(data stored in ACNUC30630 zone)

EMBL: CP001333

ID   CP001333; SV 1; linear; genomic DNA; STD; PLN; 739136 BP.
XX
AC   CP001333; ACCO01000000;
XX
PR   Project:PRJNA15676;
XX
DT   11-APR-2009 (Rel. 100, Created)
DT   02-OCT-2014 (Rel. 122, Last updated, Version 3)
XX
DE   Micromonas sp. RCC299 chromosome 15, complete sequence.
XX
KW   .
XX
OS   Micromonas commoda
OC   Eukaryota; Viridiplantae; Chlorophyta; Mamiellophyceae; Mamiellales;
OC   Mamiellaceae; Micromonas.
XX
RN   [1]
RP   1-739136
RX   DOI; 10.1126/science.1167222.
RX   PUBMED; 19359590.
RA   Worden A.Z., Lee J.H., Mock T., Rouze P., Simmons M.P., Aerts A.L.,
RA   Allen A.E., Cuvelier M.L., Derelle E., Everett M.V., Foulon E.,
RA   Grimwood J., Gundlach H., Henrissat B., Napoli C., McDonald S.M.,
RA   Parker M.S., Rombauts S., Salamov A., Von Dassow P., Badger J.H.,
RA   Coutinho P.M., Demir E., Dubchak I., Gentemann C., Eikrem W., Gready J.E.,
RA   John U., Lanier W., Lindquist E.A., Lucas S., Mayer K.F., Moreau H.,
RA   Not F., Otillar R., Panaud O., Pangilinan J., Paulsen I., Piegu B.,
RA   Poliakov A., Robbens S., Schmutz J., Toulza E., Wyss T., Zelensky A.,
RA   Zhou K., Armbrust E.V., Bhattacharya D., Goodenough U.W., Van de Peer Y.,
RA   Grigoriev I.V.;
RT   "Green evolution and dynamic adaptations revealed by genomes of the marine
RT   picoeukaryotes Micromonas";
RL   Science, e1252229 324(5924):268-272(2009).
XX
RN   [2]
RP   1-739136
RG   Micromonas genome consortium
RA   Grigoriev I.V., Aerts A.L., Rombauts S., Van de Peer Y., Grimwood J.,
RA   Salamov A., Zhou K., Lucas S., Glavina del Rio T., Tice H., Bruce D.,
RA   Pitluck S., Lindquist E., Cuvelier M.L., Worden A.Z.;
RT   ;
RL   Submitted (23-DEC-2008) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 46acb9a9cd646099a54dd1bf5dfa0098.
DR   BioSample; SAMN03081421.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF01209; snR76.
XX
CC   URL -- http://www.jgi.doe.gov/MicromonasRCC299
CC   JGI Project ID: 4000189
CC   Organism available from the Center for Culture of Marine
CC   Phytoplankton (CCMP) and the Roscoff Culture collection (RCC)
CC   Contacts: Alexandra Z. Worden (azworden@mbari.org)
CC             Igor Grigoriev (IVGrigoriev@lbl.gov)
CC   Annotation done by the Micromonas genome consortium as identified
CC   in the authorship as listed as reference 1 above.
CC   This organism was isolated from South Pacific surface waters in
CC   1998 by S.Boulben. This strain was rendered clonal and axenic in
CC   the Worden Lab through plating and a series of antibiotic
CC   treatments. Subsequently, the axenic strain was deposited at the
CC   CCMP (CCMP2709) and RCC (RCC827). RCC299 is also referred to as
CC   strain NOUM17.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. We welcome collaborative interaction on the project.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..739136
FT                   /organism="Micromonas commoda"
FT                   /chromosome="15"
FT                   /strain="RCC299"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:296587"
FT   gene            complement(433..1327)
FT                   /locus_tag="MICPUN_109519"
FT   mRNA            complement(433..1327)
FT                   /locus_tag="MICPUN_109519"
FT                   /product="predicted protein"
FT   CDS_pept        complement(493..1107)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109519"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:151 - ubiquitin ligase complex;
FT                   GO_function: GO:5515; ubiquitin-protein ligase activity -
FT                   protein binding [PMID 4842]; GO_process: GO:16567 - protein
FT                   ubiquitination"
FT                   /db_xref="GOA:C1EHM5"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="InterPro:IPR003591"
FT                   /db_xref="InterPro:IPR003613"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR032675"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM5"
FT                   /protein_id="ACO67710.1"
FT                   /translation="MVVESGHTYERSAILSHFGRNGAKDPLTRLALSSTKVMTNWAVRQ
FT                   IVRDWLDKHSDVTPDGWDSRELLEPSKDDGTHMVERDDAGVLRTWRAMCPELQERWPEA
FT                   ARPEDWRGVKWENGRVVELVLDGFGLSGGVPADINQLTSLQRLWLGYNELTSLPAEIGQ
FT                   LTSLQWLYLCGNQLTSVPAAIRELRAAGCRVDLDRGVTVDE"
FT   gene            complement(<1568..>3637)
FT                   /locus_tag="MICPUN_67523"
FT   mRNA            complement(join(<1568..1843,1919..>3637))
FT                   /locus_tag="MICPUN_67523"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<1568..1843,1919..>3637))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_67523"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHM6"
FT                   /db_xref="InterPro:IPR029440"
FT                   /db_xref="InterPro:IPR039505"
FT                   /db_xref="InterPro:IPR039750"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM6"
FT                   /protein_id="ACO67711.1"
FT                   /translation="LESGDRDDRVAARRARIAARLKAKREAEDPSLIEPEPEPEPTAEE
FT                   TQVRDSKRRLARLKALGFEDVTDIKAVAVAREAHRRGVRDDRRVERRNRIEQERAETMQ
FT                   RDGEVAGEWDKLRGIKVAHDLNAAIQAQKALCDQIVASKNALIAEMTEELDKEDEEFER
FT                   NIRRQEEEVDETLKRMNSQYNELSAAYMSEFDEIERVFLEERSAALKANMEELDALFQR
FT                   RDAAELKYMEDVAATADAYRKELEKHEADDAEEYTMLKIRLETDIANLQRHLADMKSTY
FT                   LLNAEKLEYNYRVLVERDHENAGTLQIQRRKIAKLRETLMKVKDKFHAMDKKFSDENVR
FT                   LTDDHRRVTEQFKELEIKFRNFQASDRKKFQEVWAMKEEEIARKVKRALDADRILHEQH
FT                   LGMVWHPPSEDVFKHPEQLALDEARRKRAAATKAARASSGEPGGTVGMEEDEDVDVEEE
FT                   DNPFEQRIADPAHENYLATLVDVFYFLVDPKAQRAVRAAEAAVAEGTGASDEERFTTAA
FT                   AVARLQAESVLKALGVTDASSFDGLANALTVDGVDPVMHAGGGGDVAEIMLPSVDLLQP
FT                   FGDDAPATRKTKEQLDKEFWERMSNAVGEKNFRVWRQLERSMERYREMLMKRRDSLRDA
FT                   ESLREQNDELRGLLNQYLSSSVNDELVVPP"
FT   gene            <4168..>6858
FT                   /locus_tag="MICPUN_104231"
FT   mRNA            <4168..>6858
FT                   /locus_tag="MICPUN_104231"
FT                   /product="predicted protein"
FT   CDS_pept        4168..6858
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104231"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHM7"
FT                   /db_xref="InterPro:IPR019465"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM7"
FT                   /protein_id="ACO67533.1"
FT                   /translation="MTTSAGAATTSAGAATTPPGDPLREFETDPVLEPFLADDFDAVTY
FT                   ASESLTARTSKTVLPALDAGIKSLNAALRGTVTSHYDELLQQLGGIDESERVLEIVRDG
FT                   VHNLQRSMGKVRVEIVEPHEVVAAKTKQLENLTRTVETLHRVIRTLKLTGRLKDSLGAS
FT                   GGDDAEGGAAVPHSATSGDLAKAAKMLADASELEREGVVEDQEASALAGIEVIDRDARW
FT                   LERAGKDVRSRATQALNAGMDATSQAEVGAALQVFHNLGELDRATDAVIARLANDAVDV
FT                   FREALDPRELARAMGGGVSASERAGGVGVGGGRGIWPPAGQEHRWAEALWQRLGAACER
FT                   AKAAGMGAWHLQRVLAKKRDPISHALFLDEVIAARKNLWREKVAQSTEAEAAASNPEDA
FT                   ISLPCERFVWQLSKGAGEAFGRAHAAAGFARDTLLKGFPRLVTLIEGLHEGLAKESGAA
FT                   ATAAKGGVPPAVRKDGSDLTVLLHACDAVSNAYLARSFQRLSEPVNALLSPSALQSLQG
FT                   IASGQISASGTVGTRAAAEDVRRFLLRVREELDAVARHPTLVTQVTAGAVAKALRLMAQ
FT                   KAEIGVVDGAEARVFVVGTAQTPAQAKNAALAGVLEEICAALGNVVPLLPDEPAKALEN
FT                   ALAQVAETATEALEPVMSAAHAEVHKRLASMHKEDWAGGDPPMGEGCSTYMTQVIDVVA
FT                   HVSEEHLSGVRQGSLLGHASSSSKGASGFVPSTIAAEALARRCLELFVRHVSLLRNLGE
FT                   NGKLRLTKDMGELEQAVSAYLVPATSSLGDAYKALRALRPFLFLSLDEVASSALVEDIP
FT                   AANVLLHLYSHAPKEMATPYERAGLAPPQYSAWLDKNSDAEVWAGVKGTLEAYESQCKT
FT                   RRVTPHAAVDVMRLVGSRAFEKRRS"
FT   gene            complement(<6949..>8628)
FT                   /locus_tag="MICPUN_64283"
FT   mRNA            complement(<6949..>8628)
FT                   /locus_tag="MICPUN_64283"
FT                   /product="predicted protein"
FT   CDS_pept        complement(6949..8628)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64283"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM8"
FT                   /protein_id="ACO67712.1"
FT                   /translation="MRVSVCISHLRFRHATVTRSWKGRPQIRPYLQESDWTTVHDEPIP
FT                   SVRNFVTHDGLKGRQLFDGEPTTDDARPRGRGGDTARAGPKGTASRRQRNLRGVQERAR
FT                   PIVGPDRGSARRRAPSHRSGASRKRSLSGGGKFVMPSKTKDTAAPKEGAGVKSVPVVVP
FT                   PGWKPKKKGYCIHDRQKSKCRDCGGGSVCVHGRRKRQCKECGGAGICQHNRQRSQCKDC
FT                   GGVSICPHRRRRTMCKECGGAHICRHGKEKSKCKECGGISLCSHGRVKSQCKECGGSGF
FT                   CEHGRRRTQCVDCGGGGLCQHNKQRSRCRWCRDLGIVGDVPMPKPAPNEAVHDPRSFDA
FT                   DPNVSDAPAAAMTEVPAAMVEAPAAAETAAAMAEAPAAEAAAALAEVPAAMAEVPAAME
FT                   DAAAAMADPEVSDAPALEATDLARVEPKVDLTSESQGEAIKSGSVGESLRRISENEVTR
FT                   SDRVDRMGVLCPHKKFASECPICIGAGILAALTSGNVPDPEGPSAPRTDVEAEEAKGDD
FT                   HTSADPTPSETPSSPKSPKRPAPPRRTTAFAMDSLFSSTYRR"
FT   gene            8743..10119
FT                   /locus_tag="MICPUN_109520"
FT   mRNA            8743..10119
FT                   /locus_tag="MICPUN_109520"
FT                   /product="Drug/Metabolite transporter superfamily"
FT   CDS_pept        8792..10060
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109520"
FT                   /product="Drug/Metabolite transporter superfamily"
FT                   /note="phosphate:phosphoenolpyruvate translocator"
FT                   /db_xref="GOA:C1EHM9"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHM9"
FT                   /protein_id="ACO67534.1"
FT                   /translation="MGFRLWGRKKDEEQSWSEFGELIVHVSLFMLSGPTLILLQKYVLG
FT                   NLVFEYPIFIVTMSTFSRWFLILGLVHTGTVRLGAHRDLTFMEWTKGMLPVGVLECISL
FT                   ATGSAAYLHLSVSFVQMLKAFQPVVLNVLITTLGLEPFSMRAFVCIVLVTFGSVLAAIG
FT                   EVNFTLTGMYLMLVSELAESVKYVVLHYFLRNEGYSLWEGIYFTTPSSAFSLAVLCFVF
FT                   ERDVVEQENLLVVQHNSIVFLSLVTLAIITSVSGFGIIKELGSVANKVLVMLRNALLIY
FT                   PATQLYDEVVAPIQVIGYSITLLGTAGFAFFKVSQEVITRTQSQMDLASMAELSSSDDD
FT                   EGTVPSDVDSSGGRGRYGAVGGYASDPTTQPLLASPVKASRLGTPPRSPMKRNGSIKRS
FT                   GSNSGRGPGLRRTSPPNTGGYWD"
FT   gene            complement(<10144..>11274)
FT                   /locus_tag="MICPUN_88713"
FT   mRNA            complement(join(<10144..10724,10839..10965,11056..>11274))
FT                   /locus_tag="MICPUN_88713"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(10144..10724,10839..10965,11056..11274))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88713"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN0"
FT                   /protein_id="ACO67713.1"
FT                   /translation="MATTNSEVQIVGGDYRAKLGESPVWINGELVFIDVVAKEICTLRD
FT                   GTVRRAQLPKMPGSIVPSSKGGFLAALAFFCNVLDAQVHRPLADKPGERQCLNDGKCDA
FT                   RGRVWVGSKVLDAPPSGALFCVEPAFSFRNGSMVKVGVAGAVAEVGGVWTSNGIAWSPV
FT                   GDTMYYADSPRRRVEAYDFDAESGLLRNGRVFARMPDDVGVPDGMCVDEGGGVWVCVWD
FT                   AGKVLRYVPDGEGNARLDRTIAFPCSRPTSCCFGGKDGTTLFVTSCSLDTTVDADAVDV
FT                   SADEPTAGGVFAIDVGVKGVPVHAAAF"
FT   gene            <11559..13173
FT                   /locus_tag="MICPUN_106533"
FT   mRNA            join(<11559..11638,11791..13173)
FT                   /locus_tag="MICPUN_106533"
FT                   /product="predicted protein"
FT   CDS_pept        join(11559..11638,11791..13132)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_106533"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="GOA:C1EHN1"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR004331"
FT                   /db_xref="InterPro:IPR017907"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="InterPro:IPR033326"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN1"
FT                   /protein_id="ACO67535.1"
FT                   /translation="MKFGKQLETEINAAGVLGDRVPWIDYGKLKKLRNCRCHKDGVQKE
FT                   EEENTPLKRADPEEEAAFFSDDGDAATEEKAVGEKSAAHDDGVPQKDDAPCERCTQLFY
FT                   AELDKSMNATSKAYFSWVSRILSRAPFEHSKPWWRKGLNLDAVNCGPGMYGSKGQKVNA
FT                   SLGFNEPRDEDGKDYAPDLSGVDIDLEHEAKECLNWIELNSTALRKILKKWDKANHSTK
FT                   GRQTLRRYWTDSQYQMLFSPLILELRAVAGMMEGGLEGPHWNLHDDEHDDDEHAHANVD
FT                   HSEGTGVLTCPICFDTLYKPVGLQCGHVFCRDCLLQSAGVLKEGATLADLRMEPAHFHD
FT                   DRIPLTNGLRRHSEGQDSAHSAEGDEEDGAARSNEGGAAPPPGRKYRARRDRCPQCRTE
FT                   DVFGSSVRLRHVQDCLRRVDPEGYKARKAESKKLRSKLKSEAVMNNIVNGLIKLVAPTN
FT                   RGMNLIDPRTGQIRT"
FT   gene            complement(13208..13803)
FT                   /locus_tag="MICPUN_109521"
FT   mRNA            complement(13208..13803)
FT                   /locus_tag="MICPUN_109521"
FT                   /product="predicted protein"
FT   CDS_pept        complement(13282..13569)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109521"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHN2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN2"
FT                   /protein_id="ACO67714.1"
FT                   /translation="MPAAPIVLVQLWLAKKIAVLLAVRVYGLKKLYRGGMRLNNRYVTD
FT                   PTMNRRVHSVLHKVAAGAMMMSESIEGPARRYMNKIVFGTSEMPKAGPKT"
FT   gene            <13965..16717
FT                   /locus_tag="MICPUN_64288"
FT   mRNA            join(<13965..14971,15039..16717)
FT                   /locus_tag="MICPUN_64288"
FT                   /product="predicted protein"
FT   CDS_pept        join(13965..14971,15039..16617)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64288"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4176 - ATP-dependent peptidase
FT                   activity; GO_process: GO:6510 - ATP-dependent proteolysis"
FT                   /db_xref="GOA:C1EHN3"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR027370"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN3"
FT                   /protein_id="ACO67536.1"
FT                   /translation="MPRPTRSVSGAVADDKEFGPEVSSRGGGDGEPKSGRIVDAQELLD
FT                   AMTCPVSGLVFVDPVTTTCGHTFSRQSLARWMTSTGSNQRDGAGPSCPTCRAPLYHESP
FT                   HQWPVNTVLVDLAERFLRDEMIEARTLTYKMPGAIAGGSGVDGDSQAGQILGELPLFVL
FT                   DSMTPGQELTLNVFEERYKLMIRRCLQATRKFGMVGLARPAATHGPSRGVGGDGGFSVE
FT                   AGESNGRDGVERREGVEARHEHAGASRLLRYLLADPSPPGARGGTFHADHAVECVITAF
FT                   QELLDGRLLLRCRATRHVRIVDSRDEPGGAGYTCATVEAVVDSDVHPPRPGRPSRDGDA
FT                   SGGDASASILARVCAGVAPDDLADRDRAKMLLSMEMAAGIHHVWLAHVAGRTIGWQRPV
FT                   DCPAADDLERWSPPSDPPEDWVRSRYPVRESGALGGRSGVDRFPSPNDFLRRSYGGDVE
FT                   NLLAMCGSRPAAHMPTELSWWFTRVANPLPPLGAALELRPDALRCTSATDRFRNVWAKL
FT                   FASMVSRHGLKPTQFRGARPMADATIASLVCEALDPDPATAFGAVWYPAIAELRDRGTT
FT                   TATVPSSSDGAPPVIQYEGAVEDSEGRAYRRARVEDVEALIDAVTRTLELPIAADEWSP
FT                   VEGRFLSYVYVSPSDFEGPGPAMRLPPVPPDVDREGPGRSTRVPPVPPASPGSRSTARS
FT                   GILGGPGSAGGLAAVARRGGVPAVCWCLHLRLSSMLPVEWDDAVSRIAAALRGLDPTRG
FT                   APAVEGTVVPIPEYAPQPGDWFSAGKCVGRRRARLAGRVGASYGRVAGATVGAVVWAYY
FT                   VVCELFLLTALALGLFGRPGRNRFPQSFVRGAALALAAAALFGVLSYVP"
FT   gene            complement(<16715..>17335)
FT                   /locus_tag="MICPUN_88554"
FT   mRNA            complement(<16715..>17335)
FT                   /locus_tag="MICPUN_88554"
FT                   /product="predicted protein"
FT   CDS_pept        complement(16715..17335)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88554"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHN4"
FT                   /db_xref="InterPro:IPR010492"
FT                   /db_xref="InterPro:IPR021151"
FT                   /db_xref="InterPro:IPR036224"
FT                   /db_xref="InterPro:IPR038437"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN4"
FT                   /protein_id="ACO67715.1"
FT                   /translation="MSRYFDIDSFLAEQTRVPVVFNSGCTGLGKEMDKMCQTRDLPMGE
FT                   EVELPFWLVPKLFEQNMVGPKMPDCFDERVWQVVEAEPKNVPLRDFNPHFFEFGARFTE
FT                   LLRDEELHEQLEKAFTARYSKLLVGAALSTSEFKDRHLLSREEEKLLDAGRDSMKAFHD
FT                   WKYSTTEKLTVAHTVKANKKRRAGGAYGSNQRRAMGDNLTNRV"
FT   gene            complement(17652..18641)
FT                   /locus_tag="MICPUN_109522"
FT   mRNA            complement(join(17652..18071,18211..18407,18567..18641))
FT                   /locus_tag="MICPUN_109522"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(17688..18071,18211..18381))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109522"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824 - catalytic activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EHN5"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN5"
FT                   /protein_id="ACO67716.1"
FT                   /translation="MGGFYVADKQTCEEFDMTMSKKQFYDLAGVPIRRIFEILAEEQGK
FT                   TPDLDAMAARCKELADEIMSQGPELIHPVVAIARDAKAKGLPIAVASSGVKPTVTGHLR
FT                   GHGILDLFDALVTCEDVKHGKPAPDLYLLAAEKLGVDPKRCTAYEDAELGMQSAKAAGM
FT                   TVVDVRLLDGYPTDEYKNTDV"
FT   gene            <18819..>19700
FT                   /locus_tag="MICPUN_64290"
FT   mRNA            <18819..>19700
FT                   /locus_tag="MICPUN_64290"
FT                   /product="predicted protein"
FT   CDS_pept        18819..19700
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64290"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN6"
FT                   /protein_id="ACO67537.1"
FT                   /translation="MGGERGPEKPRGAGGALSPAARRQQRQRDRREKLAREKKAGASKE
FT                   KASAAAGAGGAASKRPPAGGSARGEVKRARRESSSGSEDDVGDDSVDESGDDAEGPGAA
FT                   GGDDDDAVERTGAYGSYGRTDGRMSVEDDEWATAPRTWAALAPYLSDYHDKKIWAPFYY
FT                   DGAAGKRLRDAGFTRVVHKREDFFKRVNDRVFVKSVSAVVDNPPYTGKGMKERVLRALV
FT                   AVDVPFCLLLPLGVLHTATVREILDPEHVQALIPRRCWVSKSGQREVPFKYLVWLCYKM
FT                   RLPRDLVLMPDT"
FT   gene            complement(<19777..>22983)
FT                   /locus_tag="MICPUN_88792"
FT   mRNA            complement(<19777..>22983)
FT                   /locus_tag="MICPUN_88792"
FT                   /product="predicted protein"
FT   CDS_pept        complement(19777..22983)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88792"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5634; nuclear pore - nucleus
FT                   [Evidence 5737] [PMID 5643]; GO_function: GO:8565 - protein
FT                   transporter activity; GO_process: GO:59; intracellular
FT                   protein transport - protein import into nucleus, docking
FT                   [PMID 6886]"
FT                   /db_xref="GOA:C1EHN7"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR013713"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN7"
FT                   /protein_id="ACO67717.1"
FT                   /translation="MVASVEELVQVLQATLSPDVATREQAEAYLKQHDYAKGYIVGLMQ
FT                   VASAPQADLGIRQAAAIHLKNISAKGWEPRKEESARLHDEDKATIRANILESFIQSPEL
FT                   IRSQLTEVMRVAVQHDFPERWPDLLPTLMGHLGTDDIARVYGAVQVIQVICRKYEFKDK
FT                   DEREVLAPVIENAFPRLLQMLQSLIANEAQRRDKTLATLVKLILKTYWNATYLDLPPAL
FT                   MRADVFGAWITCFHQIIGMQVPAEGQPSDRTERKNFPWWKAKKWSLHIANRLFSRYGNP
FT                   KQVKPEYKEFAKTFKEQVSCVFLQSYMQLLATLSGGGYLPDRIINLALQYLTTALSHGN
FT                   TYKLMKPHMETLMFNVVFQIVCFNQVDAELWEEDPQEYIRRGNDIIEEMYSPRAAAVNF
FT                   LVEVCRCRTKENMPKLMGFIVQIFTRCNELGANAPHPELAGALHCIGSLQEKLKTTPGY
FT                   MEQLEPMLTAHVLPSFQSPHGHVRAKAAWCAGVYAEIEFANPQNFMALFAGVVNCLKDP
FT                   DLPVKVDAIVSLGSFVETADDISQIRPILPQLLDEFFALMNEVESEEMVFTLETIVEKF
FT                   GEEIAPYAMGMTQNLVAAFWKLNGSQDQTDEDDFTGALASVGCLRAIATILESLSALPH
FT                   MYAQLEPALMPIMRKMLGADGYDVYEEVLEILSYMTYYAPAVSPAMWELWPVLISALDG
FT                   EYGVQYFENILVPMDNYISRGTETFLAHPTCKGDCLRVASGVLLNNDIPEPEMLPAPKL
FT                   LECVLQNCKGRVDDCVAPYLAVALERLKTCELTYLKDLLIQIVANCLWYNAALTLDILV
FT                   KNGALGTALQTWFGMLGDRTRKGGNKRKHHRREHDKKVCILGLVALIQTPAQSLPAEVA
FT                   AGMGQICAAVVSLLVDLREQEKERKEFEAKHPGGFYGWGSDEEDFGGDEDLGDDDEEEE
FT                   ELDHAELEAMAKRATAVNPYRRRTGDEDDDDDDEDFDDGMLTDDENFTSPIDDVDPFIL
FT                   FAETVQVTQSTDVQRFQALAGGLDAAGQQTLQELVAYAPTRREELAKKKAEEEAKKAEA
FT                   QAKAGPGAIPVQRAGHDAHH"
FT   gene            <23187..>23372
FT                   /locus_tag="MICPUN_50698"
FT   mRNA            <23187..>23372
FT                   /locus_tag="MICPUN_50698"
FT                   /product="predicted protein"
FT   CDS_pept        23187..23372
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50698"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN8"
FT                   /protein_id="ACO67538.1"
FT                   /translation="MMWRKPTSRRRGNKPSAATVRAPAGGVEIETDQPDVDSRAAGTGI
FT                   IHHSSLSCTTTQPNKS"
FT   gene            complement(<23459..>24964)
FT                   /gene="SSIIA"
FT                   /locus_tag="MICPUN_88745"
FT   mRNA            complement(<23459..>24964)
FT                   /gene="SSIIA"
FT                   /locus_tag="MICPUN_88745"
FT                   /product="glycosyltransferase family 5 protein"
FT   CDS_pept        complement(23459..24964)
FT                   /codon_start=1
FT                   /gene="SSIIA"
FT                   /locus_tag="MICPUN_88745"
FT                   /product="glycosyltransferase family 5 protein"
FT                   /note="candidate glycogen synthase; GO_process: GO:9058 -
FT                   biosynthetic process"
FT                   /db_xref="GOA:C1EHN9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHN9"
FT                   /protein_id="ACO67718.1"
FT                   /translation="MLCKEKLNIVVVASECAPFAKTGGLGDVAAALPKGLQARGHRVMV
FT                   VMPRYKNYDGAIDTGVRITFNVMGNQAEVGYFHMHKNGVDTVFIDHQCYHSVADNIYAG
FT                   DRHAANFRNAMLCQAAIEAVWHVPCGEDRTPYGDSDLVYMANDWHTSLLPVYLSAYYQD
FT                   HGKLPYARSVFVIHNMAFQGRGPLDEFYSLQLPDHYKEHFYLDDPFGGECMNQMQAGLK
FT                   FASKIIAVSAGYAWEITTDMGGWGLAPLLREQGDKLTGIVNGIDLEEWSPEYDNFLDGD
FT                   GYTRYAPDASGFDGKLECKRALQRQLGLPERDDVPLLGFIGRLDHQKGVDLITDARHWL
FT                   MGQDVQLVMLGSGREDLEQSLRSMENDHKDKCRCWVGFSVEMAHRITAGCDILLMPSRF
FT                   EPCGLNQLYAMRYGTVPVVHAVGGLRETVRPYNPHTKEGTGWQFDEALTNKFQEAVGWA
FT                   LGTYREDKDTFKKIQLSGMQQDLSWGLAAERYEEKLIEAKYSW"
FT   gene            27161..28080
FT                   /locus_tag="MICPUN_109524"
FT   mRNA            27161..28080
FT                   /locus_tag="MICPUN_109524"
FT                   /product="predicted protein"
FT   CDS_pept        27256..27990
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109524"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHP0"
FT                   /db_xref="InterPro:IPR021883"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP0"
FT                   /protein_id="ACO67539.1"
FT                   /translation="MRSEAQAPFRTARMFVFGAFAANAALGLSIATLQAVTKALGAPSA
FT                   PPLDQSLQNIGIDLGAALFFGYLYKKDAENREKQMARISREERLSALKCELSSGKVVSL
FT                   FDLRGFSRVVIAAGDADYCNASIAAAEAVKDPLLERGVLVIPLVLGGAAESVDAPDDAT
