAMVAAEKELMMKMEDVVSKPENIREKIIQGRLSKVVNEKALLKQP
FT                   FIKDPSKTVEQLIKEVTAEIGEKISVRRFVKYNLGEGIEKKVEDFAAEVEATRTAT"
FT   gene            <975993..>977645
FT                   /locus_tag="MICPUN_80247"
FT   mRNA            join(<975993..976128,976414..>977645)
FT                   /locus_tag="MICPUN_80247"
FT                   /product="predicted protein"
FT   CDS_pept        join(975993..976128,976414..977645)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80247"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16627; acyl-CoA dehydrogenase
FT                   activity - oxidoreductase activity, acting on the CH-CH
FT                   group of donors [PMID 3995]"
FT                   /db_xref="GOA:C1E214"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E214"
FT                   /protein_id="ACO61840.1"
FT                   /translation="MAPFGSKVPLAEPSWYQNLNTPYYNASHVAWRAKLRDFFEKEVEP
FT                   IVDDWDKQASMNNHAACGEYVKRMYAKSAQYGILPACVGKPWPGKYTSAAEPEGYDYFH
FT                   ELINVDEGTRAGGGIAWAMMGGLGIGMPPVLNFGVPGDRALQDRVVRECLAGEKIICLC
FT                   ITEPGAGSDVANLACTAEDKGDHFLVNGNKKWITNGIYADYFTVAVRTGPPGSAHKGLS
FT                   MLLIERNSSPGITTSKMDCMGVWPSGTTYIEFDNVKVPKKNVVGRVGDGFKQIMYNFNH
FT                   ERWLLAAQAARMARTCVEESIAFARSRRTFGKFLIEHQAIQHKIGEMARQCEGLQAWLE
FT                   NVTFQMNTMSKEEQNRKLGGHIALLKLSSSRVAEFCASNAMQVLGGAGYTRSGKGTKVE
FT                   RIYREVKAYAIPGGSEEIMLNLAAGQFGFVTRRAPDPRDKIIKQLKDELKRVHSKI"
FT   gene            <977864..>980788
FT                   /locus_tag="MICPUN_99553"
FT   mRNA            join(<977864..978909,979111..>980788)
FT                   /locus_tag="MICPUN_99553"
FT                   /product="predicted protein"
FT   CDS_pept        join(977864..978909,979111..980788)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99553"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E215"
FT                   /db_xref="InterPro:IPR005331"
FT                   /db_xref="UniProtKB/TrEMBL:C1E215"
FT                   /protein_id="ACO61841.1"
FT                   /translation="MATTGDAREAEPLLGGGDTGAPASWWPRGRVGALVAGAMLVLLGL
FT                   CAGSAVGPMPTGLSRLGDDDAAPAPTYPAAEEPPLLDPLVSFNTPRCRQTRASLARVTN
FT                   HDGDVVVIPELRAVYVDIVKAASESIRSALEDNFHASWSADLGQYKHPVTGRPQRSSTS
FT                   YLTDDVLANYTFFTFVRDPNTRFRSSYEQAICRERCTLCTARGAGTMYTPTIAEITAFL
FT                   QGRLMHFYGDIALRGERSDEITLQEAWVDEHFESQILRLSGATKDGTPVPLNFVGRVES
FT                   FEHDWARLMDHLGVKEGDPRRVTPGHQEHACDIPERGKVVQRQRASPVTTLEKVAVAAL
FT                   YHDDFECLGIMASWKDGLEGLRERNVTELACVMMSSQKPPYSAEVLEEARKSARKVEGG
FT                   FASRSKHAKEYAAKVAAKKGDLVKKIVKVMPEGVQKEHYQEAIATAAMIDKAAAEAEAQ
FT                   AKTEVKPEVKVEVKPEVKVEVKPEVETEAKPMDVDPPSQQPSSQGTILRQPSDTAAAMA
FT                   QVEKEPLIKTILRRVLERHEIKYHLSTLELDAKRKYSAKAASAVSHAMKKYNEHVEARN
FT                   AKLPPAQRKPGLGEAALVEHITSQAHKMLLAKLKEAAEPKKEEPPAAPKPGDASFVPAA
FT                   RPPGMEGKSFDDLVQYWKRLGELRVAYLPRVRQTLPMLQKYSRGVGQVAANAENFAKMT
FT                   EHTLIPLLSQTADEPMMTAKFTMDELAALEGHVKKLVALAGGRGVNEVPAPAPAAPKPA
FT                   PADEATAGDTKRKRDGEEEEDGEGGDRKRAKTEDAPEPEPEPEPMPAPRAPSAFTGLTS
FT                   CAPDHAHAQPAPPMPSALEGTSEKRPPGKSVGCPVAAEEGELVAAAVYSSDDVSYWAPD
FT                   GELLRRALEGEVIAGTTKSAAMFKAFEELKEVFSSA"
FT   gene            complement(<980875..>981240)
FT                   /locus_tag="MICPUN_80239"
FT   mRNA            complement(<980875..>981240)
FT                   /locus_tag="MICPUN_80239"
FT                   /product="predicted protein"
FT   CDS_pept        complement(980875..981240)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80239"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E216"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1E216"
FT                   /protein_id="ACO62260.1"
FT                   /translation="MPEAGGNLSAVRGEDQFGRTLWEKGKNGALVVVKYGAAWCKHCPM
FT                   MLPEFGAAARRHPEAHFVLADVDTLPETGKDIRFTPTFSFYRSGVKLDEITRTSPQQLR
FT                   DHVWMHAPDKPYVPDDA"
FT   gene            <981450..>982292
FT                   /locus_tag="MICPUN_79551"
FT   mRNA            <981450..>982292
FT                   /locus_tag="MICPUN_79551"
FT                   /product="predicted protein"
FT   CDS_pept        981450..982292
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79551"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4437 - inositol or
FT                   phosphatidylinositol phosphatase activity"
FT                   /db_xref="GOA:C1E217"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020552"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="InterPro:IPR033942"
FT                   /db_xref="UniProtKB/TrEMBL:C1E217"
FT                   /protein_id="ACO61842.1"
FT                   /translation="MAEIDHAACLVAAELAARAAGEEIKAAWDAERDVEYKGTVDLVTA
FT                   TDKKCEDLIFDMLQSKFPTHAFVGEESVAAADGKLPEIGDEPTWFVDPLDGTTNFVHAF
FT                   PFSCVSIGLAVKKKPVIGVVFNPISNECFTAVVGNGARLNGKPISVSKVSDLGKALIGT
FT                   EIGVSRDAATVDAIMGRVRACVENARSLRCSGSCAMNMVGVAMGRLDGFYEIGFGGPWD
FT                   CVGAAVIVTEAGGVVCDPSGKPFELTARRVLCGNPDIAPALTKVLTAIPDGPLEPQAP"
FT   gene            complement(<982387..>984084)
FT                   /locus_tag="MICPUN_80181"
FT   mRNA            complement(join(<982387..983136,983287..>984084))
FT                   /locus_tag="MICPUN_80181"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(982387..983136,983287..984084))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80181"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E218"
FT                   /db_xref="InterPro:IPR012936"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039542"
FT                   /db_xref="UniProtKB/TrEMBL:C1E218"
FT                   /protein_id="ACO62261.1"
FT                   /translation="MPILLRRTSTGSGFTVGASGRDGVGGALKSVDLYAKMPRELAEGT
FT                   YLGGVFSILLMFVFVSLFGMQLRALWTVGTRTDIAVDHSEDAKFQVNFKVELPALSCEW
FT                   ATVDVIDALGTRHFNISGESIYKHSMGASRYLGVEHASAGRESQREPEYGDTTDLDHYG
FT                   NRRIAYEVTGATFERMIRAHKVLLVEFHAPWCSHCQRLAPIYEHAAELVRSELRRGKRA
FT                   RLAAALATVDCTIESNKDLCKEQHVQAFPTLRVYRAGSLHPVDLVQSVADAKAESSYDD
FT                   EFSETNARAAAMKAAEMARAAKSLGGQIRTSGCIIDGSFRVNRVPGAFYVTPHSMGHNL
FT                   NPDVINMTHTVKHLSFGKHVPGRPSYVPRNLRRVWNRVPKDLGGRFAAGDEATFYSEEP
FT                   NTVHEHYLKIVSRTFEPLEGQAVQLYEYTFNSNRFRLNPPLAADGDPDQHVDGPMIKFS
FT                   YDVSPMSVVLKEVKKPLLDWILGMCALLGGVYTCAGLLETFLQSSVCAVKRRVGKIS"
FT   gene            complement(<984255..>985451)
FT                   /locus_tag="MICPUN_79531"
FT   mRNA            complement(join(<984255..985028,985080..>985451))
FT                   /locus_tag="MICPUN_79531"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(984255..985028,985080..985451))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79531"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="UniProtKB/TrEMBL:C1E219"
FT                   /protein_id="ACO62262.1"
FT                   /translation="MLAQEKLVPKPPIRTTVGYNFEHDNDLREAYRNPWNEVRIGRVLE
FT                   DLDSLAGNIAFAHCDDADVATRPQLLVTASVDRVRLLRPLRLKEDMTLTGAVAWVGTSS
FT                   IVIRMEAWPADHPDAPTDPDPGPSLTADFTFVARDSVTNKGAPVNPLVPETDEQRDLFE
FT                   RTARRVEAKRARMRSERTNGADGALSPELAESKRLFVEDVTRAARALRELPALAPAQDV
FT                   AMDATRTENMFVAQPQQRNLSGRIFGGFLLRRAFELAFATTYVFGGAKPKFHSVADMNF
FT                   LRPVEVGDLMRIRARVLHATRTSCGRPSVDVEVEALVTKPESLRSEVSNTFMFKFDVGD
FT                   ANEGRVVRRVLPSSREEAAHVWEKCVRPDVQARLEEQTPLI"
FT   gene            <985948..>987432
FT                   /locus_tag="MICPUN_112704"
FT   mRNA            <985948..>987432
FT                   /locus_tag="MICPUN_112704"
FT                   /product="hypothetical protein"
FT   CDS_pept        985948..987432
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_112704"
FT                   /product="hypothetical protein"
FT                   /note="expressed; conserved hypothetical protein"
FT                   /db_xref="GOA:C1E220"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR039751"
FT                   /db_xref="UniProtKB/TrEMBL:C1E220"
FT                   /protein_id="ACO61843.1"
FT                   /translation="MSSEPSPSPPTAICLTIKNLTKRDFTLGEVPLALTVGELKARIES
FT                   EYEGNPPPNTQRIVYAGALLRDESAGLADVVKASDLEAGAVVFHLVLPAEASSTASTPA
FT                   STPGATPASAREPGAETSTPSSAPSPADGRLPAQPGTPPPAPRADQQSAYPPQPEATPA
FT                   FGFSNQPPPATTQPGSSRPTTPGMTPTVAAYPPPYAGLGAHSPHVQAVYASAYAAAFNS
FT                   LSPGGSPAPGAPVAVPVPVPVFGFGGGWGAPGWGAPGWNGAPGGYQQHGAPGQQQHHAV
FT                   LAPGQQQPTTPTPPRFDLNDPDQAARAVAQAVRDGDPVAAAAAAAAAAAGGRPVHVMQI
FT                   HIDLRLIMKLAMIVAVASQGATNVRMAIYAAMAVVVYLFQTGAVAWVIRRFLPDILDEQ
FT                   ADGMVGGMGAVGGGGAGRAGGAAAPPPRRRPPQGPRTNAVLPGMRDGMPRSWFGEIKVL
FT                   VCGFLASLLPSWQPPELYRHPRPGAAAAGPERPHQD"
FT   gene            complement(987431..988830)
FT                   /locus_tag="MICPUN_57080"
FT   mRNA            complement(987431..988830)
FT                   /locus_tag="MICPUN_57080"
FT                   /product="Drug/Metabolite transporter superfamily"
FT   CDS_pept        complement(987506..988660)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57080"
FT                   /product="Drug/Metabolite transporter superfamily"
FT                   /note="UDP-glucuronic acid/UDP-N-acetylgalactosamine:UDP
FT                   antiporter"
FT                   /db_xref="GOA:C1E221"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:C1E221"
FT                   /protein_id="ACO62263.1"
FT                   /translation="MGKSLNGSGQDLHDNPKGRDRRNWAGISAALFYGSMSVASVFLNK
FT                   AIFEVWRYRYPASLVAGQTVFTVLAIFTLSRFGVIKLGKFNMDHFKRVFTVSAVFQLKL
FT                   VLDMSALVLVNIPMYGILKSSTTPFVMLLDYVLRKRVPAMRIQAAVWVTTVGGLVAGFG
FT                   DLHFEPLGYVLALSSAACTACYVVLVGKLGDELQLDSFTLLLYNSLWSTPLSFGITILT
FT                   GEVTGVMNYPHVSEVAFLAAFTMSCASAFVLNYATYLCTQLNDALTTSVVGRTKSVVQG
FT                   VAGLFAFSVSWGMTNVIGLTLNSVGICWYAWERYAEKRRGTRLENVRRGIGALNENFLT
FT                   RNESQLTLSPKKQMNGFGLHRHPTRASESGSSSMASMNGHGGGG"
FT   gene            complement(<989040..>992651)
FT                   /locus_tag="MICPUN_99558"
FT   mRNA            complement(<989040..>992651)
FT                   /locus_tag="MICPUN_99558"
FT                   /product="predicted protein"
FT   CDS_pept        complement(989040..992651)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99558"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1E222"
FT                   /protein_id="ACO62264.1"
FT                   /translation="MEEAAPRAAPLQRLGPALRAVLGCDPKALRRAMDSRAAGDGGASS
FT                   GGGKSVKMARELTDALDDIAAFLAADVAEDADSGAAAAYPAVDPMLEHVVRPANGGVAA
FT                   GIDATAKSKKVALRIVAWLLASSPRGAGDECAARVGAALARRCAPPTPKRTRLAACIAL
FT                   HHAAVNLVDGLPPSCSPDAIAPGLLATAAEAGEGDAPTRLQAEAADTLLAITTRLAVVD
FT                   HRALWRALPHLRAVTESVGGWWPAACRAPRIAAREAYTRLRRVEDTGDAEAWSRALANA
FT                   WMDWAPLLAVRGGLDGITAGAVGRDVDTAVGGEVPSPSHGAGDGVESAQARQLARWLET
FT                   AAAAASAERTGGHGATAAASERLAHALVAVGLLVGRAGLAGGGESGDAHARAALRNRAA
FT                   DALVPALGSRSGAARDLAASIAACAIGGGWGAEHAALLDGSLAALDDASAVGDVRSTYS
FT                   GVASLASALVAAEPRAVGFGGTRPGLARVLRTCEHGRTEEARAGALAVIRNVLETAAPG
FT                   EDVVVGSEAAAITAASLGALKDPTLVVRKAAAATFSALPIPDVLPRLLRALSAKDARER
FT                   ASARESAAGAMRAYTETRGASAALDAFIAAVRPGPGEGDVVSGVSENDAEGSRATSVLR
FT                   GWSESLTEDQAREVAAGIAAATLRNPGVTALVRVASALAPRVGEPPACRETFAAVRAAW
FT                   SASRPAEASEASEASSNADDVFERLAPLLVLRTLPLEAWDDDHLFSVDESPSVPDVLLD
FT                   IALAGAGEHDEVRRVAAELHGRAHPDATSESRGVRLAEAVVDGALGRARACMFSLCSSL
FT                   AFRGIDACPSHSSTASPAATREVCARILESLGMDDSDEATKTRMGATETLASLVRAELE
FT                   DADVDRPGDDTDGDDDEPLSLGDEPRGGRAEGGLLEPADGFGQSPLTKSLANIYVDPLA
FT                   APTPAARREPLIRVLDGDDGTENVTENVTETGTENVTETGTETIPPRDGSRPTRRRRSA
FT                   TLNGILAALQGSSAPDWTRPADGNPGAATRIRLTLADVLVSVARRPLRDADAAAAFADR
FT                   ALPALAAVAGGSGSAACEKATEKATADANRRDPCDATRAAAFHVAMVAVAPVTGDGEPS
FT                   GGFRVSGGGRVASHARLLAASCASTLRSSGDVHDSVRVAAARLVTALVAGDDDTLEALA
FT                   GSIPEVRSALRSAVDTAESEELADSCRRLLTCMGAVA"
FT   gene            <992799..>994448
FT                   /locus_tag="MICPUN_57082"
FT   mRNA            <992799..>994448
FT                   /locus_tag="MICPUN_57082"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT   CDS_pept        992799..994448
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57082"
FT                   /product="Multidrug/Oligosaccharidyl-lipid/Polysaccharide
FT                   flippase"
FT                   /note="multidrug efflux; GO_component: GO:16020 - membrane;
FT                   GO_function: GO:15238; antiporter activity - drug
FT                   transporter activity [PMID 15297]; GO_process: GO:6855 -
FT                   multidrug transport"
FT                   /db_xref="GOA:C1E223"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:C1E223"
FT                   /protein_id="ACO61844.1"
FT                   /translation="MVTMLTSCVAASPIRGEIRRIRRARTAPRSVSVRARKDVDTLVRA
FT                   NLPSRFRSRAIQGPLRRGLVHRSPTRIASDAAKDDPEVELSDGVTLDRKAELASVVKFA
FT                   VPLLATNIVTPLLTMTDTAFVGRCAADSVIQLAALGVSTPLTDYTVSLAAFIPAGLTNI
FT                   ISNGVARGEGKESLASKTYGALIVSLTLSSIVAIVLNVWPEQLLTMLKTPPEVMAAAIE
FT                   YTRIRSIAMPAAYLTAAAYAVLVARKDTTSPLACVCIAAAVNVLLDWIAVGVMGKGAAG
FT                   AAWATTAALYAGAVAILGVLKRKGFTDAFPWGEFRWKDQIGPVMAFAGPITFLVFALLS
FT                   IYTTLIIMSNALGVTVSAAHRIAGNIFAVAVLCGDPLIQAGQAFMPRYLLPAVPKRVAA
FT                   RKMAGLLQGVGLFTGFSASTACAFVCLFGGWAFTRDAAVVAQLRAVVVPVCAAVVTNIV
FT                   SKSMYGVTVAAKQLGFLAAITGVGLVGFAGSLWWFKHNLVGSELYYWMWWVVAGYYGLA
FT                   IAAIQVRSFGVPGIVKGSFHDDRKDTPAPATA"
FT   gene            <994660..>996261
FT                   /locus_tag="MICPUN_57083"
FT   mRNA            <994660..>996261
FT                   /locus_tag="MICPUN_57083"
FT                   /product="major facilitator superfamily"
FT   CDS_pept        994660..996261
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57083"
FT                   /product="major facilitator superfamily"
FT                   /note="nodule-specific protein homolog"
FT                   /db_xref="GOA:C1E224"
FT                   /db_xref="InterPro:IPR010658"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E224"
FT                   /protein_id="ACO61845.1"
FT                   /translation="MYASRWLTLVLSQFVMVSSGTLYLFPVYSPMLKSRLDLTQEEVNF
FT                   VGSAAHFGAFFSVFGGFFYDAFGPRATLTLGGALKLGGLLTMALTIQGVAPQSHRFAAF
FT                   CAWVFGTGCSTSLTASLGANYATFKDHNLHGRLVGLILAFFGLSSGILSLVYDVFFTSP
FT                   VSFVYFLALFAGGMDLFAATLVGSPKNLALPDDEPEGGRGLPLGGVGPAPAGTVARLFG
FT                   AADHDAKLTRGLTLCGAVAIHVAVSALLIQSAGGVAAVTIACLLVTGALMTAQSWSLLG
FT                   GGGRVAFRRNEMAQVDPRLNAANKAALEGVGPAKLPFLLDFWLFFIAMMLGIGAGVTVV
FT                   NNLSQMVSAYPTLAPDAAATSRSLMKLLACTNTLGRLASGSLSDKLAHKVGRVQFTVYL
FT                   LALMAVGQCILAAMGGESAPLFGLVVGVFVVGWAFGALFWATPLLVMELFGPKNFGANR
FT                   GLVGLSPAIGGYVMSTLVAGRVYAASAGSNNDCDDGAACYGRAWVFNAFAVVVATGMMW
FT                   WLARRRARGRGMGPIT"
FT   gene            996637..998280
FT                   /locus_tag="MICPUN_90278"
FT   mRNA            join(996637..996851,997076..998280)
FT                   /locus_tag="MICPUN_90278"
FT                   /product="Drug/Metabolite transporter superfamily"
FT   CDS_pept        join(996655..996851,997076..998081)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90278"
FT                   /product="Drug/Metabolite transporter superfamily"
FT                   /note="UDP-galactose:UMP antiporter"
FT                   /db_xref="GOA:C1E225"
FT                   /db_xref="InterPro:IPR013657"
FT                   /db_xref="UniProtKB/TrEMBL:C1E225"
FT                   /protein_id="ACO61846.1"
FT                   /translation="MAAIAISTPIVARAPVVARRARVTARAAVAPAAKPAVSIGARTMM
FT                   SGSRVESRNMQVASGRKALVCNAGGVQKAAPGEKKKVFGLNLPENESLSFLILAGGSLG
FT                   SALGFAALQEGVFRIPGFKFGAWMTILTTFTYFLCGALEMKLTNDSRKASWKNYGILSV
FT                   YTYGGMAMTNYALSYLNYATRIVFKSAKIIPVMAFSVLIVGKKYDWKEWLSAAILVAGI
FT                   VLFTLGDVASSPAFAPIGVALIAGALCVDAICANFEEKNFFRCENPSTTQEVLCFASLI
FT                   GTFYGLIPFIASGKAGVAIAHSMQYTQVVPMIMGFSVLGYSSVSFILSLIKYYGATEAE
FT                   IIKSLRKVLSIVISFILFPKALNWKYIAGFAAVLVSTAYTFYLKGEKRKAKEAAKAAAS
FT                   A"
FT   gene            complement(<998756..>999964)
FT                   /locus_tag="MICPUN_67528"
FT   mRNA            complement(<998756..>999964)
FT                   /locus_tag="MICPUN_67528"
FT                   /product="major facilitator superfamily"
FT   CDS_pept        complement(<998756..>999964)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_67528"
FT                   /product="major facilitator superfamily"
FT                   /note="phosphate"
FT                   /db_xref="GOA:C1E226"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E226"
FT                   /protein_id="ACO62265.1"
FT                   /translation="RWSMVFALFCAFVLCNLDKVNMSVAIVPMAESFGWTSVEKGLVQS
FT                   AFFWGYAFTQVPGGWLAAKYGGKLVLFAGVMLWSFGTLIAPACANFSFTALLVSRFLVG
FT                   LGEGVAPSAATGVLAKGVPGSQRSKAVTATFGGLDVGSLSGLIIAPPIILFLGGWPAVF
FT                   YLFGVLGFIWGAWWAVGYMNDKSTDARETAEEKEAREAKEASGAKADPIPFGKFFKNGS
FT                   FWALMAAHFTWNYFSYGLLAWLPSFLSSALNVTLTKSSFLSILPYLATVAVTTIVAPTA
FT                   DSWEKNGMTRTNVRKLSQTLCFGGGAICLALVGLVVNSTPPEAVTQTTVITVMSLLTVC
FT                   FGMGAWVRTGLFCGHQDMSPKYASIMLGITNTAAAIASTLSTFFTGYFFSISGGSWGWS
FT                   LFFP"
FT   gene            complement(<1000743..>1001810)
FT                   /locus_tag="MICPUN_57086"
FT   mRNA            complement(join(<1000743..1001606,1001733..>1001810))