FT                   DRRFRATPVYTDKWVKWIDEQKREAKVAAGKGVYVGLRMDGRVRSSGVGTPPWEKFAKE
FT                   LPPADKWGGFLDGFDGRVGVDT"
FT   gene            <28260..>28571
FT                   /locus_tag="MICPUN_64294"
FT   mRNA            <28260..>28571
FT                   /locus_tag="MICPUN_64294"
FT                   /product="predicted protein"
FT   CDS_pept        28260..28571
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64294"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP1"
FT                   /protein_id="ACO67540.1"
FT                   /translation="MAKHKGEPWGPMKIGLGIAMGMFGAPKSEARDSRPRRGPDPLLTG
FT                   PIPYDEWRKIFKNAPIPLSTLPEKCPPDPRDPREFDEASDDEASDDEGFREAFAKRLR"
FT   gene            <28640..>29140
FT                   /locus_tag="MICPUN_64295"
FT   mRNA            <28640..>29140
FT                   /locus_tag="MICPUN_64295"
FT                   /product="predicted protein"
FT   CDS_pept        28640..29140
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64295"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP2"
FT                   /protein_id="ACO67541.1"
FT                   /translation="MHKYRRATDAVVLALLAAALVCTGAHAAETPDPPCLEISTEGIEQ
FT                   LREPCMDPALACADEGCLGAMVEWLAPQFEAADVDTSLYQDVSPEWMVQCFAPNLSAYM
FT                   ETIPVATFMSLRECDYAPYVERWPELATFDFSAVSTSDFMRAMPPGMLMEILSNQRRQN
FT                   RGW"
FT   gene            complement(<29476..>30399)
FT                   /locus_tag="MICPUN_70424"
FT   mRNA            complement(join(<29476..29774,29907..>30399))
FT                   /locus_tag="MICPUN_70424"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<29476..29774,29907..>30399))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70424"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16740 - transferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EHP3"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP3"
FT                   /protein_id="ACO67719.1"
FT                   /translation="GPIPKHVAIVMDGNRRFAETRGLRKESGHEFGAEKLLEVLEWSLA
FT                   LGVECLSVYAFSTDNFKRSETEVDVLFQLAERRLDEMATSRVIHDRNVRVQVLGELHML
FT                   PPGVRRAAARVMAATAAHSDGPVLNVCFAYTGREDVCLAVGAMARGVGEGTLDPVDDVT
FT                   ERPSDETGRKPGAPPVDLLIRTSGETRLSDFMLWGISGHAVLCFQEVLWPDFSFTDMCY
FT                   AVWTYQRSAEHSRGGRARYEAARADAEAERRDRRSVEAERAA"
FT   gene            <30893..>31990
FT                   /locus_tag="MICPUN_64297"
FT   mRNA            <30893..>31990
FT                   /locus_tag="MICPUN_64297"
FT                   /product="predicted protein"
FT   CDS_pept        30893..31990
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64297"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHP4"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP4"
FT                   /protein_id="ACO67542.1"
FT                   /translation="MSVLATVAADIDWATVLAYAFTVMAAYVALTVAAVASPIARRILF
FT                   KSRLYARGIAHMVLSREKKNWPKQRGNGVPVGKNIITKRIVFIRHGESTWNQVFNRGFG
FT                   YRFPFRLFEGVLTEVVGLLSRSSFFFDAPLSDLGNLEAKKLRAFLTSKEDGPVGKDADA
FT                   LAGVKGTSILVTSNLRRAAQTMAVAFWDRVAVTGEKIYVLSCLQEMARNVDTCALAGPG
FT                   EPVPLRGIEEQIPDIQNVPAGPIRALLERRRVTDSGSVVAESGHFNAGNKPLMRNGHAS
FT                   MLEFAHWSAAQDASTIIVGGHSLWFKEFFKCFIKPEQEHVAQRKKIVNCGVVAFDLKCG
FT                   TDASGNVGFSIDSSSVRIVYGGFGK"
FT   gene            complement(<32071..>32973)
FT                   /locus_tag="MICPUN_88715"
FT   mRNA            complement(join(<32071..32482,32657..>32973))
FT                   /locus_tag="MICPUN_88715"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(32071..32482,32657..32973))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88715"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHP5"
FT                   /db_xref="InterPro:IPR021134"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP5"
FT                   /protein_id="ACO67720.1"
FT                   /translation="MYTLIFTTLGFMLVFRMARAAVRFWDCRAAWGAIIFKSYSLCDNA
FT                   IVAIGPIAPSQAEELVRWCVAFGVGVKCVLRRERFPFEQVAGFLGADEVETMEKDAKHF
FT                   ALYPSAHHPVRKMEPHMAAQLMQTMEKDIAALIDHCGTMERIKATRLPIAYVSHLRTIL
FT                   MGFVLCLPFVYEGYWGWGTIPAVAAMAFALLGIEGAATECENPFSPKRTNHLGMDGFCE
FT                   TTQREVMELLQWWRKEEGEE"
FT   gene            <33777..>35213
FT                   /locus_tag="MICPUN_88789"
FT   mRNA            <33777..>35213
FT                   /locus_tag="MICPUN_88789"
FT                   /product="predicted protein"
FT   CDS_pept        33777..35213
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88789"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8235; X-Pro aminopeptidase activity
FT                   - metalloexopeptidase activity [Evidence 30145] [PMID
FT                   8451]; GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1EHP6"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR001131"
FT                   /db_xref="InterPro:IPR007865"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP6"
FT                   /protein_id="ACO67543.1"
FT                   /translation="MSSCGTPRAAATLSSPPASERPSPDPPGPLDHARHRDAVLSQLPP
FT                   GKLVYVPAGKAQTRNGVEGNARFRQEPDFLYLTGVEEPGYHALFGTGADAPFVLIAPRQ
FT                   DPEMDVWCGKQASRDELRAVTGADIVYYDDEFHKALDAVEAQEGQTVFVPSHDAATLPN
FT                   DPDGLFLGLRPETTALGKVMAKARSLKTSEEIDCLRFANEVSGDAHVAMWRHAARAFRV
FT                   TNGQPGQLWEHELEAVFAGETMKRGLRHLGYPSIVGAGVHAATLHYERNDARVRSADDL
FT                   VLVDAGAEWRGYTADITRTFPAGGKFEARRRAVYEAVLDVQVRAIAEMRAGANWQMVGA
FT                   RAKLNTVQNLIDLGIVRGNAQDAVMAGVCGLFLPHSLGHLLGLQVHDVGPGGPVPDGAL
FT                   APGHVVTCEPGIYFVDGLLEPALEDRFLKDFLVRDEIERFKAVGGVRIEDNVAITEDGA
FT                   ENLTTCPKTVEEIEAICRDA"
FT   gene            complement(35231..36692)
FT                   /locus_tag="MICPUN_109525"
FT   mRNA            complement(35231..36692)
FT                   /locus_tag="MICPUN_109525"
FT                   /product="predicted protein"
FT   CDS_pept        complement(35265..36638)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109525"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP7"
FT                   /protein_id="ACO67721.1"
FT                   /translation="MRHDGVGGRCEWEEVRTAGVAPLARRCAAVCVVGVDALLVHGGED
FT                   PAHPHRPLGDAHVLDLETMAWRQVACLDGSASNEGETKGETNRGNGANGSKRPMPVARS
FT                   EHVACAWSDDCVIVFGGVDASGRCLGDLWLLNVATGAWTDLTRLVPGHKPGPRAGHAGA
FT                   VVADRYWCIVGGGNGRSGGDLGCAVLDLDAMEWCGSGADERESETSSSGLRASSTTEPQ
FT                   PGLTLPSPSTAGEGMSMCAVETAGGDGVLIAFGGYDGRCRGHAQAFRFPKLTASAPDVR
FT                   NVEPNIDGKNGVGKASTPDSHQAHSPGVAAAVARGLGTLFSPMKIEGDGVSSAEASARL
FT                   RVDALTADNLRLRRENAQLREDARRVVNVQRTMETALEQQKRRCEALENRLGEERERAN
FT                   ASLAKVAELEAAADALRARIKKLETGGEDSEEAETTPAPNRRGNWFMNLLADTPENTP"
FT   gene            <37879..>41043
FT                   /locus_tag="MICPUN_64301"
FT   mRNA            <37879..>41043
FT                   /locus_tag="MICPUN_64301"
FT                   /product="predicted protein"
FT   CDS_pept        37879..41043
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64301"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHP8"
FT                   /db_xref="InterPro:IPR007941"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP8"
FT                   /protein_id="ACO67544.1"
FT                   /translation="MAGDETPSAMDDEAVQVAALADAMTDAMSVATRASLDDPEANEGA
FT                   STSAVSALLGDRASAKASRWARRAKERLEESRDRLRRVIEGEWDLKTTLAHRERKAVAG
FT                   ALACVAPGLNRDDDDALSDLLRWFVVDALGLDEDSLLAVSPLATPPPTTVEEQIQRTTT
FT                   AAGTFVGALAVAESLPGDDDPTEDDHDPTERSDFGDPANTAVDDGNSRVNSVAGRLRER
FT                   WTDVIGALMTAAVAAKRYDARCAAALRRLSVAAGVRWSRVAALEDSLALHLKSILRSQR
FT                   GAEGGAEGGAEGAAEGATSSAMSPSNAVVAKHSGGGQTQTTDGGWLSQLRNMSASRALS
FT                   VTAAAAVGGSVLFITGGLAAPAVVASLASMGAAGGILGTAALSVGTLLAYFGGAGGISM
FT                   IFGGVGAGLTGWRMLNRTSGLTQFAFLPVRGTGAGMSVYLFVPGFLRDPADLFRTWGAS
FT                   DGVYSVVLQLPPSPKDDKGNDKGDKDDKDDDVKGQLVAGLGMWLKRDPITDDVFVSWID
FT                   PGGAADRAGVAEGSVLTALATRVDTDKESLDDTDDDTPRPAPRVRRVRGRGDDPNDRSL
FT                   LRLSQVRAVLAGRDRTRSGERLSEISPVEAAGAAGNVVVAELWLRRNLAAGDDVEKIAK
FT                   RRGLPKLRLFRRRAEAKRKAKLAQAMVGASEAEIIAGKDGAVPEQDNDEEEDDEEAGDD
FT                   GDDDEDDEDEDDEDEDDDEDEDDDEKATKTEANEAGPPSPPPPAPAAQHRWHRAGIDAL
FT                   RSIGNGVVSVASVVPFVGGTPGGGEKRTPSGGDGGDGSPEKTEDERRRDSAAAAAELAA
FT                   SWPLPNGEQHVVGWEHALLVELGLAMTSFAQDAVTSYAVGHGIGYTSLAGIAAAVTWPA
FT                   LLLKSSQFIDSPWALAIARAGDAGEALASALLERKQGMRPVTLVGYSVGCEAIARCCRV
FT                   LANAEGGKGLGLVDAVVLVGATLDTGFDTWAPIRAVACGRVVNAHVSGAAAANDWLLAF
FT                   LYRANTQVLASVFNPTNVVGAAKGLAAWSTVAHPGVENVDVSDVCCQHTDIPDEMPRIL
FT                   TKCGMS"
FT   gene            complement(<41204..>42025)
FT                   /locus_tag="MICPUN_64302"
FT   mRNA            complement(<41204..>42025)
FT                   /locus_tag="MICPUN_64302"
FT                   /product="predicted protein"
FT   CDS_pept        complement(41204..42025)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64302"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHP9"
FT                   /protein_id="ACO67722.1"
FT                   /translation="MPAIWRPNVSGPLPDVDVEVGVAEDASSKGTKRKRAPYTKGPCEH
FT                   GVKPRSRCKVCSGCPHGKWRSKCKECGGGSFCEHGRHRQYCKECGGGSICEHGRRRSEC
FT                   KECGGSQICEHGRQRSRCKECGGASICVHDRQRSRCKECGGSGICEHGRRRSQCKECGG
FT                   SGICEHGRHRYRCKECGGSGICEHGRERSRCKECGGGSICEHGRVRSQCKECGGSQICE
FT                   HGRQRSKCKECGGSQICAHGRQRSQCKECGGSGICEHGRQRNRCKECRAAH"
FT   gene            <42144..46400
FT                   /locus_tag="MICPUN_64303"
FT   mRNA            join(<42144..42165,42236..46400)
FT                   /locus_tag="MICPUN_64303"
FT                   /product="predicted protein"
FT   CDS_pept        join(42144..42165,42236..46353)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64303"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ0"
FT                   /protein_id="ACO67545.1"
FT                   /translation="MSIHSRRGTARQVRAASALVRSTPGGDIDRRFGLGDVTPLHLAAW
FT                   RGDARVVRALCDAGASLTARDGESGWSPLHRAFHHGNARAAAALLARGATLHAPLDRLG
FT                   RSPLDVLTRALRRRFDDDALDRSRPHGPTASPTRAAAASASASSSSSSSSRPCDLYSWG
FT                   SGVNFQLGTGAVNEQPTPRRVDDVAVAVPTSHGSAGGGVEHDDGCGSGGSGDTNRRRRE
FT                   PCGGVVCASAGKFHTVCATADGAVYVWGHGRGGRLGVNVKAVYAGDEAIVAPARLATFG
FT                   VHPRNGPNSVQSLRVVAVAAGKHHTLAATECGLAFSWGLSRDGCLGYLTAAEETAAVSS
FT                   STRAVSSSVTAVGPTQTEERFSQNTPRRIAGTLKGIRIVAVSAANRHSVVLTADGDVYA
FT                   FGSNARGQLGVALGSHLLDHSHSPKRVDLTRGKRSFADGGGRRCVGVACAKAHTVALTA
FT                   DGDAFQWGHGAWGPRRVDIGSGLVHRDGGGSPGKNFVVHQGVTSRPTPGRLVAVAAGAT
FT                   TSLALTADGAVLAWRSDDKALRCSHVRGIPDGVVSVAAGKRRCVVATAAGDVYSWDSTD
FT                   EKEKEAAPFRVAGIKRVVSVCVGEKHSLALQRIARPPRETILTLADEEDDADEYAGNFA
FT                   GDLDDVDEVTASLEAMYSTAADDVARVADDDWDAQPPNAEPNSDGDSDSEDGDGRRRNR
FT                   RRASKCPSLKDLCVLVVAERVCDVRNATDLASFAAHLDAPSLRAYALRVAAANLDAALC
FT                   EVGPEALVECDPFTAAALELLLRRGDGATFTGNRDASRGTDDDDADDADADDRYDDRYD
FT                   DDDERVFRERRDAAEFLARIRAASAFDRADDSEPMESAAATHKPRRARGRASNDAGSGP
FT                   AASVPPAAPTDEASSGDAGGPSWLSARVRGIGKTPIESEDQTPRKPARGAGTSRRAAEA
FT                   AASRAARGALSLFLSGALEEGLRRGGGASNVDAAAAETAERRTTPRTWNRSENRSENRS
FT                   ETADANPSPDDVDVHTRPVNRRRGLLDIQLAQEREAAAEREARDARGFATAAARPVPAY
FT                   GQNGQNGQNGQNGQNDPHTPSAPADVHDASRSFPPSSPNARVFSLGALIGASRGGGYGG
FT                   RGSRSFAKNGQKRPPQSPAWGGVRSSSIESSRSRGDDASHGSPPPPSLLDIQREEEARA
FT                   ESSFGSPSPKNFSPNFSRLGGSSPASAGRSWYVPDSGRGAPVGLRALLAEEEDARLAAE
FT                   LAAAEADAAAKVKVPPLDKKEKGKKPSRRTRAGNPRPGGNPRSTDGTKGGNRKDDKSGD
FT                   GEDEAVRRHRPPAKKKASSSPEASNRGGAGAGADEAALGGGRRGRVGGDGCVGARGSGP
FT                   AKPRAFPKGTKARESEPPQRGNGRGGRSRRGAPQQP"
FT   gene            <46957..>49569
FT                   /locus_tag="MICPUN_105003"
FT   mRNA            <46957..>49569
FT                   /locus_tag="MICPUN_105003"
FT                   /product="blue light receptor"
FT   CDS_pept        46957..49569
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_105003"
FT                   /product="blue light receptor"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EHQ1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ1"
FT                   /protein_id="ACO67546.1"
FT                   /translation="MSEPAPAVEPSAAAPSDEVPKFDETKTHESIDIGFTVDAGGGISA
FT                   PQASKDLTNALASLRHTFTVCDPTLPDCPIVYASDGFLKMTGYPAEEVLNRNCRFLQGE
FT                   ETNMDDVRKISEAVKKGERITVRLLNYRKDGQKFWNLLTVAPVKLPDGTVAKFIGVQVD
FT                   VSDRTEGNADNSAAMKDTKGLPLLVKYDQRLKDQNFNRVDDVEKAVLTGEGVDLDANPV
FT                   AANRGGLDMATTLERIQQSFVIADPSLPDCPIVFASDGFLDFTGYTREEILGRNCRFLQ
FT                   GPRTDRSAVAEIRKAIDEGSECTVRLLNYTKQGKPFWNMFTMAPVRDEQGNVRFFAGVQ
FT                   VDVTVYTREEGEKDATSLDLVKEYDKDRDESSFDRQMKEYSKQTASAVASGVAGLKDGD
FT                   LPWKNMVGILRTPQPHQRHDPNWVALKARVDKHEAEGKVGRLSPDDFVPLKRLGNGDVG
FT                   SVHLVQLAGTNRLFAMKILVKQEMHERNKLHRVRTEGQILETVDHPFVATLYAAFQTDT
FT                   HLYFVLEYCEGGELYETLQKEPEKRFPETIAKFYAAEVLVALQYLHLMGFIYRDLKPEN
FT                   ILLRRDGHIIVTDFDLSYCASSRAHVIMKEGRAPGARARNRRVSQRRSFAGGGRPSVAI
FT                   DVGGSGKPPGENASGRSPRQSQMSIDATHNGGVAIPGASPKSAGPGLDMIACGTFLSPN
FT                   GANKSGKFPQIIAEPFAYTNSFVGTEEYLAPEVLNSTGHTSSIDWWELGIFIHEMVFGT
FT                   TPFRANKREQTFHNIVHQPLDFPSTPPVSGELKDLLRQLLQRDPSVRLGTQGGAEEVKA
FT                   HPFFRNVDWALLRWAKAPLAEKIARRMARASGAEAASAAVDAGGGGDDDEMFQMDVEQ"
FT   gene            complement(<49723..>50454)
FT                   /locus_tag="MICPUN_104245"
FT   mRNA            complement(<49723..>50454)
FT                   /locus_tag="MICPUN_104245"
FT                   /product="predicted protein"
FT   CDS_pept        complement(49723..50454)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104245"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ2"
FT                   /protein_id="ACO67723.1"
FT                   /translation="MSTRFAARGVRGGNVRARALAQRIIAAAGDNGPEALNKDAKRRQM
FT                   EMTPKGDDTPEQILRVSRGTSFEGLKAARRVALEQANAPGFDGDAEQRIGKINWAFDAL
FT                   VEESRAFFANAVEAKPDDADARYRMGNFYQTIEKFGEAEECYRRAIDLDPRHLDSCNNL
FT                   AMILQAKGDEKSVDEAEAYYLRCVEIDDRCVDAMFNWATLKLHCRKDPDACRVLINQIV
FT                   VIEPELKDHKLVKLLRGEEDA"
FT   gene            <50662..>51693
FT                   /locus_tag="MICPUN_113317"
FT   mRNA            <50662..>51693
FT                   /locus_tag="MICPUN_113317"
FT                   /product="predicted protein"
FT   CDS_pept        50662..51693
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_113317"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ3"
FT                   /protein_id="ACO67547.1"
FT                   /translation="MPAIWNVSGPLPDVDVEVGVTEDASSKGTKRKRAPPTKGPCEHGV
FT                   KPRSKCKVCSACPHGKRRSECKECGGSQICEHGRRRTQCKECGGSQICEHGRVRSTCKE
FT                   CGGSGLCEHGRERSRCKECGGPGICEHGRVRSRCKECGGSQICEHGRQRSKCKECGGGS
FT                   ICEHGRIRSTCKECGGSQICEHGRERSKCKECGGGAICEHGRIRSTCKECGGGAICEHG
FT                   RERHRCKECGGSGICEHGRRRSQCKECGGSAICEHGRHRQYCKECGGGSICEHGRIRST
FT                   CKECGGGAICEHGRQRHRCKECGGASFCEHGRQRSRCKECGGSGICEHGRRRSTCKECR
FT                   AAN"
FT   gene            complement(51686..52524)
FT                   /locus_tag="MICPUN_64307"
FT   mRNA            complement(join(51686..52251,52396..52524))
FT                   /locus_tag="MICPUN_64307"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(51817..52251,52396..52503))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64307"
FT                   /product="hypothetical protein"
FT                   /note="conserved uncharacterized DUF1168 containing
FT                   protein"
FT                   /db_xref="GOA:C1EHQ4"
FT                   /db_xref="InterPro:IPR009548"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ4"
FT                   /protein_id="ACO67724.1"
FT                   /translation="MSRRGDAGPAANVAKVVTLESTQRQVAVYNPSDPNEGKTGDPVKD
FT                   LEAKLNYITEAVPINPQNIQGSTAGAGSGEFHLYRQARRREQMRIAAMEREDNANVAKA
FT                   QFDARQAEREREAEERTAKNRNKRKAKKERQRAAKAAKKEGDANGDGGADDAGPGPGAA
FT                   AAEDDDDKADDQFEELD"
FT   gene            <52655..>54205
FT                   /locus_tag="MICPUN_64308"
FT   mRNA            <52655..>54205
FT                   /locus_tag="MICPUN_64308"
FT                   /product="predicted protein"
FT   CDS_pept        52655..54205
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64308"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ5"
FT                   /protein_id="ACO67548.1"
FT                   /translation="MATPPPRLHLVHFSVDAADEDRDDDDERTTERKGPHTQCALLWCD
FT                   EATARDPPSGCVPVDPVAGLASLGPGYRGVRGAEAVAALVGACASAAHVVPDATQRSKP
FT                   DEELRIITPSPSSSSSEPLAVSPSAMSLCVRVAAALGDDDGWRPTRVCELGSGTGAAGL
FT                   LVARMLTSTRGARELGARPLVLLTDRDTAALEVIASNVRLNARGWARCVPQRLQWDRRD
FT                   ERSRATRRAAEDDRIPLHDQTHSKHSDALGGSSSGVPPPAPFDLVLASDVLRGSRVDDV
FT                   HHLLDTATELLSGARRGARLVLSHPVVTDAVSFEHANPSSARVTKTELTHLDFVDDDDD
FT                   FVDGEYGDVGADEGHDDALDAFVAAARARGFAVREWFPETETKSQKPKPKPFLAKNQKP
FT                   KRARTFDVYLPGACPGAHLAGYVDVVAQRAVDMRREEDRGLRALMRERYARGWTPPPSP
FT                   PVPTMEPPARSSSSIGTEAAALGRDGDGDGDGDGGKMSAGSKQSSPGKRKKGGFCVVS"
FT   gene            complement(<54277..>55833)
FT                   /locus_tag="MICPUN_64309"
FT   mRNA            complement(<54277..>55833)
FT                   /locus_tag="MICPUN_64309"
FT                   /product="predicted protein"
FT   CDS_pept        complement(54277..55833)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64309"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHQ6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ6"
FT                   /protein_id="ACO67725.1"
FT                   /translation="MASPAPSGVAAMSASLVTVGNPLRSGRQRAALPPAARTATAKRHR
FT                   GEGRIAAKSLLRATAATRAWPVHIDRYDRYDSRRVAAGASSDDETRASKEEDEKTSARS
FT                   SSSSSSNPSSSADANSSSFADEIAAMTGDVPPDPTLALEKQRARDEADAADLANAVDER
FT                   VELPPDTIAPMPEWMYPRRLDSIPALFGRLNPLTGVLVYYTGAVLRECSGQPAVALQWM
FT                   LFVFFPSCAALSFARKFWYESIGKRELKRATERGEPPPPPRMEFNREQRAAWLDLHLGY
FT                   AILAPAGAAGGEGASWWLLLAPFFMLMRYLCAKIGFLTQPRRWFAVVGGAAALAALLMS
FT                   ASGTLTQALGGLRGGGYLGYVLAPLTFALVYVFYLAPAALLPGAIARAWRGEGYSKPRR
FT                   RLANPNPDPEASAEEARARKAWTVIGVVAMGISLATGSDVPVFLCFFAQLFKADPSKLM
FT                   QVMIDKGEPARAEMDQAIADKAAGLFKRKGEEPSGGEERDGGKEGDEKEGTDGPSSPAP
FT                   A"
FT   gene            complement(56037..56708)
FT                   /locus_tag="MICPUN_109528"
FT   mRNA            complement(56037..56708)
FT                   /locus_tag="MICPUN_109528"
FT                   /product="predicted protein"
FT   CDS_pept        complement(56272..56685)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109528"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ7"
FT                   /protein_id="ACO67726.1"
FT                   /translation="MFAIASALTIRPAVKVTARKAVKVSAFYDPDQYDHDANSGRGSGF
FT                   VATQARPTAKAASVSYAAKPTRVTRGADGVVYDPDQFDADANVRSNAVAYKPAGGAMRA
FT                   PAAAYASVGAKPSRVTRGKDGVIYDPDQYDPNP"
FT   gene            complement(<57384..>58046)
FT                   /locus_tag="MICPUN_70860"
FT   mRNA            complement(<57384..>58046)
FT                   /locus_tag="MICPUN_70860"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<57384..>58046)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_70860"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824 - catalytic activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EHQ8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ8"
FT                   /protein_id="ACO67727.1"
FT                   /translation="ALLFDCDGVIVETEELHRKAYNASFKHFGLVIPGKGKVEWSVEYY
FT                   DVLANTVGGGKPKMRYHFDNNGWPSFFGGSKVPTTDEEKTKMVDSLQDMKTEFYKDIVE
FT                   SQAQARPGVLRLIDEAIAAPDIAVGICSAATKEGFLKVVNSIVGPDRLSRLDVVMAGDD
FT                   VTKKKPDPLIYNLAREKVGLPSSKCVVIEDSLVGLRAAMGANMPCVITPCPSSDVPDF"
FT   gene            58784..60334
FT                   /gene="LHCB4"
FT                   /locus_tag="MICPUN_92498"
FT   mRNA            join(58784..59182,59518..59764,59931..60334)
FT                   /gene="LHCB4"
FT                   /locus_tag="MICPUN_92498"
FT                   /product="chlorophyll a/b-binding protein CP29, chloroplast
FT                   precursor"
FT   CDS_pept        join(58823..59182,59518..59764,59931..60139)
FT                   /codon_start=1
FT                   /gene="LHCB4"
FT                   /locus_tag="MICPUN_92498"
FT                   /product="chlorophyll a/b-binding protein CP29, chloroplast
FT                   precursor"
FT                   /note="LHCII minor polypeptide precursor (associated to
FT                   PSII); ChloroP predicts 27 aa cTP; GO_component: GO:16020 -
FT                   membrane; GO_process: GO:9765 - photosynthesis, light
FT                   harvesting"
FT                   /db_xref="GOA:C1EHQ9"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHQ9"
FT                   /protein_id="ACO67549.1"
FT                   /translation="MALAIASNTIVAKFTKKAPAKKAPAKKAAKSVSRGVKRQGNVGPN
FT                   RTLWNGWEANPEPPAYLDGTLPGDAGFDPFGLSAPTEYLQFELDSLNGSAAVNKSGNVI
FT                   GKLKKVDNKPTERTIVPFNEAFDIVRFRECELQHSRWAMLGLLGAVVAEGQTGISWVDA
FT                   GKVLNEQPSYLGFDINVPVTTLVWIEVLAMGFAEVKRSAELDSNKRCYPGGYFDPLGFA
FT                   SSASPEALFKLQTAELKHGRLAMIGMLGISIQALKNGLSPLEAINALGN"
FT   gene            complement(<60424..>65377)
FT                   /gene="IFT140"
FT                   /locus_tag="MICPUN_113468"
FT   mRNA            complement(join(<60424..61840,61959..62876,62976..63363,
FT                   63448..63641,63729..64101,64195..64551,64684..>65377))
FT                   /gene="IFT140"
FT                   /locus_tag="MICPUN_113468"
FT                   /product="intraflagellar transport protein 140"
FT   CDS_pept        complement(join(60424..61840,61959..62876,62976..63363,
FT                   63448..63641,63729..64101,64195..64551,64684..65377))
FT                   /codon_start=1
FT                   /gene="IFT140"
FT                   /locus_tag="MICPUN_113468"
FT                   /product="intraflagellar transport protein 140"
FT                   /note="Intraflagellar Transport or IFT refers to the
FT                   cellular process essential for the formation and
FT                   maintenance of eukaryotic cilia and flagella"
FT                   /db_xref="GOA:C1EHR0"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR0"
FT                   /protein_id="ACO67728.1"
FT                   /translation="MAVYFANKIPRQPGACTATSWSGHAATSARAPAMCAVAYSSGSVG
FT                   VYTEEGDDVTASRPVRSDVPGVYPCALAWHPSSPLLAIGWTDGKVATWSGTELRVVGEE
FT                   TSTHAGRSITCIAWSPTGHRVVTGDDAGKTQVWTVDEKLRPKPTGFRCAKPAPGARTSH
FT                   VLIPNDTAVDEDTGAEPERPFVFYYAVNEGLADSGYVCVGMDTAGDDRGAGESKAESKG
FT                   SKAESKATARGGPEGTQSKWTVVSSTKLPTEGDAELAWTEPGVLAVVNDRDPSCAVRMF
FT                   DLNNGDNYVLVPPARRKSQGLPKGSDGRDTAGGDPTGRRLSCLCYDADAKTLACGQRDG
FT                   RVVMFRRTPPHDSAPEDAWRVCASLDAGGTLERVHFASGRGARLLVAVCRDGARLCVRV
FT                   KLNDKTRGGISVVQVAADSVVVEATDGSRAPARLNTTERGMQILGADATSRHLLVWNSA
FT                   RAEVHEARGSGFARTSAQAMAIHGERIYRACPGRAVVEVTDLGGDVVDALAYEEAQGAA
FT                   EFVDCNGDFLCASTASGHLRFWPHAPGSGPDGDDGDIPEFSGRLPFAIDSVRVNCDGTK
FT                   ASVLFAHRGHHSVLSTLAVYDVDTDGYRTFDFAITGRAPESHAWDAAAPNVLAAQTAFD
FT                   ENFFADEETIYETAKDDDSKNEDDSGDLGINPNPGLLPQEAHPVPDGFESLLGLHAPSL
FT                   FVCNKAAAQGGGGACFAVTMRDFVGMEHLDAHAKAALLTFNYDLAVGDVDRARAMVKAT
FT                   TEPSVWEAMAHMCIKNKRLDVAETCLANLGHVRGGRAVRDGANEPELDARVGNVAVHLG
FT                   LVDDAIALYEQCHRHDLLNRLYQAMGRWDDAIRTATNKDRINLKSTHYAHGRHLESVGD
FT                   VPGAIRAYEKSGCADVDVPRMLHGRGMTDTLERYVINAGSNELTRWWARYCESSGDYEK
FT                   ALHGYQAAGDYLSLVRTYCAQGDLEIAAQLVEESGDPAAAFHLARTFEAMDEYADAIRF
FT                   FGAAGRHGHAARLARRCGMDNELMHLALQSPPEMMLDSARYLEERGEFEKATTLYHKAG
FT                   NAGKALELCFAHDLFDLLAGIVAAVADDTDADPKLVAKCASYFLDNGRYGDAARLLVKG
FT                   GDVARGLELIVEHDVKIDEALAEALTPPKSADPKEDGGISEEARKATLMKIAAVCKNQG
FT                   SYHLACKKYTQAGDKMKAMKALLKSGDTEKICFFAGVSRQREIYVMSANYLQTLRWHGD
FT                   PELTKHIVQFYTKARAVESLSGFYESVAQIEIDEYRDYDKAADALRDAAKHLAKSKADG
FT                   HDALMRSLEARTELVETFVRARTLLAAGDVAEATRLCEQMIADPRARDESEVTIRVGDV
FT                   YAMLVEHWYQARDLKRCRGLVAEMREAAGLAAEPYLEATMLAEIDGGATGAKGGDRKGL
FT                   GSRREDGFEATSPTEEEGYLHGADDDADGEFYMDEEVHSDDDGA"
FT   gene            <65617..66225
FT                   /locus_tag="MICPUN_64314"
FT   mRNA            <65617..66225
FT                   /locus_tag="MICPUN_64314"
FT                   /product="predicted protein"
FT   CDS_pept        65617..66222
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64314"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR1"
FT                   /protein_id="ACO67550.1"
FT                   /translation="MPAIWRPNVSGPLPDVDVEVGVAEGASSKGTKRKRAPPTKGPCEH
FT                   GVKPRWKCKVCSACPHGKRRTQCKECGGSGICEHGRERPKCKECGGGSICEHARERSKC
FT                   KECGGASICEHGRLRYRCKECGGSQICEHGRRRSQCKECGGSQICEHGRERSKCKDCGG
FT                   ASICEHGRQRSTCKECGGGSICEHGRYRYRCKECRAAN"
FT   gene            complement(<66270..>69974)
FT                   /locus_tag="MICPUN_104251"
FT   mRNA            complement(<66270..>69974)
FT                   /locus_tag="MICPUN_104251"
FT                   /product="predicted protein"
FT   CDS_pept        complement(66270..69974)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104251"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1EHR2"
FT                   /db_xref="InterPro:IPR001660"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR013761"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR039647"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR2"
FT                   /protein_id="ACO67729.1"
FT                   /translation="MERRRLERAAAEKARVEAAAATAELKALAAQEAAAREMARAIEVA
FT                   AVRSLRENLERRAAPWRESRARRAKGVTWSTTPKPIFVSYAPTPDATFAELAYCKKIAE
FT                   TLNDDVRTKPPPGESRGERVRLAWLDASELGTLVTSTDERALARLEACESCAGVIAIVT
FT                   PAYNGSEQCAVERDAVRIRRASGIIGGEGDEVPVVAIVVQQPRVSSVVGSIQRDDGDRD
FT                   GEGPQSLNSSSSSDPVAMAPPEGLLGAGDPPPIVVPHEYDPTVAAEAALSALESLRGRS
FT                   AQLRECLGGAAHPGFDPATKTFDASTLTALTKRAPPDERDVKAWMDANGGSWRRRPFLE
FT                   WTKHEAHAFLLSHGTYLKPYADAMLSFGVDGFLLAAIEDEDLRTTFAVANGNHRHVILT
FT                   RLAALCGKRPPVNKEALARHETLMRRRVGIQTSTDPAEQKKTKAATHPVLQKYLTDVPP
FT                   SPTGVTIVEGTGARLARMSDEQLRDFCAEIFIRATDDFDGYLNRAEFKKILKGADLGFS
FT                   ARDVREIMAEVDQKTWENADGLIDWHEFEPLAMRLMRTIGCTVAARAAEEEDSTREEST
FT                   SSGYFDTLPDTSRRSRPMNETGVQYTLSRVFHDATGTDDVGAGGERCVMTKDAFSRTLR
FT                   FAQTGLAKTEIDALAKKASANTRDGSIAYREFEPVAREVLARRVNGEYAAASMYETGGE
FT                   LLKLVLTAFDAVSGGEARVPVVGAAPKGITTAGIAPHVGSIRDAMLVNLRDYGVPVSNL
FT                   HAAVVCAEACRVASSVGTVDWRAFAPVAADRLRGMLDAAEAERRDVAVATFAATEGAKV
FT                   IAELRHHDRSTLRALLSEAFTAADEDGSGALDRDELQNVLLALARRREITPPMRAAMSM
FT                   SMRCVDVDGDGVVRYGELVDFFCDVVGHMERGARVRAALDASERRAAAKRDDDVRRAKA
FT                   LEAEKARDAAEVARANRALKIARLRAECAKYLSALTSDNAYALYRDAVDIVARFSGETS
FT                   SHVTSGDEVITGPSDTHEGTGASDTYDPNPNPKPPFDVHAVELRRGTETRIGTVAPRSQ
FT                   VLRVVVSTCASAVNATMRRGEGASWPAVGYPKANDDENGSNDSNGSNGSDGNGNGGVGV
FT                   AVDVPELDASHGAVSLASSAGDESGSGRPVAAGPGGYFACPFRGGATRGYIAVDTVGEK
FT                   FADGRRISDEDKEIVRIVAECVGDALEEGFRAREGEREEKRRAALEKFDSEEERKRREE
FT                   EFLARYRGK"
FT   gene            <70388..>71386
FT                   /locus_tag="MICPUN_64316"
FT   mRNA            <70388..>71386
FT                   /locus_tag="MICPUN_64316"
FT                   /product="predicted protein"
FT   CDS_pept        70388..71386
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64316"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR3"
FT                   /protein_id="ACO67551.1"
FT                   /translation="MTKTAKSSGKKPFGANDLILRSNVRRALPDEDVEVGVTEDASSEG
FT                   TKRKRAPYTKGPCEHGVKPRSQCKVCSACPHGKRRRYCKECGGSQICEHGRIRTLCKEC
FT                   GGSRICEHGRERRRCKECGGGSICEHGRQRSYCKECGGSGICEHGRQRHYCKECGGGSI
FT                   CEHGRRRSECKECGGGSICEHSRVRYTCKECGGSQICAHGRQRSTCKECGGSQICEHGR
FT                   IRSTCKECGGSQICEHDCIRSTCKECGGGSICEHGRQRDYCKECGGSRICAHGRERRYC
FT                   KECGGSGICEHGRQRKQCKECGGSAICEHGRQRHQCKECRGSSVPVGRWVL"
FT   gene            complement(71398..72769)
FT                   /locus_tag="MICPUN_109531"
FT   mRNA            complement(71398..72769)
FT                   /locus_tag="MICPUN_109531"
FT                   /product="choline transporter like family"
FT   CDS_pept        complement(71453..72742)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109531"
FT                   /product="choline transporter like family"
FT                   /note="sodium ion:choline symporter"
FT                   /db_xref="GOA:C1EHR4"
FT                   /db_xref="InterPro:IPR007603"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR4"
FT                   /protein_id="ACO67730.1"
FT                   /translation="MVYFKVAVIFALALIVASGGGDSPGAGVFLALLGCLTAFVFWLWR
FT                   REIDLVARLLAVASKSLQDNPHVVTAIVGVKLALLTLTVPTFAFVSAAYRNGRVVRDPD
FT                   AVLQSGKDTCLDENGDVAPCCVWETDDWASAYVAMTSLFWLWTVMLAFEVRMFTVAGVT
FT                   AQWYFAPPGVRAFAGTTIGTMKNALGPSFGSLALGSLVLTAVHVAREINQNVRRNAREN
FT                   GGGALQILACLVTACMDCVYAVIQHVTKYATIQCAVTGAAFCDAAAAVSRMLTENFLNA
FT                   YAVWWLPGTLLSAAAFVFAAAYGTCVGVAGYVAWNGADGHENAGGESVILGFVSFCLAL
FT                   VAVNFCVTVLLDVVDCVFVCYVMDLDRQRNSRPEVHEIYEEVKAKTAKAAPAVGGSGGS
FT                   GGSGGFGGAVVQGPGGNVAYGNRRGADDNL"
FT   gene            <73285..>74328
FT                   /locus_tag="MICPUN_64318"
FT   mRNA            <73285..>74328
FT                   /locus_tag="MICPUN_64318"
FT                   /product="predicted protein"
FT   CDS_pept        73285..74328
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64318"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR5"
FT                   /protein_id="ACO67552.1"
FT                   /translation="MFQKTRCHVGCQLCFKRASAGGALGRGAGMFKLPLRPTVRRDPPD
FT                   DGVEVGVTEDASSKGTKRKRAPRTKGPCEHGVKPRSQCKVCSACPHGKRRSVCKECGGS
FT                   QICQHGRVRTLCKECGGSQLCEHGRQRYWCKACGGSQICEHGRQRKQCKECGGASICEH
FT                   GRVRSKCKECGGSGLCEHGRLRSRCKECGGGSFCEHGRIRSQCKECGGGGICEHGRQRS
FT                   KCKECGGGSICEHGRERHRCKECGGGSLCEHGRRRYECKECGGGSFCEHGRRRYECKEC
FT                   GGSGICEHGRQRHKCTECGGASICEHGRVRSKCKECGGGGICEHGRERSKCKECHGSSV
FT                   PVGRWVL"
FT   gene            complement(<74442..>75938)
FT                   /locus_tag="MICPUN_64319"
FT   mRNA            complement(<74442..>75938)
FT                   /locus_tag="MICPUN_64319"
FT                   /product="Drug/Metabolite transporter superfamily"
FT   CDS_pept        complement(74442..75938)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64319"
FT                   /product="Drug/Metabolite transporter superfamily"
FT                   /note="phosphate:phosphoenolpyruvate translocator"
FT                   /db_xref="GOA:C1EHR6"
FT                   /db_xref="InterPro:IPR004853"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR6"
FT                   /protein_id="ACO67731.1"
FT                   /translation="MPSLGRLAPRLRPLVAKPPGSRGEGTSAWILAAMHGSLYVALSAS
FT                   LVLANKHLVVNTRTPILIASLGSLFGTIVAWTLVGFGRVELKTRLTTSQWVTYVLPTGV
FT                   FAAVALAFANLALTYVSLSLAQMAKAFAPAVTAAALVTLRLDRAFDDKCARAVCVIVGG
FT                   CVVAAWGATATGNEPHAWIGLGCMVACEIAEALRLCGVQYLLSSSSTVKNNATTGNSNT
FT                   GFDPATSNPGSSQPTNQGMTLFDGLFYFSPISLASLWLLVYAFEWDGLSAELHGRAALG
FT                   NPLSLLATGTFGFLANVAGLGVVQHGGAVTLTTLSLLKNGVVIALAVVAYGDPVTVRAV
FT                   AGYTAATYGFVMYQEARAKAAAAAAAAAQGLGSSGIIGGGGGIVEGGVGLVGGNTVTLG
FT                   VGVAPTGVGVDLGVGVGAMNGVVVGGGDGSMSSSSSAKSLQRTSSGHVVTAVLGLPKLK
FT                   TGRPGGAKATGSSKGGGGGDKSPRRRTVGNVDKEREPLIP"
FT   gene            <76115..>78124
FT                   /locus_tag="MICPUN_64320"
FT   mRNA            <76115..>78124
FT                   /locus_tag="MICPUN_64320"
FT                   /product="predicted protein"
FT   CDS_pept        76115..78124
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64320"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; ATP binding - nucleic acid
FT                   binding [Evidence 8026; helicase activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1EHR7"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR7"
FT                   /protein_id="ACO67553.1"
FT                   /translation="MRASAPGCTSRGARVGPGANGIKATARILASGVRRGATATVARAS
FT                   RPSTVVAMPFAPGPTRRAIAALTMRARLLIHTGRADASSSSTRPSRFLVTTRRSTAAAA
FT                   ADATNPRRSDPPSSPSPSVVDATDDASVAFANLRPKLHPKLLAALHRAGFVHATPLQTR
FT                   AVPATLDASPDGATRDVVVAAETGSGKTLAYLVPVFSNLLFHGHGGDGGGDEHGAMRSN
FT                   GRLGALILAPNSTLCEQVKRVADSLVGDDGEPLLVTRALTPDTSMPSPVSSGSSGYEAS
FT                   SGTNRGLPDVVVATPARAAEDVLEFTKGGWRRGNFAPAATHIRHVVFDEADQLLSGGYL
FT                   RPVRGAFDVLYREEKLAALGLTVPGSNPEGGGDFNVFNSLEGPEQSEWAGDKSRPKDGG
FT                   DRAWSADHDDINVVAKRKGKSRMGKGAALGGKGEIGVGEGRDFRRQYVFAAATVMSNGK
FT                   KTPGAMIRHGFPDARWIEGRRLHKAVATVDQTWVKVTASTRADALGRALALGDEKRQRD
FT                   RTLVFVNSTRACEEVTAELIRQGLSAAAFHAEVGTRERSSRLVSLANGDVTVLVCTDSA
FT                   ARGVDVPEVVHVVQAEFAANAVDYLHRIGRTARCGASGRVTNLVSNADADLVDAVRAAE
FT                   AAGAPVEGAFSRKRSFRKKFKKYGPSRTAPQNRR"
FT   gene            complement(78134..>79243)
FT                   /locus_tag="MICPUN_50709"
FT   mRNA            complement(78134..>79243)
FT                   /locus_tag="MICPUN_50709"
FT                   /product="predicted protein"
FT   CDS_pept        complement(78242..79243)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50709"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR8"
FT                   /protein_id="ACO67732.1"
FT                   /translation="MFRATTAPAPSAAASRCAHAGREDERRRCRHRAWTRVAPRVPTQS
FT                   ARGGDDSSVRLAHRRSRVAAAASASSSRGGGTPGSWNLGVAHSAANKKDQRDYVDALFA
FT                   QYPHLMAAAEADDWKKTRELMDSVYLPAPDASTAKIRDAQVRAAALAATRAGSAKSLRL
FT                   LLDRGASLGLFEDVGSDDPDGRLRCTMGIECAGRGAAEVLDVLLSETVGVSTECRDPRN
FT                   GMTALMAAARFGHVACIAVLVDRGADVDARSDFGSGANGGGSTAAMMAAENGHAGALNA
FT                   LRAAGADVNLTREVDGKTAMSLHREKVTAEMKKLSNMGYVQGSAIGNYATEI"
FT   gene            <79409..>80839
FT                   /locus_tag="MICPUN_64322"
FT   mRNA            <79409..>80839
FT                   /locus_tag="MICPUN_64322"
FT                   /product="predicted protein"
FT   CDS_pept        79409..80839
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64322"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16779 - nucleotidyltransferase
FT                   activity; GO_process: GO:9058 - biosynthetic process"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHR9"
FT                   /protein_id="ACO67554.1"
FT                   /translation="MGLRRALAAPLQASPFILASLYAIVRALLKERPWSTQARAQKELT
FT                   DSIPRVSPGTRVCVYGLSANPPTGEGGHATIVAHLRRMFDEVWVLPVYRHAFESKSNLA
FT                   PYDHRVRMCELAFGLGNMTEQQRRTEKVKVLDVERAVVRAAWDRHRVAEEEAKRVRADA
FT                   HARRGGGGGDASSSSSSRGGDGPNSTPGAQSTASESSAAPSPKARKTPPMSPSASTASD
FT                   ALHISPFKSPTTIGAEPSAGPGATNVRAHHSERHPHSCVPPPKVGSFDVITAIREANPF
FT                   ASFSWCLGADTFADLRRGRWRNGAEFAALCTQLYVVPRVGGAGAAWEEIEMGTTYGDEH
FT                   GDGDGDDEHEIDALLSGMGGDGGLGGDGAEGGAEGGAEGSGAFGDAGLVRVDNASVMDI
FT                   PGMSADVSSTAVRDALRRRRRRLHERDRANGKAFTPESSDGMEMGGRGADLLLDEATLA
FT                   TAVSEDVLRYAVEHGLYA"
FT   gene            complement(<80966..>82366)
FT                   /locus_tag="MICPUN_64323"
FT   mRNA            complement(<80966..>82366)
FT                   /locus_tag="MICPUN_64323"
FT                   /product="predicted protein"
FT   CDS_pept        complement(80966..82366)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64323"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036047"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS0"
FT                   /protein_id="ACO67733.1"
FT                   /translation="MTEQGASDDAEVRKDGKKIIIVCSPSGLRGRYAFKPSQFKGALRK
FT                   LVTFYAKKHFVPEDACKWYCASWAEPAEGQTRIKPLIKGELDVSLSLSKYIELHGETRK
FT                   VVRGCEIGYVCVGVKFTKKRCEMQWLTPEEAFARQFGLGSLTYPARHLASPTLGLADMS
FT                   MEEDTTPIWASLPLHILERVYRHLNNPDDLACAMLVCKQWSLDSPEQRMRAMATGLVAD
FT                   KDDLDSVADYCFNGERLGGNVTLMQFAVMHKQDVQAVRGLLAIGVKPDPHSLKFAVLCN
FT                   SPVARGYKTTNDCSNLEPHIIDWHKWREDQPPCEDHIAIARALIDAGLEVDFVFPDACK
FT                   VGHRGMVAALIDTGKVSADVMDAAVGHIGLVNFEDFAMIRLLVERGANINVASDLSKNV
FT                   MNPLFNAIMHCDANMVRLLIEVGADVNQKDANITPLALASYPGGQPEEADPDFWEIRDI
FT                   LKAAGAVL"
FT   gene            <82511..>85324
FT                   /locus_tag="MICPUN_104257"
FT   mRNA            <82511..>85324
FT                   /locus_tag="MICPUN_104257"
FT                   /product="predicted protein"
FT   CDS_pept        82511..85324
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104257"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS1"
FT                   /protein_id="ACO67555.1"
FT                   /translation="MPKRVWAAPPWPAHCPLPSDDDDTARVVAAAGGARGVTHALVSLG
FT                   DERVIEATLTRLHAERAARTARLTKALDAGVAASDVALRAEWDALIARVTAPPDGADTP
FT                   APVAVPRDLHATTTTTTTTKPTPRSASIAAVDDATPRHRRARRSQTLTPATNTHGAGGD
FT                   EVVAATPDAELAAAPSSFSAGANKNRATRSRSRSSPAPILADTPTIPDADAADDAADDA
FT                   AAADDDALDHPGSYKPLASSQLAGRYSISATAEYRAAAALAFAKTPTATLRSSLETTDD
FT                   GVVLDGTLDGTLDGTLRDGASFPLDTALPRRVPEDGDTLMVEETPRSEMDRRAGGGSGS
FT                   GNGASENTNAKGNANGDGSGNGSGSGNGGGSGNGFGAIGRRRGVAGHRLRFSVGGSLVA
FT                   DAGAEAGAEAGADEDTPPDPVAERIFSATHASGSVVLGVMAPPPVAPGADRVFAVVTES
FT                   SEGSEDVTVMVWRVRCHSDGDVRDGGGGGWNRSRDVNSHRGFGTTTCELAGSARLRKRD
FT                   WTGAGGKENASPRRVNIASLMPPVPGTVTDRYGASRSARDSLDPATRGKRQSGAQLCGA
FT                   VALSPCGEFLAIAESQFIVRADGDDDATGTNRGGRGACVVRVESRRDERGTNSAWIDDR
FT                   DVVLALDCPLRVTRLAMRWDPAGDGTAGDAAGDAAGDGSTERSARVVVVAGAPLGKMHA
FT                   WRFDASDLDPKKSRSKKTPGERMPDLRYLDQTPMSDPLDVLAFASTGDDVVAVTHDGLV
FT                   VGNYRRTPRNGWETRGVHYTQRHRVRAMAPLHPAAVAVTSAVTSASSAQSFVPFLALVE
FT                   RKAEPRDGVLRLHAGAVGVGVDVCAAMPLDGVCALAAGPTTGAFAAVGTNTGDVLAFDV
FT                   LTGVTIARLGDLRGEDGGVVGVATAPWEAAGDVCAGNVCAGNGRSSAALLVAASKTRMA
FT                   AYVVHAS"
FT   gene            complement(85334..>86477)
FT                   /locus_tag="MICPUN_50710"
FT   mRNA            complement(join(85334..85918,86146..86212,86371..>86477))
FT                   /locus_tag="MICPUN_50710"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(85859..85918,86146..86212,86371..86477))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50710"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR035204"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS2"
FT                   /protein_id="ACO67734.1"
FT                   /translation="MGFLTRWLAGKMEDPAKRQADFEKHMTTTMAKCEEIKKNWEQPTK
FT                   THRWWTKDRNQLTYKFSLEPMLVNAPGRAQNW"
FT   gene            <87028..>90672
FT                   /locus_tag="MICPUN_104258"
FT   mRNA            <87028..>90672
FT                   /locus_tag="MICPUN_104258"
FT                   /product="predicted protein"
FT   CDS_pept        87028..90672
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104258"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHS3"
FT                   /db_xref="InterPro:IPR002999"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR039776"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS3"
FT                   /protein_id="ACO67556.1"
FT                   /translation="MDASGPARVHPTTADGELAQSQSHRKPESLGGARGDDAGNSPRDA
FT                   SSEPEDPVERFAVMRALETLRDEHAEPHERTSACERLRDFARATPTVLAGRRRQIRGLL
FT                   GTCLPILARVFHPFPRAASDGPPRDDADVRAAALRAYIAAAYGQRETDDDDDDAQLAAD
FT                   WRKNVSAVEALAATATSSRAAVAPRVSALDVIGRCAGEVRGIFADRARQTVGGDSYSRG
FT                   GVDVDSFDERFDERFRATVEAVVRAATSTPNEHTDEEWAAVMECACRLCPHYHPPRDGS
FT                   STLGAELVRSLGSANDRVAGSAARIAGKLAWPDVIDERRSDVVDALVALTASEGRAAWV
FT                   RHAAALAVGRVGAARDGWRRSAGSTAPSTAPSTVPSTAPSTAPSTAPVANETSNAGEDP
FT                   PRSPDDAAFVDAAARVDSLVVDSARDRAPDLHVPSIGNAPHHHGPHHQQQRRTPRDALA
FT                   AALTDPCGFVRVAATHSCARASKADCVGAMHLLLPNLRARDAYLREATCRALTALWTEE
FT                   HVPAMGAIPAGEGAAAGAETAAEGDVKTDVKAEVKAEVKAEVKAEVKAEVKAEVKAEVK
FT                   AEAEAAEAKTEAPPSDGLPHPPALKTKTPGELARLKLMAATAANVAPLLDDADGGVREA
FT                   AAECMGHLKESATAHLDALRALMKDDREEAVRDAAVDAMTRLGFYNPLTGSVKQRGFYR
FT                   TWRPRRDGEGSGGRRPASSLSRTRACEVGATVRVWWPDDAQFYEARIKAWDRERDVHTL
FT                   LYILDGVEEELDLKKERVELRYKPHKRGAKESWLPIREKKEKKEKKPKKEPRERKPRAP
FT                   RPPKDPREKGVKRAEVTVEKVGKGRAVPVGARVRVFWPLDDAWYGGEIVGHNDKESVNK
FT                   QGELKVTKLHTVLYHDGVREDLNFDKEKVQLVSVGAGDGIPPLDGQPPLRVPIVGGNQP
FT                   GWILPNARRGAERVAVCGEGGVVVREMSLLDFHDEYVVSASGNNSGDTNKESSGNVGQK
FT                   RWRRTLSFDPARCGERLRRRGGCAKAVSIGRWLANQGAAWGDAVVGRPVKVRPSGWSYG
FT                   ERDYAEAERSDAPTRGTEVSGSNPAEAACVGEKRKAPEPGANADESAERRTPILGIDGG
FT                   RKKSLKDIYEEDPRSSSQPEKDEEAAAGDGETAAVEPADDDGLGGDSPGGDSPGGDSPG
FT                   DETDDETEWRSASIVGFNAQTGDHQMLYSDGTREWLPLILHETKPASD"
FT   gene            complement(90671..>92676)
FT                   /locus_tag="MICPUN_64327"
FT   mRNA            complement(90671..>92676)
FT                   /locus_tag="MICPUN_64327"
FT                   /product="predicted protein"
FT   CDS_pept        complement(90781..92676)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64327"
FT                   /product="predicted protein"
FT                   /note="distantly related to glycosyltransferases"
FT                   /db_xref="GOA:C1EHS4"
FT                   /db_xref="InterPro:IPR001503"
FT                   /db_xref="InterPro:IPR038577"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS4"
FT                   /protein_id="ACO67735.1"
FT                   /translation="MDGRAMDYGATDHGGDVHLTLESDDGAPANANAPPRAGGSRRARW
FT                   MTMGVTGRGARRRLALDAGSAPRELEWGGRYRGWTVACAVGCAFLAGVALALALVASTG
FT                   AGGDLRRLLAAPRDGVGSFRSSSPSSSSSSSSSSAAAAVRTPLPGLALAEPTHEPAGPA
FT                   HEPAQHTAIEDDGRPSVTVGFESSGDFYWLPVVRLLEAALPGVKITLADPTYDWSAVNL
FT                   ADLTTSSSRHNGRHDRYDAQADGSRSAMRDLRVDATSDPSVEPDIVVEGPDIFQAGRDE
FT                   GSRCSWGDKPWVQTTAEPSMFFNAWEWCRHESDPVMRLETGLAHYNQNLVYDPKKTTYV
FT                   WSPYAMTHAWLMRDHLADRLNAFKDNPPDLRRHMVGWASGNCQDHRAQIFRALQRASNR
FT                   GWREGRVDELGRDGAVHALGACEHNVRWSSADEYPPRGTKPWELYKDYRWVLALENSAE
FT                   PGYVTEKLVNAMASGAVPVYYGDSRAARKVFKRGTFVDVLEIWRLKGHVPGDPEVPGSP
FT                   PTESDWDVIADYVVAIDRDPDAYAKFFAHSNALNETPESEVYDDAVKFEIGVDYPNEPF
FT                   PQIDRPVGEQIGPDSGATREAVWRLRDLFRKKLDERDAWELRRANGAAQKAPARG"
FT   gene            <92923..>94728
FT                   /locus_tag="MICPUN_104259"
FT   mRNA            <92923..>94728
FT                   /locus_tag="MICPUN_104259"
FT                   /product="predicted protein"
FT   CDS_pept        92923..94728
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104259"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHS5"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS5"
FT                   /protein_id="ACO67557.1"
FT                   /translation="MASLPQWAAHQAAASHRAPRHPRRAWRWNERTAAASWSSTRSRSS
FT                   PVRTSAKPERNDARRDRRAESADWTVPDGVSHGDVARQPAGDHVHPSHLIPPNLRRPDV
FT                   PETYKKKPVALLMGYVGAGYSGNTTNASLPRGSTVDDVLEDALFDAGCILLSNYRSRSL
FT                   SRLKWSRSSRTDKGVSSLATVVSARLEVDVGVWENDPEGTRIAADINRHLPNHVRVFGA
FT                   YSTPKSFQARRACVRRTYDYLLPATCLGLNVNGERDAALAWPGAPELADATGEEVMARF
FT                   RRALRMFEGSHYFHNYTRRSAYAPAPDGGRRRARARGAGDDEDDETEGSEPMDEAEDGE
FT                   AEDGAGDSPPEHVGCRRRGCYWLKARDDADLVGVKHARKVNSFIAADPAVAAGHKDAPP
FT                   FVRVTVNGDSFMLYQIRKMIATAVAAAIGHFPLELIPASLTRPARIATPIAPASTLYLV
FT                   DAEFMSFRPRKEAKVSGPEMPGDAENIAENIAKRRQTSPNEQCVVPNRLDALVPGAEVR
FT                   ASIAEFQRFVLDPALAPAVADAEWGVFVGNLRKLRINVDDFDGDDGKGDAVRECLAAHA
FT                   EYVAMREERRAEREERERDAAGALA"
FT   gene            complement(94733..95318)
FT                   /locus_tag="MICPUN_109533"
FT   mRNA            complement(94733..95318)
FT                   /locus_tag="MICPUN_109533"
FT                   /product="predicted protein"
FT   CDS_pept        complement(94803..95087)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109533"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS6"
FT                   /protein_id="ACO67736.1"
FT                   /translation="MGPRADGGFVGGGGGGVAGGGEPAFGYEDRSDDYDYTTKDLAVDL
FT                   ASPLVAYKVVSWALNQEVPRWLDAITLAFTLAAVYAVLFDVTALDDRLQ"
FT   gene            <95538..>96428
FT                   /locus_tag="MICPUN_64330"