FT                   /locus_tag="MICPUN_57086"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1000743..1001606,1001733..1001810))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57086"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR025640"
FT                   /db_xref="UniProtKB/TrEMBL:C1E227"
FT                   /protein_id="ACO62266.1"
FT                   /translation="MEPASPIPPWVEKPEECRWFYGDERPLPAKLWSLQNMWYEGEIGP
FT                   DTLVWTEGMGRRTRVRDMPTLLGILRGDEDEPTGLDQLLADAADADHERVADGATTSFG
FT                   DEALLDAELGSGSSSWELNGGRQRAAAAAAAAGRSSPALVLTLLRELQATQERCAKHEA
FT                   REMALAREEAQARELVRELRALAVEAREARRGLASSPFDLARLAGDASFGDAGTVASLL
FT                   AANDAMDGGECAWAGGSEGAPEEAAVRGRASRRRPAAKADGDSSSAAAAAAARRRRSGD
FT                   GRRASGPGVGTVTVVRLRRKKDAELPRPEWQT"
FT   gene            complement(<1001887..>1004336)
FT                   /locus_tag="MICPUN_57087"
FT   mRNA            complement(join(<1001887..1004147,1004267..>1004336))
FT                   /locus_tag="MICPUN_57087"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1001887..1004147,1004267..1004336))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57087"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E228"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="UniProtKB/TrEMBL:C1E228"
FT                   /protein_id="ACO62267.1"
FT                   /translation="MKRPGLLAIALALVVGVQSVRSEAPPPPCSGHGTLNPDSTCSCEN
FT                   PRPAAGATGWTGGLCQVPVVGLATQTIGTNEAQSDSLESATWKCYHMATPAATDWNYLS
FT                   LELKQLDGDPDVYGMLYNATDDGRYPTGNTQGWDFREVSSSARGSVRLTVGKRDWAHPN
FT                   DAAEGVYICVTAYGDRVASYELRSVFTRCPAAFAIDSETGATVATQCSAPATGGTTNPT
FT                   DVPGACDEASGTCACKAYADHAYVAPEGSEHDDVPPELGFDSCSARIDFVPSASKSESW
FT                   DDVTLAADAWTFYRFEITDDDYQIQVTMERDEDEGGTARLFLRHETLPDSRWGHHDLPD
FT                   DFVSGTRPTQEVLVTRGDVAFVAGTWYAGVHAGADASSKFTLTVQRFDCPRDCSGRGEC
FT                   VHEQNGTRTCACDTGPLGPYLGPGCEDEYSGLTPSADGWHVNGTLGASDYDFFALPDID
FT                   IRESKRQIELVLSARYDRDETSYYWRPERPVLLLNHGDRSAFPSADNYTFKVTMEERSK
FT                   EYSIQLCAAQMRGSKWQAALYNPARTIPMVYSMSFRKKGVCPSATDGECSDNGDCVADV
FT                   TSPDFATCRCKTGWAGADCNFRACPEGSFIAVPGEGHGTCYRECVDGKHRPDGCDRVAC
FT                   DPPARSAADGSGCVMDECSNDLFFVDSGSDVSCVKRCVASSAGSPKRLSEECDPDTVRG
FT                   AGGSSGSRRRLGFPGVMVLIVVALSVIAGGVGYYAYSSCGGAEALGTLRGALAWGNGRG
FT                   FRRYDRFEGERFDDFAAADFDTP"
FT   gene            <1004678..1007023
FT                   /locus_tag="MICPUN_93721"
FT   mRNA            join(<1004678..1004803,1005011..1007023)
FT                   /locus_tag="MICPUN_93721"
FT                   /product="predicted protein"
FT   CDS_pept        join(1004678..1004803,1005011..1006933)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93721"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824; coenzyme binding - catalytic
FT                   activity [PMID 50662]; GO_process: GO:44237 - cellular
FT                   metabolic process"
FT                   /db_xref="GOA:C1E229"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR005888"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E229"
FT                   /protein_id="ACO61847.1"
FT                   /translation="MTAETQQANELYEAKNVLITGGAGFIASHVAILFAKKYPQYKVVV
FT                   VDKLDYCANLNNLRSIAGLLNFKFVKGDVGSADLMTYVMRSEEIDTVMHFAAQTHVDNS
FT                   FGNSFEFTENNIRGTHVLLETVKTLGTIKRFLHVSTDEVYGESSYEKDEANVEAASLLE
FT                   PTNPYSATKAGAEMLVMAYGRSYNLPYIITRGNNVYGPHQYPEKAIPKFIMLAQSGGTI
FT                   PIHGDGMATRSYMHVYDAASAFDTILHKGAIKGVYNIGAHEERTVLSVAQDIGKSLGKD
FT                   ISKTIVHVSDRKFNDRRYFIDCSKLLALGWTQQVSWEEGLKETIDWYTNNGQASGYWGN
FT                   LSGALVAHPTGGKPQLEGEVYQSLEEMMAAQERERAAEREEGKGEKKPMFLVYGRTGWI
FT                   GGKLGKLLTELGHDWCYGSARLQDRVGVQDDIKRSKCTHILNAAGVTGRPNVDWCEDHK
FT                   VETIRANVIGVLQLCDVALENNVHVTNFATGCIYKYDDAHTIGGVPFTEEDDPNFGGSF
FT                   YSETKSYMEMMLRHYPNVMQCRVRMPIDGDLQNPRNFITKIANYAKVVNIPNSMTVLEE
FT                   FVPMAVEGALRGLTGAYNWTNPGAISHNEVLELYRDYLHPEFTWENFTEEEQAEVIKAP
FT                   RSNNTMCDKKIRAAFPQVLGIKESIIKYVMEPNKKAGMRAPIKREIK"
FT   gene            <1007244..1007690
FT                   /locus_tag="MICPUN_57089"
FT   mRNA            <1007244..1007690
FT                   /locus_tag="MICPUN_57089"
FT                   /product="predicted protein"
FT   CDS_pept        1007244..1007687
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57089"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:9055; metal ion binding - electron
FT                   carrier activity [PMID 46872]"
FT                   /db_xref="GOA:C1E230"
FT                   /db_xref="InterPro:IPR024934"
FT                   /db_xref="UniProtKB/TrEMBL:C1E230"
FT                   /protein_id="ACO61848.1"
FT                   /translation="MLATRVAPSAVFLRGAAVKSSARPVRVAGRGPVTTQAFFGGFGGG
FT                   VPKANGQPMICIDCGYIYRGDFDALPRDYKCPQCNVGKNRFKVVEQAGSSYANLAAQKK
FT                   ANKAAAAKAKKGKGPSPRELAKQKLLEAQEEKDRKKGGGFFGR"
FT   gene            complement(1007722..1009367)
FT                   /locus_tag="MICPUN_90282"
FT   mRNA            complement(join(1007722..1009015,1009287..1009367))
FT                   /locus_tag="MICPUN_90282"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1007773..1009015,1009287..1009351))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90282"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3924; GTP binding - GTPase activity
FT                   [PMID 5525]"
FT                   /db_xref="GOA:C1E231"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/TrEMBL:C1E231"
FT                   /protein_id="ACO62268.1"
FT                   /translation="MSSSLRRLATTVARAAAPVYQGTSRAAGWRQTTPALWRTARAYDV
FT                   NSRSKEHLNIGTIGHVDHGKTTLTAAITKVLAEIGGAEVVAFDQIDKAPEEKARGITIS
FT                   TSHVEYETDKRHYAHVDCPGHADYVKNMITGAAQMDGGILVVSAADGPMPQTREHILLA
FT                   RQVGVPNLAVFLNKVDMVDDEELIDLVEMELREMLSFYKFDGDNIPIVRGSALHALKGT
FT                   DDKLGKEAILELMKACDAFPSPERVLDKPFSMPVEDVFSIQGRGTVATGRIEQGIVKAG
FT                   EDVELIGIVPTQKTTVTGVEMFKKSLTQGQAGDNCGLLLRGLKRDQVQRGQVLCKPGSI
FT                   TPHKKFEAEIYVLNKDEGGRHTPFFSNYRPQFFMRTADITGTITLPEGTEMVMPGDNIT
FT                   AVFELITPIALEKGLRFALREGGRTVGAGIVSKVLD"
FT   gene            1009645..1011505
FT                   /locus_tag="MICPUN_93725"
FT   mRNA            join(1009645..1009772,1009919..1009987,1010087..1011505)
FT                   /locus_tag="MICPUN_93725"
FT                   /product="predicted protein"
FT   CDS_pept        join(1009931..1009987,1010087..1010779)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93725"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002190"
FT                   /db_xref="InterPro:IPR037445"
FT                   /db_xref="InterPro:IPR041898"
FT                   /db_xref="InterPro:IPR041899"
FT                   /db_xref="UniProtKB/TrEMBL:C1E232"
FT                   /protein_id="ACO61849.1"
FT                   /translation="MSQLESYATQTNVQKLSEEEKHKLVAEVMRYMLFSQYRDGAPVTR
FT                   TKLSEHLSKIAPELKRAKVSSYIVAEAQVKFNEIFGIEMKELSRKAQKKTGAARTNLQA
FT                   SEPTKEYVLKSLLPSKIRRQFIDREEDHTFRGFVMAVVALVSVSGGEIEEQVLWKHLAR
FT                   LGVRHDDEAHPKLGNVRDTLNKLCLQRYLMKEKGVGSDGKDTFRYSLAERAMDELPTEK
FT                   VDKYVTELMRGHNDEDGNAAGENGNTT"
FT   gene            <1011884..>1012333
FT                   /locus_tag="MICPUN_57093"
FT   mRNA            <1011884..>1012333
FT                   /locus_tag="MICPUN_57093"
FT                   /product="predicted protein"
FT   CDS_pept        1011884..1012333
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57093"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:C1E233"
FT                   /protein_id="ACO61850.1"
FT                   /translation="MSSSDVKHLADPSSPGAGRFTFVIKGKPEPWTKFRKRASGEKDVP
FT                   EPENEAYVAYEIRFFIDPYELEPPKRKANTVGVERSNGTMMLWHTYVPESQRGKGIAEI
FT                   IVEEAMEWASANSLSVDSSCSYVNETFMKRPHNRQRWKHIMIRDY"
FT   gene            complement(1012351..>1014201)
FT                   /locus_tag="MICPUN_52280"
FT   mRNA            complement(1012351..>1014201)
FT                   /locus_tag="MICPUN_52280"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1012399..1014201)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52280"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="UniProtKB/TrEMBL:C1E234"
FT                   /protein_id="ACO62269.1"
FT                   /translation="MLKRSEHLKRWKRRWFQADASGDIVEIRGDKAEAKTRSTISLADV
FT                   RSATVSSTNFHGDSDMKGCCVYLELGTPWRAVFLVADSPAKADAFVNDVRMRAGLDQSL
FT                   ATLPRAFTPAVKTKGAVPAMSQEAANALLAPGLTPVRAPATPSPNASRQQPAARTPGSP
FT                   LTVSAIANEASPASSAGSARSGLANDSARTPSTANSGASKKVGVGWFGKPSLASSIASV
FT                   AEQFSKSTDLSQEKMNDMTRMMEGAMRAKDEQLSATNRLLEAECTVAREARGRADALQK
FT                   RLEEKSAQLDRRTQELASEKISASALRMKYDSVRETAEEETARADEAEASLARVRRELD
FT                   DAVRELAETRQKADDTQRALMEEGALLQERHARAVATERELRESLDAAERRGDQLARET
FT                   AELKQRAADLDQDLSNAEDRAVAAADKAAKELEAERKKVAELLHVVRTKRGFLGMFRKT
FT                   PKASALVEHDEARRSARRGRRAAAALPAPPATAPPALRGGDVQQPPSSDFEFRTATHTP
FT                   ADGSEVSDGSFDAANAVLARRMMRDGVWMNTPRHRRVGGPVIANASTPEAAIIRKRLVY
FT                   GAVETCEEVIDALDSPHAQGCRQM"
FT   gene            <1014638..>1015663
FT                   /locus_tag="MICPUN_57095"
FT   mRNA            <1014638..>1015663
FT                   /locus_tag="MICPUN_57095"
FT                   /product="predicted protein"
FT   CDS_pept        1014638..1015663
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57095"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E235"
FT                   /protein_id="ACO61851.1"
FT                   /translation="MGGAEGASVGSRPAPADTGGFGGDVPSTSDGHPPSGERGSKSMTS
FT                   MDFLLRGESVRSNPYLRAFAASGLPEVMMADDNFSSWTNIKGRVLRKEIAEASAAASRI
FT                   PRAVAKARGLPAAAADGTCADDPLGDGDGVVLFDLCSGKGFTSIFLSHRYPKARILMFD
FT                   FDRKMNLKHLPSLAPRVSFHRLNLYDDEVERLVSDAVISHGDRGSCVVGVHLCGDLSRR
FT                   AIELWDRCGVDGLVLSPCCLVRELAEVKRPHGTFGYGMARLAKRTGWNSYRLWCLFLWN
FT                   HIGVIGSDGDDGDVLVRDGDDGDGGRGTRHRRDLNWDDDMISERNAFLCVSRASACVPC
FT                   G"
FT   gene            1017081..1017869
FT                   /locus_tag="MICPUN_107940"
FT   mRNA            1017081..1017869
FT                   /locus_tag="MICPUN_107940"
FT                   /product="predicted protein"
FT   CDS_pept        1017121..1017684
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107940"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E236"
FT                   /protein_id="ACO61852.1"
FT                   /translation="MVASYAGSDDVENNEPSTPEQDKEVAGVAGTTGSRGEERVRNRAH
FT                   EYHHASEDLLESALRLFGQLIEHLPDARDVVSHETMKALMDIHESDRFSREQRSLAEQT
FT                   MQLMGCPTPGSSDDHAPGDLFAEHNEGSREPFMDDDKTVAWTAPMSHATPSKRSREIFE
FT                   YRESSKSEGLLDACLDDLPRATPF"
FT   gene            complement(<1017878..>1018780)
FT                   /locus_tag="MICPUN_57097"
FT   mRNA            complement(<1017878..>1018780)
FT                   /locus_tag="MICPUN_57097"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1017878..1018780)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57097"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR032037"
FT                   /db_xref="UniProtKB/TrEMBL:C1E237"
FT                   /protein_id="ACO62270.1"
FT                   /translation="MKKPEPVVKVDETGPPKAAVAGAVGVAVAVAWRLFISRMRNAGGA
FT                   GRNNAWKTVTADAKEKLAAAGFDIVAPLKLRWYNEIAPDSAKIAPGGAMGEDALVILVG
FT                   NSAALWPVFCDAHNARPEIGDAENPVDTYVDIEVNRVFRGKIRRVFYAHETKPGRLVAV
FT                   QRMAHVAGVAHLDERSHLSIHPTLGPWLAFRAVVVLDDARGPGDGQKPRPPPNPLAFDP
FT                   SARARVDEAFDDALDGYEAPGGPSEGQWRLWVAVRDAVEPGHPARYPEDQVAYHYNCLD
FT                   GRERARIRSRLRGGFEPSD"
FT   gene            complement(<1018977..>1019361)
FT                   /locus_tag="MICPUN_79721"
FT   mRNA            complement(join(<1018977..1019024,1019143..>1019361))
FT                   /locus_tag="MICPUN_79721"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1018977..1019024,1019143..1019361))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79721"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E238"
FT                   /db_xref="InterPro:IPR009846"
FT                   /db_xref="InterPro:IPR017089"
FT                   /db_xref="UniProtKB/TrEMBL:C1E238"
FT                   /protein_id="ACO62271.1"
FT                   /translation="MATAADRFNINSQLEHLQSRYVGTGHADTNRFEWAVNIHRDSYAS
FT                   YYGHHTMLQYFAIAENESIGRVKYNMMQKMLLPCGLPPEREEE"
FT   gene            complement(1021532..1024135)
FT                   /locus_tag="MICPUN_93727"
FT   mRNA            complement(join(1021532..1023529,1023634..1023704,
FT                   1023919..1024135))
FT                   /locus_tag="MICPUN_93727"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1022922..1023529,1023634..1023704,
FT                   1023919..1023950))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93727"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E239"
FT                   /db_xref="InterPro:IPR015257"
FT                   /db_xref="InterPro:IPR038564"
FT                   /db_xref="UniProtKB/TrEMBL:C1E239"
FT                   /protein_id="ACO62272.1"
FT                   /translation="MKYLEDVALSRLNAFLGHVNVGDYVIHGQLDAYSCKLAGVDKKLS
FT                   KSLDAEVVTMMASSPSALSVSPVGPLTDSSSRKTLIYLILTLNHTYPDYDFSALRGHHF
FT                   TKEDQNPGVLKVKQDIDSLLLESGKVYEQTLGAGGVGLSAELWQAVDEVIGLVDCDVYT
FT                   YRAVAEGDPFTDEANLWSFNYFFYSKKLKRILYFSCRAVSKTAEEDSDYDDVPYNGGME
FT                   DSFVDGMDMDEEMY"
FT   gene            <1024367..1025401
FT                   /locus_tag="MICPUN_57101"
FT   mRNA            <1024367..1025401
FT                   /locus_tag="MICPUN_57101"
FT                   /product="Drug/Metabolite transporter superfamily"
FT   CDS_pept        1024367..1025398
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57101"
FT                   /product="Drug/Metabolite transporter superfamily"
FT                   /note="nucleotide-sugar"
FT                   /db_xref="GOA:C1E240"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:C1E240"
FT                   /protein_id="ACO61853.1"
FT                   /translation="MADAEKARSRSRPDEAPIKTTEAQRQYSKVAFAVAAYATCSASML
FT                   IVNKLCITYLPAPTVVLFLQLSFTAVAIRAMTHYGIVDADPLDVEKAKPFVLVALAFLG
FT                   ALYTNVKTLQYANVETFIVFRCSTPCLIAVLDYVFLGRAMPNLKSWASLGAIVCGAVTY
FT                   VSFDADFEVRAYGWVLAWYVVFAFDQIYIKYAVDQSSLSVWGRTYYMNALAVVPVSVMG
FT                   LLSGESSAVSRGGLTREDEAYQWGWAGFCALTASCVAGVVMSYSAMQLRGMISATSFTV
FT                   VGTMCKIATVVVNCLIWDKHASLGGLAALFICLFAGLGYEQSPLRTPQPATTKPATVGS
FT                   DKV"
FT   gene            complement(<1025681..>1026889)
FT                   /locus_tag="MICPUN_66775"
FT   mRNA            complement(<1025681..>1026889)
FT                   /locus_tag="MICPUN_66775"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<1025681..>1026889)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66775"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; ATP binding - nucleic acid
FT                   binding [Evidence 8026; helicase activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1E241"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E241"
FT                   /protein_id="ACO62273.1"
FT                   /translation="ESFADLGLEEALVAATDSMGLTRPTDIQASAIPKILSGGHFLVAS
FT                   HTGSGKTLTYLLPVIQQMKDAERETGARAKPKRPRVLIVGPTRELAEQVRSVAKAVSHH
FT                   CKFSSELIIGGEKFATQRQVLDRSLDVVVGTPGRIIKHCEEGNLFLSNVTHVILDEADT
FT                   LFEAGFGDEVRRLLRPLQKNPEGKQCIVVSATMAEKVAKMVSAELPDLQRIDTPSLHKS
FT                   APNLRHRFVDCPGSVDKMAIVEQIVSGDFRSGKKTMVFCNTMPSCQAVEFSLNEAELPV
FT                   VMYNGDMTAEERKESMREFVEGSHADGTAVVMVCTDLAARGLDFGGGEKGKVDHVVNFD
FT                   FPMNPIDYIHRSGRTARAGATGKVTNLVAKKDRILAQEIDVAVKMGQPLDSATSSKAVV
FT                   EARR"
FT   gene            1029482..1031091
FT                   /locus_tag="MICPUN_107941"
FT   mRNA            1029482..1031091
FT                   /locus_tag="MICPUN_107941"
FT                   /product="p-type ATPase superfamily"
FT   CDS_pept        1029489..1031006
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107941"
FT                   /product="p-type ATPase superfamily"
FT                   /note="copper ion; GO_component: GO:16020 - membrane;
FT                   GO_function: GO:5524; hydrolase activity, acting on acid
FT                   anhydrides, catalyzing transmembrane movement of substances
FT                   - ATP binding [Evidence 3824] [PMID 16820]; GO_process:
FT                   GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E242"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1E242"
FT                   /protein_id="ACO61854.1"
FT                   /translation="MITGESMPVSKSPGDGVIGGTVNRSGMVLVLATGVGADSMLSKVV
FT                   RLIEDAQVAKAPIQAYADKVSAVFVPAIVVIATVTWVTWFSLASAGALPSEWTDVEGEF
FT                   LFSFLFAITVLVIACPCALGLATPTAVMVGTGLGARMGILIKGGAPLETAHAVSHVVFD
FT                   KTGTLTKGQPAVTAVRAFDAIRADEDRLLWLAGSAETGSEHPIGRAIVAAASSGRKLST
FT                   IQDFEAVAGRGLRCRLVEDGSSVLVGNVRFMSENGVDMTPAMLEAVREEEEKGQTVAVV
FT                   HAGVAQGGKPLGLVCVSDPVRPEASAAVAALTGRGVGTSLVSGDNWRVARAIAASVGIR
FT                   HVVAEALPAGKVDAVRDLQREGNKVAVVGDGINDAPAMAQSDLGIAVGAGTDVAMEAAG
FT                   VVLVRSNLLDVVAALDISRVTFRRIRINLFFSLAYNCLGVPIAAGALYPLIHARLPPEV
FT                   AALAMALSSVSVVMSSLSLRYYQPPIGSHRSEVFEPASAVLIEMNRL"
FT   gene            complement(<1031146..>1032927)
FT                   /locus_tag="MICPUN_57104"
FT   mRNA            complement(<1031146..>1032927)
FT                   /locus_tag="MICPUN_57104"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1031146..1032927)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57104"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E243"
FT                   /protein_id="ACO62274.1"
FT                   /translation="MGRVTVAALLLLTLSSASWSGANGAGAVRRALHVMDPFHEHGPVK
FT                   YVVSDLDAAPPRSGSTDNAPSPPQPIDTSVDVPGSGSGNSDDAVHAAKDHLTHTPASVV
FT                   EEKKGDANLDETPHEPKATDAEPADTSAEADDDDVDENIVGQTYPTCAPCDECMVDWVA
FT                   ASKRVSEGTDQCRGTGECRGACDVQLLRINGTYGLKKLSKDRPQTRDLGASAATVMRVE
FT                   TPRGNPFVKFVCVPGLPRHHTVCEKGEEYPKEKRLIQNTESLQKLADFCGLESISSRSW
FT                   IAHVRGRMPAGMPLTPTENHPTPVDVDQLGIFSSPADGIAISALCAGVEGPSLLFDVPA
FT                   YQIVEAALYDFIFCAGDRHTQNVFIDEDSNIKLIDNDNLLGEQVFVPGSFNKSRKCGVS
FT                   SLFIPGTMESWRLRRSKYCRGLLGTLDYRCHAGPSGEVNLKPKLQQCLTHFKKSSANDI
FT                   HAEFGLAELDFAESLKQRATDLLDVGFPAALQRANEFEKTIMFTKAPDNKKPFVGKKWD
FT                   DIPTSSDKDMFAAWRDSMWRPLEPAVCNGLRANWDNAPWDYRTDKSFVGGEEGANGIGI
FT                   ELQRITVEMTRPKTIQP"
FT   gene            <1033032..>1035310
FT                   /locus_tag="MICPUN_57105"
FT   mRNA            join(<1033032..1035236,1035272..>1035310)
FT                   /locus_tag="MICPUN_57105"
FT                   /product="predicted protein"
FT   CDS_pept        join(1033032..1035236,1035272..1035310)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57105"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E244"
FT                   /protein_id="ACO61855.1"
FT                   /translation="MGYIMGSHSPTRRSREEKEQRKSAAKAKIRAIGMVQAAFRRAQQR
FT                   QGAASPEAVNNGEEEPRLTWRERMAERAKEREGLATARGFDETARSSRSFRDPPSEPSS
FT                   KQWHARKLEERAKVERRRKEEARARTRRDTDRRARTSDPFEAELDRMSDAEAMSRLDDI
FT                   PISDLDTDRDSDDDGARSRRTGAAAATDEESDPDDGLAPMERAMARAARARAATRGGDA
FT                   SSGGEAEARVASNVAAPLAPRRHPPPPRTQTAPVPERDPVPERRGGGDVEERAFAAEER
FT                   ARRAEAELADARRRIMELERRVTTAERRAEVAERRSAAGTGSGSGVVSVGAPAEPGLPQ
FT                   GPSWLAPSPADVLERRPDGRPREGTRIEVREEREEEARVAMREEKAEATRRFDPPALEP
FT                   SARADIGRLDLSAVRSDVDDDAPPSRVSSRGDVSARALGGGDGAAVGATGDGSMRHEVS
FT                   RLKKSAKQSLDKERAMVDQLNALRRARDASESRVRDLAKELQEAQMDKQAWGREEDALS
FT                   RRVNTARGGGGYDDGGYAPRQEPSTPRFAPAAAPQRMAATPVVARVRGGDITSGSESDG
FT                   GLTDASVSSARKHGEHPIFQKIRHGRVNEAAAMLSGDGGGAGVDPDVRDRFGNTPLIVA
FT                   AQNNRKRISKMCVKAGVPLSAVNNMGNSALHYCYSYGYFELGEYLVSKGADPRVRNAEG
FT                   KTPRDTLQPEQLRALAQVQHEVQEKLARRGSSRGRSGGSDIRGERRGGRVRLV"
FT   gene            complement(<1035365..>1036216)
FT                   /locus_tag="MICPUN_80159"
FT   mRNA            complement(<1035365..>1036216)
FT                   /locus_tag="MICPUN_80159"
FT                   /product="glycosyltransferase family 77 protein"
FT   CDS_pept        complement(1035365..1036216)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80159"
FT                   /product="glycosyltransferase family 77 protein"
FT                   /note="candidate a-glycosyltransferases"
FT                   /db_xref="GOA:C1E245"
FT                   /db_xref="InterPro:IPR005069"
FT                   /db_xref="UniProtKB/TrEMBL:C1E245"
FT                   /protein_id="ACO62275.1"
FT                   /translation="MICQNTKICWWDGGNILASFLEVTWRRLGVRNLILAVLDDETETY
FT                   MAKHWPDVPTFRSDLKIPDAQQGTHPANKVSTLKYDLLRQLIATGTGVLITDLDLVYVS
FT                   NPFENLHRDADIEGQTDGFSREWAHGKFGGIDDKTMGWGGGGLYAQVFTINVGCMYVRP
FT                   TARSAMLMARVAHRMATEQAWDQQVFNEECMFPAHGEQTSGLVSIRILDYLKFANSKTF
FT                   FRSERNRFIPGDKSAKSDTPIMIHMNYHPDKHKRMLCLIARYHDGKLNACDDFPGGSEP
FT                   GT"
FT   gene            complement(1036653..1037930)
FT                   /locus_tag="MICPUN_107942"
FT   mRNA            complement(join(1036653..1037545,1037740..1037930))
FT                   /locus_tag="MICPUN_107942"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1036742..1037545,1037740..1037868))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107942"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E246"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1E246"
FT                   /protein_id="ACO62276.1"
FT                   /translation="MSASMYGRGGSTCGVDRNALDEISSDISSANIATCTGRVEQYQLQ
FT                   TVIGNGKFSTVWKGVHMPTGKVLAVKKVQIYEIMDTKQRADCVNEVKLLQSFNHPNIIK
FT                   YTDSFIENNELVITLEFCDCGDLGGLVKDRLAAGAFLAEGHVWSIFTQLCTAVSHMHAH
FT                   RVMHRDIKPGNVFLSASGVVKLGDLGLSRYLSSQTAQAKSMVGTPYYMSPECIRGQPYE
FT                   WSSDIWSLGCLLYELAALRNPFHRPGLNYYTLGKLITACEFDPLPEHYSQELKQLVAAM
FT                   LQRDATKRPGLPEITVYADQCRAKFRDVC"
FT   gene            1038468..>1038959
FT                   /locus_tag="MICPUN_57108"
FT   mRNA            1038468..>1038959
FT                   /locus_tag="MICPUN_57108"
FT                   /product="predicted protein"
FT   CDS_pept        1038507..1038959
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57108"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E247"
FT                   /protein_id="ACO61856.1"
FT                   /translation="MALQNTSELDDLRRTMARERLNASWKQVAPEHDSTPTMSYSQEKL
FT                   AYYPPAAGTIPTKFRRNSGEFVKFADRAIQLKENLGGRDTGPSPGKSSPLSKGEGGTGS
FT                   QHGSQQGSRVATPSGGSVTGDLGAAPTPVASPAAAAPPAPEASPAQ"
FT   gene            complement(1038975..1039908)
FT                   /locus_tag="MICPUN_107944"
FT   mRNA            complement(join(1038975..1039638,1039828..1039908))
FT                   /locus_tag="MICPUN_107944"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1039050..1039638,1039828..1039892))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107944"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E248"
FT                   /db_xref="UniProtKB/TrEMBL:C1E248"
FT                   /protein_id="ACO62277.1"
FT                   /translation="MERVRGELKVKATKATPEERERLVTDARPSDGVELEEWSSPRGGA
FT                   GSSTNSPMGSLTDDGLGDTPRASEREPTDAHVSIRDADAGDEARRDAALPLSGINDDGY
FT                   FGDASGQWLNLEPNASITLHASADADPWLEVKEFARVYGAPFVSGILTVVVAVSALIWW
FT                   SESRLAAGERAAEAAAASDSGPGRRLLAGALGEAMSRGAGPGLRAARKLLVVGR"
FT   gene            <1040213..>1041793
FT                   /locus_tag="MICPUN_57110"
FT   mRNA            <1040213..>1041793
FT                   /locus_tag="MICPUN_57110"
FT                   /product="predicted protein"
FT   CDS_pept        1040213..1041793
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57110"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E249"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR012919"
FT                   /db_xref="UniProtKB/TrEMBL:C1E249"
FT                   /protein_id="ACO61857.1"
FT                   /translation="MSPSVNARAPGPARTNPANPLGGGGMPTVQQPSRVIASQAPFTGG
FT                   YTGNRLGRDERSPSARTPKSPRRPKKAGISLGAVALWALVAVVVAMSTSVRTVTIVRGD
FT                   GVRASEKAAKLLAERVSVVGDSVDAMAAALDARGPSTAKRDRETAALRKDLDTLVKQVK
FT                   AQDATIAKVKKQRGGGGAERAAAAPAEVVDHGKDIAALRREVEKLAKQKAPTPAPAPAE
FT                   VGKAELLELRRELLKEIAGVASQAAAAQVNNGAPEVPERVTAELDELRKRLDALASIPY
FT                   PVPDESKADKTDIEDLRREIGKLANEAKGTRRHSKASKEVADEVRAQMELFRADRTGLV
FT                   DYAMFSGGGKVVGHSALASAVAKGDGPLTNALKGLRGGVHPRADEWVISASSEAAGECL
FT                   ALEGTRGWVDLRLREAIVVKAVTVEHVHRDVAYDITSAPKSVKILGWNNTKSPGAGARV
FT                   LGSIRYQLLDGQGGSAMQTFELGGAPGTAVDHVRFEVESNYGNKDWTCLYRLRVHGKPS
FT                   VPPSEPIWD"
FT   gene            complement(<1042022..>1043556)
FT                   /locus_tag="MICPUN_57111"
FT   mRNA            complement(join(<1042022..1042056,1042101..>1043556))
FT                   /locus_tag="MICPUN_57111"
FT                   /product="bile Acid:Na+ symporter family"
FT   CDS_pept        complement(join(1042022..1042056,1042101..1043556))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57111"
FT                   /product="bile Acid:Na+ symporter family"
FT                   /note="sodium ion:bile acid symporter; GO_component:
FT                   GO:16020 - membrane; GO_function: GO:8508 - bile
FT                   acid:sodium symporter activity; GO_process: GO:6814 -
FT                   sodium ion transport"
FT                   /db_xref="GOA:C1E250"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="UniProtKB/TrEMBL:C1E250"
FT                   /protein_id="ACO62278.1"
FT                   /translation="MANVAVSVVSYILLFILISGLAGTVEFHEFKKQFQDKVPIMVGFC
FT                   GQFILLPFLGFCSVMLFGLTELGKEDAQTVVAVNATTGNVTTTVTVPDGGVVGIEAVIL
FT                   MMTTSSPGGSYSNWWCFIFNADLALSVAMTTVSSISSVFMLPLNLAIYLNATNSDSIDI
FT                   EYGPLSIAVAVVVVAVACGLASSHVFPNHRHVFHTSANVAGLSLIALGLVFTTGSRDGL
FT                   FGQPWEFFAGVAMPCVAGLILSNVMSFAVGLNKPQCVSVAIETCYQNTALALSVALASP
FT                   APARAAAVPVFYQAVQMVSLLTYSLFSWKMGWTYAPSNVSVWRMIVTNYQPVFQRESAA
FT                   IKEELEKAKTALKEAQKDHRGMHSPHARSPDNTVKGAGAASSILASVFPSTSANGRKVA
FT                   PQPRTGVEDDMDFSDSPTTPTRPGHSRTKSALGLGLGEIEQEALDKVEKGTSRKGHLHD
FT                   SEADDLITPLRTRVKALEELNIQVARKRQRDVCGEDGE"
FT   gene            complement(<1043909..>1044667)
FT                   /locus_tag="MICPUN_79652"
FT   mRNA            complement(<1043909..>1044667)
FT                   /locus_tag="MICPUN_79652"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1043909..1044667)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79652"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16564 - transcription repressor
FT                   activity; GO_process: GO:6808 - regulation of nitrogen
FT                   utilization"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E251"
FT                   /protein_id="ACO62279.1"
FT                   /translation="MPAVAASLSGPTDGPVLVVGATGNTGRRVVAQLRAKGVAVRAGSR
FT                   DTKKASSLGLAAAGAELVQLDVLDKASIEAAMQGCTAVICATGFTPSLNFKKDNPAKVD
FT                   HEGTDNLVAVATAPGSSVKRFVLVTSLLTNAKAAGQGNNDNYKFLNALGGVLDEKLAAE
FT                   LNLRASGLDYVIVRPGGLSNEAPEAVGNLIVRGEDTTFGLETDPGREISRDTVAAVCVE
FT                   ALFQDAAAKRVVEVVSSPSAPLFPPNKWFA"
FT   gene            complement(1045020..1046577)
FT                   /locus_tag="MICPUN_90289"
FT   mRNA            complement(join(1045020..1045680,1046530..1046577))
FT                   /locus_tag="MICPUN_90289"
FT                   /product="caltractin"
FT   CDS_pept        complement(join(1045186..1045680,1046530..1046532))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90289"
FT                   /product="caltractin"
FT                   /note="Synonym: Centrin Component of flagellar inner arm
FT                   dyneins and basal body/centriole-associated structures;
FT                   GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1E252"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1E252"
FT                   /protein_id="ACO62280.1"
FT                   /translation="MAVGSARRDKGKGRSTGLTEEQKQEIREAFDLFDTDGSGTIDAKE
FT                   LKVAMRALGFEPKKEEIKKMIADIDKDGSGTIDFEEFLTMMTAKMGERDSREEIMKAFR
FT                   LFDDDETGKISFKNLKRVAKELGENMTDEELQEMIDEADRDGDGEVNEEEFFRIMKKTS
FT                   LF"
FT   gene            <1047090..>1049141
FT                   /gene="TOP6B"
FT                   /locus_tag="MICPUN_99582"
FT   mRNA            <1047090..>1049141
FT                   /gene="TOP6B"
FT                   /locus_tag="MICPUN_99582"
FT                   /product="type II DNA topoisomerase VI subunit B"
FT   CDS_pept        1047090..1049141
FT                   /codon_start=1
FT                   /gene="TOP6B"
FT                   /locus_tag="MICPUN_99582"
FT                   /product="type II DNA topoisomerase VI subunit B"
FT                   /note="Type II DNA topoisomerase 6 is composed of subunits
FT                   A and B. Subunit A forms double-strand DNA breaks and
FT                   sub-unit B contains the ATP-binding site; GO_component:
FT                   GO:5694 - chromosome; GO_function: GO:5524; DNA binding -
FT                   ATP binding [Evidence 3918] [PMID 3677]; GO_process:
FT                   GO:6265; DNA unwinding during replication - DNA topological
FT                   change [PMID 6268]"
FT                   /db_xref="GOA:C1E253"
FT                   /db_xref="InterPro:IPR005734"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR015320"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:C1E253"
FT                   /protein_id="ACO61858.1"
FT                   /translation="MPPKSKGAGDKNLKSKSPAEFFQDNKGIAGFENAGKSLYTTLREF
FT                   IENSLDSAESIGVLPDVDIAVEEVTLSQYEDLIGLKAHVRKDSALYADIETDKEKQKRL
FT                   KEEAKAAAKAAKGGKGDAGGGGRKGGAKSFFRITVKDNGKGMAHDDIPNMLGRVLSGTK
FT                   YGVRQTRGKFGLGSKMALIWSKQTTGLPIKITSAQPKSKFTSRYVLDINMEKNEPNVHS
FT                   AEKTPNDSAWHGAELSVIIEGNWTTYRNKVLSYLRQLAIVTPYAQFHFRYESAGGDARQ
FT                   NVDATFRRRTEVMPAPPTTTKHHPSAAKENQLLIKDLLSQTREKTLQAFLNKEFTCISK
FT                   EYAGRLVAELGKGFEPGMSPKEVSDTQGTRIQQLLCDARFADPDGACLSPAGEYNLRLG
FT                   IMKELAPDWIASYVGPALASQGHPLIVEACVSLGGKDVKSGFNVFRFANRIPLLFEAGS
FT                   DVVTRCVQRLNWGSYKIDKNNDKIGVFVSIVSTKIPFKGTSKEYIGDDNTEIAEAVDRA
FT                   IRGCATQLKGKIVRAQAAKERKARKKVLTRYIPDVANAIAIMISASAEAAEPPSKRCKW
FT                   GPGAPSNGGKLWQVDPVFEGKLLEQVRNGDVQRSTIERKLSDFVERMDSEQALEHSMQN
FT                   KEGLSETMHLVPTGPVHKFAPTVHHPTCAFRLLDTLCAGGFLPRGDLK"
FT   gene            complement(1049154..1050384)
FT                   /locus_tag="MICPUN_107947"
FT   mRNA            complement(join(1049154..1049788,1049927..1050003,
FT                   1050177..1050384))
FT                   /locus_tag="MICPUN_107947"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1049199..1049788,1049927..1050003,
FT                   1050177..1050352))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107947"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5839 - proteasome core complex;
FT                   GO_function: GO:4298 - threonine endopeptidase activity;
FT                   GO_process: GO:6511 - ubiquitin-dependent protein catabolic
FT                   process"
FT                   /db_xref="GOA:C1E254"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR016295"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E254"
FT                   /protein_id="ACO62281.1"
FT                   /translation="MIPTRVSHNPIIGPGVVPFGVDPAYDAQYKLNQAPRSHVASHGQG
FT                   KPFTVEPGPHQRTQYPYVTGTTVLGCKYKDGVMIACDTLCCYGSTKRYKSVERIKKVNS
FT                   STIISFTGELSDFHYIVSLLEELDTTDYCEDDGSELAPWEIHSYLCRVMYNRRNKFDPL
FT                   WNSLVVAGVKHGRTFLGTVGMIGQHYEDSHLAAGFGNHMARPLFREKHTDDMSEEDARK
FT                   LMEDCLRACLMRDKTMMNKFQIAKVTAGGLEISEPFQVPMNWGYEKFKDPTKHAVGAW"
FT   gene            <1050504..>1052006
FT                   /locus_tag="MICPUN_99583"
FT   mRNA            <1050504..>1052006
FT                   /locus_tag="MICPUN_99583"
FT                   /product="predicted protein"
FT   CDS_pept        1050504..1052006
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99583"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013894"
FT                   /db_xref="InterPro:IPR033472"
FT                   /db_xref="InterPro:IPR042470"
FT                   /db_xref="UniProtKB/TrEMBL:C1E255"
FT                   /protein_id="ACO61859.1"
FT                   /translation="MGAEEAVRALLDTEGWSLRDGAILAASQRARGDPAAARATVLDAD
FT                   LRAVGKPSLPRWAYGGAREAGAGVTGPMVLQVMDARDISSPKRASGSSGRRMLRLDLTD
FT                   GDATVVAVEYRELTSVEDASALAPGTKVAVPPGVRIRCQSGILLAHGDALRVLGGKVAA
FT                   LAEEWEGVRAVAETGDAEQTGTDAPRFETYDREKAEATVAAAVAGRAAANKAAAEAIAE
FT                   KRTASTSTSTSTASPAPETERGEEPAPFVPRRRPALPPTRAQRAAAQAAGVKLPPPGAP
FT                   MPSTPEETATGRTVEPEGAPATSPGRSHIAQEVKESIPKEVKEAIPSPPPGFRARAAPE
FT                   EEATAPVDPPPAPAPAFAPTVTEEDRRSRLLSRFASDSREGRGSRDRGREDRGRGDRDH
FT                   GRGDRDRGRGGRGGRREGERRGGGGRRGGDEERDDGFRTLDRTASGSRTEDDEALARQL
FT                   QRDLELEDSGYVATDAAALAASLFSFPAREQEREDSGRRGRR"
FT   gene            complement(<1052102..>1053275)
FT                   /locus_tag="MICPUN_57117"
FT   mRNA            complement(join(<1052102..1052941,1052994..>1053275))
FT                   /locus_tag="MICPUN_57117"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1052102..1052941,1052994..1053275))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57117"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR040235"
FT                   /db_xref="UniProtKB/TrEMBL:C1E256"
FT                   /protein_id="ACO62282.1"
FT                   /translation="MSADPLEPNPASAPLRPFGESPIPTRRGGFAGHPPEVAALGPTRG
FT                   ARGGPKDTRHIPGEAILSAGSRRRDVQWPACQPASVNPWIIVMTHSTSQIRIGGVARGM
FT                   ATAEAFSRLRVSDEREGPSSSSRPFGFSAGVQEPTQVRLAVGTVEFFPFPVQTAEGRPI
FT                   PSRRIVDAKVEGRPERVRFIAFRNHYSSCVTVKARVAGSGGASGPWQTVLTTYKLMRSP
FT                   HFEDDAEDWKVIELPDRTRNGLELDRVTELRLYLFQPSAMFNGAHYGIRSLAAYSDGNK
FT                   ESCLRAAYRAHLPTEATAKEDSAGEPSLEALIPGIDLEAATGGDGAGGIPVDELEGVVA
FT                   SAVDLARALRDVYRTRGQTEDPVPKGFRQAFDN"
FT   gene            <1053481..>1054806
FT                   /locus_tag="MICPUN_57118"
FT   mRNA            <1053481..>1054806
FT                   /locus_tag="MICPUN_57118"
FT                   /product="major facilitator superfamily"
FT   CDS_pept        1053481..1054806
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57118"
FT                   /product="major facilitator superfamily"
FT                   /note="oxalate:formate antiporter"
FT                   /db_xref="GOA:C1E257"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:C1E257"
FT                   /protein_id="ACO61860.1"
FT                   /translation="MDDDSDQNSGRPKRSAAAFLGAFLLNVLLGTLYCWSCYLVPLEQA
FT                   LGVGRGLLSGVFSLATICFTVAVAKLGPWLYAVAAPAVIGTGAAVCAGAGLLIASQSIA
FT                   YVSAAPLFLGYGVVFGAASGVGYGLSVQMASRAPFGEGLSTGLITSARAAGAFVFAPVV
FT                   RYLLDGGGAGRAMSTMGCALLASAPFIYGVLATDGTKHPLASQKRDKDLPMTTEEEERE
FT                   RQLGPAMFALWISLGLGVSAGLMLMAHASALLYSHGASIGVATAGVSIVSVFTTAGRIF