FT   mRNA            <95538..>96428
FT                   /locus_tag="MICPUN_64330"
FT                   /product="predicted protein"
FT   CDS_pept        95538..96428
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64330"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS7"
FT                   /protein_id="ACO67558.1"
FT                   /translation="MPTVSEPDLDELRASVAEMEGRASEEEEDASKQGTKRNRAPHTKG
FT                   PCEHGVKPRSQCKVCSACPHGKQRSKCKECGGGSICEHGRQRHRCKECGGSGICEHGRQ
FT                   RHRCKECGGAGICEHGRQRSYCKECGGSGICEHGRRRSGCKECGGSQICEHDRVRSTCK
FT                   ECGGSQICEHGRQRSKCKECVESRICKHGRQRSTCKECGGSQICEHGRRRSQCKECGGG
FT                   GICAHGRRRSQCKECGESQICEHGRQRYWCKECGGRGICEHGQELFKCSNCEGGGLCEH
FT                   GRRLSVCEECGGGST"
FT   gene            complement(<96571..>97428)
FT                   /locus_tag="MICPUN_64331"
FT   mRNA            complement(<96571..>97428)
FT                   /locus_tag="MICPUN_64331"
FT                   /product="predicted protein"
FT   CDS_pept        complement(96571..97428)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64331"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011421"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS8"
FT                   /protein_id="ACO67737.1"
FT                   /translation="MGAGDRTDAEADDATDMSAKRRAEVDALWAKLNGGGGAPDASARA
FT                   PAAAKARGRGGKKAAAPANDGDGDGAAGPSKGKAALGVLARLNRVAGGGVAKKGATKGG
FT                   DRGSSRKKAPNDSDWRKALGLDGDANRPARAKVSAEAVKEALAKAGGGVRMRAVERTDG
FT                   VMTVKETRNFAGKEMEVTKTYAEGSKEAKQAAKRDAAAKSGGLDGVLLQMEKTRKLNVL
FT                   DKSKMDWKDVKEGDAEMEEDLEKHKRGKTYLEEQDFLKRAELREYELERDARLNADVRT
FT                   RGRL"
FT   gene            <97542..>98399
FT                   /locus_tag="MICPUN_64332"
FT   mRNA            <97542..>98399
FT                   /locus_tag="MICPUN_64332"
FT                   /product="predicted protein"
FT   CDS_pept        97542..98399
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64332"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHS9"
FT                   /protein_id="ACO67559.1"
FT                   /translation="MSRRALRWTRGWMPSIWRPNVGRVLPDVDVKIEVTEVDASNKGTK
FT                   RKRAPPTKGPCEHGVKQRSKCKVCSACPHGKRPSVCKECGGGSICEHGRRRTQCKECGG
FT                   SGICEHGCQRPRCKECGGGSICEHGRHRYSCKECGGGAFCEHGRQRRYCKECGGSQICE
FT                   HGRERPVCKECGGSQICEHGRVRSTCKECGGGSICEHGRQRKQCKECGGSQICEHGRRR
FT                   SQCKECGGSQICVHARERSKCKECGGSQICEHGRVRSTCKECGGSQICGHGRRRSMCKE
FT                   CKKM"
FT   gene            complement(<98446..>100496)
FT                   /locus_tag="MICPUN_88700"
FT   mRNA            complement(join(<98446..98604,98942..100108,
FT                   100323..>100496))
FT                   /locus_tag="MICPUN_88700"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(98446..98604,98942..100108,100323..100496))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88700"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHT0"
FT                   /db_xref="InterPro:IPR000690"
FT                   /db_xref="InterPro:IPR021966"
FT                   /db_xref="InterPro:IPR024598"
FT                   /db_xref="InterPro:IPR031774"
FT                   /db_xref="InterPro:IPR031776"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT0"
FT                   /protein_id="ACO67738.1"
FT                   /translation="MASTLLERTRESHEEIERLERAICADFRNEAVTHKERLAQNHRVR
FT                   SMLDDMANKSKRLRAVYEDADGVRKEEIEALGGGSNVFSAFYDRLKETRDYHKQFAGYH
FT                   APLSDEFLRQYRDGKPPEFSGEEASGRYLDLHAHHRAFQNASFGSKDCEYIAYLSVVGD
FT                   FDPIPREKKFTKAYEEYLSGLVGYLRGFHARVKPLVFLDTVTRKAEEEFETRWASGSIP
FT                   GWEDKGLVAVKSNVVDLEAFDSAVEMETAVGMDKIKEALASMGLKQGGTPTQRRDRLWS
FT                   TRGKSVGEIDKKLFAKGAVTGADDADAKKKEERAKGVARAESLAQTLLEHLRQQLEATK
FT                   GNVEKKATLSLAELEAEAEEDDDWVEEEAEDEEEEIYNPLKLPMGWDGKPIPYWLYKLH
FT                   GLNLEFTCEICGNYSYWGRRAYERHFKEFRHQHGMRCLNIPNTKAFAEVTTIADALALQ
FT                   KALDARKVGQWKRETDEECEDADGNVYNKKTYEDLRRQGLI"
FT   gene            <100684..>101856
FT                   /locus_tag="MICPUN_104262"
FT   mRNA            <100684..>101856
FT                   /locus_tag="MICPUN_104262"
FT                   /product="predicted protein"
FT   CDS_pept        100684..101856
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104262"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT1"
FT                   /protein_id="ACO67560.1"
FT                   /translation="MTTVWEPDLDELLAIVAETEGCASEEEEDASNKGTKRKRAPPTKG
FT                   PCEHGVKPRSQCKVCSACPHGKRRRHCKECGGSQICEHGRVRSQCKECGGASICEHGRQ
FT                   RHRCKECGGAGICEHGRQRSVCKECGGSSICEHGRIRSTCKECGGSQICEHGRQRHRCK
FT                   ECGGGGICEHGRQRSVCKECGGSQICEHGRVRSTCKECGGAGICEHGRQRHRCKECGGA
FT                   SICEHGRQRRYCKECGGSGICVHGRQRHSCKECGGGGICEHDRQRHRCKECGGSQICEH
FT                   GRVRSTCKECGGGSICEHGRRRSGCKECGGGGICEHGRQRSRCKECGGGSICEHGRRRC
FT                   ECKECGGSQICEHGRRRSQCKECGGASICEHGRHRHQCKECRAAKAKQSR"
FT   gene            complement(<101916..>103210)
FT                   /gene="D1BLIC"
FT                   /locus_tag="MICPUN_64335"
FT   mRNA            complement(join(<101916..101960,102002..>103210))
FT                   /gene="D1BLIC"
FT                   /locus_tag="MICPUN_64335"
FT                   /product="cytoplasmic dynein 2 light intermediate chain 1"
FT   CDS_pept        complement(join(101916..101960,102002..103210))
FT                   /codon_start=1
FT                   /gene="D1BLIC"
FT                   /locus_tag="MICPUN_64335"
FT                   /product="cytoplasmic dynein 2 light intermediate chain 1"
FT                   /note="involved in intraflagellar transport"
FT                   /db_xref="GOA:C1EHT2"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040045"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT2"
FT                   /protein_id="ACO67739.1"
FT                   /translation="MSSSQVPRPPSARSASSSASRAPSTPFDAGQKNVWTDVIDHNKSV
FT                   AKQRGDSGRPDGVLFVVGSRGCGKTTLVNRLLYPDKTEVPKPTEGMEYNYARRASSGAG
FT                   GGGGGVDRKDVAHVWEIAGSRHFADEVTEQDNVFLGPRHVTTAVVAICVDLAKPHEAMR
FT                   TAEYWLGRVHARCAKTFEKLAARGSRLPEQLVRRSERVFAAGGGGGGAAGGAHEDAHSP
FT                   LVRHSGVTVLIVATKHDAWRRTDPERMKVLVRALRFLAHANAAGLFFLGGFGAADGDSR
FT                   ADRSSLNDADDADEYPGEMRSQFNQFRAYLNHLMFAGADRKFPGRIAARLDHLRPVTCP
FT                   VGGDRLSSIGVPKGAEGGGEPLRAWRDVTSRMFPPPRDGDGDEGSKVAGTAPDLSKFPE
FT                   REVDEEPGDAPRGGRGRG"
FT   gene            <103632..>105551
FT                   /locus_tag="MICPUN_64336"
FT   mRNA            <103632..>105551
FT                   /locus_tag="MICPUN_64336"
FT                   /product="hypothetical protein"
FT   CDS_pept        103632..105551
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64336"
FT                   /product="hypothetical protein"
FT                   /note="May contain a IMPDH domain. IMP dehydrogenase / GMP
FT                   reductase domain This family is involved in biosynthesis of
FT                   guanosine nucleotide. Members of this family contain a TIM
FT                   barrel structure"
FT                   /db_xref="GOA:C1EHT3"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT3"
FT                   /protein_id="ACO67561.1"
FT                   /translation="MASSLPSPTGRGGAVVIASEGGSSSSGVGGGGRRGTPDRGGAHGG
FT                   SLNHSSHALTQTVQKRRSAMTRCMTIFAASLIVFELLRHLVFVGGKFCGELPRGAPVAV
FT                   LLAGSAHAFNRTHCGLANRVIAPFTRLGHPVVVFAADENGDDDAMVPALERIRKDYPNV
FT                   DFVVAPPAAASQKDLHDRCVESVERRFRRMGVGPGSIYAESHQTHAVARARWEERNLDD
FT                   SRLDDDGSDRSSTSGRGARPRLPGRDARADEDDALGAHRRRIVHYMRRLAARKRADDAR
FT                   LRWESGDGSFNSGGKTGSGVGQGTGTGMDRGSPFAWIVVARPDVAFADEIPADRACVPP
FT                   GGRRVHVPWFHSRGGANDRFAMAPPEGAAEYLGLYDSLCDNHALAAGEDYAGMIPRGVD
FT                   SSEKVLRWHLRRRHVATDPWLLFNFVFYRVRSESNFDDWDRSPDTRLAGSPFNPSRGRW
FT                   SDASAELGRCPAIYERSTRGHRRSGGKTTQEGSELARRGGDEREVGGSNPARGAGGRKG
FT                   GRFGSVGGTGWVGKIVEPGMEDADADADADDEPLGPEDLGMTGAAKGKSKAGHHVTWLI
FT                   ASTSTEAQTLIPEWVLGFCLVFFGLAFTLIASGIVAEGFRHYRAFYANRREERERKRGD
FT                   GDEV"
FT   gene            complement(105613..>109935)
FT                   /locus_tag="MICPUN_64337"
FT   mRNA            complement(105613..>109935)
FT                   /locus_tag="MICPUN_64337"
FT                   /product="predicted protein"
FT   CDS_pept        complement(105733..109935)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64337"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4289 - subtilase activity;
FT                   GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1EHT4"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023828"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT4"
FT                   /protein_id="ACO67740.1"
FT                   /translation="MTVPRGAGRRGSTSPRGAIAVRRHTARCARVGFGLAFALLACARC
FT                   VAAVADPTQRDRCDAPIDGTDRPVMSCDATDAGATDAGDGRLTGVSTTAEFLRDRYVVR
FT                   FDDYRPIEAHYDALVAALGPPLNAEEGAMGKPSTDDAPTHAGESATRIEHRVDRGFVRI
FT                   PRDDDAPRSERSVRWQWVVRDNPATRKFPTDFAVIAVDADDDEFMAPVTIAPTTKAPQT
FT                   APPTAPSTDDARAEALLVVGAVDGVRDVRREQRLLRSLAWERADAPDNDDGGADSGAHS
FT                   GADSGADSGADSGADGVPTGARVGPGVDPVAGGLRWGDAGEDVGGAPNRAERRRRERRG
FT                   GSGAHQGAHVSRHGGGGGPSPGRLRTRPTIGMEPPGYAPDLDAGGLYHDDVEPSFGGST
FT                   REGDREERDEVDGDTKPRANAGGRSLAAARHVVDAFDAAALWREGFSGKGVKTGVFDTG
FT                   VRADHPHFRKIKERTNWTHERTLNDGLGHGTFVAGVVASQDGECPGFAPDAEIHTFRVF
FT                   TNDQVSYTSWFLDAFNYAIATEVNVINLSIGGPDYLDLPFVEKIDEIVANGIIMVSAIG
FT                   NDGPLYGTLNNPADQLDVIGVGGVDYRDKIASFSSRGMSTHELPHGYGRVKPDVVAYGR
FT                   DVMGSKIAGGCRSLSGTSVASPVVAGAVTLLASVVPVEKRWKILNPGVMKQALVEGADV
FT                   IAGGPMIYEQGAGKLNLHASREILRDYEPRASLVPGRLDFTACPYMWPHCRQALYHGAM
FT                   PFMFNATVVNGMGLTGWLEAAPVWTPTGGDGGDGDDGDRSDDLGKHLDVRFEFSDVLWP
FT                   YSGYLAFYARVKKSASTSEGVASGVITFTVLSPPGPDETTLRRSTVRVPVKFQVVPTPP
FT                   RAKRVLWSQYHSVRYPPGYVPRDNLDAKNDILDWHGDHPHTNYHAMYDALRDKGYFLEI
FT                   LGSPLTCFDASRYGALMLVDAEEEYSDEEIKKLRNDVVRKGLGVFVVGDWYNVKQMESM
FT                   RFFDDNTHSHWTPVTGGANVPALNDLLKPFGFAFGDAILHGAATLNGQAVAIASGANIA
FT                   RVPAGAFVHKAFVADKAPKGGTGAGGGKAAVSGGGGNKEHVVAAFFQVPGEQGGDGSHP
FT                   NDGSDDDTSVGSPAGRLAIYGDSNCLDSSHTSAPCFPFMGNVLEFLTENALDTGLTSDK
FT                   NLAPEPYDNGEELPTRRTDVDFDALSTTRGGTPGNEGLNRCGPNSPPEFWQSSGAGEDV
FT                   EQSGGHPDAKTVIGWSETRAESAMREAKRRLDAVLRRRESLVNVEGSSPASVVRDDDSF
FT                   SDADGGSHHQFTTPRANTRPNDDDYDADAGPFDDAKKRTPSRVGTRHDGFDPATPSIDS
FT                   RDADRSAGAGLAWVALALFAAFAALVIRRVRRRRRGGKRRQEGSSPLASRLARRRAL"
FT   gene            110847..112540
FT                   /locus_tag="MICPUN_109534"
FT   mRNA            110847..112540
FT                   /locus_tag="MICPUN_109534"
FT                   /product="predicted protein"
FT   CDS_pept        110881..112305
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109534"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:20037; transition metal ion binding
FT                   - heme binding [Evidence 16491] [PMID 46914]"
FT                   /db_xref="GOA:C1EHT5"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT5"
FT                   /protein_id="ACO67562.1"
FT                   /translation="MKSDGYSAEDVARHCAKDDAWVIVGDGVYDITEWIPRHPGGSIPL
FT                   VQYAGRDMTDAFRAYHSPTGKAAKTLNAYRIGEYVGRAGSRASDSECESPKDHLATASG
FT                   DSVGSAASSDAAAPPHVAAFRALVAGLEGEFRTDYRHYFKLFACLTALFATAVWCVVGA
FT                   GHGVWTHMLGAVLLGMFWQQTMFIGHDAGHGAITHNHAKDFFIGLIVGNLCNGVGITWW
FT                   TTTHNVHHCACNSLECDPDIQHMPVLAVTPKYFDSVWSLYHQRRMTFDRAARFLVSVQH
FT                   YSFYPIMAVARFNLYAQSLILLLTSKEIKNKRRALEICVMGLYFTWLGALVSALPANER
FT                   LGFLLLSHAVGGIIHVQICLSHFSRKIFDGRPENDKWVTMQLDGTMDIDCPPWLDWFHG
FT                   GLQFQTEHHLVPRMPRHKLRRFREEVVKPFCDEHGLKHDCPSFWEANVEVWRTLKASAK
FT                   AAKLSPAFVHAVNLEG"
FT   gene            complement(112513..113196)
FT                   /locus_tag="MICPUN_109535"
FT   mRNA            complement(112513..113196)
FT                   /locus_tag="MICPUN_109535"
FT                   /product="predicted protein"
FT   CDS_pept        complement(112570..113106)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109535"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT6"
FT                   /protein_id="ACO67741.1"
FT                   /translation="MISCDVWVEHRAKSCPRGFSGEPRVDTIAPNGKAWVGATSDATSV
FT                   ATWRLEWPVVDPGPDAKDGGSTFRVEEGAFAKEGAVGGAEGAVGGAVAVAGNPAANGVG
FT                   QLLRLPGGAWAYCGADPSAPNAGTIVVECGYDPRAGTGAGAFERAVASRRYDVATGKLV
FT                   RVTLGRERLVDAARG"
FT   gene            113978..115269
FT                   /gene="HPF_4"
FT                   /locus_tag="MICPUN_105005"
FT   mRNA            113978..115269
FT                   /gene="HPF_4"
FT                   /locus_tag="MICPUN_105005"
FT                   /product="cysteine-rich protein with zinc figer"
FT   CDS_pept        114007..115233
FT                   /codon_start=1
FT                   /gene="HPF_4"
FT                   /locus_tag="MICPUN_105005"
FT                   /product="cysteine-rich protein with zinc figer"
FT                   /note="Cysteine-rich protein domains are also occuring in
FT                   antifreeze proteins from insects"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT7"
FT                   /protein_id="ACO67563.1"
FT                   /translation="MTTVWEPDLDELLAIVAETEGRASEEEEDASNKGTKRKRAPYTKG
FT                   PCEHGVKYRSKCKVCSACPHGRERRYCKDCGGSKICEHGRQRDYCKECGGGAICEHGRE
FT                   RHRCKECGGSGICEHGRRRSRCKECGGSGICEHGRVRSRCKECGGGSICEHGRERSRCK
FT                   ECSGSGVCEHGRERSKCKECGGASICEHGRQRSHCKECGGGSTCEHGRERRYCKECGGS
FT                   GICEHGRIRSQCKECGGSGICEHGRRRSDCKECGGSQICEHGRIRSTCKECGGSQICEH
FT                   GRQRSYCKECGGGSICEHGRRRSRCKECGGSQICEHGRERSKCKECGGASICEHGRQRS
FT                   QCKECGGSGVCEHGRQRTRCKECGGASICEHGRVRSQCKECGGGGICEHGRQRSKCKEC
FT                   RAAKAGTHS"
FT   gene            complement(<115351..>116584)
FT                   /locus_tag="MICPUN_64341"
FT   mRNA            complement(join(<115351..115357,115392..>116584))
FT                   /locus_tag="MICPUN_64341"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(115351..115357,115392..116584))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64341"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT8"
FT                   /protein_id="ACO67742.1"
FT                   /translation="MAPAAEVIDACRRCEDGGAETDGGAESTSPSPFGDAAQDALHRCV
FT                   THPIATSHPPDREYVARLLKLATLEAERSGRELSDRVGDLVTRTFTRCDGADEEAGWCH
FT                   KTYVYRHPTSDAERRPDRDDVNVNVNVNDDDDDDDDDIRDAPSVSFRMHRNLFEGGTGC
FT                   HEWHAAIYLAELALTHPKLFEHRRVVELGSGCGVAATVMARGGAACGVRGGSGPVGAPS
FT                   RLVLTDADAGALANLERNLAANDVRVERYESNDESNDDESNELSNDDDDDVRACSVRTA
FT                   RLNWEDLEAGDYFGGGGSRPRVDLVVASDVLYDPLNVTPLLNACERILGDRDGDGESAP
FT                   PGTIPGDGEWAPRPWHEDAMSRPSAIFVTTLRQPETLALFERVAAERGFEPRDVTAEVT
FT                   "
FT   gene            <116798..>117607
FT                   /locus_tag="MICPUN_64342"
FT   mRNA            <116798..>117607
FT                   /locus_tag="MICPUN_64342"
FT                   /product="predicted protein"
FT   CDS_pept        116798..117607
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64342"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHT9"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHT9"
FT                   /protein_id="ACO67564.1"
FT                   /translation="MGRKKRRAELPWCFYCDREFDDEKILQQHQRAKHFKCTHDRCNKR
FT                   LMTAPGMAIHMLTVHKIKVEKVPNAIEGRDNPEWLIEGMNGIPEGFDFENNRALVDPKA
FT                   ENVVVTGKRPNLGEHAPPGAIGGWGAPPAVGMGMRPMMRPPGAMGMPGMPPPGFPPPMM
FT                   PPPPYGMMPGMPGMMPPPGMMPGSMPGMMPPPGVAPAPQPQPVAPRPEQAPITETVMVW
FT                   DDESESIEEKRASLSKYSGVEGRAAADGEGETKDPSAEGEEDGGDAR"
FT   gene            complement(117655..>121363)
FT                   /locus_tag="MICPUN_64343"
FT   mRNA            complement(join(117655..120933,121088..>121363))
FT                   /locus_tag="MICPUN_64343"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(117709..120933,121088..121363))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64343"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHU0"
FT                   /db_xref="InterPro:IPR018222"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU0"
FT                   /protein_id="ACO67743.1"
FT                   /translation="MSSLSPEDAPLTSQGKPRSRPGGRRRGGSGSGDAAAAEASGSSGS
FT                   STAGEDDGSPGSHGENARRMRHVAKRFLGSYYRDINDAPERVARHYTDASTPRATTPVA
FT                   GAERPGRGRDTRQSQSNVKTTPGSTTPGEYIEIVDFFDGIEPGTSRSPMRALTHSDPTA
FT                   EGVDAIVQRQRRMFRNRRVSVVSVDVRPVPSGGDSENTAVHGEGSSSHRERVMAVVLGN
FT                   LHATAQGPTDDDVNGDVQFMHTFVLERGRRPRGDTADAGDDENLGDFNDQQEQFAIVDE
FT                   VFRRVDPVGDARAPGGLAAGAASLLRAAQSPPPTRGGGRSRAGRRDGDDETGTSDGETS
FT                   SEFGEKGSPKIAKNGGQTPVVDGPEDGGDSPESTKTRKTPPVDDGLDDSVDEADVWLTN
FT                   PMYGDVPDTNPAPRDAQTEGHNTQTETPRAVRRAPGSAEVVPESPAINFASPNPFEDEA
FT                   EGGGGGGVPRGVPKRGADGGAQGARSATRPMSPDANSIPFPSRSLLGANGPHVQHAPRA
FT                   NGARPNSGGESRLNRVSRRYSHEFEDAGTRRTLFDESPYVNRGRGNRRDHDDFDDDFDD
FT                   DEEEEGFGGAEGAEGAEDAEHTERRARRKERSVAGPPSSRYRRRVYSSASSSPAMSHAA
FT                   GPTSAAPSPGFEPGTSGFDRNASPAAKRGLNARFQYDAQPWASAESEGVGVGDGVGVGA
FT                   AAAASPSGRGGPAPGPRALEPMARSPRLVTLTERSDEGSTAASMRESASVTESAVNSDS
FT                   ERGSTRSGATAGRVTAGVLSDEEDRGSLRAHPVAEDAEILDWEDVRGYPAPNNRPNPSA
FT                   ASPDPVPRSSSRVRHNGYNGQSRGYYSSRDSRNGTRRSQHGDEYGDAGVDPYPRSTHTL
FT                   RGPPPVRYGSYRSSHDDVRPFGDGGYAGVGGYSQPGSRSSSRGSARSSRGFVSRSHAGM
FT                   YGGFDRGGGYDGVAGEDSFRRSSLVGSMPRGGRSAPPSPSMGATRAREFGVRDRTPRVR
FT                   LSSAAGGLRGSYRRDDYDFATGAFEFHPPRSSANTTPGNTFEESEQPPQLEDAVNYLGM
FT                   LTAALHFTAAVVVFGFLLVAVYANGSAMTSLSKRLDRLDGAIVAGPASGNLGGVGGWGG
FT                   GGGGGGARMPKVGASVFGGSVVDVSGDAKAVKAAGGGTAGAPASRRSAPKIVDLDSDEL
FT                   "
FT   gene            <122118..124688
FT                   /locus_tag="MICPUN_64344"
FT   mRNA            join(<122118..123265,123340..124077,124160..124688)
FT                   /locus_tag="MICPUN_64344"
FT                   /product="predicted protein"
FT   CDS_pept        join(122118..123265,123340..124077,124160..124550)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64344"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU1"
FT                   /protein_id="ACO67565.1"
FT                   /translation="MATQAERNLALCKEVFDIQSELALDIVDQAAFVAVASKLPDFFAP
FT                   SFALTMGPGLGDAEAVNFRAMTQITHPIFHNVKNTKVEHACTVLNNDKIRALEHRTAVF
FT                   LDAWGREVPGTNKMYTFEHVVAFDAATGKITEWRQTWDLVEWHLSCAKRDAVNDAQIFD
FT                   RNRQLYYDIMGAWGAGEFDSCASNSPAGESSRETLAKKLFADDFTLDPRYPSTYRRDAC
FT                   DVLYDGPGGYLRWCDFFAKTFATPDYTVRDAYPGESGEVWAVGHYTPTDVTSNRALPFK
FT                   VEFVHRVGFDVKGKCVYFKVYNGPQAIHLDALGAPTEDAVPPMIPTPPRPTLDVEKDFQ
FT                   KALALFELNQRQWASGTYAARDRDEALAAIAEVWDPECVVDVRYPSRCATNLNAVLRGH
FT                   EGVRRWCAVLSGYDCPGFRVCRTARGPDGDVIARLEFNASVKATKASMDERQDCFMRVV
FT                   ASRRTGRLTHCVVHWGPGRVAEDAALVPDASSPGRFFAVVHRPVGKASEWWRATAAAFD
FT                   DPASLRETFERQYELGYYNHYFLPEKAGDPNAPVLCLWESAKSVTVEEFRSFIDGADGP
FT                   FPNGEFANDVYAIAPTGATGGLPATGFIAPADPWHARPMPTATRGSRFWVRHRFKSEDD
FT                   RAAFWNAVKAFTAADWKEFAIANHAAGYHNPLFAPAMDDGDVFCVWECVDPTTTVEQFA
FT                   EYVDGPSRQTRLLKHFVNECHACDAVVGVWPDAKFAKPTGGAMLTIKQTPQAAMAAATS
FT                   RATAA"
FT   gene            complement(124644..>125523)
FT                   /locus_tag="MICPUN_64345"
FT   mRNA            complement(124644..>125523)
FT                   /locus_tag="MICPUN_64345"
FT                   /product="predicted protein"
FT   CDS_pept        complement(124714..125523)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64345"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU2"
FT                   /protein_id="ACO67744.1"
FT                   /translation="MAIALTDAQVRSLRARFDAHDATPQAHSSTWSRRLYAPFFIDAPE
FT                   MADVKRAITRAHPRHVVAFDIVFESRGNETAWHTDYESLGPFVVRDALVAMRDRHFVSV
FT                   HFNLTKDGGALVTCERAPMWLDWLTYRCIVAFGIYSTAHRLLTRIAGPFLAAFASHAPN
FT                   AVGAGNSFDNMRLHKVTAGAPRISYVVRLAHKDALISREAVRRGVERSAACAALGFLSE
FT                   TLPDEREHRVGDLDWSGEAREASARKGATTATVTTAAGADAKSARVS"
FT   gene            125758..126417
FT                   /locus_tag="MICPUN_109539"
FT   mRNA            125758..126417
FT                   /locus_tag="MICPUN_109539"
FT                   /product="predicted protein"
FT   CDS_pept        125765..126181
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109539"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:20037; transition metal ion binding
FT                   - heme binding [PMID 46914]"
FT                   /db_xref="GOA:C1EHU3"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="InterPro:IPR036400"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU3"
FT                   /protein_id="ACO67566.1"
FT                   /translation="MGLIVKSEINNTLYLILSFIAVFSIPVISFVKKQMAQLGNGPKVV
FT                   VGTGYGGKDGSYTAADVAKHKAQDDLWLIIDGNVYDVTEYVDEHPGGVAAIMKNAGGDA
FT                   TKGFHGPQHPSRVMDIVDEYKIGTLVTEGTSKDE"
FT   gene            complement(<127855..>128830)
FT                   /locus_tag="MICPUN_88698"
FT   mRNA            complement(join(<127855..128286,128345..>128830))
FT                   /locus_tag="MICPUN_88698"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(127855..128286,128345..128830))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88698"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:5097 - Rab GTPase activator activity; GO_process:
FT                   GO:32313 - regulation of Rab GTPase activity"
FT                   /db_xref="InterPro:IPR000195"
FT                   /db_xref="InterPro:IPR035969"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU4"
FT                   /protein_id="ACO67745.1"
FT                   /translation="MALRGRCWQIFARVKERRRDGVFRELLVAAGESASAEVLETKDRK
FT                   EDGDENGDEEDAVERVLASLVDATCTAVPDDGSRTAVRDDASDSTPCTAVSPDTSFRRV
FT                   RKQIDKDLPRTFPGHPLLDGIGRDALRRVLCAYALHNPAVGYCQGMNFLAALLLLLMEE
FT                   EPAFWCLGALVEDVLPGYYGNTMLASAVDQAVLRTFVDSRFPRVGAALDDAGVPLAAVA
FT                   GSWFLTLYVNHLPWEVALRVWDVLLFERTRRVLFQTALALIDVNAKRIVEGGRCDRLME
FT                   CAVQIAPAQFDGSGEFILIFAWAI"
FT   gene            <129914..>130500
FT                   /locus_tag="MICPUN_64348"