FT                   GGWACDRSGVGAERVLRWAPFVAVPALAGAAVAANSVAAAQAALAAASIVYGVFASVIP
FT                   VEVRRRTGSRDFARQFGKVYTAWGFAGLAAPVAAGCLFEARGDYTAALVAATALCILSA
FT                   MVVRWMLKPGRSHEEWKEAIAEAKRAKAEEDAANGISQVIAP"
FT   gene            complement(<1055027..>1056127)
FT                   /locus_tag="MICPUN_99585"
FT   mRNA            complement(join(<1055027..1055520,1055690..1055892,
FT                   1056117..>1056127))
FT                   /locus_tag="MICPUN_99585"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1055027..1055520,1055690..1055892,
FT                   1056117..1056127))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99585"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR024286"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:C1E258"
FT                   /protein_id="ACO62283.1"
FT                   /translation="MSSRNRDDVEEIVLGGGANGITFVDGPRTSVELVGDVAVYFSGTL
FT                   NEELSNDSESCAHEIWRRYNNRQQYPNGAIDLGPLSGEFSMIIFDKLAGCILAARDSSG
FT                   AVPLYWGTSNFGECLLFSSDPRLLEESCADADAFPTGTLFVSKCGEISGDLNMLVSDEW
FT                   AEGEEDLKEEEEEPDYLVKEDEARAAFHSPFGHRGFGSGSTALKRSWQNLVPSESPHGS
FT                   ELSLENLQQQPVA"
FT   gene            <1057487..>1058707
FT                   /locus_tag="MICPUN_75328"
FT   mRNA            join(<1057487..1057838,1057890..>1058707)
FT                   /locus_tag="MICPUN_75328"
FT                   /product="predicted protein"
FT   CDS_pept        join(<1057487..1057838,1057890..>1058707)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_75328"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; ATP binding - nucleic acid
FT                   binding [Evidence 8026; helicase activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1E259"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E259"
FT                   /protein_id="ACO61861.1"
FT                   /translation="LSKYYGHADFRPGQLEVVAATVQGRDSCVYWSTGSGKSLCYQLPA
FT                   LHTGKTSLVVSPLISLMNDQVTHMNNTAGADEGDLAAFLGSSQTDKSVEERALRGDFRV
FT                   VYVTPEKLVGDIDDMARDGKLGLVAVDEAHCLSQWGHDFRKSYRGLTLIRTQLSPNGEV
FT                   PVMALTATAVEKVREDIKDVLALKRPHVARNSCDRTNLRILVSKKRGGAADHLHIYERC
FT                   RDAKGSVVVYCVTKRDAEDIATVLKNKFATQNIAAGVEVYHAGLAMSRRDATHKGFLTG
FT                   SVKVVVATVAFGMGIDKPDIRLVMHYGAPKTMEEYYQQVGRAGRDGLPSDVEMIYGDGD
FT                   FSRYSDEFYVGKLDAAARKTQKESTDALERFSRSREVCRRASILAHFGES"
FT   gene            complement(<1060360..>1060975)
FT                   /locus_tag="MICPUN_57121"
FT   mRNA            complement(join(<1060360..1060783,1060899..>1060975))
FT                   /locus_tag="MICPUN_57121"
FT                   /product="flagellar associated protein"
FT   CDS_pept        complement(join(1060360..1060783,1060899..1060975))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57121"
FT                   /product="flagellar associated protein"
FT                   /db_xref="GOA:C1E260"
FT                   /db_xref="UniProtKB/TrEMBL:C1E260"
FT                   /protein_id="ACO62284.1"
FT                   /translation="MDVARAAWFDSAVNQQKTELFNKEDKWAAVGMRQDYAKELADLER
FT                   EEAEAKAAAEAAAADATQEGEEEWVGGRETVDPSTLSQWERDNRMTNQIGANMWRTCNP
FT                   AYDARSMNTTSVTKAEFTYDPEEIEPVDKTHFRRRDKFTFYVEAAAKSHNLAKASAKEA
FT                   AAE"
FT   gene            <1061125..>1061421
FT                   /locus_tag="MICPUN_57122"
FT   mRNA            <1061125..>1061421
FT                   /locus_tag="MICPUN_57122"
FT                   /product="predicted protein"
FT   CDS_pept        1061125..1061421
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57122"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E261"
FT                   /protein_id="ACO61862.1"
FT                   /translation="MTTPTIAPVALSFGSTGGVSSVGAPPAKTTGGIAGRDGRAPLDET
FT                   TMVALADDIGAREEKLGETRGAVRRETLEQLRQLEKDIEEDAWMYAKPRHSEP"
FT   gene            complement(<1061505..>1066250)
FT                   /locus_tag="MICPUN_99587"
FT   mRNA            complement(<1061505..>1066250)
FT                   /locus_tag="MICPUN_99587"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1061505..1066250)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99587"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5875 - microtubule associated
FT                   complex; GO_function: GO:3777; ATP binding - microtubule
FT                   motor activity [PMID 5524]; GO_process: GO:7018 -
FT                   microtubule-based movement"
FT                   /db_xref="GOA:C1E262"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C1E262"
FT                   /protein_id="ACO62285.1"
FT                   /translation="MTLPRGDGEVVSNTRVAVRVRPMTNIERDLGAGRCLNISGGNRVA
FT                   CSDARTWNSEDFTFDHAWELDETQEEVYAAIGEPALRAAWDGYDVGVMAYGQTGTGKTY
FT                   TLWGDDRGRDDRGRVDDIAFDHDAGLIPRIGADLFARVERERAGAVVGGSGTGAEVRVE
FT                   MSAFEIHCELARDLLAPVSSERDKDDRGDHDLEVAKDGSVHGLTARPVASRKQFEGFLA
FT                   EATRRRAGSAWRRSHVVVRLVLTRFPRGGSGGAPVSSSSAPVSSSGVATAALRDAPPAV
FT                   SRLTLVDAAGSERSAAGADSPVNRSTSALRRCVDALAARARSGEAVASIRAITAEDDDD
FT                   DVGGAPDDAGRDEAALTRVFRESLGGNARSFLVATVSPSDDDHAETLDTLRFAASMRLI
FT                   RCRTIVNVDPDARRVTALKREVAESARVLEALKKDLSLARVRQTGGAGSRPGSAAGQRQ
FT                   GAGAFGPTRPKSALTKPARDEPAGRDPLDIRKEMRNARTNLELSEKRLKAAEGRWNTKV
FT                   RGYDKQRAIHKADVSTMRPTVDVSQNDDETRWMPRLVRLHEDPSLTGSIWHVLRTGTTR
FT                   IGAGNECELRVWGLGVKASHCTVNVRVAPLDRSLDGAAVRNSARVVVPNLGEAAVFVNG
FT                   EKVDQPNGVELSHGDRICVGLNSGVIFRYDDPASVSGGEGREMRGADWVSAQAELRREV
FT                   ALTLMSEAPSPPTAREGEAEGGGGARGERRRRWRAALQRRVVYLLALVDEANERCVEMR
FT                   LDVNFRARFGGGTMGAPPSVASNNPAAPLLEVTMMRGEDDPWGERARGGRQILPLHEGD
FT                   FADRALLIRHLHSKWRRSGRALGPLAAVVTAMKKGDIGADPLHVLDEIGMRMFCLADAC
FT                   PAAAKHAAEAENKPRVRKAPETKEAATPAAAKHGPGKAWGTPGTITRSPDDGGVAARAI
FT                   ANPSTPSVPGISGDEEIDPMTPAAVRRERSLRLAAEQKLRELMSAAEEAAVALVSEKKL
FT                   VLAAEKRARAAEAKLEKAVDLGGELQHTAQRLAAEKKTLENAPKPVDTSHLAGKALAVA
FT                   EQLKEQLKAAEERAAAAEEAIKTQAKEIKAKYKAKAEKAAEECREAVAEAEAKVKRAEA
FT                   TIREVEAKCREEVEAAEERARTCSLPLPPNTGPLGEPLQVIPQGGNENQDTYTRASNYA
FT                   AQADEVAARITGITPYYPPRPPTPPEEKNLPGETDFECARRLKAAMQELRVKLWTVGDR
FT                   NLFLEKCMPLCNQEMMLWKAQCLEKHADVVACETAIQEMEQAIAEKDGLIKQMRKQLKA
FT                   WERAERGEFGGDGSSNDDDDEDGEGKPPKKMTEEEMLKELEQFDEAFKGITFADIRKQA
FT                   NLFGEELGLAPIPDPTPPAEEMEELRPTPEKFDKKATPMVPRMRLPGDAKPPSPVPRPV
FT                   KKSSAADPFAPVPVSHKKTAPPRTPELQDEEDLDDKMYGDELEPTRKDESYPGEDKDGK
FT                   MLPDFLFAESGKENAAPGSNSRTPKRWDNLRRNFEESEHRKEDRWDRLRRNLEEAEVDP
FT                   SLLEGGGESDDGEFDFDNRRGSAVGGVFSPQEPARPTSNKYNVGSSRKKGKKRGKKTCT
FT                   IS"
FT   gene            complement(<1066437..>1066835)
FT                   /locus_tag="MICPUN_80305"
FT   mRNA            complement(<1066437..>1066835)
FT                   /locus_tag="MICPUN_80305"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1066437..1066835)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80305"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E263"
FT                   /db_xref="InterPro:IPR007741"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR039927"
FT                   /db_xref="UniProtKB/TrEMBL:C1E263"
FT                   /protein_id="ACO62286.1"
FT                   /translation="MSIRGVYQLMRLELKYCDHSGSSRHLRNFLENHLKTLREEWSHLD
FT                   ITTTVRRGRHPHVTGTYRNGRQKTVDLKNKEEEKIRYHLNFLFTEKGRKSSTKLPGSRR
FT                   ITDTPSIQGRWRPGMWDTPTKSAGAAAS"
FT   gene            complement(<1067080..>1067685)
FT                   /locus_tag="MICPUN_57125"
FT   mRNA            complement(<1067080..>1067685)
FT                   /locus_tag="MICPUN_57125"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1067080..1067685)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57125"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E264"
FT                   /protein_id="ACO62287.1"
FT                   /translation="MPATAGRVPMPAGNRVVTGNALKVSDRWSSIVGSDPYASEKKEDG
FT                   DVMEKLWADQRLHGNKRKIGTDERGMPIFEMLNGAEKREKRKGDAMAAREREYQLMQEK
FT                   KRRMDEVRAAEQELAEASHKASKKHKKDKKDKKDKKKKKKKDKKEKKEKKKKHKKEKKS
FT                   RRDRSSSDSSSDSSSDDESDTEDSTEKFRLSGFFKSKE"
FT   gene            1068440..1070686
FT                   /locus_tag="MICPUN_90296"
FT   mRNA            join(1068440..1068673,1069592..1070686)
FT                   /locus_tag="MICPUN_90296"
FT                   /product="predicted protein"
FT   CDS_pept        join(1068557..1068673,1069592..1070614)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90296"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8234 - cysteine-type peptidase
FT                   activity; GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1E265"
FT                   /db_xref="InterPro:IPR000668"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="InterPro:IPR039417"
FT                   /db_xref="UniProtKB/TrEMBL:C1E265"
FT                   /protein_id="ACO61863.1"
FT                   /translation="MKMGVTRFADLTEEEFSKHHGKGFNAMDKEKEKGGGDEGKALPKD
FT                   IDLPKTLDWRQKMDIGPLYSQGACSGCWAYSTVQVIADSKLIGTGHRPSPSPYYLLSCD
FT                   ELDSGCNTGNMATAYAWIQVQQHGILSVEDFPTASDRCMEAESNEKAKGVTIDGFCEIP
FT                   PLRGAETVYALLRALYQQPVAIGMNVKPLQLYGGGLVTMEDCPPASSDQINAINHAAVV
FT                   VGWGEDEESGKPYFLIKNSYGQDWGENGYARLEMAYDGDSMYGACGMFAEQNYPLTDGR
FT                   DCTEGSEKKWSELRGDDVYLMPDNVVILPDGGGILTPARIKVFGYDLTAILKTASFVCF
FT                   ALCVFFLGIEIYYCFVPEQDGDTPRTPAPSHLHYGAAGK"
FT   gene            complement(<1070683..>1071519)
FT                   /locus_tag="MICPUN_70635"
FT   mRNA            complement(join(<1070683..1071288,1071367..>1071519))
FT                   /locus_tag="MICPUN_70635"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1070683..1071288,1071367..>1071519))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70635"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8168 - methyltransferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1E266"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E266"
FT                   /protein_id="ACO62288.1"
FT                   /translation="ETAKFEADAALWWDEERGPFAPLHAMNPTRVGFIREALARHFDGG
FT                   IEPGTGPLAGLRILDVGCGGGILCESLARLGADVTGIDAAKGNIAIATAHAAKDPGMSR
FT                   RVTYHATTAEEVAAAGAKFDAVVSLEVVEHVNDPEGFVRQLEALTNPGGAVFMSTVNRT
FT                   ARSYALAIVAAERVLRWVPPGTHEFDKFMTPEELAAVAHRAGLEVREAAGMVYTPPLPA
FT                   PGRNGAVAGRWTLSGDDLAVNYIVYLSKPK"
FT   gene            <1071910..>1073370
FT                   /locus_tag="MICPUN_99590"
FT   mRNA            <1071910..>1073370
FT                   /locus_tag="MICPUN_99590"
FT                   /product="predicted protein"
FT   CDS_pept        1071910..1073370
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99590"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E267"
FT                   /protein_id="ACO61864.1"
FT                   /translation="MAWGKTVGVASWVDRLKADDQTLTSVTVFRGRLFGPAEAAEVCDA
FT                   LRSNTALREFYASGHAMDVDTAGKFSDMLAVNETIESICIGDASFGDDGVAALARGIAS
FT                   SASLRAVDLENKGMGDEGARALGAALAKSKVIELNVSRNVALTDAGLAAVCLGAAAGRT
FT                   VTSLRVAGLSVGPKSAAAVSKLLASSGGSLRRMDATDAQMDPDGIVALGVALRDDGGEG
FT                   SGSLDELVLDGTQLGDDGATALAGGARGREGDEGGGMGVLSISMQVCGIGEAGVSAIAS
FT                   TPRASREVLVKTLNLRGNEAGDVGANALAAAIAGEGPAGGESAFSALETLDVGANRLGA
FT                   AGAVELIRHSGPVENLSLFGNEAVGDNGAVAMVDEVRTGAGGRRLRVLDIGGCGIGEEG
FT                   MTTLCDALIDHPTEVFPVLETLVVGGNPGAVGDAWEAALEKLRQARPTLDVAWRAADAG
FT                   DSQEQHQQKNKLLEQYKQQQELPPPSTP"
FT   gene            complement(<1073532..>1076071)
FT                   /locus_tag="MICPUN_57129"
FT   mRNA            complement(join(<1073532..1073626,1073770..>1076071))
FT                   /locus_tag="MICPUN_57129"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1073532..1073626,1073770..1076071))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57129"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E268"
FT                   /protein_id="ACO62289.1"
FT                   /translation="MREACSRKEEESDAFRRGVHARGSIVCTGKMREACSRKEEESDAF
FT                   RRGVHARGSIALFSVALLWCSSLSSCGAIVDMVLPAPVSWSSVREMLNSTLVATRRAEA
FT                   EYANCATRQGDACMRRLEEGRRVELSRASYKESRNNNMVEVSQATARLCASMERGIVST
FT                   LRSLDTDQISWRVSCSDEDRAEVRARIRLPEDALTPVSEAYRWNSESRLNRTLGLLEER
FT                   TTYDTEYVRNRTAFLGAVTVDVNLNVTESVTAMAQRLSENVGSMDVAAGANIVAMALGA
FT                   ANRLEEVREMSLEVMSAYVGTVVDYVGEVTDRMAKIGAWFEAFNGLGAVLDTINIGMTP
FT                   SVTPPLPPALQIGEIPGVPPDVSRMIRDLGESASAMSAEISRIADDVRVDLAADASVIP
FT                   RAVSEIMKGVPTVFDDYDPPPRGNNANFTEVVRDDAMADGDAFENKTAELVTSFENERI
FT                   RVVEEKAAEALSRVNASDPVTVAATRAADIRAKLGAAADSAAEVDWLGVSPPDFAAFST
FT                   ASDALDAVIDGLVAADMAYRFARSFQHIARHLSPAGAVLPPVDLTRGVSARQEKKSTLV
FT                   KIAGALGHPACMAAVRAVAASLAIALIAVAYLPFLASFRGGCISGCDGTFASRNLHSLA
FT                   HNYAAAGGSRRLSQELAAASTERRDICARHAPAAAARYEAARLDVEVANTTRATSTHSA
FT                   ELFIKCVDPSEFTLDVATFQTACRDGEELTNAASLDPFAVFDCDQLPKCEATCIGPVRR
FT                   VLAPLAHSSACAAEGKSASGWHHVEARNIGTTGETGGTGEAQKCR"
FT   gene            <1076217..>1078502
FT                   /locus_tag="MICPUN_57130"
FT   mRNA            <1076217..>1078502
FT                   /locus_tag="MICPUN_57130"
FT                   /product="inward rectifier K+ channel family transporter"
FT   CDS_pept        1076217..1078502
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57130"
FT                   /product="inward rectifier K+ channel family transporter"
FT                   /note="inward rectifier potassium ion channel"
FT                   /db_xref="GOA:C1E269"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016449"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041647"
FT                   /db_xref="UniProtKB/TrEMBL:C1E269"
FT                   /protein_id="ACO61865.1"
FT                   /translation="MSAPVTENVTDGRHPSLRSSLRRDSSGASSLSLKTGSLSGWDAIR
FT                   ASLSSQNNRSLRGGLPRKHKSSKRLRESSTKAVKDARGGAAVKSRSSLGFSASAIYFLV
FT                   LERTWWYCALVIAGVFALSLGVCALLCMAVGGFHDPLDSTATAPLRFAASHVLTMSFGT
FT                   VTPVTDASYALAVTQCFLGVLLNVFMFTFVITKFQRPLAHMLLADSACLCTRAGEPFIL
FT                   VRIGNLRCNTLHRAEVTLTLLRRKRTPEGETFVSRTTLSLQEPPRTLTAVATVAHKILP
FT                   QGPGGVFMDLATGRKTSEELKDLLLQCIVTAYDPIYDAEVCAVKVYGAHDFARGCVYAD
FT                   VMSIDEKGEAVVDFERIHDVLPQKIKIFPPLKDSWEGPDMNRPARMLEVVFGGGRACYG
FT                   SKDETFPTLGPLTAMEQTCSYCYKLALLLNEAGMDYIPYIANISLGDDKPDWLEACNPK
FT                   KETPVVRLQGRTEWIAGSDVIISTLAEIDERVRAVVERRREDVNEGHEQVVKKALMSVL
FT                   GGVMFGPTVGLKRAVKIGGVGVMLLKMVGLVTPDIEKEVEEEMKKQMEQKEAESEASSD
FT                   DIVVDVDNVDEGLNVRSLVQTCVSEAFDTIERLIACSHGDEGRMFLCGKAPGVMDFGAA
FT                   VDLAFFFQPSFEVFLAKHDIRFRAGPNCRAWHARMTSLPHWRSGMGAGHSDGSAAAMKT
FT                   IITKLVLWSKDPGYPERAASEELLRSTMRDFPPAYIEDTGKEELRSDDVDVVIGGTGLD
FT                   SATAKLCV"
FT   gene            <1078801..>1079652
FT                   /locus_tag="MICPUN_79899"
FT   mRNA            <1078801..>1079652
FT                   /locus_tag="MICPUN_79899"
FT                   /product="predicted protein"
FT   CDS_pept        1078801..>1079652
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79899"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; zinc ion binding - nucleic
FT                   acid binding [PMID 8270]"
FT                   /db_xref="GOA:C1E270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C1E270"
FT                   /protein_id="ACO61866.1"
FT                   /translation="MPPKLSLADQKKKLKEKAQRAKDQEKREKDKERAERKAQEQKDRI
FT                   FGLKNKHTSKHAQQFVQDVERNMKQLPGEQQKAEAKKRENDKRKAAEEQAQRELDEMMG
FT                   LAIKQPKVPEGVDPKTIPCEFFKKGRCAKGWKCKFSHEKNTRKGTEKIDLFVDHRDDAE
FT                   KEKDSDKMDDWDQDKLESVVKEKHSGENQNNKTDIVCKHFLEAVEKRLYGWFWVCPNGG
FT                   NECKYRHALPPGYVLKSQLKAMMEEEKASQRTDEEILEEERAKIGEGVPVTQDTFAEWK
FT                   RAR"
FT   gene            complement(1082189..>1085330)
FT                   /locus_tag="MICPUN_93739"
FT   mRNA            complement(join(1082189..1083407,1083483..1084046,
FT                   1084182..>1085330))
FT                   /locus_tag="MICPUN_93739"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1082565..1083407,1083483..1084046,
FT                   1084182..1085330))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93739"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR033551"
FT                   /db_xref="UniProtKB/TrEMBL:C1E271"
FT                   /protein_id="ACO62290.1"
FT                   /translation="MGIEASALPDHTYWDVLKLANVLDLHELEIDSEDDRPVNQKKIRV
FT                   EHTTISAGKDLPSAVRQGFVSISGAEARMLEHVRDFHAQYVEYYPDRFHLLLDPPNECG
FT                   VRKFVCTTVRPSKLSFTELYDLEPCARFIADYLEYEPLENPIMPPESIPSPYTVLGTWK
FT                   AGDSFDFSIALCSLLIGVGYDAYVCMGYAPKEITENDQTRDTCPLLEREAAAAAAAAED
FT                   ALKTPQKKKAAPSKYKIKEPTDLTCKIDEMLLAEEVAKMTPPESKESEAPEKSLTQRPN
FT                   LATAEDKYNGRRVHAWVLVRAGSREMAETVFIEPTTARKYPIDASPYLGLEYLWNHSNF
FT                   WVNIQPGTIRQVPAIKNLDTNLKDTTKWEPVRAGVEEIEIPVVSMTDPEDVNEEGDVSI
FT                   SPEIDVEPTLEMPASWVPKMVIAQEDFDTTCPRGHKTTRYHRCIHELFAVFGPCSRWDG
FT                   LVEKLCTFSDDACKNKSEERETFRRRKDKLCERIVRHSDETKIERFEHGSAYGIKEIRE
FT                   IPDVERKTHFYVSSRAADQLETRYEVFGKRLTETFSGRDDHMVYRSIVYDPEGTRRPKK
FT                   VKFEEPPPVIAKMTQKFELPVNSAVPPHQCVSKRVFDIANESIRVDYHYGSGFITTTQK
FT                   WFYKDGTSSITLVNPKDPKPTEIEIQEEFHALCVTEKSIASEIRDVEREIKDIVMNRAK
FT                   EEMAIDLLSPYFDISRIKTAEESDDEEEAEQDAGFDYLEPYMPPIIPGHDLTVSEAAEA
FT                   KEGCLTALKERLIDRANIIKGRLDREDAALVKRRNAFERDRDVMTPAEEEEFNRACEES