FT   mRNA            join(<129914..130219,130366..>130500)
FT                   /locus_tag="MICPUN_64348"
FT                   /product="predicted protein"
FT   CDS_pept        join(129914..130219,130366..130500)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64348"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU5"
FT                   /protein_id="ACO67567.1"
FT                   /translation="MACCGTRSRVDGPEACTVCLEPLPLPGPGGDCVLVLHACGHAFHR
FT                   DCAQDFLLDALRRRRTPRCPNCRATLHTAPFGKLLGQRKLPRSRRMKNMRQLITVSEEY
FT                   MKHKNWRVPRRNPTGTSEQQRALAGLIIQSRKEFKEEFGEEP"
FT   gene            <131357..>133105
FT                   /locus_tag="MICPUN_50720"
FT   mRNA            <131357..>133105
FT                   /locus_tag="MICPUN_50720"
FT                   /product="predicted protein"
FT   CDS_pept        131357..133105
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50720"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16564 - transcription repressor
FT                   activity; GO_process: GO:6808 - regulation of nitrogen
FT                   utilization"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013857"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU6"
FT                   /protein_id="ACO67568.1"
FT                   /translation="MGRRATLAVTRATDEKDAKTSIDDETVSETVRRRREAAKQGKDNS
FT                   PTLNPLDLGRRARQLTDGFFKGITGLTQLARSPSIDEAKYDAVYSADLLAGDDLTEYET
FT                   PNARFTTVLVVGAAGRVGRVLVRKLLLRGYTVKALVRKESDREILPDKVQAYVGDVSDA
FT                   KTLELAMSGVNKVVYCARAKTFMASELANVDSEGVRVAAKALQDYNNSLASRRAGRSQK
FT                   SKQMLYSFAKFRDVFEDWTVDETRLVNPEDGRWQAAAEVAQRVFFDKEEKDASDSTDGR
FT                   SPYPTFSGYVFAKTGVAQISCACDALGSGDAAGAVVLRDHEGVLLRLRGDGKRYSVVLS
FT                   EGGVEGRTFIAPFATTGKWQIVRIPFAQFRPEVFNRAYNSGGDAEVDAVAPVDLNAIDR
FT                   IGLRFEARNQSRSGSSGSNGAGAPEWMSELDAPSNNSFELELEYVKALPKGEETDFVLV
FT                   SCGGAGLPDGEDRDKLVRAKRDGERTLRNSGLGYTIVRPGQLLEEPGGNKALVFDQGNR
FT                   ISNYISCADVADVCVKALHETEARNKSFDVCFEAEVGGAYEKVAMVAGKSNNYLAPALA
FT                   VLEKNT"
FT   gene            complement(<133425..>135181)
FT                   /locus_tag="MICPUN_64350"
FT   mRNA            complement(join(<133425..134939,135119..>135181))
FT                   /locus_tag="MICPUN_64350"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(133425..134939,135119..135181))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64350"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU7"
FT                   /protein_id="ACO67746.1"
FT                   /translation="MATRDPTVEEYAIRFVRKYLKGDFARAAARTNDDGGAAVAADDAN
FT                   RAAAADTLVDLLRKCSDDPVLLKVPLRVLRDEILRRYDEHRHRRDRDRAPSLDESALPA
FT                   DVESLFALFDGVHRVCVTLASRLTAGPFETIDRALRLRLFLCVCGETWRDAPALRACAL
FT                   RRCHAFAREEDAHEASRATTTTAAAGGATNGFSHSATTASSSSRRSSASASSSSSSSSG
FT                   WLGSIASRAVPAFVSHDAVDVSSWRRVIGQIFARCPARLMSPTVECLLESLRVRGPDCA
FT                   AANVVGPIASRQLGLDDDDATTEYVLYGETTVVRADANPPKTPPPPDLLGFEPQLCAPG
FT                   FDGFDGFDVTTPIDDDRKNLTAGWETFETPTTTLTPPTPTPTTVTTTVTTTDGRSSRAI
FT                   STGASTGEKGLVFDGSFGSDASLTSAFRPDRAGDFTRADHETSHAPIASRQVEPHSCAS
FT                   FGAFGSFPVETPPGKEPSPSSSSAADGSGKSSGESSGKLGALASVAARLPVRDSHDFDE
FT                   LVRDLERM"
FT   gene            135653..136442
FT                   /locus_tag="MICPUN_109540"
FT   mRNA            join(135653..135879,135954..136154,136223..136442)
FT                   /locus_tag="MICPUN_109540"
FT                   /product="predicted protein"
FT   CDS_pept        join(135715..135879,135954..136154,136223..136345)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109540"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHU8"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU8"
FT                   /protein_id="ACO67569.1"
FT                   /translation="MDALLSIQKLLLAINVYNACYCALLVVINLWTGNEPMASLQESNE
FT                   ADYLILQFFKCAAYGAFIVIQVVHVCMLWSTRAENMKVAAVGNLALSLCIGFHYFIRVW
FT                   SPAMEGHPPKTSATSYTLYTTMFAAMAFSHYVKPDKGERAMAAQANAAMAGNDENKQF"
FT   gene            complement(<136454..>137026)
FT                   /locus_tag="MICPUN_64352"
FT   mRNA            complement(<136454..>137026)
FT                   /locus_tag="MICPUN_64352"
FT                   /product="predicted protein"
FT   CDS_pept        complement(136454..137026)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64352"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHU9"
FT                   /db_xref="InterPro:IPR019184"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHU9"
FT                   /protein_id="ACO67747.1"
FT                   /translation="MARQRGGYGGDKPVFSFADNRGVEMTSVAPDASDTTARGGAPRMA
FT                   HRAVASDVTLQMLISFNVYFSVCFWVATVVATFVKTNGAREDFDEIRPVMICMYAVFEP
FT                   ARLYAGFAGNLQEQVPMLIGFVALSFCVALPLHFYFLAGQMGVVAFDKALNLFAVVYVV
FT                   AQVVAGVVAARKILASQSLSFFMSELR"
FT   gene            137601..138543
FT                   /locus_tag="MICPUN_109541"
FT   mRNA            137601..138543
FT                   /locus_tag="MICPUN_109541"
FT                   /product="predicted protein"
FT   CDS_pept        137658..138518
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109541"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039856"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV0"
FT                   /protein_id="ACO67570.1"
FT                   /translation="MIDEHKLRRPDPVYRAASLVVNNQKRAKLQKQDLYAFMEQLAVAA
FT                   LDVNDVDTCDRTIDVLRETFPSSSRVKRLEGMSLEAKGRVDDAVAVYGKVLEEFPSDQR
FT                   AMKRRVAALASAGRDKEAIEALAKYLDTFMADTRAWERLAGMYQERGAYRQAVFCWEEV
FT                   VAAEPSVHYHHRRLAECLYTLGTEEDLRAARKYYAAAVDMSNASDVRALYGLALTDNRL
FT                   TRKGKVKGNPDQPVDGDGQVPVTELGQHAAGLLRKMYAAGEKIGASKPGLCAIVEGQLK
FT                   TLLDA"
FT   gene            <139166..>139489
FT                   /locus_tag="MICPUN_88622"
FT   mRNA            <139166..>139489
FT                   /locus_tag="MICPUN_88622"
FT                   /product="predicted protein"
FT   CDS_pept        <139166..139489
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88622"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:8137; electron carrier activity - NADH dehydrogenase
FT                   (ubiquinone) activity [PMID 9055]"
FT                   /db_xref="GOA:C1EHV1"
FT                   /db_xref="InterPro:IPR007763"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV1"
FT                   /protein_id="ACO67571.1"
FT                   /translation="GKLVGEDEFGNKYFENTSYQSGRHRWVEYADLDNYNASTVPSEWH
FT                   GWLSHVDDEPGLATRTAPKYQAKFIAGGLTTGVQGEMYQPKGSFYNKRGMRNWKRYTPW
FT                   SPP"
FT   gene            complement(<139661..>142438)
FT                   /gene="CPKG1"
FT                   /locus_tag="MICPUN_64355"
FT   mRNA            complement(<139661..>142438)
FT                   /gene="CPKG1"
FT                   /locus_tag="MICPUN_64355"
FT                   /product="cgmp-dependent protein kinase"
FT   CDS_pept        complement(139661..142438)
FT                   /codon_start=1
FT                   /gene="CPKG1"
FT                   /locus_tag="MICPUN_64355"
FT                   /product="cgmp-dependent protein kinase"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EHV2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR000961"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV2"
FT                   /protein_id="ACO67748.1"
FT                   /translation="MRASNGGAGGVAGGGNAKKKRVAIAVENVASVDDIDVVSKDERVR
FT                   ELILGATESNTLFEGLDLATRCALCDVMTETRVAAGADVIVQGATGDDARHFFVLESGA
FT                   CQVKVRRRDPADGKPVMTDPERTVATYGPGDSFGELALLYGAPRAATIRASKDCKLWSL
FT                   DRAHYVAIKRRFQEALAERVRDLVESVNLFQGLSPEHKATIADALKCEVFEKDDVVVSE
FT                   GETGDKFYVVSSGEVSVYVGGADSYSTAKSHRELTRLTAGASFGEKALINDDVRGASVK
FT                   VVSDRCELFHLDRARFNALLGSYGEIWRWLSLRRVPVLSSVSDAEITELVSHLDELSLR
FT                   PGELVYDVGDAGDCMYVAERGEFLITDADGKRVDVVTDGGFFGERSLMGSERRAMRAEV
FT                   ANGGLCATSAPDAKLLRLNRRDLENLLGEGLTAVTTQSRLRCLQHVALLKSLSDEQRTT
FT                   LVSYLQPRQYAEGEVVFRQGDPGDKFYIVETGNVAIHRESESTSATNETRTKHEVLKLV
FT                   TRGEYFGELALLSTNSRAATATVERGGAFILSLTKEDFDTHMGSLAKELSQQAKDEYGV
FT                   AVYDDKVANDPARSLAAKAMTDFKVKAVLGVGAFGKVLLCRHPSSAGVFAVKQLSKAQI
FT                   IAAQLQHHVRQERDVMKDCDSPYLVRLVATFQDPRMLYMCMETVMGGELFNHLSRVGGS
FT                   IPERDARFYAACVVLAFQYLQNKHYIYRDLKPENLLIDGKGYVKVADFGFAKRLLPGEK
FT                   TYTLCGTPEYMSPELYRQSGHNKAVDWWALGVLIYEMVAGAPPFYSPNADSTDQMRRIL
FT                   AAKYSFPEGVSPAFKDVVRRFLSVNAVHRLGSLKGGVKDVKLHPWFKSTDWIAMTRREG
FT                   KPPFVPPLRGDDDHSCFDEYDPRTPHPGEEFDRKNATSRSKKREKEQEAAFAGF"
FT   gene            <143649..>145430
FT                   /locus_tag="MICPUN_69067"
FT   mRNA            join(<143649..143960,144402..144821,145071..>145430)
FT                   /locus_tag="MICPUN_69067"
FT                   /product="CorA metal ion transporter family"
FT   CDS_pept        join(<143649..143960,144402..144821,145071..145430)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_69067"
FT                   /product="CorA metal ion transporter family"
FT                   /note="mitochondrial inner membrane magnesium ion channel
FT                   protein (MRS2); GO_component: GO:16020 - membrane;
FT                   GO_function: GO:46873 - metal ion transmembrane transporter
FT                   activity; GO_process: GO:30001 - metal ion transport"
FT                   /db_xref="GOA:C1EHV3"
FT                   /db_xref="InterPro:IPR039204"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV3"
FT                   /protein_id="ACO67572.1"
FT                   /translation="KAWLKMDEEGACTAVSIEKHRLASMLRVPMRDLRMLEPNFSNSYS
FT                   AAILCRERCIVLHLEQVRLLITAEEVYLQDGRNSSVTKYLPELQRRLLMRKLKLMDSHG
FT                   EGSLRRALSIQRGGDAPRQEELPFELIALEVALEIVCNSLEAEQRETVTEAKAGLEGLR
FT                   KKVNTNNLERVRRVKSRVTRLTGRVAKVREEIKRYLDDDSDMRDMYLTRRLLAELFGGA
FT                   EARGGGMGGMGGEHQQTPGGGIDEDKDLQEVEDLLETYFTHIDSTFAELQALDEYIDDT
FT                   EDFVNIELDSQRNQLIKLELVLTTATLFMTMYGVVASVFGMNVRNGAEDSKASFVVINV
FT                   VCSVCTVLAFVLAVTYIRYKRIM"
FT   gene            <145594..>146406
FT                   /locus_tag="MICPUN_64357"
FT   mRNA            <145594..>146406
FT                   /locus_tag="MICPUN_64357"
FT                   /product="predicted protein"
FT   CDS_pept        145594..146406
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64357"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHV4"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR032862"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV4"
FT                   /protein_id="ACO67573.1"
FT                   /translation="MPVDMKALLARERERRRAAASGDPAGAATASSSAAATAPVVMAPR
FT                   AKISLRDFDVGERAGVRGLHYVPDFISPDEERAVLAGIHAPGTESRWVRSGRRRVANYG
FT                   GVPSSSEVTEPLPQFATSLLEAIASAGIVNERTAPNHVLVNEYVAPAGISPHNDGDVYA
FT                   PHVAIVTLGGAALMDFWPNDGSVTADDDRRDCDEREPTPIAQVLLRPRSLLLYTGDAYG
FT                   LRHGIRHRDVDVATDRCVNAAVAGVEIGDEVERGRVRYSVVFVRKGHG"
FT   gene            complement(<146555..>147451)
FT                   /locus_tag="MICPUN_64358"
FT   mRNA            complement(<146555..>147451)
FT                   /locus_tag="MICPUN_64358"
FT                   /product="predicted protein"
FT   CDS_pept        complement(146555..147451)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64358"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; zinc ion binding - nucleic
FT                   acid binding [PMID 8270]"
FT                   /db_xref="GOA:C1EHV5"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV5"
FT                   /protein_id="ACO67749.1"
FT                   /translation="MDLDAMITEAEADKEEKKARRVVVKRPARGGRGGGGGGDDLRSRL
FT                   RGSDDYHGGRRGGGDRWEHDRHDDRRGGGRGRAGGRGRRDDYDGGDRDRPQAETLDGWT
FT                   VSDRVDARTGKNFFAGKCEGCGVDTEVPFRPVKGGNPPVCLDCNTSLKDAQGGGGPDRG
FT                   GRGGRGRRGDPYGPSPKMMMQQMQMMQMQMMAMAQHMQAGGGRGGRGGRGGRGGRGAGG
FT                   GRGSNVWTPDMGTSEPKPESGVAKGGKTWVREEAAADMSSTPCVFFQQGSCKYGDTCKF
FT                   AHVPARDNDGNVDMGEA"
FT   gene            <148301..>150331
FT                   /locus_tag="MICPUN_104280"
FT   mRNA            join(<148301..148864,148889..149018,149136..>150331)
FT                   /locus_tag="MICPUN_104280"
FT                   /product="predicted protein"
FT   CDS_pept        join(148301..148864,148889..149018,149136..150331)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104280"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV6"
FT                   /protein_id="ACO67574.1"
FT                   /translation="MRLPRRRRGEASRGVVPAETDDTGDASPTRPAAESEAFSSSSARF
FT                   FGGSRFCTEAFAARSAASARLRMRAESRGVRAAARAGDATTIAVVAAVSADERRRRRRG
FT                   GGGAALALAGFFRFSPFFARGAARAGAAVAARAAAEGFGARALFAPALFAAAPAASRAA
FT                   AETPLSRALYAAFASASAANVPKVTCRTFHRVLPSLVTHRLMYESGMGSCRGAMASVEA
FT                   ASVKQPAPTRCHAGEAHSALRAPRPRTTMRVATCSRTGRCPSPAHARWRALGPRRCPPT
FT                   APPLFVGARSDDEASSTRRYLTILSSSRAFEGGADPFDMSGLSDAERAAMRHEWSLECR
FT                   RAGLDHLAESFKKPSVLNPRDDDVLPFTDPSLHRNPIEAVVASVAREDLTSNLDAKLAF
FT                   LNGEGVAGVAHTGNGKFDAHLVGVASVLRAWGCDDSVVDAGLFHSIYGTEGFQGFSLPY
FT                   ERRDDVRALIGDRAERLVHTFCVVDRLSVDNDLDSRPESHGFKTRPELSSLFFDDGANE
FT                   VAAIDLDEALWFDFVTLTLADWLEQVEGASRGTNEVFQWFERGDAWGYRRGAYRRMSEI
FT                   VGEKIPAARALWEAVYAREHPGTRHKSQPVTPPMSDAARIARAGIEQPQPRYP"
FT   gene            complement(<150457..>151860)
FT                   /locus_tag="MICPUN_104281"
FT   mRNA            complement(<150457..>151860)
FT                   /locus_tag="MICPUN_104281"
FT                   /product="amino Acid/Auxin permease family"
FT   CDS_pept        complement(150457..151860)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104281"
FT                   /product="amino Acid/Auxin permease family"
FT                   /note="amino acid"
FT                   /db_xref="GOA:C1EHV7"
FT                   /db_xref="InterPro:IPR013057"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV7"
FT                   /protein_id="ACO67750.1"
FT                   /translation="MAMTRAVALSRPASAPAPLRGRAARDATRVPVVGGRRAVVSIIAS
FT                   APAPRSVRRVLAERAAAPRGERAAMSAASSAAPASAGDTGETAAIVNVIKAIFGAGGFA
FT                   LPWAFAQGGTVLVTACLLSSYWFAIKALEMLVQSQETLIAAGKATQAEVQTYAGLTQKA
FT                   IGPAGDVICRVLNVITCFGITVGYMIFVADTCISMLPAAQAATYTTAKMLTYNLPVWLF
FT                   MAWQRSIAGVNLISLFGTTTVALSMIWVMISALRNPLQLAAIPLADVSQFSGFFGTVAF
FT                   LFFIHFTLFSVQEGMPEKKYFLSAANKAFLISMAISLVFGLVGAVGYGRGVSSVVVTML
FT                   TGVAGLVVKGLLALNLWSTFPLMARSSLLICENVVSPNKEAPLPVSLAVRTGFVSLAAY
FT                   LACNVPNFGAVLGLVGGVCCCAMSVFMPPIILYKSKELCGTPAAGKEKGMIGFVALTGF
FT                   VCMILSVVL"
FT   gene            <152121..>153503
FT                   /locus_tag="MICPUN_104282"
FT   mRNA            <152121..>153503
FT                   /locus_tag="MICPUN_104282"
FT                   /product="predicted protein"
FT   CDS_pept        152121..153503
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104282"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHV8"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV8"
FT                   /protein_id="ACO67575.1"
FT                   /translation="MPRVPSPPASPPAARLAPSPTAAPRNAAPNAFLGGGELFPGATAG
FT                   ELYYEFHAQDGTPETAASAAARHSRAAAASASAAAAAAAARAAMTRAERRAAQLERCRG
FT                   RTAEQFGSLASRGFIAALDQSGGSTPRALALYGVSDIRAGDKSEMFDAAHAMRTRIVTS
FT                   EAFDGEKVFGAILFADTAFARLVRGKPTASYLWEDKGIVPFLKIDVGLQPEANGVQLMR
FT                   DIDDLGVTLSRCGRRDPKLDDDDASSEDTGYPKPPKPLNPGDGDPGLCIFGTKARSVIR
FT                   SNDPNGIDALVAQQFESWITGWCPSSSPRWTSTAKTRRVRLSASFSYHALTEAPFLSLA
FT                   QAGAETTLKAALVRHLDILETLADADDAGDQPPTVIFKLTLPEDPALYDSLVADPRVLR
FT                   VVALSGGYDREESTRRLRTCRGVSASFSRALTEGLRVDMTDEEFDAALGASIGAIYEAA
FT                   CT"
FT   gene            complement(<153869..>156139)
FT                   /locus_tag="MICPUN_64363"
FT   mRNA            complement(<153869..>156139)
FT                   /locus_tag="MICPUN_64363"
FT                   /product="predicted protein"
FT   CDS_pept        complement(153869..156139)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64363"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHV9"
FT                   /protein_id="ACO67751.1"
FT                   /translation="MGKSSGWIYEGHAPLMAKRGRRGDKRRRLVGAVVILGLTLTVVMT
FT                   ARTASGGSSPSAIDDRFDDFATHGARFGGGSRDEIRGDVRLHRFGSDADAASAATRASR
FT                   AMDSMNSLTVGAAADRGVEMMRDHRRHEPSRGGGLRTTDHPIYLGIDDDVHRAVDFSHR
FT                   PLVSHGGGWESQPLIESRIRHRDCGVSQAAMAAATANDAPHVDASPADAARWFRRFWEP
FT                   CVSCADEEQIGGEPVSAGDGVASGSDQVDSDSDSPIDSADAESLGGRWVCDPERMIATP
FT                   ESDAEFKARVEQERRAARGAHGWLHSLGFGGGGSSNDGESSKGDGASHIGEKVGCVVLT
FT                   VGVDIANSRGGFAFERDMRALYGCEVHVFDAMAGATPPDTADADAFDDDDDGVGGGGAE
FT                   KKPRAAAGGSMTFTAGVSLASTSTAPTAVTKPLQTGKRRRDAPLDDDDDEDEEEDEEFR
FT                   GESGDDDDAAAKRRSNSRDASWDADDMRPRKQTTHSAFLSGGDSRPLTDANASPETTYS
FT                   MTLPEMIDVATRGSASRSKDGTSGGHHALVDVVRIACDGCELDALTTPGASRALKERVK
FT                   QLLLEVRYVPGDAPFVVRARASSFGGGKKAESSFSREVDDGEDGFGADDADVADDDSPA
FT                   GADSSSSDAASGSTAASGTAGLWRSLQVDAGMLPFHKEVEIVDVSREHHVGHHGGSDPL
FT                   RKGVTVKRKSVGFFGSLFGGGGGGGARGGRRGAEDLRPVVEYGLINERMVRKTKGRAGT
FT                   RDW"
FT   gene            159450..160850
FT                   /locus_tag="MICPUN_109542"
FT   mRNA            159450..160850
FT                   /locus_tag="MICPUN_109542"
FT                   /product="predicted protein"
FT   CDS_pept        159473..160738
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109542"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW0"
FT                   /protein_id="ACO67576.1"
FT                   /translation="MAAEIARIKAQMAVFESLRNTDRGAYEGPGRLTSTAVAPYRRQGY
FT                   ERRAALAEERRKEALNAAAAKKAKESRQSDRELERTRRRAPWSCAADAGPAARYMAAGG
FT                   ADRGADRGADGGADGGADDPNLPAGAAKLAEKLAGSTWSGFYRRHERAIVEAVAGSNPA
FT                   RGVGASAATHAKARAAVLDVGAAGGTPTHVFRGPPPPPRPAAAVAGAMFKTDVSSDVAS
FT                   DVAPTWEREDDDDGRVGHREDEPPPLPPEREAQIARLLNDAGGKEKEPSLSKFGPRHPA
FT                   RGRKVGTLPVPVPARDDPRTRAPLVPALDLNVIDGRSSRGGTSPDDGGDAGLDRETSSP
FT                   GNITRTRIPVADVDDEGFDDDGPVPRLDLRGLTKTAGRNGRAREDRNQNQNENAARPSR
FT                   LRRTTTVRARIAADWDTDDLDA"
FT   gene            complement(<160860..>161579)
FT                   /locus_tag="MICPUN_88739"
FT   mRNA            complement(<160860..>161579)
FT                   /locus_tag="MICPUN_88739"
FT                   /product="predicted protein"
FT   CDS_pept        complement(160860..161579)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88739"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16021 - integral to membrane"
FT                   /db_xref="GOA:C1EHW1"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW1"
FT                   /protein_id="ACO67752.1"
FT                   /translation="MRHAHRRFSSQRRFSSASNEGTSAQQTSGGIRGALAKYNALNEAH
FT                   PTTTKVGTSVVILLFGDTMAQRIQHRSAAKTSKDGAAPAFRMDWRRLAAFASFGAIYTG
FT                   YFQMHWFRYLQTVFPRQVGLKARFLRKDVLAPLLVNQLGMVCVGYYPFFFAWTGFVRGR
FT                   TWDESMEEMKKKYKLKLLAQNWAFWIPAQGVQFALVPSSYHILYVSAMGLAWNTILSLV
FT                   TLEKIPEAAQELKRKKA"
FT   gene            163789..164516
FT                   /locus_tag="MICPUN_109543"
FT   mRNA            163789..164516
FT                   /locus_tag="MICPUN_109543"
FT                   /product="predicted protein"
FT   CDS_pept        163809..164351
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109543"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW2"
FT                   /protein_id="ACO67577.1"
FT                   /translation="MSILERLDERDVLPRPGFDGDDQWGSVRCHLVFTHRTGRAFVSAP
FT                   ALAAASYVGKGVGQGVGHAPARGSRAGHYGVTFAGAPAGGCTYQVLPRRSHTWGAGGFG
FT                   EYDPGDTVARPIRVVLFDCVVAVGHSVLVTVPARALVDAHEAAERSVRHELKEFLAEKE
FT                   GKRLVEEATRARLDPYE"
FT   gene            complement(<164510..>165334)
FT                   /locus_tag="MICPUN_64367"
FT   mRNA            complement(<164510..>165334)
FT                   /locus_tag="MICPUN_64367"
FT                   /product="predicted protein"
FT   CDS_pept        complement(164510..165334)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64367"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW3"
FT                   /protein_id="ACO67753.1"
FT                   /translation="MPAIWRPNVSGPLPDVDVEVGVKKVDASSKGAKRKRGPPTKGPCE
FT                   HGVKYRSNCKVCSACPHGRQRCYCKECGGSQICEHGRIRSTCKECGGSQICEHGRERRK
FT                   CKECGGGSICEHGRERHRCKECGGGGICEHGRQRSQCKECGGSQICEHGRRRHRCKDCG
FT                   GASICQHGRVRTLCKECGGSQICEHGRLRSRCKECGGSGICEHGRQRRKCKECGGSSIC
FT                   EHGRERHRCKDCGGSGICEHGRRRSTCKECGGGSICEHGRVRSQCKECRAVN"
FT   gene            <165433..>165972
FT                   /locus_tag="MICPUN_64368"
FT   mRNA            <165433..>165972
FT                   /locus_tag="MICPUN_64368"
FT                   /product="predicted protein"
FT   CDS_pept        165433..165972
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64368"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW4"
FT                   /protein_id="ACO67578.1"
FT                   /translation="MRAVTSMPSASSAVPRWTPRRAPSSRRRVSSDRTPARALGSSSPT
FT                   AGGPGPIRVTWTGGGAAEVSGAGATLGAGAGADARVTLPGVADAHVKLEVKQGRVFVTA
FT                   LKGGGRVTLGDSSLFPGVAYAVKEGATIGLGEEGSEVTVEQVDGGAGTAGIDMMSKMMQ
FT                   MQFEATLKPEIKKALE"
FT   gene            complement(<166084..>168111)
FT                   /locus_tag="MICPUN_64369"
FT   mRNA            complement(<166084..>168111)
FT                   /locus_tag="MICPUN_64369"
FT                   /product="predicted protein"
FT   CDS_pept        complement(166084..168111)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64369"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000048"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW5"
FT                   /protein_id="ACO67754.1"
FT                   /translation="MGDKGDASKLGASQPALVIGGVNPSGRKKRASFPPSARKLPPSAA
FT                   APTASNNNNGGGTGESHGLSDAEKAKIHGKINGAKALEASEKMRAYLENKARKQREAME
FT                   RKYGVGSLSGGGKLSSDGSYHAAPREASSVTLGVGAEVKRAAAIAVEAGIRACTPESSA
FT                   MLAQGLDGMLERDGSADLGSIPRVSPPRVAGFGTAKLARPPLSNRSSIKGVKTNNSALD
FT                   GNRLLDARRPAPLAQPPSSVGSDGSHPSSAEATPTGHGRTGRGKHPNLNNTPGPSLMTP
FT                   SANDPLLDPADVDSPGDFPSPAPSAAARYIGRPLGLHVTSPAAFGGMGSAESTPGLTPS
FT                   EGQIGGREGGLGGMGGRAGEAATGRAAVTGRASPDVVRRMRLPTLSDVEDAARLGAGAG
FT                   SGYDSPDDSFPDEHDVRFNSGNLTGAIDGTPRMYPDEVDGGTEHSDPGAPSPRSKALRL
FT                   EEEHRAAARIQANARGHLVRCRMDRELRARRLALAAREMEEVRVYDGEDGSPGGGGDGV
FT                   DEEAAAAAVAAAMLTRPGGGSIEALQRSVVDAVRGVDRAGASGGSSHLSADDTIARAAD
FT                   ALTLSLTGSLPSSVGRTTGEGVFFDEDEGGEEDDGVGLDATELDAAELAAVAKMQASAR
FT                   DLLSKADDDAAATAAAAVSDGEAAAVAKMQASARLHLARS"
FT   gene            complement(<168472..>170202)
FT                   /locus_tag="MICPUN_64370"
FT   mRNA            complement(<168472..>170202)
FT                   /locus_tag="MICPUN_64370"
FT                   /product="predicted protein"
FT   CDS_pept        complement(168472..170202)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64370"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:3676; zinc ion binding - nucleic acid binding [PMID
FT                   8270]"
FT                   /db_xref="GOA:C1EHW6"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW6"
FT                   /protein_id="ACO67755.1"
FT                   /translation="MTAAAGVPPAGAARIVRVEERARFRCARCGETFADASSLVSHKVW
FT                   HRKRDASNAPVEEEHHRDGGVTGARGGPTRGHPSGVRRGNDVAGALTHAQRDLLREGEQ
FT                   LMRRLDTVRASTSFSSPSSSSSMGRLHATSRTSLAQRLRAEKEERARRDGIIGWTSPTR
FT                   SPTREPRQQQPGTRPSAGGFDEEKSHEKGEDDKALETVAPPRRPVAPRYGSEVPDEPAA
FT                   RPIRGSSPHEAETIRYRDDDDDDDASPSSASSSTASFDSTIDAASAEGTAPSADDGSLF
FT                   RPACAPIALRKAPGQIRREEAAARREAARAAARDAKTKQRLENQNQNQNGEARPGTRED
FT                   AVRPTQPSLPRWQGGTVIRRDRTGGGGGGGGIRSGDLTKGDDGKETEDDPRLNDPRWGD
FT                   PGGRLLDRARAAAVKIATRELAREAKRLALKEKGAIDPVGARKGGRDRATAEGGESPVA
FT                   IFDESGDDSTDEARGSGVGDFLARYRALVRERDVGVLREREEREARAREEEEWRSSRSD
FT                   EEDEDEDEGEGGRDGRALRAVASNEEDESFVEELTPEEEDELAEFERLERQVAAEVGAA
FT                   "
FT   gene            170314..171670
FT                   /locus_tag="MICPUN_106545"
FT   mRNA            join(170314..170703,170832..171670)
FT                   /locus_tag="MICPUN_106545"
FT                   /product="predicted protein"
FT   CDS_pept        join(170326..170703,170832..171578)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_106545"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824; molybdenum ion binding -
FT                   catalytic activity [Evidence 30170] [PMID 30151]"
FT                   /db_xref="GOA:C1EHW7"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW7"
FT                   /protein_id="ACO67579.1"
FT                   /translation="MVAVLAAARAAMAARAAAVAGGKRDASSEDKSGLDASDGGFLHMR
FT                   RVGRVRSIATYPLKGARGQMLDRAKVSLGSSTPRDREFALLRHENIEQFWANGDGGDDD
FT                   EARAGRILATGEGKDPGHHSNKHLFHQLITDPSMVRYAVKMLGDRGIAVVDAATGQTLV
FT                   SAEDVSDATQRSVVEAFFGEVLETSSAAKPPSLVRARGHSFANVGGRPNEHVLHLNAAP
FT                   TVERCWRELVAADAENSDGGKAPESLEAFALRFRPNLVVEDAGDGSLKPWSELGWCGRD
FT                   VRVGPEVVLRINEPTIRCPSTRVRYDTAGDEVLVDEAQLKMPDVALQRAFPSLSAGIFG
FT                   RETTLAEKGSYLGLYATVIQGGTMSPGDDIVLIG"
FT   gene            complement(<171684..>172474)
FT                   /locus_tag="MICPUN_64372"
FT   mRNA            complement(join(<171684..171722,171764..>172474))
FT                   /locus_tag="MICPUN_64372"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(171684..171722,171764..172474))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64372"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW8"
FT                   /protein_id="ACO67756.1"
FT                   /translation="MFKLILRPTVRRDPPDDGVELRVTEDDASSKGAKRKRAPPTKGPC
FT                   EHGRVRSKCKECGGGSICEHGRERHRCKECGGGSICEHGRRRSRCNECGGASICEHGRR
FT                   RSECKECGGSQICELGRVRSTCKECGGSQICEHGRIRYQCKECGGASICEHGRQRSQCK
FT                   ECGGASICEHGRQRYYCKDCSGSGICEHGRERKQCKDCGGSQICEHGRGRSKCKECGGA
FT                   SICEQVVSANSARSACKECRAAKAGTR"
FT   gene            <172673..174402
FT                   /locus_tag="MICPUN_64373"
FT   mRNA            join(<172673..172852,173085..173243,173359..174402)
FT                   /locus_tag="MICPUN_64373"
FT                   /product="predicted protein"
FT   CDS_pept        join(172673..172852,173085..173243,173359..174399)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64373"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4055; ATP binding -
FT                   argininosuccinate synthase activity [PMID 5524];
FT                   GO_process: GO:6526 - arginine biosynthetic process"
FT                   /db_xref="GOA:C1EHW9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHW9"
FT                   /protein_id="ACO67580.1"
FT                   /translation="MSAFTASAVAAPCAAKLLASRRSVAARTPAMAAKRVANKANKRAP
FT                   LSVAAKAGPSGEVKKVVLAYSGGLDTSIILKWLQDTYGCEVITFTADLGQGEELEPARA
FT                   KAEQMGVKQIYIDDLREEFVRDYVFPMFRANAIYEGTYLLGTSIARPLISKRQIEIAKE
FT                   VGADAVCHGATGKGNDQVRFELGYYGLKPDIKVIAPWREWDLNSRTKLLDYAEKNGIPI
FT                   AKNKRQEAPYSMDANLLHISYEGLALEDPWVEYTEDMFTRSVAPENAPDTPTYLEIEFE
FT                   KGDPVAINGERMSPAAMLTALNKYGGDNGIGRLDIVESRFVGMKSRGVYETPGGTLLLH
FT                   ARRGIESICLDRGESHLKDELMPRYAELIYNGFWFSPEREMLQAAIDRCAENVNGTVRV
FT                   KLYKGNVDVVGRKSAQSLYNANIASFEDDGGAYDQKDAAGFIKLNALRLRTLGTQRGVP
FT                   K"
FT   gene            <174724..>176457
FT                   /locus_tag="MICPUN_88500"
FT   mRNA            join(<174724..174879,174955..>176457)
FT                   /locus_tag="MICPUN_88500"
FT                   /product="predicted protein"
FT   CDS_pept        join(174724..174879,174955..176457)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88500"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16021 - integral to membrane"
FT                   /db_xref="GOA:C1EHX0"
FT                   /db_xref="InterPro:IPR009637"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX0"
FT                   /protein_id="ACO67581.1"
FT                   /translation="MTRAPPLAALVALLLLAVHRCDGAIHPYRAARFTPTDGAHVLRAG
FT                   REGLYASAYVRFEDVEFRRSRSHASRFTGADSEGKDTGAVHAVLFELKDHFRIGWTDPR
FT                   AGTRHLCCDSPDLVADTGCVMNDVLIAPPDDGREPEPGWPWVRRVEFVGDHAVRSMSAE
FT                   QVTVTRDGMYYLWFVTCDASLGESLTVTGRTTWRNPHGYLPGMMRHTRPFFGTLALAYG
FT                   GLVFWWTAKVAKVHVKRPDVVTQLHHCVTAVVAASFTEAFLWYADYEYFNAVGVRPVAL
FT                   TLLAVFFSAARESASRTLVLVVSTGYGVVRPTLGGLSTKVVGLGTAYFVAAVALDVATH
FT                   VGNVDDLTQTTRVLLVVPVALMDATYILWIFSSLSRTLTQLRARRQLAKLALYARFTNV
FT                   LAVSVVGSVMWILYETWFRATDALNQKWQVDWVVGAFWHVLSFLLLGAICVLWAPSDDA
FT                   ATQFAYGEVSGKDDATGAMFDGFEGWDFGDGDASGGGYSDEEDGREREMRKVPAGHMGG
FT                   GKGMGVGQTPLKGGDVFLMDSDDEREARLARDKMR"
FT   gene            complement(<176514..>177719)
FT                   /locus_tag="MICPUN_64375"
FT   mRNA            complement(<176514..>177719)
FT                   /locus_tag="MICPUN_64375"
FT                   /product="predicted protein"
FT   CDS_pept        complement(176514..177719)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64375"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX1"
FT                   /protein_id="ACO67757.1"
FT                   /translation="MTERSRLGCASASSSGKKTVCLYSAARARGAGMFKLTLRPAVRRD
FT                   PPDDGVEVRVTEDDASSKGAKRKRAPPTKGPCEHGVKYRSKCKVCSACPHGRLRTQCKE
FT                   CGGSEICEHGRRRYSCKECGGSGICEHGRVRSKCKECGGGSICEHGRIRSTCKECGGGA
FT                   ICEHGRERYWCRECGGSQICEHGRRRIQCKECGGSGICEHGRRRSRCKECGGSRICEHG
FT                   RRRYSCKECGGSGICEHGRVRSKCKECGGGSICEHGRERHRCKECGGSQICEHGRQRHR
FT                   CKECGGSGICEHGRQRSQCKECGGSRISEHGRERYSCKECGGSGICEHGRQRHRCKECG
FT                   GSQICEHGRVRSQCKECGGASICEHGRQRRYCKECDGSQICEHGRRRSQCKECRAAKAR
FT                   TG"
FT   gene            <177775..179103
FT                   /locus_tag="MICPUN_64376"
FT   mRNA            <177775..179103
FT                   /locus_tag="MICPUN_64376"
FT                   /product="predicted protein"
FT   CDS_pept        177775..179100
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64376"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8270 - zinc ion binding"
FT                   /db_xref="GOA:C1EHX2"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX2"
FT                   /protein_id="ACO67582.1"
FT                   /translation="MAPRVNGFRDADGRLSMNAHQWLGIGAYASLVLGFYLLQAPAVGD
FT                   STTRLALEICYGAVALVAACAFVKAAAVDPADDDDDDDDEAGLFCQLCDRNVHAGSKHC
FT                   RACDKCVAHFDHHCKWLNNCVGARNYHSFFALVATVLWQVLGQLCAGAWLLAWVSRNPA
FT                   RADALLDDDARFPSHLTRLEFQAALAAYLLLCVCLGYLVGDLFAFHVLLIRRGMTTYEY
FT                   IVSRREADDDDGRGGGRDGAGGARRADWKVAKGGDVLRCGWCAGNRVGVGDEDDGDATG
FT                   GGTRRKRKRVAVSCVGLLFARGVGVGGVGVGANDAPGRQGRRRGGSFDGPRGVTESSSS
FT                   AGKPSRASGDADGAQGDVASGTGRRGREEGYRVSGLGGAMEDDDAMDDDDDFGPHGLRG
FT                   LRPPSESLGSLRAPGAVGGGSARGGTGIGRSGSGVRPVSARE"
FT   gene            <179498..>180594
FT                   /locus_tag="MICPUN_68964"
FT   mRNA            <179498..>180594
FT                   /locus_tag="MICPUN_68964"
FT                   /product="predicted protein"
FT   CDS_pept        <179498..>180594
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68964"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16597 - amino acid binding;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR040217"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX3"
FT                   /protein_id="ACO67583.1"
FT                   /translation="VRVTCPDKTGLGSDITRTIFDFGFVVLKGDFATDGKWAFVLVTVR
FT                   RQGGGAETSAPVNWDLLRIRLENLCPSKASISTLSSLNLRSVGEVRDPLEPPKGTMYIL
FT                   QVEVEDRVGLLHDVTQELWASELTVHRAHISTSPADTAVDLFYVTDERNELPAEARVAE
FT                   ISRNVQRTAVRQTFGESGGGALAMGGRHCRVTVTPAPKFVTKTSSAGRLVEANSIGKIE
FT                   TASATQYSEATVTVDNLMSQKHTVFQMRTRDRKGLLYDVLRASKDLKVHISYAKVELKS
FT                   GGLCEVDLFVARCTNLQEQRYLCQRYKENIERPVSVQIMTMGLDEITTELRVIAPLDIS
FT                   GFTRPRVLLDVTEALRQLKVMVFKA"
FT   gene            complement(<180913..>181761)
FT                   /locus_tag="MICPUN_64378"
FT   mRNA            complement(<180913..>181761)
FT                   /locus_tag="MICPUN_64378"
FT                   /product="predicted protein"
FT   CDS_pept        complement(180913..181761)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64378"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX4"
FT                   /protein_id="ACO67758.1"
FT                   /translation="MDGAHANAHDDDSGDVDTGFWTAADRENMKKPILVPAKLVAPTQR
FT                   GFYARAPKLGKKAEAELQRAKDAFDQYLANAEYSRPLVELLKPHIRPRYEAVVGDSEGF
FT                   SLYVTSTPSQRELKTLPKSERTSHHLIYDYCINMSAFHPLIDFHLTTDAGKLFTAYVSM
FT                   WPGCFALRRDKAATRKLTEAERAARRLPAKVTPTDVVVSQEAYIAYRSGNVVEPTPHQI
FT                   AYMERRKIEEGSDAVLSAYPFSLHNDEVALMNVRMRAANAKKRLREEVEAELDWRSNEE
FT                   I"
FT   gene            <181935..185002
FT                   /locus_tag="MICPUN_64379"
FT   mRNA            join(<181935..181988,182112..182369,182492..185002)
FT                   /locus_tag="MICPUN_64379"
FT                   /product="predicted protein"
FT   CDS_pept        join(181935..181988,182112..182369,182492..184237)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64379"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3924; GTP binding - GTPase activity
FT                   [PMID 5525]"
FT                   /db_xref="GOA:C1EHX5"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR019762"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX5"
FT                   /protein_id="ACO67584.1"
FT                   /translation="MDPAAHLPSRPLEPLLRLEACALAGDGVDAPRRQDLPSLWQCLPQ
FT                   IVVVGGQSSGKSSVLEAIVGRDFLPRGAGICTRRPLILQLHCVDDAEKDTARFLHKPDE
FT                   VFDDFRKVRAEIEAETDRLLGANTKSVSAEPIVLSVRSKDVPNLTLVDVPGLTKVPTAD
FT                   QPASIVRDIESMVKKFVTPPDVIVVAVSPANADIATSDGVRIAREVDPGLVRTVGVLTK
FT                   LDLMDRGTDASEVLAGRAVRLRLGWCAVVNRSQFDINANVDMATARANERSFFDEHRAK
FT                   YSNVNCGTGVLTEMLTAILGDSIRRRVPRIRETIDGAAAALELELMTLGSPVPSDRGAL
FT                   MHEVLLSCGGFEKEFVKSLDGGRGGGETIRVIFEDKLVNSLRSLNLREFYGAEFVKSVV
FT                   DATDGYQPHLVAPELGIRRLIELGLARLRDPTAQCVRAVDRVLRSMVERSVEDGVGAGL
FT                   GTLGTAPSSASSGGGRGSSSSLDGTLDGTLDGTLDGGGGRDRLRRFPALRAAVASAAYS
FT                   ALDARRDESEKMVAALVDMEASYFDADFFRRFTREEHLRRYNNAASEPDESSPPTLDEA
FT                   SDGRPTKRSDETLDWDDRVGLIRASVYAYVDAVRTRIAKSVPKAAVHCQVVPARSGLLA
FT                   DFYANLGGKTQEELASLMAEDDGVGERREACKTRLGLLNRARAEIAAVVG"
FT   gene            185166..>185667
FT                   /locus_tag="MICPUN_64381"
FT   mRNA            185166..>185667
FT                   /locus_tag="MICPUN_64381"
FT                   /product="predicted protein"
FT   CDS_pept        185421..>185667
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64381"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5839 - proteasome core complex;
FT                   GO_function: GO:4298 - threonine endopeptidase activity;
FT                   GO_process: GO:6511 - ubiquitin-dependent protein catabolic
FT                   process"
FT                   /db_xref="GOA:C1EHX6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035206"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX6"
FT                   /protein_id="ACO67585.1"
FT                   /translation="MDVIFGFVGDKFAVVVSDTMAVQQIIINKDDEDKTLELDSHKLMA
FT                   MSGPKGDCVYFGEYIQANMKLYELRNGMKLSTHAASS"
FT   gene            complement(<185770..>186321)
FT                   /locus_tag="MICPUN_104292"
FT   mRNA            complement(<185770..>186321)
FT                   /locus_tag="MICPUN_104292"
FT                   /product="predicted protein"
FT   CDS_pept        complement(185770..186321)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104292"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHX7"
FT                   /db_xref="InterPro:IPR006811"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX7"
FT                   /protein_id="ACO67759.1"
FT                   /translation="MAEAKRFAMVCAANMNRSMEAHKVALNAGLDVKSYGAGNRVKLPG
FT                   ASRDNPNVFEFGSVTYKDIYDKLMAEDEKLYTRNGLKDMLERNMTIKPAPQRWQDSEVD
FT                   VDVVVCFEERVFDNVVSDLKGRVGGSGEPLLVINLDVIDSHEEALNAGPHALKLCEMID
FT                   ASDDWECECDEIMDSSRGNP"
FT   gene            186636..187564
FT                   /locus_tag="MICPUN_109546"
FT   mRNA            186636..187564
FT                   /locus_tag="MICPUN_109546"
FT                   /product="predicted protein"
FT   CDS_pept        186891..187517
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109546"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5839 - proteasome core complex;
FT                   GO_function: GO:4298 - threonine endopeptidase activity;
FT                   GO_process: GO:6511 - ubiquitin-dependent protein catabolic
FT                   process"
FT                   /db_xref="GOA:C1EHX8"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035206"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX8"
FT                   /protein_id="ACO67586.1"
FT                   /translation="MDVIFGFVGDKFAVVVSDTMAVQQIIINKDDEDKTLELDSHKLMA
FT                   MSGPKGDCVYFGEYIQANMKLYELRNGMKLSTHAASSYTRNQLAESLRKGPYQVNLLLA
FT                   GYDADVDEASLYFMDYLASCQKVNSGGHGYGGMFCLSLFDKHWKPRMTREEAGDLVDKC
FT                   IAEVRTRLVTAPTKYHVKIVDKDGTHTTLYDCVEKAAQKARDEGK"
FT   gene            complement(188652..189448)
FT                   /locus_tag="MICPUN_109547"
FT   mRNA            complement(join(188652..188994,189170..189448))
FT                   /locus_tag="MICPUN_109547"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(188938..188994,189170..189283))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109547"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHX9"
FT                   /protein_id="ACO67760.1"
FT                   /translation="MLGTRITSFAFGFACASGISMYKLKEEIWSSHKILADQCAATEAR
FT                   LSKLEMTMSKQ"
FT   gene            <189559..>190773
FT                   /locus_tag="MICPUN_104294"
FT   mRNA            <189559..>190773
FT                   /locus_tag="MICPUN_104294"
FT                   /product="predicted protein"
FT   CDS_pept        189559..190773
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104294"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY0"
FT                   /protein_id="ACO67587.1"
FT                   /translation="MTTASLSQCRRLAHHARWRTPDPRSYRRGASSRRSLNRVVVVAAD
FT                   GRFRDEAERRAAIDRLSPPSTSRSTDDGGDARDDDARDPAKAPRVPPPKITRDADRTRP
FT                   RRFKDALDADRRRKGGAVGRTARMPANDEDPPADVDREALARELRERRRERRVAAVESE
FT                   AADRLASIVQIVRAELGDPRVLISSSMDGEARNKRFAALYERLEGVGTVEIAFALVKYY
FT                   WTYWDEAEAGETSEKAAFAAELGDSKSTSEEENDTSTSSSENKENEDDEEDRSTYDEAV
FT                   DEKTRRALLRAAQLRATQRGDEVRTSSSYYSGDEDFGDEKSAPGDGNKGADDDEYGLMD
FT                   AVADMVRSYFSVDVVKDEDGNEEMVVMTSPEFLGFLIVAVIVSSRLGRYLVDTYLATPV
FT                   DPLLR"
FT   gene            complement(190792..192627)
FT                   /locus_tag="MICPUN_109548"
FT   mRNA            complement(join(190792..191920,192039..192204,
FT                   192332..192627))
FT                   /locus_tag="MICPUN_109548"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(190823..191920,192039..192204,
FT                   192332..192456))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109548"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:30131 - clathrin adaptor complex;
FT                   GO_function: GO:5515; protein transporter activity -
FT                   protein binding [PMID 8565]; GO_process: GO:6461;
FT                   intracellular protein transport - protein complex assembly
FT                   [Evidence 16192] [PMID 6886]"
FT                   /db_xref="GOA:C1EHY1"
FT                   /db_xref="InterPro:IPR001392"
FT                   /db_xref="InterPro:IPR011012"
FT                   /db_xref="InterPro:IPR022775"
FT                   /db_xref="InterPro:IPR028565"
FT                   /db_xref="InterPro:IPR036168"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY1"
FT                   /protein_id="ACO67761.1"
FT                   /translation="MASGGGGWQGMARNPPVALSALYFLNLRGDVILERQYRDDVDRNM
FT                   ATAFKTEIINGKDRGGNPVVNLGMCSFMYTREENVYVVAVTRANANAMLAFTFMHQLIS
FT                   LFKSYFNKFNEKVLKSNFVIIYELLDEVCDHGYPQITSPEVLKSFITQRADRAADDPTA
FT                   TYENQRKAKEVSMQVTGAVQWRSPNLTYKKNEVYLDIVESVSLLMSPKGVVLKASATGV
FT                   IEMKTLLSGMPELTIGLNDKVGEEAQANAQATHGGNHKKSIDLADLQFHQCVNLSKFAS
FT                   EKTISFVPPDGKFDLMKYRVTEGISLPFKLMPLVKELGRTRIQVDVKVRSCFSDKQFAT
FT                   NVKIRIPVPKYTSGATCKLTGGTAKYKSAEEALVWKIKKFQGMTELTLSAEVELVSTTT
FT                   ERKPWHKPPISMDFHVPMFTASGLRVRFLKVWEKSGYQSTKWVRYLCNSGRDTKTGVYE
FT                   VRCQ"
FT   gene            <192757..>194004
FT                   /locus_tag="MICPUN_64388"
FT   mRNA            <192757..>194004
FT                   /locus_tag="MICPUN_64388"
FT                   /product="predicted protein"
FT   CDS_pept        192757..194004
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64388"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY2"
FT                   /protein_id="ACO67588.1"
FT                   /translation="MAPTIASRVERRWRSSPGVVKAFIEQRDVRAVDNAAAARAPVGAS
FT                   AFEGNVVGTRRERLDDEDVEILARRATEVVPDISALVSVTTVVKVKECVRRWRARVRSS
FT                   LPTPERKTVTRMARTREDDATVTLCEETVARAMKDPAAVRCPHLLAADDDTGGFWRSDD
FT                   DGARFVKPRSVRTVRVNAPGTPFLAKHVQCDRCHAAMQALAVRSVAVCPACDASVPRHV
FT                   MARYAHDWDGDPSKLTQLCLFCDKLNQRVAREAEERFRPGDRARAASRACIEPSCGYLA
FT                   VDDVPFIETILHRNVASRWDPITNENVSVEKERRTRVGVYTVRKSSKPDEGVSDSPLIN
FT                   DVVAHEWEFTRQGYAHGLRGDAPETERGFLAIGDPPPIVDETFPRIGQTRLTPNLMKKT
FT                   YAGRRKEVRPPRIVVQ"
FT   gene            complement(<194394..>195055)
FT                   /locus_tag="MICPUN_88535"
FT   mRNA            complement(join(<194394..194828,194990..>195055))
FT                   /locus_tag="MICPUN_88535"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(194394..194828,194990..195055))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88535"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR010400"
FT                   /db_xref="InterPro:IPR037047"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY3"
FT                   /protein_id="ACO67762.1"
FT                   /translation="MGIPETDLIEEMDLSSVECLNMATGKEWGNAVKPGYREDAGLLCQ
FT                   SDDDEQLIVTIPFKQLVNLTSLIIRGPADGTAPRTVKVFVNKPNLSFDNCGKKAAESLV
FT                   LTAAQATGDEKIELDFTQFQNVRVVSIFVDDNQGGGDVTNVAKIVVNGHPVHTTNMSEL
FT                   KKC"
FT   gene            <195231..>195950
FT                   /locus_tag="MICPUN_64390"
FT   mRNA            <195231..>195950
FT                   /locus_tag="MICPUN_64390"
FT                   /product="predicted protein"
FT   CDS_pept        195231..195950
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64390"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY4"
FT                   /protein_id="ACO67589.1"
FT                   /translation="MDAGDEDGGDVGVTREDAAILMTLKHGTKRKRRRAGSTCEHGRQR
FT                   HRCKECGGSQICEHGRRRSRCKECGGSEICEHGRQRSQCKECGGGGICEHGRQRTQCKE
FT                   CGGVSICEHGRRRTQCKECGGGSICEHRRRRSECKECGGSGICEHGRRRSTCKECGGSQ
FT                   ICEHARQRRHCKECGGASICKHGRERSKCKECGGSQICEHGRRRSRCKECGGSGICEHG
FT                   RRRDGCRECLAAKALTG"
FT   gene            complement(<196022..>197335)
FT                   /locus_tag="MICPUN_88752"
FT   mRNA            complement(join(<196022..197086,197195..>197335))
FT                   /locus_tag="MICPUN_88752"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(196022..197086,197195..>197335))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88752"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY5"
FT                   /protein_id="ACO67763.1"
FT                   /translation="KAILAGSRNSAALASSGALYTWGWNSHDTLGHDVDDEWIPRPRAV
FT                   AALDPSDVACASLGGWHVCAADNDGRLFAWGGNEYGQAGVDTGTAGQGVHVSLHLSVPE
FT                   LVPFPAPDGLNANRLQITQVACGGMCSFAVVGRTGEVYTWGQTVGSEKEPARSPVRVPG
FT                   IKGVTTLAAGMFHALALQEDGRVFSWGNGDYGQLGLGRPGNEDTPTEVEALSRAGVRSV
FT                   AAGGWHSAAVTAGGVCYVWGRGEYGRLGLGDGDCADKQRPVELTLGSWGGDNREGGGRG
FT                   GSVPRIVEAALGGTHSCLLDESGRVYSFGRNSLGRLGRAVSGKWSGDPAPVHFPPAPGG
FT                   GAWRVTSVCAGGRHTMATARVRSKERLDAEEAAASASGGSRPRSPLLSQSPSRRTSISA
FT                   QQ"
FT   gene            197915..199072
FT                   /locus_tag="MICPUN_109549"
FT   mRNA            197915..199072
FT                   /locus_tag="MICPUN_109549"
FT                   /product="predicted protein"
FT   CDS_pept        197936..199009
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109549"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5524; kinase activity - ATP binding