FT                   TFRINILNQRLERHEEISKRRFLELDAKLRADPRLAALL"
FT   gene            complement(<1085778..>1086320)
FT                   /locus_tag="MICPUN_70619"
FT   mRNA            complement(<1085778..>1086320)
FT                   /locus_tag="MICPUN_70619"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<1085778..1086320)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70619"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:C1E272"
FT                   /protein_id="ACO62291.1"
FT                   /translation="MKLEDEGPLLRSRHSTTCGANHMYVFGGLLSHKGCKTNELFVTNL
FT                   DRMVWMKKNPGGERPVERDGHCAVFDSNRKKLLVFGGRDAEKKRLNDLFQYDPETDRWT
FT                   RLSPDGEQPAPRESASMAQLDEDTLVLFGGKGAGARFNDLWFLDLKRMEWTQAATKGDA
FT                   PSPRQDAAICACDGKIYL"
FT   gene            complement(<1086465..>1087127)
FT                   /locus_tag="MICPUN_79689"
FT   mRNA            complement(<1086465..>1087127)
FT                   /locus_tag="MICPUN_79689"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<1086465..1087127)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79689"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E273"
FT                   /protein_id="ACO62292.1"
FT                   /translation="MTTSGVLDDEALQLALKDASVKGKLSLAYLDLTEITSEQATRVRA
FT                   GAPNITELDLRSNNLTDLPDELGDLKALRVIKLDYNKLEHLPAMLTKLPRLTNLQMGGN
FT                   LLSTVDASVAELRALTDLDLSGNRLITVDPAIARCEKLVYLNLENNMLTALPPEIGSME
FT                   NLCVLDLSNCQLATLPDTVSGLVSLTRLEVNNNMLKTLPPSMGRLENLKDLDCRYNLL"
FT   gene            1087493..>1088463
FT                   /locus_tag="MICPUN_93744"
FT   mRNA            join(1087493..1087537,1087700..1087935,1088143..>1088463)
FT                   /locus_tag="MICPUN_93744"
FT                   /product="predicted protein"
FT   CDS_pept        join(1087510..1087537,1087700..1087935,1088143..1088463)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93744"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:19843; RNA binding - rRNA binding [PMID 3723]"
FT                   /db_xref="GOA:C1E274"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005710"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C1E274"
FT                   /protein_id="ACO61867.1"
FT                   /translation="MPSTTFYRSYSKTFKKPRRPFEKERLDSELKIVGEYGLRNKRELW
FT                   RVQFALNKLRNAARVLLTLDEKDPKRIFEGEAIMRRMYRYGLLDESQDKLDYVLALTPE
FT                   IFLERRLQTIVFKLGLAKSVHHARVLIKQRHIRVGKQIVNIPSFLVRADSQKHIDYSLN
FT                   SPLGGGRPGRVKRKRMAAAGGGGGDGEEEDE"
FT   gene            complement(<1088627..>1089743)
FT                   /locus_tag="MICPUN_99594"
FT   mRNA            complement(join(<1088627..1089538,1089630..>1089743))
FT                   /locus_tag="MICPUN_99594"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1088627..1089538,1089630..1089743))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99594"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; hydrolase activity - protein
FT                   binding [PMID 16787]; GO_process: GO:290 -
FT                   deadenylation-dependent decapping"
FT                   /db_xref="GOA:C1E275"
FT                   /db_xref="InterPro:IPR008594"
FT                   /db_xref="InterPro:IPR036265"
FT                   /db_xref="UniProtKB/TrEMBL:C1E275"
FT                   /protein_id="ACO62293.1"
FT                   /translation="MASEDESALLPHKLPSLRGLKVDRVLNDGKESGVVALLGTFAGCS
FT                   TQAVVKLSRPPIPVGDPDALSRAISLSERAPWSGMEYGYYHGALDPLFAPGLSVDVLYP
FT                   GCLYDESEEAREKLLKKHISRNTAQAPVAFRETVEAYENAHVPYIRAIPEGAVGWVYKI
FT                   LALEKETERLLFNDPTEDAGFLLNTDPKWTTHPDHNTTPKAAWKGHASTRDLYCLGLCH
FT                   RRDVKSLRDLRREHLPMLRAMAETGRRVIRDTYGLEDHSVRVFVHYPPQFYHFHVHYTN
FT                   VAVDIGVQTERAHLLDDVIDNIERDSEHYAKCAITGRMGENDELWRRYREWRANSDAGS
FT                   T"
FT   gene            complement(1089845..>1090648)
FT                   /locus_tag="MICPUN_52299"
FT   mRNA            complement(join(1089845..1090342,1090497..>1090648))
FT                   /locus_tag="MICPUN_52299"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1090009..1090342,1090497..1090648))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52299"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E276"
FT                   /db_xref="UniProtKB/TrEMBL:C1E276"
FT                   /protein_id="ACO62294.1"
FT                   /translation="MPAIASSPAVALLRAPLASRAARKAPAGGTSQIRPAARPASLGRG
FT                   RSVTVRASAPVDSVVSGVNQAVPQVADIFGIDTSAADTLFVNAASIILPAWGAIVGAIF
FT                   VFGTVYKIAFPDKYNEQVYSGKAAEMVQDEIIDLDNLSEDDLAAVAELEAERAAQKQ"
FT   gene            complement(<1093932..>1096277)
FT                   /locus_tag="MICPUN_57138"
FT   mRNA            complement(<1093932..>1096277)
FT                   /locus_tag="MICPUN_57138"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1093932..1096277)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57138"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E277"
FT                   /db_xref="InterPro:IPR015324"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E277"
FT                   /protein_id="ACO62295.1"
FT                   /translation="MYRRVCRTVSLVSGVVNGCALRQPSAPAAASLRRLSDDAVSPIDR
FT                   LEAPDDFAPGDGPPLLPVALRMADDIAELLSGDDGDVLIAGVHGLSARNRGIVELPGKL
FT                   DRAVRVAVRDTGATHRQVKAKGRSLLEALKSISRGLVPVDDDDHSGKVKAWLKEGKTAG
FT                   EFSSEDSEVSGAHFLGEGTEWGARLSVRKQKRLFESLENEESMARGKGKKKPPVRSEAA
FT                   TNYGPLEAAAYAVTRLPMTFGAQVRVMQELRVRAPGFMPVSLLDFGAGPTPALWAAREV
FT                   FGNSISLGSTGGTTSVTLVDASPSMMAFTRRLARWVYDDTEVHELGSGMGFLARPSGRP
FT                   LPDPNPWGITGPVQTVASLRSLNPHATFDMVVSGYSLGEIATGTRHEQQQRILRGDGSE
FT                   ASEKSGATKRLDDTIMSLWSRVAPGGVLVLVEPGTPRGSKLIRRARALILDAEKNKTRN
FT                   RREDGEDADDSFDAHIVAPCQHDKVCPMDGLEGSTWCHFSQRVKRTEMHRQMLPRGRGP
FT                   QHQDERFSYVVIRRMSRKRAIAEAKNRVAEIAAGEQKVGFKIDKEDDEEDYRDEDEEDE
FT                   EDEEDEEDEEDEEDEEDEDGDGEEDDDDDEDGEEEGKDVGETKAGAVAVASSFSWGRLV
FT                   RPPIKRSRHVILDMCSANGELDRHIVARSNAWEGGVGKQGYKAARKSKWGDLWPYRDPR
FT                   KLHETKDASAAELEKFFEDFEDFNMEDLQVMMKGRSTPVGVRLRTKSFQAKRPAFVEEF
FT                   VRLEREVGVDAMEENESATAGKEGVRED"
FT   gene            <1096620..>1099304
FT                   /locus_tag="MICPUN_80220"
FT   mRNA            join(<1096620..1098062,1098150..>1099304)
FT                   /locus_tag="MICPUN_80220"
FT                   /product="predicted protein"
FT   CDS_pept        join(1096620..1098062,1098150..1099304)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80220"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8236 - serine-type peptidase
FT                   activity; GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1E278"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1E278"
FT                   /protein_id="ACO61868.1"
FT                   /translation="MLKGTRFVRVATAASGGDDSKTTTEDEGYRMPPPEVAQFVERPQN
FT                   PSISISPMRDQLLYLMRPPPYPLVSELARPELKLAGMRIDETQNSRSRMSGNTGIAIGP
FT                   MPTSEEEINSFEHFDGLPDGATLNYVSWGVDARHIAFTVRFAGPEVPETDRAPPELWIA
FT                   DVTTRACRPLLPGRGLNTLFESYSWLDKDTIVACVVPAGRPPRPQRPPTPPGPRVQTNF
FT                   GGNVAQARTYADLLKDSHDGDLFEYFSSSEFVKVSVLTGEVTPFGSGPAIHTRLDPSPD
FT                   GNFVIMEALQRPFSYAVPCGRFPKRVWITDRDGREVREVCNLPMADNIPIVHNSCREGP
FT                   RSINWRPDRPAELYWTEAQDRGDPRLDVSPRDITYTADMHADPTAPGVATFQTDLRYGG
FT                   VSWAGEGVGLLYESWYKSRTIRAWVVDTDGRTDRAPRLLYDRDYEDSYNDPGSPLSRRM
FT                   PDGTYLIANVTGSIPESGWKPAKGEGASDKGDRPFLDLLNLDTGATKRIWQCPEDGALE
FT                   RPGSIISDTNGAPITLDTMQILLSRETPSENPQYYSLELNGSDGTLKPRRISDFPHPHP
FT                   GLIDPPKEILRYKRADGVELNATLYTPPGYDAKRDGPLPTIMWAYPREFNSAEAAGQLR
FT                   DSPLRFTSISPMSPLVWLSRGYAVLEGPSLPIIGSAAEGVEPNDTYVEQLVAGARAAVE
FT                   EVVRRGVTDPQRVGVGGHSYGAFMASNLLAHAPYLFACAVARSGAYNRTLTPFGFQSEE
FT                   RTLWQAPDTYMNMSPFMHADIIKKPILLIHGEEDTNSGTNVIQSERFFAALKGNGADAR
FT                   LVLLPHESHSTRAFESVCHTLAETSEFFDKHLSAKAVEREAEVAQEETLTSKL"
FT   gene            complement(<1099376..>1100838)
FT                   /locus_tag="MICPUN_57140"
FT   mRNA            complement(join(<1099376..1099380,1099413..>1100838))
FT                   /locus_tag="MICPUN_57140"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1099376..1099380,1099413..1100838))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57140"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR013899"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="InterPro:IPR041806"
FT                   /db_xref="UniProtKB/TrEMBL:C1E279"
FT                   /protein_id="ACO62296.1"
FT                   /translation="MTEGKPEGPAAALNPSAAAFTFKATAPSFTPGSTDSRPAAGAAPF
FT                   YPRPQAPPTEPEYPGYDEFDEYHDHEQDQVVDLPKKKSLADLGLDSLGFVSDGSESGHD
FT                   TPSPMTQIRRQQAMRQNVGDGQDIGGWYSGEGVEGVAAEWQHTVSYQPHDQHPIAGYEG
FT                   EYDQQLAAYNMPHYPYYPAGAGGGLSEYDEGEFLKFLQESFPGYSLDSLQELLEANGGD
FT                   ANITVEMLLEMHSEVAPPEPPRLDDESSFPTLGGSTSTGTSESQKPPDSKPPEEIFKSF
FT                   TISGGVSNMRLPGNNIASRSTHGDFADRVRTTQPSAPAQSRGTTQVGYGAGSFSGRRAA
FT                   AEQQWVDTGDTVSAMYATNREDARDYMRLRNICFQQATQAYLSGNKALAKDLSRQGRQH
FT                   AMNMKAAHERAAAFIFQERNNSNVQGGTPMLDLHGLHVAEAINVLRRELPNFKAAGRVV
FT                   HILVGTGHHTKERVGGAQ"
FT   gene            <1101045..>1102278
FT                   /locus_tag="MICPUN_57141"
FT   mRNA            join(<1101045..1101242,1101358..>1102278)
FT                   /locus_tag="MICPUN_57141"
FT                   /product="predicted protein"
FT   CDS_pept        join(1101045..1101242,1101358..1102278)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57141"
FT                   /product="predicted protein"
FT                   /note="Encodes a Micromonas-specific homeobox protein with
FT                   two homeobox domains; GO_component: GO:5634 - nucleus;
FT                   GO_function: GO:3700; sequence-specific DNA binding -
FT                   transcription factor activity [PMID 43565]; GO_process:
FT                   GO:6355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="GOA:C1E280"
FT                   /db_xref="InterPro:IPR001356"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:C1E280"
FT                   /protein_id="ACO61869.1"
FT                   /translation="MDSGEPTPAYQLVIGNDHPPEGGLTHGTAQSTSEGVPTKVKGRGW
FT                   KAKPYCQNTWSTRQDGQRRLEALLNKAANTPDFKPASLTGDRLSGDAAQLLVDFIQRPV
FT                   IRQQLQPLGVGTILGKKRKKKPLLDEDGNPTLTAKKKKPVLISEDTGRRVKTRLSAQQT
FT                   EYMQERFAEKPRWKPQECAELLKVLNTMGPEVTADQAYRWFDNRRNKKPTKVSSAMNDS
FT                   GATTSHIMKTSRISKDEREMLETAYSQDCAPDMHKRAAIAAAIGISTRQVTNWFARRQA
FT                   SQRPAMPRSLLANVDHGGGDDIGLLSRGLVEGLLPGASTAGVQGGSQMTLPETLAAQSD
FT                   LGLGIHHPELYGNLPTSHSPVPQGVVTRVWGW"
FT   gene            <1103125..>1103400
FT                   /locus_tag="MICPUN_79717"
FT   mRNA            <1103125..>1103400
FT                   /locus_tag="MICPUN_79717"
FT                   /product="predicted protein"
FT   CDS_pept        1103125..1103400
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79717"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1E281"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/TrEMBL:C1E281"
FT                   /protein_id="ACO61870.1"
FT                   /translation="MTRPNLDDESIQMFKTGPNDTGSSSLQIALLTKRIESLTEHLLVN
FT                   KKDYACQRGLRILLGQRSRLMKYLMKKDRAEYERVMDGLNLRIKSA"
FT   gene            <1103663..>1105165
FT                   /locus_tag="MICPUN_57143"
FT   mRNA            <1103663..>1105165
FT                   /locus_tag="MICPUN_57143"
FT                   /product="predicted protein"
FT   CDS_pept        1103663..1105165
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57143"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E282"
FT                   /db_xref="InterPro:IPR000300"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C1E282"
FT                   /protein_id="ACO61871.1"
FT                   /translation="MEGPEGSSQPLAGPSAVLRARNTKPTEPGAQPKAVSPVKAWDSDG
FT                   SSGSSENDPGAATVVPFDPVPPPRLLSVRSRAPATDGYNYDDTASTSGRKPAQKELRVC
FT                   AVTWNMCGRKFPSNLEPMLAPLFGRGDDGDVVRGWSAADDDEDGIDTPCDILVIGVQEA
FT                   AAMDGFVEGILSALGGDDEFVHLAGVSLEPGGWIQMEVFLRRELLPLVSDVRRDAVSCG
FT                   IGNVFGNKGSVGVAFMCAGAELCFLNAHLAAHTEKVKQRNADYHRIVRTMFAPRVGSQN
FT                   GSISSSKAVRKPKAKANAVAPADAPDETGALKPHTPIDPHRPTPETPSRFGGLLKRRAW
FT                   TAAERFDMCVFMGDLNYRVEGNRRAVDVLLENDMMDVMLSNDQLGIEKAAGRAFSGWSE
FT                   AELKFPPTYKLNRGTADVYDTSAKQRVPSWTDRVLWRTKTGGKVRCNNGADVYTSAKGI
FT                   RTSDHLPVVARIKTTIFDANLAAIRGGGHPSTGSRSRLCSVM"
FT   gene            complement(<1105249..>1105665)
FT                   /locus_tag="MICPUN_57144"
FT   mRNA            complement(<1105249..>1105665)
FT                   /locus_tag="MICPUN_57144"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1105249..1105665)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57144"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E283"
FT                   /protein_id="ACO62297.1"
FT                   /translation="MQRVTSNSIRLGPTQILEAACAARDLARVEEAMLTVMRAGRSDPQ
FT                   DDELLSTAAKVVWDIVSDSGTVDERERAKLTIRRAVQWLVEEAGNLEGAYSLAHITSDR
FT                   VTLEDVLVGAARGRKYNPSAARVMAVVRERLDGV"
FT   gene            <1105917..1107395
FT                   /locus_tag="MICPUN_57145"
FT   mRNA            <1105917..1107395
FT                   /locus_tag="MICPUN_57145"
FT                   /product="predicted protein"
FT   CDS_pept        1105917..1107392
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57145"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E284"
FT                   /protein_id="ACO61872.1"
FT                   /translation="MNSLTRIALICLCLDVVRAQGAASGPSPAAATASNEEVNKLALWP
FT                   DVDIRGLLAGEPNATGNAPNPIDLLFVLQAGSVTLVPANDGGLIGGQLFFREVLAQIVV
FT                   FADRPYRTMDMLSLEDFFAFELVQDFFAGPNPPNAIITGELPQDIRLQRHNESDSMPYR
FT                   RLLGTVLGAAEWDSQQPSELRFDIPAGMDIFRENGRVDIVDDELFQDLRKGYANASYDG
FT                   FPTLHRVTVFIDPFQTAPEKTQLNIGRRLLQRGRVGRGGGRFGRAGAFAAPRGFGRRWN
FT                   GNINNYWGGRNAFLGGFSRGGLYGSRLVGTSTLYPGWGGFGYYDDGFYDPSIFSGRAMA
FT                   YQTPNTVVQQVPVYVPVPAGPAPQSPVPTQTSVMTKAILKSELTGTWAGNGGGAGMGSI
FT                   RVSAVETVDGLEVTAQLPGCETCKLGCRWERARGTAMISSDGGSQLQVDFVSCDDARNA
FT                   ITTLRGILAIAANGRNVIYWSPATHSTQWIRNS"
FT   gene            complement(<1107445..>1108163)
FT                   /locus_tag="MICPUN_57146"
FT   mRNA            complement(join(<1107445..1107472,1107574..>1108163))
FT                   /locus_tag="MICPUN_57146"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1107445..1107472,1107574..1108163))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57146"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5739 - mitochondrion; GO_process:
FT                   GO:6461 - protein complex assembly"
FT                   /db_xref="GOA:C1E285"
FT                   /db_xref="InterPro:IPR010591"
FT                   /db_xref="UniProtKB/TrEMBL:C1E285"
FT                   /protein_id="ACO62298.1"
FT                   /translation="MRSLQRAFNYRTCLKAWATCGDASTSTVSMRKVSTPFLARNQGEL
FT                   RWMSTVVPPGKTLGEVTHVDLLEKENPDDIATIWRQYHEGKSGRVGLKVEPEAYRSLEK
FT                   RSGQCPIFVMPLHKSPGRFLSLVMQTKLPYVSFTAIDDFRKLQEAATPVMVAAHYPELI
FT                   DSKGLALVQAAHVDATTAGAVEHLTGQEAVRLVRSEPEDMGG"
FT   gene            <1108437..>1109369
FT                   /locus_tag="MICPUN_80225"
FT   mRNA            <1108437..>1109369
FT                   /locus_tag="MICPUN_80225"
FT                   /product="predicted protein"
FT   CDS_pept        1108437..1109369
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80225"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1E286"
FT                   /protein_id="ACO61873.1"
FT                   /translation="MGRFENAAGLSIAFYSWEVPNPKGVVIFSHGHGVHATFELLNSPK
FT                   PPGIRTEYSGTWADSLNKAGYSLFALDHQGHGRSDYARGKRCYFERVQDLVNDFKRFVK
FT                   LVRQEVGQELPTFLLGMSMGGFVVVNAAMQDENLADGVVLLAPMLSLDRLAARGINKVL
FT                   LPLVTMISVFLPTLPVAETAKNIKFPHSQLEVEMDDLTYPSGVMRTRCRVAAEYYIGTK
FT                   RTQTLMHKMKIPFITFHGKDDQMTDPASSQMLYDRASSSDKTLQWVENVFHDLMHEKPT
FT                   SNDIIAAIVNWLSERTGSSKPKRKNRALR"
FT   gene            complement(1109375..>1111547)
FT                   /locus_tag="MICPUN_57148"
FT   mRNA            complement(join(1109375..1111435,1111488..>1111547))
FT                   /locus_tag="MICPUN_57148"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1109429..1111435,1111488..1111547))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57148"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1E287"
FT                   /protein_id="ACO62299.1"
FT                   /translation="MSAVAVEYVFKSSAAGEGEVVVRAERAALFPETSSTAHRDETGHV
FT                   AWQAMPVLCEFILSSRGRQLLTSARVLELGAGIGIPGLLAGRVCTELIITDSNDAVVER
FT                   LKRNVELNFGEMNCSGDAIRVENVVWGADLFPSNLAHSVDIVLGSDVIYSASSAKSFLE
FT                   TAEAAMAQPGGIIVLAYIPRWPNVDRALYDSIAVMKLSAEVVPLCSFMSEKTSNGHALP
FT                   KGTCLLLLRRMQDVDDPAEVCTDPPEITRRQYNDDVREVFDVCIGPGNITGDLCDRLSS
FT                   GIGLDCEGKQQICLVIDATGPVALTTEKARLLSDVFRVPPLINCTELKLKECWLSDGWA
FT                   ILTPGLLDCANKLSRLIADGDEIGVRAAKEINKLLLHCSDLKFLGLLRNPLGNDGAIAI
FT                   TGGLSSCSMLHSLVLSHCRIGDAGTAAIARAFPPTLQELDLSNNELSAIGVADIANAMR
FT                   DSVLSKLTILNLSGNDIGASGGAELGEVLGVCVPKLQQLDLRGCGMTSTGITWLSRAIP
FT                   ACEDMRVLHLGSNGAGDEAMNELAPAISRCKNLKHLSLAMNSITGEGTWVLVEDLVDCL
FT                   SITHIDMKGNSLGDDGAAAIADILAEVKTLEVVDLSNNEIGEEGAIAFAEEFEKPMMEE
FT                   PFSWPRGLTLLLENNPEIVGAARSRLEKAVEDKNPQVEVKLSSVTAMETGFGR"
FT   gene            <1111846..>1112135
FT                   /locus_tag="MICPUN_74029"
FT   mRNA            join(<1111846..1111918,1111996..>1112135)
FT                   /locus_tag="MICPUN_74029"
FT                   /product="predicted protein"
FT   CDS_pept        join(<1111846..1111918,1111996..>1112135)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_74029"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:43565 - sequence-specific DNA binding"
FT                   /db_xref="GOA:C1E288"
FT                   /db_xref="InterPro:IPR003958"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="UniProtKB/TrEMBL:C1E288"
FT                   /protein_id="ACO61874.1"
FT                   /translation="ARIKKLMQADEEVGKIAQATPVLMAKALEMFMVELMKSTTDIASA
FT                   HGAKTVSAGHLRASIMGNEKFDFLKD"
FT   gene            complement(1112473..1114576)
FT                   /locus_tag="MICPUN_57150"
FT   mRNA            complement(join(1112473..1113840,1114076..1114576))
FT                   /locus_tag="MICPUN_57150"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1112527..1113840,1114076..1114189))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57150"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E289"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1E289"
FT                   /protein_id="ACO62300.1"
FT                   /translation="MAELPAPPSLLDEVNPRLVVAVTRSQKRKREEEQALVSERKASGA
FT                   SAEALDSSARATSSKGASGSVKVHQSPPHRPDSKDGHLQYELGESITPVYKILAPLGEG
FT                   TFGRVLECWDRKSRSYCAVKIIRNVQKYRDAAMIEIDVLKTVQKSDPEGRYNCIMLENW
FT                   FDYRGHICMVFEKCGLSLFEFLRKNHYKPFSAHLVQTFGRQLLHAVAFLHTLKLVHTDL
FT                   KPENILLLSSAYQRVPVSSGSKFTKRVPMDSTIRLIDFGSATFENQYHSTVVSTRHYRA
FT                   PEVILGMGWSYPCDVWSVGCILIELLTGDALFQTHENLEHLAMMQVVLGPIQRDVIKRA
FT                   DRHAQKYFRNGGELNWPEGSQSAESTRAVEKMKSLQEIVCSRLDGTPAAHFTDLLLKLL
FT                   AFAPEDRITPDKALEHSAFRIELPSEELIMPANVHRTSSPRINQSRSGNSHQRASKQGT
FT                   APQAPPTTCDSNAYANA"
FT   gene            complement(<1114748..>1115089)
FT                   /locus_tag="MICPUN_57152"
FT   mRNA            complement(<1114748..>1115089)
FT                   /locus_tag="MICPUN_57152"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1114748..1115089)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57152"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E290"
FT                   /protein_id="ACO62301.1"
FT                   /translation="MPKRSKMLLMLLVVLLCCPRPSRANEGDKKFQLQAILCSTPEWSL
FT                   LETLVTAPLVGSYNVQNSSLLQKLLSRFIPVSGTLEVRADSSAKLFLLFVHLPLIAPIP
FT                   RAPIKVYLQ"
FT   gene            <1115318..>1116333
FT                   /locus_tag="MICPUN_57153"
FT   mRNA            join(<1115318..1115347,1115404..>1116333)
FT                   /locus_tag="MICPUN_57153"
FT                   /product="predicted protein"
FT   CDS_pept        join(1115318..1115347,1115404..1116333)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57153"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C1E291"
FT                   /protein_id="ACO61875.1"
FT                   /translation="MKRGPDDLADRYPIPVEIVHHPADCPKLPFPQKELPPLLKKRLLA
FT                   RGIKVGNEDANDSAKESSLPPGWKETIDAKYGKPYYYNTALGISSWTRPTEQAAEQSGK
FT                   GEEDPLPPGWKSALDPQTGQTYYCNPFTSATSWERPVDAATVAKMKRCRGCGGFGRGLV
FT                   HAHGFCLHCSRILNKPPPGQQALEVKPPPKQKPSVVVVAKGPGIYADSPGIGPSSISTR
FT                   PIPKVANPIPSSRVQVAQRAARKAASGGIDPMDPASYSDAPVGGWGSGIDTNKKTKTGG
FT                   GSRPLPSPGDVLRQNAEAIKSAQPTSREDQKDGLGEAD"
FT   gene            complement(<1116412..>1117812)
FT                   /locus_tag="MICPUN_57154"
FT   mRNA            complement(<1116412..>1117812)
FT                   /locus_tag="MICPUN_57154"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1116412..1117812)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57154"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003347"
FT                   /db_xref="InterPro:IPR039994"
FT                   /db_xref="UniProtKB/TrEMBL:C1E292"
FT                   /protein_id="ACO62302.1"
FT                   /translation="MSAACQCFTTPTMTVPNLNVGRRGNHVRLTPGHRRVSLRAVQEGE
FT                   IRKGSIKEIPEIHAELPFAPELWTTFFEKYWQKEPVVIRGGLPTELCTPVDNDELAGLA
FT                   CETEFRPRIIRKGDEGPSSWSLQMGPFSEDELKSLPSDGSWCLLLNDLEKHVSEFMDVL
FT                   NLFDRFPRWRVADVQASISSEGGSVGAHSDQFDVFLIQGTGHKRWSISDCAEYVPDNDE
FT                   AFFPDAEVRVLKNFQPQSCSLLKQGDILYLPPKVAHHGVAEGCKTICTTFSVGFLAPAH
FT                   DELVLSYAQASVDTHDGSQRWRDPWLKPQEHVGEISSEAVAQAAEIIRQSMPKNDAEIA
FT                   RWFGCHATQSFGIDPSETIPAKDLSADELVVQFAEEGSLQRRADAKFAFVQEVKDGSLE
FT                   GGLFFAAGNMWPLQSAPGMELARHIANYDEIIADDWIESGDAAEYDMDSEAKTLLHDLF
FT                   SSGLIYFS"
FT   gene            complement(<1118034..>1120211)
FT                   /locus_tag="MICPUN_66033"
FT   mRNA            complement(join(<1118034..1118672,1118736..>1120211))
FT                   /locus_tag="MICPUN_66033"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1118034..1118672,1118736..1120211))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66033"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3723; tRNA-pseudouridine synthase
FT                   activity - RNA binding [PMID 16439]; GO_process: GO:31119 -
FT                   tRNA pseudouridine synthesis"
FT                   /db_xref="GOA:C1E293"
FT                   /db_xref="InterPro:IPR001656"
FT                   /db_xref="InterPro:IPR011760"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR020119"
FT                   /db_xref="InterPro:IPR042214"
FT                   /db_xref="UniProtKB/TrEMBL:C1E293"
FT                   /protein_id="ACO62303.1"
FT                   /translation="MESAKGANTVVDDEEKAVGIECYANTASGFQAILKERYTDFIVNE
FT                   IGLDGEVVHLTSLDAAVDEEIDSREQEKRQKTIVQLSATQEEPDDHSDRQLDDGKKAPA
FT                   AAAATPSETQGEGTDAKVEQTEVAASVDFSAEIEIAVADFVKLAGPAEAERLKEFLEQP
FT                   GVLLPAAEGKPAPAPLILASSNDKAYRTRMHVFFNSHFQLMTDTVEAPADEEASGPVKK
FT                   DSKRPCLCIRVHPRKPVNSKGGNGGQKRNRDEGGGWKGHRRWPANLPQYLEFTLCKENK
FT                   DTGDAIGVLSRILHVKPRSFGFAGTKDRRGVTSQRVTIFKVRAARMAKLRLLGMKVGNY
FT                   RYVDRDLRLGDLKGNLFTLTLRGIEEGSQLSISEAVRTLRTSGFINYFGLQRFGSHSIG
FT                   THVVGAALLRGAWEEAVDLILRPRDGDKPQVAMARSIFKEQGNAAAALKHMPTWCVAER
FT                   SLLEGLVRAQKNDYVSAFSSIPRTTRKMYVHAYQSYLWNRAASERVRRHGLQRVVAGDL
FT                   IIDTGCQTDIDNEDGDNDWIFSNVREVTPEEASAGVFSITDVVLPLPGSRVIYSESVQK
FT                   IYEEICQSDGVQLVGFAHSVREYSFGYLTGAYRRLVTKPDKVKFDFVRYSDPSADLAET
FT                   DLARLQPVQHDTVKPAGKAEEGELLALRLSFSLPTASYATMAIRELMKSSSSQASHKAA
FT                   TLSANHIVQN"
FT   gene            <1120562..>1121237
FT                   /locus_tag="MICPUN_57156"
FT   mRNA            join(<1120562..1120806,1120879..1120963,1121023..1121108,
FT                   1121195..>1121237)
FT                   /locus_tag="MICPUN_57156"
FT                   /product="predicted protein"
FT   CDS_pept        join(1120562..1120806,1120879..1120963,1121023..1121108,
FT                   1121195..1121237)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57156"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1E294"
FT                   /protein_id="ACO61876.1"
FT                   /translation="MTSGERRPTSGETRSNDSESRLSTDDSQTYLGGRLGHGSIAIPQL
FT                   IQPARARPLNRSMKANYVKNQADSALKSGNARDAYIKYTECLNLVPQKYEQLHVIYSNR
FT                   SLAYAKARKFELALTDAEKACELQPGWHKAWWRKAAALKALRRYNEVS"
FT   gene            <1121436..>1122506
FT                   /locus_tag="MICPUN_57157"
FT   mRNA            join(<1121436..1121599,1121684..1121726,1121783..1121899,
FT                   1121970..1122272,1122339..>1122506)
FT                   /locus_tag="MICPUN_57157"
FT                   /product="predicted protein"
FT   CDS_pept        join(1121436..1121599,1121684..1121726,1121783..1121899,
FT                   1121970..1122272,1122339..1122506)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57157"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E295"
FT                   /protein_id="ACO61877.1"
FT                   /translation="MAQETTRLMTREQVADFIISELREYESKGLIAPPSTQTISKQAKR
FT                   EAMFCHIKSWQSMAPHIAKDFVGLERMIGRFPLFVPICGKKIQQRASMFHEAICFSQAI
FT                   ADCQAALSRMNQYTAESEESIEKTVAHGPTSKKPPIECEKHFFLGLNVKCVENFAICMT
FT                   RVVTFRVRSLAWYIQGLAYEGAKRGCPEEAKDPVKAAKCFKIAANLDRDGNDEYQNKFD
FT                   SILSNLSNNETSEVLNAVNEQELAAKFGTPVRHEHFQAEDYN"
FT   gene            <1123247..>1124014
FT                   /locus_tag="MICPUN_57158"
FT   mRNA            <1123247..>1124014
FT                   /locus_tag="MICPUN_57158"
FT                   /product="predicted protein"
FT   CDS_pept        1123247..1124014
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57158"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR007052"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="UniProtKB/TrEMBL:C1E296"
FT                   /protein_id="ACO61878.1"
FT                   /translation="MGLRSSRHLSHLQKLNSLISMPSALNFLRLHPQCAVFHFRTYSLV
FT                   RFDGSPVERVDKHPFCMARVYYNEKEETVWFQASDGTHRWQQSASEIRILVPNLRARAK
FT                   EIDVIICSESLKISSVATGEVFLEGCLQHRIIVEESVWDLDEDEGVLTVYLQKMNIELF
FT                   AKPHEHSESEWTSLFRDSFKIMWDDCAKNYQDLPEPVMKLHRIREAKEQECRLSDNRES
FT                   KERDAARELDDLRRRTRMARLGALRGFSVCDGM"
FT   gene            complement(<1124087..>1127823)
FT                   /locus_tag="MICPUN_57159"
FT   mRNA            complement(join(<1124087..1127214,1127305..1127610,
FT                   1127715..>1127823))
FT                   /locus_tag="MICPUN_57159"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1124087..1127214,1127305..1127610,
FT                   1127715..1127823))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57159"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E297"
FT                   /db_xref="InterPro:IPR007529"
FT                   /db_xref="InterPro:IPR019514"
FT                   /db_xref="InterPro:IPR019515"
FT                   /db_xref="InterPro:IPR040047"
FT                   /db_xref="UniProtKB/TrEMBL:C1E297"
FT                   /protein_id="ACO62304.1"
FT                   /translation="MKGDQECVVCGENSAKYKCPVCRAPYCSVACCRSHKEIPCSKPEA
FT                   ERESAGEEGAGACPVAAKPKEPSKRPRAKLPSEEDTEDEDGARLRREHIISIASSDSIR
FT                   KALCDPHLVETLAHIDASSQAEQALDAACEDPGFQKTAELKDRAKKKVSDATEQSRRFR
FT                   ESMESITGVDKARERFAQARNPIGSSGSAAGLGAFSGAATTPSSLSDAFSNIGANPYET
FT                   NGVDRGQSKAEASTAARVSTRNGGARDVHSEVAQGSSSAPADEIISTLAPGFYLPESDF
FT                   DPLRHVLQSIVETSGEFTTDTLHKEEDQLSTVVEAVSTLLSKQVLDHYGEFVQGMSNIT
FT                   ELTNNLEQSFVIVKNGRRNLSSASDNVADALRIAESQTRKKSLLSTLNMLVRVQECQGL
FT                   EAKIKDSLASSSFTKAVNEYIAAQRILQVLDGLSCAESFRQDLRSLLWDLVAKMEGVLF
FT                   ATCGDFQPSQYQPLFDAYILLGEQVKPFGDKVQECFLRAVESQTEGVLRRSLGKGGVTE
FT                   EKVAHDAKIGYKELCQQLSSTQFFSCFQRTLEFLFDLLCSHHTMLRWHEAQKQMMTNGD
FT                   EHERVQACEAVGAALVRSRRAIADMAGARISALLQASSAPSSGQFKAVLDWARVFIGVA
FT                   EAFSGTQASALRGHLERAGDRYFESLHSQRLEALSQMFGRELWVRLPEAAVQQARTALR
FT                   AAASRGQGGGVKFGVAAFGGVAEDGSGFNTWIEKGNPFIEGRDSLDASTSSFDGAIKPG
FT                   QKEPRAEDHVGEAEDEEENAEVCAAYIDEDEDSDENDNNDAEFKKKEPDVRIVGKGFSV
FT                   LGGSDGDGKGLSARNPTLTASSLYLLQSVAEYLRLMRVLTPSMPVIFQGFCSLFERTMV
FT                   HIFGVFGQHAALEQDSDKMTPRLRSILVQAMNGSTLASFMPAVGEGVGAEASSVLSSGN
FT                   LYGLKERAVALESLSCIADELMGLKPGLKQALPHKEEQKLERFFGQTISSVEDLREHVY
FT                   RHVTGLLLNLSWVAETIGDSDKLSDKLKVGKYAKKEISTDHSKWVDDLSAELTQFGAKL
FT                   ACAEVTTEALVMLWDFAIAETASAIVDGFSRVRKCSSEGRAGMILDVQMLHGNIRRLAP
FT                   QGTKEDFRMVDTYVKAFYTPQEEMMHFCQTHLEFSQTQKVALINQMAGAFGWASSVKSE
FT                   MIAGIGANDSDTFV"
FT   gene            <1128451..>1129675
FT                   /locus_tag="MICPUN_80359"
FT   mRNA            join(<1128451..1129025,1129085..1129252,1129320..1129408,
FT                   1129515..>1129675)
FT                   /locus_tag="MICPUN_80359"
FT                   /product="predicted protein"
FT   CDS_pept        join(<1128451..1129025,1129085..1129252,1129320..1129408,
FT                   1129515..1129675)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80359"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR003409"
FT                   /db_xref="InterPro:IPR017868"
FT                   /db_xref="UniProtKB/TrEMBL:C1E298"
FT                   /protein_id="ACO61879.1"
FT                   /translation="GEAVERIRNGRGIHQCSNGDIYDGEWKDDKRHGRGLLRYVSGLEY
FT                   NGQWVVDKAEGHGVCMYVNGDKYEGEWKQDLRWGWGKQIFTDGDMYEGEWKNNAMDGSG
FT                   RYTYADNSYFQGKFSEGVQVSGKYSSADGSLEYDGQWKGDMRHGQGTFHLSGAYKYTGS
FT                   WFENARHGQGKCVYFDGALYDGEWQSDERHGTGRYKDADEEFEGMWKHDVKEGYGTSKS
FT                   ISGGRYQGQWKQGAEDGNGKRLYPDGSVYEGQWTNGKRCGKGKFTDASTKEVYNVYGTK
FT                   FRGEWEDDCWLQSTADPTFTKVHGPGLSRGIAGEPSVFVIEARDELKNK"
FT   gene            complement(<1132220..>1133313)
FT                   /locus_tag="MICPUN_57162"
FT   mRNA            complement(join(<1132220..1133059,1133107..>1133313))
FT                   /locus_tag="MICPUN_57162"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1132220..1133059,1133107..1133313))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57162"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E299"
FT                   /db_xref="UniProtKB/TrEMBL:C1E299"
FT                   /protein_id="ACO62305.1"
FT                   /translation="MTVFQVTLQPFGILNSLRGRFMIPCVVTTILRIGLFSPKNTFIYK
FT                   MLGRTHRNVPVSVPVTNLDMCWLLNLLPPDWCTVLLAAGTMMFSILYFVALETETYGKL
FT                   RSVFDSRPWRNRDNVYLPASSVSPASGAANLCPFSNKMARGTCPICCSCTSRDGYHHGD
FT                   PKRIHDVIGIAMIEYDMARKAAEGREGPLIARVQLDTLVSYRGNYLFGTISPSCKGCFI
FT                   KTWCWNVAYRMTWQSAILAFNSMLCTFIFYADITIFYADLKNMLLCISAFFSVSTLCMQ
FT                   FTILATAVVFIMEHPFMDDDSLPKWLMVHKKLVMKWIHYFALPSAKFGIPATRKYWSWL
FT                   TKADAKQK"
FT   gene            complement(<1133905..>1134360)
FT                   /locus_tag="MICPUN_73657"
FT   mRNA            complement(<1133905..>1134360)
FT                   /locus_tag="MICPUN_73657"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<1133905..>1134360)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73657"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013978"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A0"
FT                   /protein_id="ACO62306.1"
FT                   /translation="QPYEATATVMQSLTICGSYKDRTGEKLLDGTILVQEAAKALWNAP
FT                   FVCASHDASDVFNYGNKAALSLWRLSWDEFVGLPSTKSAEDDESVQSERRELLDRAAKD
FT                   GYIKDYSGIRQTSDGRKFKINGATVWTITDKDGKKTGQAVRFDTFSWL"
FT   gene            <1134799..1136886
FT                   /locus_tag="MICPUN_57164"
FT   mRNA            <1134799..1136886
FT                   /locus_tag="MICPUN_57164"
FT                   /product="predicted protein"
FT   CDS_pept        1134799..1136883
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57164"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16810; NAD+ synthase
FT                   (glutamine-hydrolyzing) activity - hydrolase activity,
FT                   acting on carbon-nitrogen (but not peptide) bonds [Evidence
FT                   5524] [PMID 3952]; GO_process: GO:6807; NAD biosynthetic
FT                   process - nitrogen compound metabolic process [PMID 9435]"
FT                   /db_xref="GOA:C1E2A1"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR003694"
FT                   /db_xref="InterPro:IPR014445"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR022310"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A1"
FT                   /protein_id="ACO61880.1"
FT                   /translation="MRVTCLATCALNQWALDFEGNLARVKSSISIAKRRGARYRVGPEL
FT                   ELPGYGCEDHFLELDTTEHSWECLADLLNGDETDEIVCDVGMPVIHGGVRYNCRVFVLN
FT                   RKILLIRPKLCLANDGNYRETRWFTAWQHQKKIEDHQLPPAIVAVTGQSCVPFGDAALE
FT                   FLDASLGSETCEELFTPAAPHIQMALSGVEVISNGSGSHHQLRKLNTRMDLIRSATGKC
FT                   GGVYMYANQRGCDGGRLYYDGCACIAVNGEIVAQGEQFAIQEVEVVIANVDLDAVVGFR
FT                   GAFQSMAVQASAGDKYPMIHVPFRLCPNDNVSRIPHSPCDIRYHSPQEEIALGPACWLW
FT                   DYLRRSGASGYLLPLSGGADSSSTAAIVGSMCQLATAAAVSGDEVAVADVRRIAQIDEN
FT                   DPLPCAKELAHLLFQTVYLGSENSSAATRSRSSALAAEIGASHLDVRIDTVVAAVVAFF
FT                   TSVTQKTPKFRVDGGSNVENLALQNIQARIRMVLSFVLAQLMPWVRGRSGFLLVLGSAN
FT                   VDEGLRGYMTKYDCSSADINPIGGISKGDLRSFLRWAADRLGYPTLAEVEEAPPTAELE
FT                   PIRDDYVQTDEEDMGMTYEELGVYGRLRKISRLGPVEMFKRLLHEWRDRASPTEIAAKV
FT                   KSFFYHYSCNRHKMTTLTPSYHAENYSPEDNRFDLRPFLYNVRWPFQFRKIDQLAGAAE
FT                   "
FT   gene            1137296..1140365
FT                   /locus_tag="MICPUN_90309"
FT   mRNA            join(1137296..1137465,1137600..1137822,1137965..1140365)
FT                   /locus_tag="MICPUN_90309"
FT                   /product="predicted protein"
FT   CDS_pept        join(1137380..1137465,1137600..1137822,1137965..1140283)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90309"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E2A2"
FT                   /db_xref="InterPro:IPR002015"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR016643"
FT                   /db_xref="InterPro:IPR040892"
FT                   /db_xref="InterPro:IPR041433"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A2"
FT                   /protein_id="ACO61881.1"
FT                   /translation="MVVRSADPKAGVAKLAMETMRSEIKSATSSMTSVPKPLKFLRPHL
FT                   QTLKDTYAKLKPGENKKLLADIISLLAMTDAPIDDAMPESLKYRLLGSNEDIGTWGHEY
FT                   VRNLAAEIGTEFHRRQDESAKEGKDADVEDLMGLVSEVIPFHMKHNAEPEAVDLLIEVE
FT                   RLDLLAPHVNEGNYARTCLYLFSCSSYLPEPEDSEVLKVAHEIFLKVGKLTDAMRVACR
FT                   LGLQDYMEKTFLASKDKLEKRQLCYMLARHGHPLRLDEGPCEIEDGDELEELQIIMSNS
FT                   NLSANYLTLARDLDVMEAKLPEDIYKTHLMEGRAPAGAAVDSARANLAATFVNAFVNAG