FT                   [PMID 16301]; GO_process: GO:16310 - phosphorylation"
FT                   /db_xref="GOA:C1EHY6"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY6"
FT                   /protein_id="ACO67590.1"
FT                   /translation="MPTATLSASASLGAPTRAACARAGRTARRVALRSPGSIASSSSSR
FT                   RVVVMAAAASDAVPADAVEYFSPSKVNLFLRVVRRREDGYHDLASLFHVIDLGDDMKFA
FT                   KSTGSRDVLVCSDETIPLDSSNLVIKALDLWRQRTGSTQHFWVELVKNVPHGAGLGGGS
FT                   GNAATAMWAANELCGQPASEAELLEWSGDIGSDISVFFSEGAAYCTGRGEIVEDVEPPI
FT                   PLDTPMLLVKPDIGLSTPAIFKALDLDGRSTEDPLDLLERIKSEGCKDDICVNDLEVPA
FT                   FGKLPELLKLKERLRGAGTKGVSSVFMSGSGSTIVQVGSDDVPEFVREDAALFRSPARL
FT                   ITRKRGEWYKPSGLWKK"
FT   gene            complement(<199125..>200003)
FT                   /locus_tag="MICPUN_64393"
FT   mRNA            complement(<199125..>200003)
FT                   /locus_tag="MICPUN_64393"
FT                   /product="predicted protein"
FT   CDS_pept        complement(199125..200003)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64393"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:9654; extrinsic to membrane -
FT                   oxygen evolving complex [PMID 19898]; GO_function: GO:5509
FT                   - calcium ion binding; GO_process: GO:15979 -
FT                   photosynthesis"
FT                   /db_xref="GOA:C1EHY7"
FT                   /db_xref="InterPro:IPR002683"
FT                   /db_xref="InterPro:IPR016123"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY7"
FT                   /protein_id="ACO67764.1"
FT                   /translation="MSVVCHRGTGLTARAAPRAPPRRVARPAIVTRGAAVDGASSSSQD
FT                   QQPRSQQHRQQRSPGLFGRRALGAGAALVASTLLESTALVPPARAFTRPPPGYRPFNDT
FT                   IDGYKLFRPEDWIEVKGSGNDVFFRNPSSVEENMFVSISSPSSTKFASPRDLGTPDEAA
FT                   QKILAQYLNEFMSSRLGVRRESSVVSAREREGTDVDGEPMLFYDVELRIKSYAAKNQYG
FT                   LTEADRPQFLEWDRTLSSTLGVANNRLYELRFQTSALDVDEAEWRARYGVIKDSFKPFD
FT                   VDQSNLSFPLF"
FT   gene            <200245..>200892
FT                   /locus_tag="MICPUN_64394"
FT   mRNA            <200245..>200892
FT                   /locus_tag="MICPUN_64394"
FT                   /product="predicted protein"
FT   CDS_pept        200245..200892
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64394"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8080 - N-acetyltransferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EHY8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY8"
FT                   /protein_id="ACO67591.1"
FT                   /translation="MEPHPAMEWTASKPPLDGVSIEPLSDATLEGARAVWNDFVRRSNK
FT                   RFLFGCCPACDESARQFARPFEADPSRLRTAAVAVRRADGNVIGAVVCTTHGQMRTEEE
FT                   RSVAPDPKPGASHVEWIAVLPEARGGGIGAALLTHAFSAVKQDPWNARSIDLGVVGGNR
FT                   AKRLYERLGFERVGPNDPIEKCIAGCVICFFMGCPNRDPCAGFTYSDMVKAL"
FT   gene            complement(200923..>203010)
FT                   /locus_tag="MICPUN_64395"
FT   mRNA            complement(200923..>203010)
FT                   /locus_tag="MICPUN_64395"
FT                   /product="predicted protein"
FT   CDS_pept        complement(200986..203010)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64395"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHY9"
FT                   /protein_id="ACO67765.1"
FT                   /translation="MTAVATTAHLPPMRTRTGTGRPMPIKPYRHFLVQKNMDRRLSGKN
FT                   NIQPNPRGGALLSRAPPAMTKISPKRASAVVPRAAQHSYAEWCKERGVDAPNVSIHYLT
FT                   SSLPDGAETERGCLVTAPIDAGRFRALQKAPRLFLRHVVVRAPRPVPAPTRPIPPTRKT
FT                   RRSRASTRIARAGQVIARCPASIVFALPPSPPNPFPDFCPDDLWNDPPGVAPGRPAQEL
FT                   RMALALIRERRAGTASPWHAYVSQIPDEYDLLGMWTDAQLDELHAPKLVDDAKRQRGEN
FT                   SAAASAVCDALGLTPAEVHWGLNTVRSRSFLGKYPTSVSVMMPPYAAGTDAATTLAECD
FT                   AREEQKASQLAAAEEDARRAAEAARHAASAECGLDPDDPAGVAVASCTPSDVSRRSAAQ
FT                   PAVFVVPFLDAFNHSPSSSDGSQTGDASGGATKLTFTDGAFQLVATRAMTPGTEATISY
FT                   GAHANDELLLRFGFCVEGSEDEKIALPGCMDELEWLMPGSLREADMKAEGLHAAVKDAH
FT                   LTHDGEASPDLLWALRVLLASDDEYEALGGVHGLRREFSGIEEVGSGAQLAAEASLALA
FT                   CERELTEMGGLAAYDEDLVNLHAVEGVYGEVVAECSLDSGDVERCGGDGEDGNDATFLR
FT                   RLLSALSFRVNRKRILARAMERYTPGGVGFVDPEAALEV"
FT   gene            complement(203496..>208966)
FT                   /locus_tag="MICPUN_64396"
FT   mRNA            complement(203496..>208966)
FT                   /locus_tag="MICPUN_64396"
FT                   /product="predicted protein"
FT   CDS_pept        complement(203708..208966)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64396"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="InterPro:IPR036322"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ0"
FT                   /protein_id="ACO67766.1"
FT                   /translation="MVAAPVKRKTTSSSSRRAATSAAADSGLDMELARVIGMSQCRGGG
FT                   LACSPATGDVAHPAGAVVVVYSPARDAQVRFLRAPRANSGVKETRAIRPSATTRGGLGL
FT                   GFAGASSGGGKPFACVAFSGTSKGDKTIVGSFVAAGERGHQPAAVVWSAESGRALAVLR
FT                   GHRYGVESVAFCPSDDAKVLTLGADNDGHVALWDWREGTCLARHFCAHDASGHLRAVSF
FT                   DATGTAFVTAGARHLKVWTVGTKGDAHDDGSKFHAKYRKLAGGGANNKRVFGLVECGSK
FT                   NADVGGHASHTWVAVCAPSTTSTHRERRETAPGDDSATNESANAFSDDDALYALSEEGV
FT                   LCMLRRGERVERWVDARVRRGGSVAVGGPNVAVAAGDGVVRIFQRGTLAYRGTLPRPDR
FT                   AELDASPGSTRHPAAPATSFEPPPGVAFPDAVACAFDTRGVVLTVAYSDRSVFRWDVRS
FT                   SIDGAALPVRRFFAHSAAVWGVAPLPPAASERGIAPRGTFATCAADGSVRLWHLGERDD
FT                   RTGGGDWEHPEPHPVGSDQGSGTYSQTAVMYATPDPSREAAALKQVEKQADGGADEAAV
FT                   AAAGGHALRCVATRPDGVELAVGDAAGNVRVFDLASRTERLRLAAHDAEVLCVAYGPSS
FT                   ADKSKGGGNVVRTSASSPDSAGFPFVAEAEAPELRLVSCGRDRLVHTYDASLAPDGSPG
FT                   TYLLEETIDDHDAAVTGARIAGLGSDATLVTCGADRKVIFRRLAPLKRVRSKTNNNPHN
FT                   NPHVNRPTKAFSTETMPRGTVHGVDVDAGGRTCATAGADGRLRVWSVGSGKSTRAFPCA
FT                   DEGAGEAVCVAVDDAGTLAAVSHVDKVVRVYDARTGALVGRCAGHGDAATCVAFTAGGW
FT                   SPAGGALVTGGADGTICVWRLPAAYANRAHPPAAAKQRAVLVGTDAGALKLRPVDVNDR
FT                   YGAPVWKTPSGTRPGLCLDVSDGGATEDRATAVSAKEATHAVEDDATRADELNASGSSS
FT                   VPSLAPFEELPRWAAAGVQQHERERAERETEKLANLAKVAAGSKWAANAPGGYAPKLEG
FT                   LSASVIDHGDVDVRIDEDEDRPDKENEPTRSPRRAPSVVSLKPLDDDDDALYYAESEPG
FT                   GALAEHSAAPGAAFGVVTTSPRREGSDVVATDETVVHDGIEATTPAHDAKAEELSEDRP
FT                   KDKDRPKGVFARVAAMLAGGGGKKPPSHLGKKERPVEAEKPLQTPCSEPPRSESPTLGG
FT                   NRFEVPRVADSDDADEVATDSEEFGSSEDESSEDEPAVPLALRFDSADEEDDTEDPTRA
FT                   GPAIEPTRTHAGALRESFSGRWRRRAKREPLPVHELIGGGDAPVAIDAVDVATAIDAVE
FT                   REDASRRAAAAEFARERATNDAKGGEDAVRKSVEELRASLPRIRTSAEKKKEEEEKEEV
FT                   KEEKKEVKEEKEVEVAFEPEATWPPLPEDAPSDDDDDDDDDDDDDDDATAPSDEDEDDD
FT                   DAVRRSIADAVAYAVDAEEEDVTAVTAVTAEGNAGVIHDSDAPTPEAEPEPVAEPLPSI
FT                   EPAAARRSSRSAGGGLRASLKKRRGRARRIIAAIAARTARTKDDARVGGKEREPEAAAD
FT                   AARSSPEPVASPEPVAMDALAAMDALDAAVRASLAAVRASVKDAGAHERAAVVARLASL
FT                   ASTMRLDDRSSAEASAPRAEVHVQTDVDDGAVRGSSFGADGESRARVVDDDDAGHPSAS
FT                   DETPAMPKGLADSFEVPPSLERAINATMERALAAYSERLIETVRSSVAASATSRG"
FT   gene            209364..210360
FT                   /locus_tag="MICPUN_109550"
FT   mRNA            209364..210360
FT                   /locus_tag="MICPUN_109550"
FT                   /product="predicted protein"
FT   CDS_pept        209369..210334
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109550"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ1"
FT                   /protein_id="ACO67592.1"
FT                   /translation="MQAKDSAQDLSKLSIEDNFGHRFFIAPHRHTKTLYLVRHGEGYHN
FT                   LHGEPSLGGDRANYKSERYFDAHLTPKGWAQCRALKKHLDEAVTHDGCEHVMDRIELVV
FT                   VSPLMRALETAVGALGGDDKSCDPPASRLDSALMLSRTAIEGVRPAHAAIGTRNEGIHE
FT                   QPGRKGLKFLACELCREHVGENPCDRRRPIREYAAAFPGVDFSEITDEEDTAWGTMIET
FT                   NDAMCERAHRFMEWVMRRPETHIAVVTHSAFMAAMLREFGATDQLGCHESVKQETHRWP
FT                   DNCEMRPVVVIDPSGGGGLDPMFFPGGRTGLENFDDADNV"
FT   gene            complement(<212076..>212441)
FT                   /locus_tag="MICPUN_50740"
FT   mRNA            complement(<212076..>212441)
FT                   /locus_tag="MICPUN_50740"
FT                   /product="predicted protein"
FT   CDS_pept        complement(212076..212441)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50740"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ2"
FT                   /protein_id="ACO67767.1"
FT                   /translation="MKLCPTSSDIHHPHTFIRRGKPVSHVEVEAGLLHFTRADVAVPAA
FT                   VSPSTRCARARPRGASDTATVDAVKLPVAPILARVRGGSARIWFAHRRCHYPKAARRCP
FT                   RYRVPGITRRLTRRPAR"
FT   gene            complement(<212478..>213701)
FT                   /locus_tag="MICPUN_104300"
FT   mRNA            complement(<212478..>213701)
FT                   /locus_tag="MICPUN_104300"
FT                   /product="predicted protein"
FT   CDS_pept        complement(212478..213701)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104300"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ3"
FT                   /protein_id="ACO67768.1"
FT                   /translation="MSDGAGEAVENAPAVATTDPPTTPVARVASTDAVVIGGTSGGGDD
FT                   DPTPPAFSTEDLARMEEERVRVQELYLREADLKRREKAVAVAELSSPESLAAMNAERMR
FT                   RAENFRLEALAKKATRGKDDAPPPPTAAAATSPVIPAETTWMERERLERRRRYELEAYE
FT                   RRRAAERAVTAEDVLRRKEAEASARRAMAEAMYAPSFVPPPSAVLGPNGSALGGNGDDD
FT                   DAVETVTLEEVLHAATTTTAADAAADAAADDDAPGVVERGPETRFDEGDARGSDSGDAT
FT                   PDEGKGGGAADENDDDDADEIDAIADRLAAAADEDEAWDELDANGGVIAYGRIPWPNEL
FT                   DDISNHRLPASVERARLDRLASRFDPDEFLATYGDRVDEADGTRVMEKVREVSRAVQER
FT                   RAALRRDS"
FT   gene            <213700..>215017
FT                   /locus_tag="MICPUN_64400"
FT   mRNA            join(<213700..214076,214291..>215017)
FT                   /locus_tag="MICPUN_64400"
FT                   /product="predicted protein"
FT   CDS_pept        join(213700..214076,214291..215017)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64400"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHZ4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ4"
FT                   /protein_id="ACO67593.1"
FT                   /translation="MSISERRRTRFLSDGGDSAGALLADVDVHGFSQVKTNSPVARLPD
FT                   ADWVRAMDAPDRHDTMVEATELAQNNEYKSYHSGVVIASYCVVAVVAVLAARDVQKQRA
FT                   ARPGGVSADLVGAAAGKDGVSRFALGLGRLFWLLFGVFFVGYHLCYENILHHTDGMEYL
FT                   SDWTIVLLCFVMGLLSWHSLVKDPEGSVPGWVTELAVIAYAVAWSSNIMSTVGAWYSFF
FT                   FYPICETLEGVNNWPWCYLEWYRLTEHGLNMLVLLGDWRWGCVPLRRKDLGWSVLFLEV
FT                   YALWAWYLMFKTGRCPYDMFDFATGWGELPWLMAALGGIAICHALARWAHVRRDDAAGR
FT                   DPEGEGGGTLPTRARQGGGYKSLDGSG"
FT   gene            complement(<215206..>219153)
FT                   /locus_tag="MICPUN_64401"
FT   mRNA            complement(<215206..>219153)
FT                   /locus_tag="MICPUN_64401"
FT                   /product="predicted protein"
FT   CDS_pept        complement(215206..219153)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64401"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHZ5"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ5"
FT                   /protein_id="ACO67769.1"
FT                   /translation="MLRYKIIAFLALFVGLAAAQQKVMPSTYTAFTESPYPETSANQQK
FT                   NLASDYIIYKGSMQPLKYTELIRSGEKVGGVTFAQIKTTAGATIPHSSTLTSVATITGM
FT                   SADSKSATLAYDAAIGKEAAHSNTKVSNMEDFVSLLKTRNTASPNTVWAVVHLEDRPAN
FT                   IQVLELEQAAATGILTVKKIHKADFSADGGLIATCAGSVSPWNTHLGGEEWGVPSSLKW
FT                   DSAVTGAYTSTSDLGGDVLSLRHLGLHDDDLATIKNSWTPYMHRWVNEVSIDDSSSVSS
FT                   PTITATKHYSMGRYSIELPYCVGDFPQVCYITDDSNTGVAAMFVPDKANDLSSGELFAM
FT                   KVTQTSTKGVGAGKFDVEWVSLGKASDSQVKTLMGTAGSYIKFTDMFEIGTKTAGPNGD
FT                   YDFTCASGFKATVVDGGAMCLKLKTGMEIAASRFETRIYAAYVGASAQWRKLEGITWSK
FT                   NRKEMYFAISSNEASMEHKLDSKGDHAEGDHIGIEKNTCGCVYRAPLDANNRIKSISPL
FT                   VCGVPTSFNTEDKLGHTDGDDKCDIHNIANPDNVAFMNGHDILLIGEDTSKHKNNAVWA
FT                   YHMETHALTRINTVVQEAETTGVWYHENINGWSYIMNQVQHPDEASTYGGAGTVGYLGP
FT                   IKVPGVEAEPTQPVAITGATGTFFGESPYPETSAAQQSNMASPWIVYKGLFQKLQYTEI
FT                   IRSGQKVGGVTFAELLDDSGKTMPHSSELGSVATITGMSDSGKSTLAYDAAIGKASKTK
FT                   ISNMEDFVSILKTRNKATPNTLWAAVHLEDRPANIQVLRLKQNPGTGILTPDKIFHADF
FT                   SADSGLIATCAGSVSPWNTHLGGEEWGVPSSLKWDSAVTGAYTKTSDLGGDVLSLRHLS
FT                   LHDDDLAKIKKSWTPYMHRWVNEVSIDDSKSADEPVITATKHYSMGRYSIELPYCVDAT
FT                   PQVCYITDDSNTGVAAMFVPDKANDLSSGELFAMKVTQTSAKGVGAGKFDVEWVSLGKA
FT                   SNAQVKALMTKADGSYIKFTDMFEIGTKTAGPNGDYDFTCASGFKATVVDGGAMCLKLK
FT                   TGMEIAASRFETRIYAAYVGASSQWRKLEGITWSENRKEMYFAISSNEASMEHKLDSKG
FT                   DHAEGDHIGIEKNTCGCVYRAPLDANNRIKSISPLICGVPKDKSFNTEDKLGHTDGDDD
FT                   CDIHNIANPDNVAFMNGHDILLIGEDTSKHKNNAVWAYHMETHGLTRISTVVQEAETTG
FT                   VWYHENINGWSYIMNQVQHPDEASTYGGAGTVGYLGPIKVPGTAAVGVDNGGKKAIELN
FT                   AEAAKAAAVSGAVSFVTIVPAIFAAVLALMM"
FT   gene            <219783..>221156
FT                   /locus_tag="MICPUN_64402"
FT   mRNA            <219783..>221156
FT                   /locus_tag="MICPUN_64402"
FT                   /product="cation diffusion facilitator family"
FT   CDS_pept        219783..221156
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64402"
FT                   /product="cation diffusion facilitator family"
FT                   /note="cation efflux; GO_component: GO:16020 - membrane;
FT                   GO_function: GO:8324 - cation transmembrane transporter
FT                   activity; GO_process: GO:6812 - cation transport"
FT                   /db_xref="GOA:C1EHZ6"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ6"
FT                   /protein_id="ACO67594.1"
FT                   /translation="MSGANTPAAASDAPAAVRTFSRGGKDEPDARDDDCDSRASSSGDR
FT                   PDDQLERQCGEWCVPLDDLDDNDTSASDAEYFSTVVWTAAMGTAVDAVLAVVKFAAGFA
FT                   FASSALVADAVHSASDVVSDLVVIAAARYASAPPDARYPYGRGRWEAVATLFVSVALAW
FT                   AASTLIVEFAERLAAAYDGPLGRHLGNPGAPPRSLLPSTRNALLEVLPANSGGASSTSI
FT                   LDDVAAAMRTEDPTDASHFRPSTKEADPNEGKTVGTAMDSAAVLVALLSVVAKEAAFQV
FT                   TNRVANRIGSKVLAANAWHHRSDAVSAFAALVGVAGAAAGFAWLDAAAGVAVSALVLKA
FT                   GWEIGKGATMALVDENAADGEVEEAVGAAASEALGTGAKSPTVAGLRARRVGRRTHVDC
FT                   WVELDPASQTSVGDALRRTEELRAGVRRRLGNEAGDVTVQLRWKEEAYTGGAFMYAYL"
FT   gene            complement(<221263..>224910)
FT                   /locus_tag="MICPUN_64403"
FT   mRNA            complement(<221263..>224910)
FT                   /locus_tag="MICPUN_64403"
FT                   /product="predicted protein"
FT   CDS_pept        complement(221263..224910)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64403"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR001611"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ7"
FT                   /protein_id="ACO67770.1"
FT                   /translation="MAPPRHSPKRVQRRAQQLQERQREEAERRRSRQGDADKEPAARRS
FT                   LDKDAPSFGKGDLPQVDLRDDPTTPDGEVTDISCYGGRLQSLSQIVGISRFANLRSLCV
FT                   HGCRLTRMDVDPMLRACGDSLRDLNLSSNRLARLEGLPVLRNLRTLDVTNNAIVSLDGI
FT                   DLGAPKLSRLVARYNRVRSLHALTIPRADGQPWSLAHLDIRDNNVETFADLGAGLAAVV
FT                   SLRAILLRSSPSPFGSFEPSSDADDPVHGLSSAPPSTTDSLEATAGSGEDVGTRGRRVG
FT                   NPVCLEPSYRLAIAALAPWLRELDGEPLSRGPDELAEGSGAVADARNADLLERAAREAA
FT                   ETAETAALARSAAEAAREGKEARVGKESLDLSFAAADESPENFIASDDSAAARRNRTTP
FT                   KMDEALTRYKARAVGQGRSGRSPAKRDHREVTFALTDEILQALDDDGVSTKAAEGSVAS
FT                   AEPDPPEPTSDAAATAAARDETDEDEQDARVERKRAKKRDRKERERRRAETDDADAAVV
FT                   DHELRLRRIERDLLRAANARREAAGGVHAAEVASTQRGAASTRGEVVSTQTSVSLGRGA
FT                   LAHPPPKPQSGGREQLEAEVSALKSQVEALLRERDPRGKGSGSGARPDWQHPGRRATIP
FT                   STPPPVRGNQPQQQQQQQPGADDVEVGAGADDGAEGAEGTDYADAETRVSSSPAKRLAT
FT                   AAEREAELARKLAAARAEVTAERKRHALETQRLKDDHAKSIDASTRAAKEATEARDVAL
FT                   KSLAEHPASVDAAELDRVNAELVSALAVSEELEATLREVREEAAANLDALRAMHARECQ
FT                   LRDENLVAANNLTRKVVQDLADSKTARDALESEVRRVNERVKAVEDEFRWALKESEEDK
FT                   TRLTAEVEEMTRVARAALDGKRDAEALAEELAEVCEQQRVAIEDMARDRRRAERAEADA
FT                   AAARADVGEMQVRIREAEKRASAAVAAERAATKALDLVKDQKAQSIAAIAEVDGVRKQL
FT                   ELAHDNVRIKDAMLESQAELIKSLKDENARNKEATSGAVKAAVDAERAASSRAKSTEND
FT                   LHRLKKDLAGADAAIERLEKALEEVTARRDAAEDAAADARREIAERDQMLAYVSSEVES
FT                   VKSMFAQREDGLRRERDDALARLAERDDADDELKAEARAAREDAAAARADAAEAAAAAE
FT                   ARVASIDERERAATEKVRRVEAEMRALLQEVAQHKRQSQAKVQELMALI"
FT   gene            <225301..>225555
FT                   /locus_tag="MICPUN_74827"
FT   mRNA            <225301..>225555
FT                   /locus_tag="MICPUN_74827"
FT                   /product="predicted protein"
FT   CDS_pept        225301..225555
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_74827"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EHZ8"
FT                   /db_xref="InterPro:IPR007872"
FT                   /db_xref="InterPro:IPR036671"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ8"
FT                   /protein_id="ACO67595.1"
FT                   /translation="MGGAYDEIDLEDMDWNSELGAFTYQCPCGDLFQITPEELRAGEEV
FT                   GHCPSCSLVITVVYDPDELKELIPAGNRDESGRWVEAEE"
FT   gene            complement(<225865..>227577)
FT                   /locus_tag="MICPUN_64405"
FT   mRNA            complement(<225865..>227577)
FT                   /locus_tag="MICPUN_64405"
FT                   /product="predicted protein"
FT   CDS_pept        complement(225865..227577)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64405"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1EHZ9"
FT                   /protein_id="ACO67771.1"
FT                   /translation="MLRALATGSTRAIAATGAVAAYLCSAAAATEAGPSTSSDHQGANT
FT                   IAGANRREVTPLDAPIAAAYPTAANKATAQWRVYTDIARDLSSRGEHEEAGKYLRRALK
FT                   EAQEGFGKDDPHVAAARNNLAELYRLQKRWDEAERLYEDAARALERHFGPSHPATATAV
FT                   HNLGGCKLARGDFRGAFAAYADAAKKKAASIGTSHPDYAQTLFHMAEAKRAGGEHEACA
FT                   SLLERSVRVLDECGRGDDGANLRRIERLAQVRGDVLGDHVSAERLRARVLEARERSSRA
FT                   HGDHEPGKRGFVRDLAMSQRRAAVASALEARARSLEALGRRSDAIESLRSAVRIHETRL
FT                   SDAMGLGIPRELLDADDIRPAGLVRGVIELVEQTVNPMFGWARPGAAAEAAAANMRLQL
FT                   ASARLTLADVALREEEARGDEAMAAMATEQLARAVGSLQPLAAAAAAALSKPPAADDDE
FT                   GSKGTASRAHGDDGDRSVAADIRRREISEAPERHVAALVLFARAARTLAAIESARAIPR
FT                   GGTGVGSHHLGDAVEWLYASYGADVRGVVAEAQARALLRELRDCVGCVAESRR"
FT   gene            <227927..>229864
FT                   /locus_tag="MICPUN_64406"
FT   mRNA            <227927..>229864
FT                   /locus_tag="MICPUN_64406"
FT                   /product="predicted protein"
FT   CDS_pept        227927..229864
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64406"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; zinc ion binding - protein
FT                   binding [PMID 8270]"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI00"
FT                   /protein_id="ACO67596.1"
FT                   /translation="MVSTSEADWTEYECPPTDVAAPAARSAPRQRHAGAVQPPTRAVTS
FT                   TGAKLTELGDLLVDLESQIIAEAQQRTWEQCRHHWRQRVHSLVPGEDACRRLSLLLLGA
FT                   FERGPSKPTKSQKPKPPLSAFSTKSLTRPDADRPPDDLNPRTHPHPRTRADLEASLLID
FT                   AQHESWIDTHRRHWVRRCKDLAGLDENLEDDTRIRSARVLRLDVSLSSYSVLALGLFGG
FT                   IRTDALRRISEGGWDADGCREWNRRIRLIMDDDEEEPEEPEPTPVPSSVLRARELALAR
FT                   ESLESLRRLPRRAPDARDEAVAAAQRTATRFERDYLDDGAGGVSDGPRDSADEDDSYNG
FT                   DDSYEDEEETTAAVAGTNLTREILHESPHYRQLVEHYRRRMGEPGYDPDASDDEDDPIR
FT                   DSLVAATVRETVGLHEGARRRLAVGHDGAHGLVTATRASRGAEANVAARAAVAAREVYA
FT                   AAGLPYPTRPLHEGLGFREAHRFAGVPYPADIFPTGVADAARSEDDRAGRLLARRLVER
FT                   ERLVRATGDFDAAGGEDGDDDDNATVAPSPPSLTPAPIDEAGVRDMDERDLRAALMDTA
FT                   RRLEAAQDELLCQICFTERRDALIMPCLHLLYCRSCVDRSSEANERRGLPDRCPCCRAS
FT                   VGGVLRCKRL"
FT   gene            <230069..>230959
FT                   /locus_tag="MICPUN_64407"
FT   mRNA            join(<230069..230807,230874..>230959)
FT                   /locus_tag="MICPUN_64407"
FT                   /product="predicted protein"
FT   CDS_pept        join(230069..230807,230874..230959)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64407"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI01"
FT                   /protein_id="ACO67597.1"
FT                   /translation="MPLIEEIAEEEPIDDVEPGRGDECSMSVDVKIQWSERLKLAGNAH
FT                   FKRGNLEKAVAKYRRGAKLFEMLYAVSATDEEGYEAANERCYVAAAPLYNNLALCLYKQ
FT                   GKWKEAADACTDNLDLTPTDAKSLLRRAACYAKINEWVEAERDIKCALILCEEKWALRS
FT                   AAETRKEIRELRLKQNMADHAVIGGKIADMKLYDAADVAPTGEAFPHSGRRKPSVTTVE
FT                   DVKKELDEMEDEDREETRRRKEDFYNGMIRSGKWRLVNASGEEIKQKARPAA"
FT   gene            complement(<231169..>232410)
FT                   /locus_tag="MICPUN_104304"
FT   mRNA            complement(<231169..>232410)
FT                   /locus_tag="MICPUN_104304"
FT                   /product="predicted protein"
FT   CDS_pept        complement(231169..232410)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104304"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR007109"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI02"
FT                   /protein_id="ACO67772.1"
FT                   /translation="MAKTRRKKRRTHLDQNAGREAPGGKGDIPKSFVMKRGKMSELVKE
FT                   LTEDVRHVMEPHTAKNLKESKANKLKDFVQVAGPLGVSHFIILSATENSKYVKIAKTPR
FT                   GPTLTFKVNKYTLAREVAAAQRNPRAPPNAFLSPPLVVLNNFGDAPHQKLATITFQNLF
FT                   PAINVRKVKLSTCQRAVLVDYDKESNKFQFRHYSINALPTGTNRHLKKLLTKNKVPDLG
FT                   RLTDIGEFFESGANSGHVSEFSDSEGEDAVNARVELAQDYNRLSKANTTSRVKLQEIGP
FT                   RMEMELVKVEEGMCEGRVLYHAYVDKTEDEVKELETRAVDKEALRKRRREEQERNVAKK
FT                   AKEKAEKEKIEEDMAALGARKRKRDKKKEKEKDAKIARKGGKGLDGGKGKGAKKSPSAR
FT                   PGKSKRIKGRTRSR"
FT   gene            <233036..>233956
FT                   /locus_tag="MICPUN_69609"
FT   mRNA            <233036..>233956
FT                   /locus_tag="MICPUN_69609"
FT                   /product="mitochondrial carrier family"
FT   CDS_pept        <233036..>233956
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_69609"
FT                   /product="mitochondrial carrier family"
FT                   /note="GO_component: GO:16020 - membrane; GO_function:
FT                   GO:5488 - binding; GO_process: GO:6810 - transport"