FT                   YGQDKLLTASEGDTEGEGASSGAGSNVSWIFKNKDHGKMSAAASLGSILLWDVEDGLPR
FT                   VDNYLYSMEQQVVAGGLLAVGLINVNVRNDCDPAYGLLYESVNKENSSVRIGAIMGLGL
FT                   AYAGCQKEEVQELLVPVVTDDSTPIDVAAFAALSLGLVFVGTCHEECVQAIVQALMLRP
FT                   EKDLEDPFAHFLCLGLGLIFLQRQGEVEATLEVAKTLPPRISDFLQVTLEACAYAGSGN
FT                   VLKVQALLARCGEHPELDGDDANEGADSESQEWKYDPQSIAALGVALIASAEELGSDMA
FT                   VRAYDHLIQYGDAAVRKACPVGLALLHISNPKLNVTDVLGRLSHDSNEDVAQAASLALG
FT                   IVGAGTNNARLASQLRQLSSYYYKDPSLLFLVRVAQGLVHMGKGLLTLSPSHSDHSLHS
FT                   NVALAGLITVAFAMLDMKHTILGKHHYMLYYLFVAAQPRMLMTVDEEGKPLPVAVRVGQ
FT                   AVDVVGQAGRPKTITGFQTHTTPVLLSAGDRAELATEKYIAIASVLEGVVILKPNPEWI
FT                   EEKE"
FT   gene            complement(<1140363..>1141289)
FT                   /locus_tag="MICPUN_99600"
FT   mRNA            complement(<1140363..>1141289)
FT                   /locus_tag="MICPUN_99600"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1140363..1141289)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99600"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E2A3"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR031142"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A3"
FT                   /protein_id="ACO62307.1"
FT                   /translation="MKFGHQFTQTIEATHPTISDKVGGENRKEPRLEPRFSPAPLKPPS
FT                   PTPQFLCYKKLKKCLKTIPKKTEPAKNADGTLKPGEKRKLTEEQRAFVKTLNAELQKFN
FT                   KFFMDAEEDLVIKDSLLEQAYREVVNEDGKRAESFSMKKYRKTCQEFADFHGELVLMEH
FT                   WVGLNYTALVKILKKHDKRSNLSLRSPFLVSVLQQPFYRTEVLSQLITKTETSFRKLNA
FT                   LLPEGGSPVELQRREEAREHQEESKEESESDSSDGEGDTTQDPLNRTKAAMECWDGLKS
FT                   SDSCKRPLGDIQSVVASGKRTKQTITE"
FT   gene            <1141866..>1142306
FT                   /locus_tag="MICPUN_52305"
FT   mRNA            <1141866..>1142306
FT                   /locus_tag="MICPUN_52305"
FT                   /product="predicted protein"
FT   CDS_pept        1141866..1142306
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52305"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A4"
FT                   /protein_id="ACO61882.1"
FT                   /translation="MTQGSRVIFCDREPLAIHCALSSAQLNGLEVHSVEDISKSSQGVA
FT                   GAVLDWASPLHTLAQSADVVLGADCLYDPATAAMLAKTCKHVLGEDGVVVICEPELERA
FT                   KGTYSKFLEAAKMLGAASAEILPHPDSDEPRSILLRVSWKSL"
FT   gene            complement(1142293..1143542)
FT                   /locus_tag="MICPUN_107953"
FT   mRNA            complement(1142293..1143542)
FT                   /locus_tag="MICPUN_107953"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1142364..1142582)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107953"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A5"
FT                   /protein_id="ACO62308.1"
FT                   /translation="MMQEMLCSPIITEALVKNSAKPTGLISQLKSPHRMTGREKETTMT
FT                   VTMMKCFVSDPTAMGSKVGTWQMTSPR"
FT   gene            1146903..1148494
FT                   /locus_tag="MICPUN_107954"
FT   mRNA            1146903..1148494
FT                   /locus_tag="MICPUN_107954"
FT                   /product="predicted protein"
FT   CDS_pept        1147021..1148430
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107954"
FT                   /product="predicted protein"
FT                   /note="Encodes a Squamosa-promoter-binding protein (SBP);
FT                   GO_component: GO:5634 - nucleus; GO_function: GO:3677 - DNA
FT                   binding"
FT                   /db_xref="GOA:C1E2A6"
FT                   /db_xref="InterPro:IPR004333"
FT                   /db_xref="InterPro:IPR036893"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A6"
FT                   /protein_id="ACO61883.1"
FT                   /translation="MRDENDIGAQEPEEQDENPPASPRSEPAANAFGPGGFQEDAPEEG
FT                   EKRVPIGDASADAAGSPVEPAKEPEGNTVDQEQSAGAQPVVAANSADASDPSDAAAPDN
FT                   TLRTAQHAILLRQQAIKYKGCCQVDDCLNPRKQPTANSRMPLTCAEHNGMLSLTYGGEA
FT                   SRECQACRAFHPVSAFDRDNKTCETRLLRKKLRYRAKTLQQRDEHRGQVGKQKARRHEA
FT                   ALQAVAAATAQPGVGVGLGQFSHLQGPAGFMLPFGGKFLGVAHKDGGADALAAARESIA
FT                   SVNPYGMFPGLTHMPFGQGAVEGSAAAAASAFAASFGTGLGGDDNKIAIPQPGGINLQS
FT                   LAGFPTRSNPAELAESSPAAAQAYLAALVQGNTGLSALALQGAGLTGGIPGLAGLQNPD
FT                   VLANLARQNNLQEQVAALRANHMLRIAQAAEMQASVAMANSRSTGGDILNRQNLYPHLA
FT                   SDPAQAGCSIM"
FT   gene            complement(<1148471..>1149463)
FT                   /locus_tag="MICPUN_80383"
FT   mRNA            complement(<1148471..>1149463)
FT                   /locus_tag="MICPUN_80383"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1148471..1149463)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_80383"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5542; transferase activity - folic
FT                   acid binding [PMID 16740]; GO_process: GO:8152 - metabolic
FT                   process"
FT                   /db_xref="GOA:C1E2A7"
FT                   /db_xref="InterPro:IPR012886"
FT                   /db_xref="InterPro:IPR022384"
FT                   /db_xref="InterPro:IPR037064"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A7"
FT                   /protein_id="ACO62309.1"
FT                   /translation="MKLSSSSNALKRRAGGLVAVVYVSEGKDADAVNVLQTVAEKACQQ
FT                   HGTRVLNVFRDDEYNRTGFTLGVGVASVAGHATPSVEPLKQSALALTEQALKTIDLRNH
FT                   SATHPRCGAVDHISCHAVGDAPDDLAAQLAKCLGEGIGDRLKVPVLLYGLASSTGTQLA
FT                   DLRRKYGYFRRTSQDVGWSGAHRVGDGQVEADYGPSTIPPESGILMLGATRWVCNYNVP
FT                   IVLGKCGVDADAADALAVARRLARQLSERGGGLPGVQAMALTHMIDAMGSTIEVACNLL
FT                   DPSTCGPDAVQAEVERLFGEEGEFGWTVKRGYVTNLTPEDMLQQLVPLR"
FT   gene            complement(<1149597..>1150865)
FT                   /locus_tag="MICPUN_57171"
FT   mRNA            complement(<1149597..>1150865)
FT                   /locus_tag="MICPUN_57171"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1149597..1150865)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57171"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR010733"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A8"
FT                   /protein_id="ACO62310.1"
FT                   /translation="MSAVHVRHPPHRSGLSSGSRSRSPLCPVATSSMRRSRESKPDARS
FT                   AAAELCSRCELLVQRIESFALMRPDIEGIDKLARAALRERDFAASLIDSPDPARGIQGC
FT                   ENNLRGLSLELECAEWAPGVTAVRKRFATRPPSLGAKFGDEEVVEVDVVAQEGLLWIEC
FT                   KAESKTLSSNIVPQALSMKRVSKASCNRRCFGKAPKIVVYATGTLGDIEAGFLSDAGIS
FT                   VLSALDAKTEYLPKLPSPTKMANLDITALFALVSEVTNGGATKPISEEITSWAERKPQH
FT                   AACLRAEMNEPLNLAAELAGYDSLIAHPSVIERFHDILHTVGGPKEHQRWEETWQPRIK
FT                   VVSPREDGDVKAEGIAEERSLERAAQVRSLSRLSPQQLDPFELGEVAMARTFTANGRAV
FT                   SSAAEQGVLLETYVHRAVWLVGL"
FT   gene            <1151457..>1152719
FT                   /locus_tag="MICPUN_79954"
FT   mRNA            <1151457..>1152719
FT                   /locus_tag="MICPUN_79954"
FT                   /product="predicted protein"
FT   CDS_pept        1151457..1152719
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_79954"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:151 - ubiquitin ligase complex;
FT                   GO_function: GO:4842 - ubiquitin-protein ligase activity;
FT                   GO_process: GO:16567 - protein ubiquitination"
FT                   /db_xref="GOA:C1E2A9"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR020472"
FT                   /db_xref="InterPro:IPR025666"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2A9"
FT                   /protein_id="ACO61884.1"
FT                   /translation="MVATGHTYDRPSIKRWLEQGHKTCPVTGSRLRNLDLLPNFALRSA
FT                   ISEWAAANNVKLNDRQLTSVTEKAVGGTDGESDAQTSPHCVLEGHEEIVWAVEATDGHL
FT                   FSASADKSIRAWDTKTRRCVHVLEEHTRPVLSLVVSQLHGKLFSGSYDCSICVWDLVTF
FT                   RRIKSLHGHTDAVRSLAVAGDTLFSASYDSTLRAYDINTLKPLKVLEGHTGPVRTLTVL
FT                   GAHLFSGSYDYTVRVWHTETLEPVHVLEGHTDAVRALAASPVPELKYIFSGSDDNSVRV
FT                   WDANTFKCVSVFQGHEDNVRVLTADSRYLYSGSWDKTIRVWDTQSLECVRVLEGHMEAV
FT                   LALTVMRGHLISGSYDTTVRFWNTETFQCVGKFEGHDDAVRVLTSTGEDAESVYSGSYD
FT                   GSIGFWSLPAPTSNTRAPATR"
FT   gene            complement(<1152885..>1153512)
FT                   /locus_tag="MICPUN_76326"
FT   mRNA            complement(<1152885..>1153512)
FT                   /locus_tag="MICPUN_76326"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<1152885..>1153512)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_76326"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E2B0"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR039516"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B0"
FT                   /protein_id="ACO62311.1"
FT                   /translation="KSVLLVTSHPDDESMFFGPTIQAAKRMGAQVHILCLSAGNADGLG
FT                   EVRAKELDAAGNYLGVASVNLVDDAALRDGFEEKWPVEAVAAQVDAAARKVGAETVVTF
FT                   DAGGISGHPNHTATYRGVLYWMLSEDYRETLRGVRQVWSLVTTNTVRKFVGAYDAFASF
FT                   FLDPDAMLAASNPLVLMRAMAMHASQFVWYRRLFVVFSRYSYTNTL"
FT   gene            complement(<1154123..>1155387)
FT                   /locus_tag="MICPUN_97179"
FT   mRNA            complement(join(<1154123..1155076,1155259..>1155387))
FT                   /locus_tag="MICPUN_97179"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1154123..1155076,1155259..1155387))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97179"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1E2B1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR003527"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B1"
FT                   /protein_id="ACO62312.1"
FT                   /translation="MIWRSLFEIDMKYVPIKPIGKGAYGVVCSAKDSETGEKVAIKKIA
FT                   NAFDNATDARRTLREIKLLRRLQHENIVLLKDIMRPPSKDDFNDVYLVYELMDTDLHQI
FT                   LRSSQGLSDEHCQYFLYQILRGLKYVHTAQVLHRDLKPSNLLLNANCDLKICDFGLART
FT                   SSERGFMTEYVVTRWYRAPELLLSCEDYTSAIDIWSMGCILAEILGRKPLFPGKDYIHQ
FT                   MRLIVEVLGSPNEEDCAFIQSTKARNYIRTLPHSPQVRWERMFPKGNPQAIDLLDKMLQ
FT                   FDPKKRITVEQALEHPYLTALHDPMVEPASEPAPFEFEFEDEELQEEQLREKVWEEMLS
FT                   FHGEGSFGRGRGSGVTPMMS"
FT   gene            <1155820..1158423
FT                   /locus_tag="MICPUN_57175"
FT   mRNA            join(<1155820..1157037,1157153..1158423)
FT                   /locus_tag="MICPUN_57175"
FT                   /product="predicted protein"
FT   CDS_pept        join(1155820..1157037,1157153..1158394)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57175"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013883"
FT                   /db_xref="InterPro:IPR040218"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B2"
FT                   /protein_id="ACO61885.1"
FT                   /translation="MASALPVVVRVKRKRELAPVDTIVVEAEESHAAKRRARDAALAAE
FT                   LDTALSGALGDSVDERQSSIAGGHGSERAPLEGTGRPNRRRFRRVQMTLSVADAQDEGR
FT                   VRELVQTVVAATRKRVQEDVASGGESTSLSKVTDGIVDPASHPTKRATRLTRPANARST
FT                   SDAMSGHFRMYDLVCDEGEAPPPAKPSPSTRKPVGAGLRRGARPPPPPRDATDEPREED
FT                   PARLLCNYAPMLREYLGTDALGTNGETGVTEGGDDDDKYVYDVYVRADDDDEEDDEGAN
FT                   SKFVGDVNAKANLASLIYVNSEDAALFEWMDGLAEEYDHEDDVDSQDSNREDAPDADYP
FT                   EDESDSYSEGDSREDWVGGSDDDGFGSRHRGGYNWVDGGVEGDYSGDDDVYDEFHGGIE
FT                   RHSGYREGSMSAKKPGWDGSTKILEASTGTEAGSTLAWVEQSRLNRKEFNDQLENSLKL
FT                   VGLSRRNPKRSKSMTQKRKGLHERHATASLSPIETGVLDELQSLLATAAAHPPDSERVA
FT                   NLDDATTATASTPPPPPTATGFDPAKTPHAGRVVMPAAKPGAKILRGSVVGDLRATLEE
FT                   TRSLLSDRDEQLRKARLREAELMTALESERQCVLRAERRIESLERALGVADPQGVFPVP
FT                   ANVHTENDELEASAQILEASFDEYLDEKSVTERGHGSRDLREPLDIVARAEAAVRGAIE
FT                   EAARAVCAEASAKEAVRLMTEAETQTALAEALRASRRREEALAARISVLERDRAARISV
FT                   GSRGPPSIIPSAAREAILAKAASREANLERGDGRSRGLAPSPALVQLLNKESSGHRSRA
FT                   DGAIVTS"
FT   gene            <1158637..>1159209
FT                   /locus_tag="MICPUN_76709"
FT   mRNA            join(<1158637..1158796,1158833..>1159209)
FT                   /locus_tag="MICPUN_76709"
FT                   /product="predicted protein"
FT   CDS_pept        join(<1158637..1158796,1158833..>1159209)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_76709"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019155"
FT                   /db_xref="InterPro:IPR039272"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B3"
FT                   /protein_id="ACO61886.1"
FT                   /translation="VTTANRDALVETFREIAELMIWGDQNEPSFFDAFVEMRTLTHFSR
FT                   FINQQARHRSHLTLQLLQTLSIMVQNIQLETSLFYLFSNNHVNELIECDFDFDDEEVMA
FT                   YYISLLKTISLKLNPATVQFFFDYGDGVQGGNKKCSEAPDAKLASFPLFTRAVGFVEHP
FT                   ESMVRAAARTVVLNVF"
FT   gene            complement(1160944..1162437)
FT                   /locus_tag="MICPUN_107955"
FT   mRNA            complement(1160944..1162437)
FT                   /locus_tag="MICPUN_107955"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1161046..1162341)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107955"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B4"
FT                   /protein_id="ACO62313.1"
FT                   /translation="MVAARVSTSRVPADPAGRDDAFDPSNTIIYRFDNDGNPVEGTLMS
FT                   DVMGASGDASDAISASTALVDIVAEVYDHVDEDGSETAVEVIRSADGDIMFRFVGKDAE
FT                   DFQARATANVKKEQTPAERAQMLLDEAQELIEQARALQNGEDELAAATEKAKLAAAAAA
FT                   KELAPKESVVEPASDGTVIMRRERKAPEGGDALGKGFEHVSKMGIKSIVDGIENMFDNF
FT                   RRAVSPEKQPRLPKTPEGTPWVDHEKVPTAGVDVAFDSFGTDDVSSSSDYMSVENADSE
FT                   EAREAEEIEEEHAQWAETAAQVRSSGDVTKVESEPEEDEEAKLAEAIERYSSMGSVVAG
FT                   AWRPKPIDVTIGGKVYVAYISPNSLRQLPGGKMAVVEDDAEKPGDTTTIIMCDPQDDGT
FT                   NVFMFGLTRTVLDDGSILYRFPSGEALGQSRR"
FT   gene            1162979..1164715
FT                   /locus_tag="MICPUN_105314"
FT   mRNA            join(1162979..1163102,1163410..1164715)
FT                   /locus_tag="MICPUN_105314"
FT                   /product="predicted protein"
FT   CDS_pept        join(1163011..1163102,1163410..1164679)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105314"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:8202 - steroid metabolic process"
FT                   /db_xref="InterPro:IPR000648"
FT                   /db_xref="InterPro:IPR037239"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B5"
FT                   /protein_id="ACO61887.1"
FT                   /translation="MSAPAPAEKEQGWFSRLASSVASSVGEGLNYLTGVEDPDELKTVD
FT                   DGSGNVTKKDDADAGGRKAMWSQLKDLVGADIMSKFSIPIFLMEPISVLQKTAENMQYC
FT                   ELLDRACEEEEEFMRLAYVAALAVSVYSSNERTKKPFNPILGETWEMALPEVDGIYVAE
FT                   QVCHHPPIGASHCETPRWTFDLTSAVRTKFMGNWVDVWPKGRTRIHLKECGDVYNLLPP
FT                   ASRVNNLVVGRLWVDTFGEMRVNNLKTGASAVLTFKECNMFGAGRWEVSGDVLGADGEC
FT                   KLKLKGKWNESMTATKPDGSTGRILWAKNPEPKEGALVEKYGFDNWTLRMNAAKDAPKG
FT                   LLKSDSRLRPDRMALEKGDDTTAQKMKHVLEEKQRAERRKREANGGEWKPRWFKLAAEA
FT                   DLHELELDVGTAVWEWNGAYNEELAKRTEKGIDNVLETEFDPWEFEDTKDMVIP"
FT   gene            complement(<1164785..>1165783)
FT                   /locus_tag="MICPUN_57179"
FT   mRNA            complement(<1164785..>1165783)
FT                   /locus_tag="MICPUN_57179"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1164785..1165783)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57179"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B6"
FT                   /protein_id="ACO62314.1"
FT                   /translation="MPSAKDLLRRWQREDAAAHDHSSGDLDDDNLRLSMWDDSPLNLSL
FT                   VAVKWGVRKREALALRQVRFAGLQDVEDIMGSIESQYETEEGDNDPASLVIALRRLPQR
FT                   PDGYFKGAPLRAVVIRALLSLGVAMEHCEEGFRSATRWCTSDPVCTLASPIRALGKVGG
FT                   STARCVSPVARITWGVASAAARAVRLATRKSRALARLAVMPPRSPRGSPDAAARARDAA
FT                   RSARDAGLAMASALGAINAAPAAAAAAEEEEEEEDEWASDKENETNAMIMSAVKAKLSS
FT                   PRRLERMFASDASNRVYSPQTWNGKRRKLSGLAAAAGVGSPRGSQIQGIRA"
FT   gene            <1166021..>1167274
FT                   /locus_tag="MICPUN_57180"
FT   mRNA            <1166021..>1167274
FT                   /locus_tag="MICPUN_57180"
FT                   /product="predicted protein"
FT   CDS_pept        1166021..1167274
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57180"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR019775"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="InterPro:IPR039328"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B7"
FT                   /protein_id="ACO61888.1"
FT                   /translation="MIPVTSWRSHRGTSRELTQHRRPPPPCRSHPGRSPIYSPHLLAST
FT                   DSSDGKYLATSLSTQAVKVYQRTEDGGIAALVELTGHGAAVTDVTIPLPHEPCTVCSSS
FT                   LDGTVRLWDCRAAEGQREVMKFVAGFAKEFASATLGGGNDHLVVGAQNEQVVFWDRRVG
FT                   TGLEVFEDSHSEDVTRVRFQPGRRNRLFTAGVDGLACAFDVGGCPADINDEDGLLTVMH
FT                   TGCAIVELGFVSGAGDDDVLWLLTGNEDAWFYDAGDDADTIGNTLAYIPDTRGAAQRSS
FT                   FAADIHAGGLSQQVDYLVGCFSRKEPGGGSTVMVAAGTQGGAVGVYPVVASTDPASSPA
FT                   VLGAPIAVMDGGHVDIVRAMAWKPDNAAEPPVTGAEDSRMCAWGEKKAVDPGGDGGYIQ
FT                   AGGKIGRGDEGGRRHSPY"
FT   gene            1169317..1170781
FT                   /locus_tag="MICPUN_107957"
FT   mRNA            1169317..1170781
FT                   /locus_tag="MICPUN_107957"
FT                   /product="predicted protein"
FT   CDS_pept        1169380..1170648
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107957"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E2B8"
FT                   /db_xref="InterPro:IPR007498"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B8"
FT                   /protein_id="ACO61889.1"
FT                   /translation="MLSASIVKPDGGSDIAPLTLPPLFEFTLDNSVRDMWNAGVYPLSI
FT                   LIAVFSGGWPYFKLALMLLAWYSPMGVLSTSARGYLLRSVDALGKWSLIDTFVMTLFQV
FT                   AFRFHVITPPSSVPFQSSSDDTGVGSFAQLDAMVEPRYGFHVFLFATVLSLFLGHFALG
FT                   WHRHAVGEDLAGVDPKDEGEEDEDNDDNVARWRRVGGNERKRIALRNGMAGCLSFAAVL
FT                   LVVGVFATSIRFDFKGLAGFVLGRGGATREYSLVSLALNIPGGELSHVGVQVSLWVFVI
FT                   VMPAAQLVALALLWLMPMTASSQRRMEIVAEICGAWAALDVFLVAALAAVLQIGRFTEF
FT                   IVGDACDGINKVLREISNLGGDGLDPLRLNGDDVCFDVDTRMESGCWVLVCAAGCIAMV
FT                   MHRSTVRARRVKEQAEPVVEEEV"
FT   gene            complement(<1170784..>1171746)
FT                   /locus_tag="MICPUN_57182"
FT   mRNA            complement(<1170784..>1171746)
FT                   /locus_tag="MICPUN_57182"
FT                   /product="glycosyltransferase family 2 protein"
FT   CDS_pept        complement(1170784..1171746)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57182"
FT                   /product="glycosyltransferase family 2 protein"
FT                   /note="candidate b-glycosyltransferase"
FT                   /db_xref="GOA:C1E2B9"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2B9"
FT                   /protein_id="ACO62315.1"
FT                   /translation="MGRAKKATASPGRLGDLSSSSSGSLEGAARGRNTTIVIPCYNEAE
FT                   RLRTDEFLAFARREHDTQLLFVNDGSTDDTSDVIRSMRRRCPDRIDVVDMPVNVGKAEA
FT                   VRRGMQIGCMSGSRFVGFWDADLATPLDHVAMFKEVMEDKPEVDMVFGARVGLLGRDIR
FT                   RSMKRHYLGRVFATLASITLGLGVYDTQCGSKLFRVDDRGDLETVISMPFHTRWVFDCE
FT                   MIGRFSALRRSRVRGGVRKWGKVDDGDMSGSIYEYPLHRWEDVGGSKVKSSDVIKMAWG
FT                   LMQVRRRYFWRRWPVLAPSRTGWEGWVDGWNFAFKPRFN"
FT   gene            <1172122..>1173300
FT                   /locus_tag="MICPUN_97181"
FT   mRNA            join(<1172122..1172145,1172365..>1173300)
FT                   /locus_tag="MICPUN_97181"
FT                   /product="malate dehydrogenase"
FT   CDS_pept        join(1172122..1172145,1172365..1173300)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_97181"
FT                   /product="malate dehydrogenase"
FT                   /note="putative malate dehydrogenase. A similarity search
FT                   suggests that the enzyme is glyoxysomal, but ChloroP and
FT                   TargetP predict a chloroplast localization; GO_function:
FT                   GO:16491 - oxidoreductase activity"
FT                   /db_xref="GOA:C1E2C0"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001252"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR010097"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C0"
FT                   /protein_id="ACO61890.1"
FT                   /translation="MTAKAEYKVAVLGAAGGIGQSLSLLLKMNPLISDLALYDIANTPG
FT                   VAADLSHTNTTCSVKGYAGEEQLADALKGCDLVIIPAGVPRKPGMTRDDLFSINAGIVK
FT                   NLCEACAKNCPKAILNIISNPVNSTVPIASEVYKKAGVYDPKKIFGVTTLDVVRSNTFI
FT                   SEAKGLDVNDVDVPVVGGHAGITILPLLSQTYPSTKFTAEELEALTVRIQNAGTEVVEA
FT                   KAGAGSATLSMAYAAARMAEACLRGLSGEAEVYECSYVASSVTDLPYFATKVKLGPNGA
FT                   EEVLPVGDITDYEKGWLEKLIPELKASIDKGIEFANKD"
FT   gene            <1174525..1176476
FT                   /locus_tag="MICPUN_93757"
FT   mRNA            join(<1174525..1174677,1174971..1176476)
FT                   /locus_tag="MICPUN_93757"
FT                   /product="anion exchanger family"
FT   CDS_pept        join(1174525..1174677,1174971..1176404)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_93757"
FT                   /product="anion exchanger family"
FT                   /note="sodium ion:bicarbonate symporter; GO_component:
FT                   GO:16021 - integral to membrane; GO_function: GO:15380 -
FT                   anion exchanger activity; GO_process: GO:6820 - anion
FT                   transport"
FT                   /db_xref="GOA:C1E2C1"
FT                   /db_xref="InterPro:IPR003020"
FT                   /db_xref="InterPro:IPR011531"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C1"
FT                   /protein_id="ACO61891.1"
FT                   /translation="MAARRAAVTVRAGGNPEPIVQAPFVGIKEDLAARGPLYIDDFKQG
FT                   ISPKSLASVFFLFFAALAPAVAFGAVLTSATAGMLGATEVILATAIGGVLYAVLCGQPM
FT                   SILASTGSVVTYTAILYTTCAQYGLPFFGTYAWIGIWTSILLMIVAVTSSSNLVRFFTK
FT                   FTDETFAALVACIFCVESAKKIIMMFFNPSISSTLAMGSALTALVTCGSAIAISNFKRS
FT                   PYGPEGVRNLIGDFAPTFAIAIGCFFGAWLAGNYGFTFDALSLPASLAPSIARPWVTDI
FT                   MAVPTWVKLAALAPAPACAILLYMDQNITTRLVNASKGLKKPGAYHLDMFWLSLITAVT
FT                   SICGLPWICASTVHSLTHVKSLTDVKQDPATGREEVTGVTETRWTPLVLNLLIGASIIF
FT                   LKDILGQIPMCVLSGIFFYLGLAAMRGNEFLERVGMTLITDPAKMPASSPLTKSVSLPT
FT                   LKKFTIMQIACLAVMWWIKGSPAAMLFPILIAALGPVRIVAGKAGWFTQEELNALDEQV
FT                   ETDPGYVYQAA"
FT   gene            1177044..1178174
FT                   /locus_tag="MICPUN_90319"
FT   mRNA            1177044..1178174
FT                   /locus_tag="MICPUN_90319"
FT                   /product="bile Acid:Na+ symporter family"
FT   CDS_pept        1177191..1178084
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_90319"
FT                   /product="bile Acid:Na+ symporter family"
FT                   /note="sodium ion:bile acid symporter; GO_component:
FT                   GO:16020 - membrane; GO_function: GO:8508 - bile
FT                   acid:sodium symporter activity; GO_process: GO:6814 -
FT                   sodium ion transport"
FT                   /db_xref="GOA:C1E2C2"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C2"
FT                   /protein_id="ACO61892.1"
FT                   /translation="MSAVVGIKAPATFSFMQANMYTLCLATLMLSMGITLTLDDFKRVF
FT                   SKPDVVGIGFLACYVMMPVTAMLVGNMVGLSGPLLAGLILVGSINGGQASNLCAYIARG
FT                   DVALSVLMTTATTIGCIFMTPLICKFCLGAIVDVDAIGMAISTIQVVLMPIVLGVTLNK
FT                   YVPKACRAVEPACPIIGVLMTIILVGASVATCAEPILNAGLKLQLAAFLLHAIGGAAGY
FT                   WVMRALGYDETVCRTTAIETSMKSSAFGFLLATLHFPEFLVRVPSAVSVVWMAVMGSSM
FT                   AVFWRMIPVKKDRETA"
FT   gene            complement(<1178181..>1178831)
FT                   /locus_tag="MICPUN_57187"
FT   mRNA            complement(<1178181..>1178831)
FT                   /locus_tag="MICPUN_57187"
FT                   /product="transferase hexapeptide repeat-containing
FT                   protein"
FT   CDS_pept        complement(1178181..1178831)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57187"
FT                   /product="transferase hexapeptide repeat-containing
FT                   protein"
FT                   /note="GO_function: GO:8415 - acyltransferase activity"
FT                   /db_xref="GOA:C1E2C3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C3"
FT                   /protein_id="ACO62316.1"
FT                   /translation="MARNALFDEQRKHRLDWMHWLHDKPKHARWARDWQESHQRELSRL
FT                   ETVSFGKDCFVASSVHIFAEPTRDISIGDGCHIGAEVFMHGPILLGDGVAINARSHLDG
FT                   GSAGIVIGAQTRVAPGVQLFAFNHGIDAAAFVKDQPVVSDGIVIGEDVWIGANVCVTDG
FT                   VRIGDHAVVGMGAVVTRDVPDWAVAAGNPARVIGDRRTWKPGRRDVDDAISAG"
FT   gene            <1179073..>1181077
FT                   /locus_tag="MICPUN_52316"
FT   mRNA            <1179073..>1181077
FT                   /locus_tag="MICPUN_52316"
FT                   /product="predicted protein"
FT   CDS_pept        1179073..>1181077
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_52316"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR001810"
FT                   /db_xref="InterPro:IPR006553"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C4"
FT                   /protein_id="ACO61893.1"
FT                   /translation="MDSVDDEVLALIFRAVPARDRLRCEEVCVRWRRVLTNHSEFTTRL
FT                   VLPPDPLDDSLVETTEGGWSPWREEARDDTLRVASAKAKGGLRHFDASGCADITKRAVI
FT                   DVLKSNPRLTSLVMDEGEVETSLYGLKLRPRHLVALAETMAARGRDGGSTPRIDISVEV
FT                   TGNRELEELRKALEEGSSFGDSLQIGGVEVYVVSLTTSLLFVVDSALTHGDSDIDEDVH
FT                   RETNEKTTTDLVEVLRRIGGRGLRRLNFLERSLNDHRGVPKIFNAVGEDCRTLRELHLD
FT                   SEAFTVDREHWEFLESTVDSFNGMIDAIGDTLCRLTLFRAYRDGGGWGPVRAVWCKKLP
FT                   EGLQKLHFEMPHHGLRHDTLDALSRCPNTRVLSFANRPRLQTRSINRQLSNGVMSKASA
FT                   SILADYLRTSSVTHLDLSNMLLDGDALGEILGAALPNQSDDVWDGIKVLILSGNERGGS
FT                   GGKDLPAVLEANASTMLHLDVGGLPDDQVAQAIDKLPLLTRLHTLDISGTQVNMFGISG
FT                   VTPKRKKLKTSDEAAKNDGEDFPPPAQLQTIGKKLAATLAAPSCRLKRLILESCSLTAS
FT                   DLREISPGVLKCPSLVFVDVSYNSAIGDEGCVEVARWIQGNARAKKNGGWLTRIHLEGC
FT                   GIGDVGAKTLAEAVATSPKLRRLDLAQNLNIGR"
FT   gene            complement(1181282..1182474)
FT                   /locus_tag="MICPUN_107959"
FT   mRNA            complement(1181282..1182474)
FT                   /locus_tag="MICPUN_107959"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1181337..1182368)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107959"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491; FAD binding - oxidoreductase
FT                   activity [PMID 50660]"
FT                   /db_xref="GOA:C1E2C5"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C5"
FT                   /protein_id="ACO62317.1"
FT                   /translation="MKAEANVIKNSETILVIGGGLVGTEMTSNVATKYPEKKVIICQAG
FT                   PYILPRVPEAHDKVTAFWESLGNVEVHLNERVIEFDDMLQEYKTDKGNTFNAGKVIRAT
FT                   GYKPNTDFFKDANTDPAIAAALDDKGFVKCDPNLRLHGFSNIYVSGDIVEDAYFGKTGV
FT                   TRSGERFPERLAAVAGSHSYVVTNNIKRTITGEPLASIDASRDPFGQPVEISLGLEKGL
FT                   AVVHGDLAPLYVGMGFDFGVDNEEFVKYGCAISANVPGLKDYISDLCAKATYIPEAHEG
FT                   LRQFGAMDPKVLDPLAPPMPPPPGADGAGDGEADQAPADPAPEPTEEAKADVPEAAPAE
FT                   AEE"
FT   gene            <1184869..1188530
FT                   /locus_tag="MICPUN_106815"
FT   mRNA            join(<1184869..1184962,1185137..1185254,1185297..1186677,
FT                   1186744..1188530)
FT                   /locus_tag="MICPUN_106815"
FT                   /product="predicted protein"
FT   CDS_pept        join(1184869..1184962,1185137..1185254,1185297..1186677,
FT                   1186744..1188279)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_106815"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491; proline dehydrogenase
FT                   activity - oxidoreductase activity [PMID 4657]; GO_process:
FT                   GO:8152; glutamate biosynthetic process - metabolic process
FT                   [Evidence 6562] [PMID 6537]"
FT                   /db_xref="GOA:C1E2C6"
FT                   /db_xref="InterPro:IPR002872"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR024082"
FT                   /db_xref="InterPro:IPR024089"
FT                   /db_xref="InterPro:IPR025703"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C6"
FT                   /protein_id="ACO61894.1"
FT                   /translation="MRRLPRYRTVVRREFTTWIRDTLAPIAPARSGVPITTGAAAAALE
FT                   AAENERLRVRAAARRDSAIAEKLGEEKHLTLDPLISEYSVDSPEGVALMQLAEALIRTP
FT                   KEAGRYMPARLIRDMLGAGNLDFLSHFGGDKSLLINASSVALSTVRGILPKHVPGGDFF
FT                   DESTRGLAGKGSDAVLEVGVTRALGLMARKFTMGANIEAAARRAMRAETYNPQRSHSFD
FT                   MLGEGARTYEDSARYLASYAHAAEAIQAAGFRSPQMSVKLSSLSPRFDELSRRECVPDL
FT                   SSKLGSLFPIADGPNAFTVFVDAEEQNRLELTLSVVENVIRERAPPRIGVVVQAYGRRA
FT                   METLEYLRELAVRYPETKISVRLVKGAYWDAEIKQAQLLGADSYPVWTEKRQTDVSYLA
FT                   CASFLLENSDTLPMPAFATHNARTVADILSMVDGDMDEFTRRGCEFQRLHGMGESFDYC
FT                   GLPVRVYSPVGAPNDLLAYLVRRLLENGANSSFLKRLAQGRDDLMNVDVLCEREPEVST
FT                   VIGTPVVVAEESSGHPNFPAAFAAQKAYGPAFKPLVCTGEDSLAELTARLGTFRPNTAK
FT                   ASDTIRSRATVLRKAADIVERDSVAMSKMIMEEAGKTLVDAVNEVRELVDFLRFYANQA
FT                   ETHLADPKRLRTVTGESCLLQAQPRGPWLCVGPFNFPFAIVGGLASSAFVAGNPVVIKP
FT                   HPSTPRCAAALVDVLLEAGAPEGSLEVVVDGPLPEGSRGAREGQSDAGAALVSSGEFAG
FT                   VSFVGSTRTAAKINHALALNSVEKRAPLARLVAETGGLNVLVADSSALPEQVCDAVLAS
FT                   FAQSAGQRCSSARILVVDNGCKNELTRMIQGGLSAMRVSKNNFDLSTDVGPLISEVAAD
FT                   KARAHCDALESGGAKMLARTIGEDDGALFHPRVYDLNPQPGSDPVAGLNLLEDEVFAPV
FT                   LHVVTYDGSQAELERVIEAVNRKGYALTGGVMTRCESTKALVTNKLDCGNFYINRDVVG
FT                   AVVESQPFGGHGLSGNGVKAGSEGYLEQFVAHKVICEDTTAAGGNVELMRTTT"
FT   gene            complement(<1188527..>1189685)
FT                   /locus_tag="MICPUN_99616"
FT   mRNA            complement(join(<1188527..1189362,1189625..>1189685))
FT                   /locus_tag="MICPUN_99616"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(1188527..1189362,1189625..1189685))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_99616"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C7"
FT                   /protein_id="ACO62318.1"
FT                   /translation="MAYGAQTSWSISAPSRRPLAPPAGTDRKEKGGGAWGENSRKTRHG
FT                   KLVEKADYRAWNDVEVFDVPSDLRRPGAEAVVEHVKFFGLEELFPSTGLQEKFNADAAF
FT                   RTAIRRAIRDDLFVPDPNASDKVNAAISSLSSSLMVNWKSSRTGYASLTKVFADNAVQN
FT                   LTGENFIQTLGKLCGPVSHGSLIDITSTGRKQERHSWHQDSGLDRFTVMVGFPPESNWT
FT                   GVGVFSHSCKLSHPLRQDGDEGEVIQWEDYEAGELPVSAIGRPEYSPGREVMVYCDATH
FT                   LHSAPDETNRESVWRFM"
FT   gene            <1190158..>1190769
FT                   /locus_tag="MICPUN_70401"
FT   mRNA            <1190158..>1190769
FT                   /locus_tag="MICPUN_70401"
FT                   /product="predicted protein"
FT   CDS_pept        <1190158..>1190769
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70401"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1E2C8"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C8"
FT                   /protein_id="ACO61895.1"
FT                   /translation="SSLALRIGEVLREHDIVRHADRVVLCVSGGVDSVALLHLMVELRQ
FT                   EWALDLHILHFNHGKRAESREEEAFVKDLGAKLGVEVHVRRPTKAFDTSGFQAKARAWR
FT                   RDEAEKLLDAVAGQVILQGHHADDQTETVLMKMMRGCHVSNIAGMSHRAGNYGRPLLDV
FT                   SKDELRRYLTSRALEWREDASNADVAFLRNRVRAELVPVLR"
FT   gene            complement(<1191668..>1192261)
FT                   /locus_tag="MICPUN_57193"
FT   mRNA            complement(<1191668..>1192261)
FT                   /locus_tag="MICPUN_57193"
FT                   /product="predicted protein"
FT   CDS_pept        complement(1191668..1192261)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_57193"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013252"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2C9"
FT                   /protein_id="ACO62319.1"
FT                   /translation="MAPEASFAECHELIEEMRRIYATDEDALKVRALNQQFKEVRKLCE
FT                   DREAHMQTVIKEMVKRVADAEKRATPSESPSEHQKRIAQVEAEKRAAGEFLTHMEAEAQ
FT                   ALEHMQAELKSQSANLKVKKQEVDAIEMDDVPRAKHELSLYAHISKISWQYETTDRIKG
FT                   RVNAHEGKDLQVIDYAVGDRSEYQLANDLWNLID"
FT   gene            <1193001..>1193915
FT                   /locus_tag="MICPUN_67788"
FT   mRNA            <1193001..>1193915
FT                   /locus_tag="MICPUN_67788"
FT                   /product="predicted protein"
FT   CDS_pept        <1193001..>1193915
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_67788"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5875 - microtubule associated
FT                   complex; GO_function: GO:3777; ATP binding - microtubule
FT                   motor activity [PMID 5524]; GO_process: GO:7018 -
FT                   microtubule-based movement"
FT                   /db_xref="GOA:C1E2D0"
FT                   /db_xref="InterPro:IPR001752"
FT                   /db_xref="InterPro:IPR019821"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027640"
FT                   /db_xref="InterPro:IPR036961"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2D0"
FT                   /protein_id="ACO61896.1"
FT                   /translation="KEYTFDGVFDQESNQKEVYEDVGKPVLKDVLQGYNGSILAYGQTG
FT                   AGKTHSLLNSGMGVDGKPDPKQAGLLPRLVAALFVHVGADVKHVYTVEASMLQIYNEQV
FT                   DCLLGDDREKAQGLQVTGKSEVKGLVWHKCKTPNELLQCFQKGRMNLVYAETKMNKSSS
FT                   RSHAVFQIKVSKRPRALDKTGTKGGKVEMKATFGKLTVVDLAGSERIKKSGVTGTQLKE
FT                   ATNINSSLLSFGNIVQALAEKKKFIPYRDSKLTRILEDSVGGNCKTSLLVCCSPSAESS
FT                   DETVSTLEFASRAARIEITATINE"
FT   gene            1196325..1197074
FT                   /locus_tag="MICPUN_107960"
FT   mRNA            1196325..1197074
FT                   /locus_tag="MICPUN_107960"
FT                   /product="predicted protein"
FT   CDS_pept        1196331..1197017
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107960"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2D1"
FT                   /protein_id="ACO61897.1"
FT                   /translation="MYDSGRVLFGKSSLFKDPFTGVPLSKNARPDLDVALFVDEGRCIG
FT                   CHQCKHAAPHTFKMEPHFNVARVETQWADSEEDLETAVACCPKDCIHTVPKADLALLEW
FT                   IHRSQPRQRIVTCSVESMSGKGRGLEESPFVAMERFERRRTEMMRDAEEAAKRAKKREE
FT                   AEAAMEMVSNVVGIGSWAGFFSRQRADEPAEKTRAPSCPLPAVYVNASLLLPQFSSMIS
FT                   EPAIDE"
FT   gene            <1198390..>1199373
FT                   /locus_tag="MICPUN_71440"
FT   mRNA            join(<1198390..1199049,1199197..>1199373)
FT                   /locus_tag="MICPUN_71440"
FT                   /product="predicted protein"
FT   CDS_pept        join(<1198390..1199049,1199197..>1199373)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71440"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR023375"
FT                   /db_xref="InterPro:IPR039343"
FT                   /db_xref="UniProtKB/TrEMBL:C1E2D2"
FT                   /protein_id="ACO61898.1"
FT                   /translation="GNDKAPWRFTGRALYQLNLVRSSEARKHVPKDLKLVELFGWTLGG
FT                   VYLARYDDSPAGTFDEMVALGGLVWNPPTSCAWAARVLVNSKEARQHGVKTCGLPSHFV
FT                   DFNDELDRAPERHGWWKDTRPESGLARAERFVKGGWKNALRKNDEAPKETKGGERVVVR
FT                   DGKGAELCSLALPHAAPSLPGPRIKMFLPSFSGRTDTCPDLLKYSLELNANVRLSAPLA
FT                   VASLTASDPTPAPAAVVSDESPAAERDAALAGILRGKPLLCIAFDCMQMDVGVPKVV"
FT   gene            complement(<1199450..>1200625)
FT                   /locus_tag="MICPUN_79595"
FT   mRNA            complement(<1199450..>1200625)
FT                   /locus_tag="MICPUN_79595"
FT                   /product="predicted prot