FT                   /db_xref="GOA:C1EI03"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="InterPro:IPR023395"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI03"
FT                   /protein_id="ACO67598.1"
FT                   /translation="TVARLMQRRPVAVITHVMGTGVALFLAGGTAGALAKTCTAPLDRL
FT                   KIIMQISSANQQTAAAKAAASGGLIPAFIAIGKSEGIKGYWKGNVPQVIRILPYSTAML
FT                   NSYEFYKQQFGGDQYRETGKLPVASRLMSGALAACTATLVTYPLDIIRLRLSVDPNMTT
FT                   MTQVCKAIIKEEGAKAFFKGLPATCLSISPYSALNFCMFDLIKKAIPGEETAQTVATAS
FT                   FIATMLASGTCYPLDTIRRQMQLKSSSYANVFDAGKAILARDGVGGMFRGFVPNVIKNA
FT                   PNKSVQLTTFDVFKRKIKESEKALEE"
FT   gene            complement(234120..234955)
FT                   /locus_tag="MICPUN_109551"
FT   mRNA            complement(join(234120..234265,234390..234499,
FT                   234842..234955))
FT                   /locus_tag="MICPUN_109551"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(234176..234265,234390..234499,
FT                   234842..234950))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109551"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5740 - mitochondrial envelope;
FT                   GO_function: GO:4129 - cytochrome-c oxidase activity"
FT                   /db_xref="GOA:C1EI04"
FT                   /db_xref="InterPro:IPR001349"
FT                   /db_xref="InterPro:IPR036418"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI04"
FT                   /protein_id="ACO67773.1"
FT                   /translation="MSARATLLNFAKRAAKAPVRVTRRNMSGGGTIEEERAHMEKWRGV
FT                   TFLAVPGCIGLGVYLFSNHHEHHAHEQPAYSYMRRRLKQLPWGGDCALFEYGKCQEN"
FT   gene            complement(<235098..>236141)
FT                   /locus_tag="MICPUN_64411"
FT   mRNA            complement(<235098..>236141)
FT                   /locus_tag="MICPUN_64411"
FT                   /product="predicted protein"
FT   CDS_pept        complement(235098..236141)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64411"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:31072; unfolded protein binding -
FT                   heat shock protein binding [PMID 51082]; GO_process:
FT                   GO:6457 - protein folding"
FT                   /db_xref="GOA:C1EI05"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI05"
FT                   /protein_id="ACO67774.1"
FT                   /translation="MASGGDGSETLYATLGVSSTVTAEEVRKVYRKLVLKCHPDKVRDE
FT                   AAKPEAEKRFQAIVTAYEVLSDTVKRAEYDKRMRLNGAASDDVLVNITLAEALTGATKL
FT                   AMIPYRKRCAWCAGVGMSCPPCTEHTHGRKDESCLTCGGNGFGKPVACAHCGAAGATDE
FT                   FHQARVVVPPGVEDGARVKIKDRREHAKINVMASRMFTRRGADVCSTLRITHKEANDGG
FT                   FHEVQTLRGSETLFWEAGAKTGDERRLQGKGLPRNGVGSGGGDGDRGDHVVVVEVKRET
FT                   TPEREAAAAAAAAGGGADAGEPSAKRARTTDDGPPESTTDLEKLLAEKKRQLMAKLQEK
FT                   KGPVEVD"
FT   gene            <236309..>237232
FT                   /locus_tag="MICPUN_64412"
FT   mRNA            <236309..>237232
FT                   /locus_tag="MICPUN_64412"
FT                   /product="predicted protein"
FT   CDS_pept        236309..237232
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64412"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI06"
FT                   /protein_id="ACO67599.1"
FT                   /translation="MGIHDLPPFPIPVDKFIEEVESDNASTAAQCCAAFATLATKVPVP
FT                   RDFRGACRSVMGLVERTGNGFGRATKESASAAMAALLACVPGADKHMVQRGVVGKLVAI
FT                   AVADEEDGEGDETPAAADGTSGTTRRGGVNGMGTLTLNALECIRILAASEHGVSELMKN
FT                   DEAMHFATRRCDSGDARIAECACDVLCALASRGVAHRTRVKDVGGVGALARALASHGGA
FT                   NEEVALRALLGLAMTCAQDAEAQAELVRVDGAVPALLAAQRSGGDAAGGISKDLWGSIG
FT                   KNPTLKMAAMEALRADVERARLVESA"
FT   gene            <237823..>239004
FT                   /locus_tag="MICPUN_64413"
FT   mRNA            <237823..>239004
FT                   /locus_tag="MICPUN_64413"
FT                   /product="predicted protein"
FT   CDS_pept        237823..239004
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64413"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI07"
FT                   /protein_id="ACO67600.1"
FT                   /translation="MESMPKLPKVTYTGSFKSVVAGTPGSVWKTDEDKPSYVDGRLIGR
FT                   SKVLEFCLVRPGCWCKIPPPCVGLCAPFIACGSTCRTTCGSVCGSVCGPCFKLPGMCKT
FT                   ECGKVCGPVCGPCFKLPGMCRTECGKVCGPVCGPCFKLPGMCRTECGKVCGPVCGPCFK
FT                   LPGMCRTECGKVCGPVCGPCFKLPGMCRTECGKVCGPVCGPCFKLPGMCKTECGKVCGP
FT                   VCGPCFKLPGMCRTECGKVCNPICNPICSFGKSCWAGCWGGCGKVCEPICTPCRSFGKS
FT                   CWLALVPFMCCVCCTCHPRKPSIEVEGDKRLQVGYPCHIEACWYCGGCSLDVTFLWDLC
FT                   GCLGPTSDLMQNGHFEPRELHNSKWAAKIPEAKRSVPKLTAAPAAQTMDANTA"
FT   gene            complement(<240002..>241648)
FT                   /locus_tag="MICPUN_88652"
FT   mRNA            complement(join(<240002..240282,240344..240430,
FT                   240565..240974,241062..>241648))
FT                   /locus_tag="MICPUN_88652"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<240002..240282,240344..240430,
FT                   240565..240974,241062..241648))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88652"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI08"
FT                   /db_xref="InterPro:IPR002013"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI08"
FT                   /protein_id="ACO67775.1"
FT                   /translation="MRLLTGHHLLLVTARRALGLVCGHVVWGVGDTKLVRLADTVDRRG
FT                   TKADEQRLKRLLQWVDLATGFFWSDTYNLTETLQTNALSPLSGERHPGHLVYCPGDFES
FT                   AFAWNAHLSRALRVALGTETASRWIAPLCHGYFAQTRASMSGREVTMTVLARRSRHHAG
FT                   TRFNRRGVNVRGRVANEVETEQIVDAGDAQLTWYEPRVSSATQLRGSVPLFWSQDTSAL
FT                   NARPTIVVRGHDVTHSATAAHFSLVRQRYCDPAVCLSLIRSQERRPRESALRGELAAAL
FT                   HYVNGALPADRERIACVHWDFERQMKGSVSADGDDFHGDGDGDGDESEGFGAAARPVRG
FT                   CARSRRRRRLVQGRGLRAGHRPGSGSDPWLFSTAPSRVTPLDDSKRLALTCQSGVLRSH
FT                   CVDCLDRTNVAQFAWGLAALGCQLERLGVIDGDAVGPDSSVAAALMSVYRSMGDVL"
FT   gene            <242098..>244380
FT                   /locus_tag="MICPUN_104310"
FT   mRNA            <242098..>244380
FT                   /locus_tag="MICPUN_104310"
FT                   /product="predicted protein"
FT   CDS_pept        242098..244380
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104310"
FT                   /product="predicted protein"
FT                   /note="Encodes a protein with hydroxyproline-rich
FT                   glycoprotein (HRGP) motifs"
FT                   /db_xref="GOA:C1EI09"
FT                   /db_xref="InterPro:IPR005011"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI09"
FT                   /protein_id="ACO67601.1"
FT                   /translation="MEDGEAPAASMDDFPEGMKVNTSNAGGEVSMSLEETNRVREKLGL
FT                   KPLRTGESDRTKARREAEETERAAREADAKDAETAALAAKIAAAKEKRTMEQRNRATKQ
FT                   LGEAADADDDDMMAWVNKSRKIEEKRRKEERKKAEELARKLAEQDDEAEESEGDEIYGG
FT                   KDLAGMRVRHGLEDVAEGETMILTLKDSSILDDKLQGINEEDDELENVNVAQERKRQKA
FT                   KKAATKRSDNPFGADDEDAGKKILSKYDEEDEDEGLTLDAAGAIDAAEEKRKADIKRRL
FT                   AASLGGVSVNAVAETADVRKREMSEFMSAAEVAEEAAAKFNKPKKKRRKKLREKKFDIS
FT                   EIENDHLAQAAQEKQEAAAEPERARGRFRNDAGEEERKLMGFQNALNKAKIKTDERILA
FT                   EMAGDVEDEDTELAMALERTKRLAERGVGARSDVDVARVAAARRATDAPDVGERGASGE
FT                   GMVFNDVQEFVHGINVEDKRATRSEAAAAGDMPPVPPPPPGSGDMPPVPPPPPGSDVDG
FT                   MPPVPPPPPSGVGAEEEHEDDEVNPLDGVQANPMGSGLAATLALLKETGKLHENDMWDG
FT                   RTNDKKPLALMRVREAAEITGAEFEGHKFDFKLDRYDEFGRKMTPKEAFRELCHRFHGI
FT                   EPGRAKKEKRLRAYQEEVKAKKMREGESVTGSVDKMKMAQKATAAPYVVLSGKIHAGQI
FT                   SDAVSKYATAGLEDDAGKETGKASPAPGGAKRGGGGGDGGGGNAMDPTTLPMLTGAEKV
FT                   KFMMSKK"
FT   gene            complement(<244476..>245896)
FT                   /locus_tag="MICPUN_64416"
FT   mRNA            complement(join(<244476..244589,244655..>245896))
FT                   /locus_tag="MICPUN_64416"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(244476..244589,244655..245896))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64416"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR031968"
FT                   /db_xref="InterPro:IPR040147"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI10"
FT                   /protein_id="ACO67776.1"
FT                   /translation="MTECLKRSSANANAAPPWLEEHFPTDSTDVLLGSFVGSYRASRLL
FT                   VSGRVYVVSGQRGARVWFHSDIFGIVTTRLIHLADVSVVRKVNKVGVVSAIELLRASDG
FT                   KSYVLCSFLYRDNAFKCIHDAWRLEHSANATATTHDGSVAHTASGDENDDDDATGIPGI
FT                   TGSSERTYSVASSQATEKVYGSQDTFSYASRRPPPDAREIVLTRRFPDCKDQCELYDRM
FT                   FDSELTLLTNHLTRNCKAKNVVRSPMRDGKCYLSYDTPTGVHLPSVPKVCHMKDAQMYD
FT                   RGAWMSSRAHSQGTPYADCYKVETLVLFDVSFSLTSEVQVSCHVEWLKPVSSIVKSLIE
FT                   RGTRDKVRKSYGRFFDLVEEDLRANEGASAPPMQDAGLIRSNSTMSVSSVEVPVPETNS
FT                   TADRVARTSYWWGHAQRRNRRFGGSRVVAVRGRRCGARDEKRDPFGHQAPGQ"
FT   gene            <246018..>246536
FT                   /locus_tag="MICPUN_64417"
FT   mRNA            <246018..>246536
FT                   /locus_tag="MICPUN_64417"
FT                   /product="predicted protein"
FT   CDS_pept        246018..246536
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64417"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI11"
FT                   /protein_id="ACO67602.1"
FT                   /translation="MAPKREMVDPAYHTLVLSESDDDLDSEEIEDAPVCDDPHAALRRV
FT                   SSAFDAKVAHLTSPGLAPSEATAVTLDAEVTSRLNAARAMLSKVKRALLDPFKQMIETK
FT                   RDEAAQLEEARAAEQRVLLERLTAQSKGVDEELSMLADAAGLRSVCDLYAAAEDEEIEA
FT                   RARRDKSRA"
FT   gene            complement(<246876..>247895)
FT                   /locus_tag="MICPUN_69278"
FT   mRNA            complement(<246876..>247895)
FT                   /locus_tag="MICPUN_69278"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<246876..>247895)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_69278"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI12"
FT                   /protein_id="ACO67777.1"
FT                   /translation="YPYWWALPLAPYGSKATAMNEVVPGQVWTFDQLQGLLDVLVNVRM
FT                   TVVALANGGLWVHNPVAPTQELMDMLAPIVAKHGPVKHIVVGSAAIEHKIYSGPFSKKF
FT                   PAADVWVPQKNWTFPVDVPIDAYVPYYPRGSPKYLPLDSSSGIGAVPWADEIEHYTLEV
FT                   GGSSLRNFKDPWFVDTAFYHKRSKTMLVTDVVLHVSQDPVPVAVIEPEPLLVRGMNGPD
FT                   QMLPNTREARSMGWGKTVLFGLLFNPTAVDVRINPLSVNKSFLDGFYWEPKWKDAFKNL
FT                   TDKDMFVPPILHTLAFPRRRDEVKRWAESVAAWDFERIIPGHLDGPIDATPKQFAAAID
FT                   "
FT   gene            <248556..>249672
FT                   /locus_tag="MICPUN_64419"
FT   mRNA            join(<248556..249617,249655..>249672)
FT                   /locus_tag="MICPUN_64419"
FT                   /product="predicted protein"
FT   CDS_pept        join(248556..249617,249655..249672)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64419"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI13"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI13"
FT                   /protein_id="ACO67603.1"
FT                   /translation="MWDRIVVFLAFLAHHIDAARLTPRANTIGPSQHALRADNSNWMAE
FT                   DASILRDMTLGEVVLPGTHDAGAYALTSKLMPGSRFPTPWEAAAIAIAEDLGIGVDRVI
FT                   TPWALTQSLDVLAQLEFGYRYIDLRAGWNGTAWCAHHAEVGVPIADILNDIATFMRTHP
FT                   GEVVVVQTSHLDGFPNATRVDELSAEVTKTLGEYVAGPEWARGKAFGDVTIGEMVDSGR
FT                   RLAVVFGDGDYESFGGASKTTWPPEVLHNAYADADDPTAVMKYVRDKIVEYNNSSGEAA
FT                   PPGTMSKISWILTAQTKTVVGMFEPGARPRSLRELTERSRPAFGALAEEVVQSGCRAGN
FT                   IMSVDFGGGAGDYATRAVR"
FT   gene            complement(249691..250346)
FT                   /locus_tag="MICPUN_109552"
FT   mRNA            complement(249691..250346)
FT                   /locus_tag="MICPUN_109552"
FT                   /product="predicted protein"
FT   CDS_pept        complement(249739..250269)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109552"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI14"
FT                   /protein_id="ACO67778.1"
FT                   /translation="MLQSRKAEARKLVGGVTIEDWMNGREQTRRLVMEHAQKSAAYAEA
FT                   AQHRTELLREAEVTFSQNRSVRHGSLAELPDDADPENFPNPPGVSEKTARRLHQEAMRA
FT                   VGGDDKWWKETARLNREQRVLDQQEEARRRKVLEREVQATPGVTYKNNRDRAGVGAART
FT                   SVQSLHFGETEVF"
FT   gene            251089..251866
FT                   /locus_tag="MICPUN_64421"
FT   mRNA            join(251089..251184,251312..251371,251548..251866)
FT                   /locus_tag="MICPUN_64421"
FT                   /product="predicted protein"
FT   CDS_pept        join(251113..251184,251312..251371,251548..251775)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64421"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1EI15"
FT                   /db_xref="InterPro:IPR000307"
FT                   /db_xref="InterPro:IPR023803"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI15"
FT                   /protein_id="ACO67604.1"
FT                   /translation="MSATASASSLSFGRNVVDQRLKVAAPSARVVAPRPALQVENMVKI
FT                   RFTRLGRKRTPFYRIIAIDSRKRRDGAPLEYLGWYDPVKKQSNLDAPAIKAWLGKGAQP
FT                   SDTVRNLLKKSLIMD"
FT   gene            <251928..>253389
FT                   /locus_tag="MICPUN_64422"
FT   mRNA            join(<251928..252041,252154..>253389)
FT                   /locus_tag="MICPUN_64422"
FT                   /product="predicted protein"
FT   CDS_pept        join(251928..252041,252154..253389)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64422"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI16"
FT                   /db_xref="InterPro:IPR025792"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR030382"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI16"
FT                   /protein_id="ACO67605.1"
FT                   /translation="MTTPDEPFTRLTPAPDDVVIDREKFTKTVPLIALRVPKAKCQFYM
FT                   KALRGLVLDIPRQQSVVRDPSDDSMRLLLLKEEVKDGSLPTMSEERRAEIGVDALERTT
FT                   HDLVLSYDYFNAEQVLRRLLPEGCDVPGSFETVGHIAHLNLRDEVLEHKHVIGRVLLDK
FT                   NPRLKTVVNKVGSIESEFRVPTWELLAGDTSLETEVRQHGIPFKLDFGEVYWNSRLEAE
FT                   HKRLIEQIRPGEILCDAMCGIGPFAVPAAKAGRRVYANDLNPSCARYARVNCVGNKVKN
FT                   LVKCYNMCARELIRKLLRPGKVEDTGETTVGTDGKRRAVQWAATGEDADGEPPSGAVFD
FT                   HVTMNLPATAIEFLNVFKGAFDRETWAGRRLPVIHVYTFKRATETVEDVVRRGEGHLGA
FT                   AIANPTVHEVRDVAPNKIMLCLSFRITPDAAFPPEDGTKGNEAKRAKTGD"
FT   gene            complement(<253529..>255394)
FT                   /locus_tag="MICPUN_66240"
FT   mRNA            complement(<253529..>255394)
FT                   /locus_tag="MICPUN_66240"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<253529..>255394)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66240"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515 - protein binding"
FT                   /db_xref="InterPro:IPR000210"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR000357"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI17"
FT                   /protein_id="ACO67779.1"
FT                   /translation="IEKEACYAIGLLASKENHQNRIADAGALPGLVALLKRYPPQMSGN
FT                   VAPSVARRAADAVTNLAHENNPIKNRVRTEGGIPPLVALLETRDAKVQRAAASALRTLA
FT                   FKNNENKEQIVEEGALPMLIFMVRSGDPHIHYEAVGVIGNLVHSSNHIKRRVLDEGALQ
FT                   PVIGLLSSECNESRREAALLLGQFATTTDDTNIEYKIKIVQRGAVQPLIQMLNHTESQL
FT                   REMAAFALGRLAQNKDNQVGICHADGLRPLLDLLDSDETNLQHNAAFALYGLADNEDNV
FT                   PDIIREGTVQRLMGGELKAQPSKDCVNKTLKRLEEKVDGRVLKYLVYLMRSSNKDEQQR
FT                   IAVALAHLCSDDQQRVIFDEQGGLDILLEMYSASAGALFPLAMRDAAGALFKVSQNMKA
FT                   LLSARYPNDAVPLPATPETHLAYEHFNNPELSDIVFFSDRDGGWEFHAHKIAFTHVSDE
FT                   FHQLIDQHKVADTQQGDSHMPVRVDMSDVMQKDEFHGLMQFVYQGDIEVPEELTEENDE
FT                   NGVAPLAQRLLQFAHRYEMNGLKRHCEGCMEEILTHMEDPKCEFLREFISLAGRCNADD
FT                   FIRACALYTLQHHGRICKSIGDSETVLLAQQIEPHIRQHLQSTMYR"
FT   gene            <257768..258966
FT                   /locus_tag="MICPUN_64424"
FT   mRNA            join(<257768..258003,258104..258966)
FT                   /locus_tag="MICPUN_64424"
FT                   /product="predicted protein"
FT   CDS_pept        join(257768..258003,258104..258908)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64424"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:8652 - amino acid biosynthetic
FT                   process"
FT                   /db_xref="GOA:C1EI18"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI18"
FT                   /protein_id="ACO67606.1"
FT                   /translation="MATSLLAPRATVAARHSVGRQHVGRKCAPARAVSRVALRPWAAPV
FT                   LRREAVLARALSRDDDEDSFDEDDDTDIRCELDRVPGDGNKYTRVMLKVSGEALSGSSG
FT                   FGIDPEVVQTIAREVAEASLAGVQVAVVVGGGNFFRGAQHEGKGLDRASADYMGMLATV
FT                   MNAINLQAAVESNGVPTRVMTAFSIQEVAEPYIRRRAIRHLEKGRVVIFGAGTGNPFFT
FT                   TDTGAALRAAEIGAQCVFKATMVDGVYDSDPRRNPDAQLYENLTYETVQRLGLGVMDQT
FT                   AITLCQENDIPVVVFNLNTRGNIVHALRGGTVGTRVSSKMDAPQKNGAKNGAKRGAEQK
FT                   GDAAKK"
FT   gene            complement(259037..259900)
FT                   /locus_tag="MICPUN_95986"
FT   mRNA            complement(join(259037..259493,259842..259900))
FT                   /locus_tag="MICPUN_95986"
FT                   /product="predicted protein"
FT   CDS_pept        complement(259169..259489)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_95986"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6414 - translational
FT                   elongation"
FT                   /db_xref="GOA:C1EI19"
FT                   /db_xref="InterPro:IPR027534"
FT                   /db_xref="InterPro:IPR038716"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI19"
FT                   /protein_id="ACO67780.1"
FT                   /translation="MSGDLACTYAALILSDDGQEVTGDKMDTIIKAAGVTIEPYWTMLF
FT                   SKFLSGKPVEELIANVGAGGGGGAGGGGAAAGGDGGAAAAAEPEPEPEEEEEEAMDFDL
FT                   FD"
FT   gene            <260170..>260725
FT                   /locus_tag="MICPUN_88611"
FT   mRNA            join(<260170..260277,260400..260472,260598..>260725)
FT                   /locus_tag="MICPUN_88611"
FT                   /product="predicted protein"
FT   CDS_pept        join(260170..260277,260400..260472,260598..260725)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88611"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5524 - ATP binding; GO_process:
FT                   GO:6457 - protein folding"
FT                   /db_xref="GOA:C1EI20"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI20"
FT                   /protein_id="ACO67607.1"
FT                   /translation="MAKRLIPLLDRVLVEKIVAPTKSVGGIILPESAVSKINEAKVLAV
FT                   GPGRRAAQNGDLIPMGVKVGDSVLLPDYGGQKVDLGDKDKELFLYSDQEILGVVESN"
FT   gene            complement(260817..262526)
FT                   /gene="SSIIIA"
FT                   /locus_tag="MICPUN_105006"
FT   mRNA            complement(260817..262526)
FT                   /gene="SSIIIA"
FT                   /locus_tag="MICPUN_105006"
FT                   /product="glycosyltransferase family 5 protein"
FT   CDS_pept        complement(261001..262506)
FT                   /codon_start=1
FT                   /gene="SSIIIA"
FT                   /locus_tag="MICPUN_105006"
FT                   /product="glycosyltransferase family 5 protein"
FT                   /note="candidate glycogen synthase; GO_process: GO:9058 -
FT                   biosynthetic process"
FT                   /db_xref="GOA:C1EI21"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR011835"
FT                   /db_xref="InterPro:IPR013534"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI21"
FT                   /protein_id="ACO67781.1"
FT                   /translation="MDFVFASKPDGKGTFDNNNRLDYHVDIKGGVDKATGEKLKEPPLH
FT                   IVSISVEMAPIAKVGGLGDVVTSLGRACQEEGHKVEVILPKYDTLDYSAIQDFKEITGF
FT                   SWGATYNRVFHGKVEDIDTYFIDPENGMFRVGMIYGTDYLEIPMTDAERFGFFSKAALE
FT                   FMLQSKRQPDIIHCHDWQTAPCAKAYWEDYAPYGLNNPRVVFTIHNLNYGAELIQEAMT
FT                   YSQAATTVSRTYRDEVSGHESIHENIGKFHGVVNGIDPDIWDPANDDFLPRYYDETEVI
FT                   EGKAACREALCAYSNIPNKPGVPMVGIVTRLTPQKGVHLIKRGVMRALERGCQVILLGT
FT                   APDPTIQQDFDMMFHQLKQNHHDFMAFHLYYNEPLSHLIYAGSDLLLVPSMFEPCGLSQ
FT                   LIAMRYGTVPVVRRTGGLNDTVFDYDVDHKKAEWEGMKPNGFSFDGMDDGAIDFALDRA
FT                   INLAYDKPKDFRALQANCMSQDWSWNRPALEYIEIYHAARKPY"
FT   gene            <267425..>267895
FT                   /locus_tag="MICPUN_73025"
FT   mRNA            join(<267425..267475,267548..>267895)
FT                   /locus_tag="MICPUN_73025"
FT                   /product="predicted protein"
FT   CDS_pept        join(<267425..267475,267548..>267895)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73025"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16829; metal ion binding - lyase
FT                   activity [PMID 46872]; GO_process: GO:9236 - cobalamin
FT                   biosynthetic process"
FT                   /db_xref="GOA:C1EI22"
FT                   /db_xref="InterPro:IPR002762"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI22"
FT                   /protein_id="ACO67608.1"
FT                   /translation="VVIVDHGSRRKASNDLLEEFVRMYREETGRPIVELAHMELCEPGI
FT                   DVAFSRCVEQGATLVAVSPFFLSPGRHWQEDIPALTAEAASKHPGVGYFVAAPLGLHPL
FT                   MATIVESRLETCMAHLTTGGGKCDVCDGT"
FT   gene            complement(267969..268735)
FT                   /locus_tag="MICPUN_109558"
FT   mRNA            complement(join(267969..268105,268529..268735))
FT                   /locus_tag="MICPUN_109558"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(268040..268105,268529..268711))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109558"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1EI23"
FT                   /db_xref="InterPro:IPR001931"
FT                   /db_xref="InterPro:IPR038579"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI23"
FT                   /protein_id="ACO67782.1"
FT                   /translation="MINAEGENVDLYIPRKCSWTNRLIEAKDHASVQINIGHLDQSGVY
FT                   NGKYTTVALSGFVRCMGDGDSATDLLWQKKKAGVGQA"
FT   gene            complement(268883..269681)
FT                   /locus_tag="MICPUN_109559"
FT   mRNA            complement(268883..269681)
FT                   /locus_tag="MICPUN_109559"
FT                   /product="predicted protein"
FT   CDS_pept        complement(268977..269654)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109559"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR007454"
FT                   /db_xref="InterPro:IPR027471"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI24"
FT                   /protein_id="ACO67783.1"
FT                   /translation="MAAISAMPHRAFDLSYPGPASALAGARDRGSTLVRQDRARLSKPT
FT                   PSQRVSAGGRGSVAVRSSIDDIPDEIPEELIPDALKGLVLNEDGDLVDTKTGKVLNEFG
FT                   ATRFDVAVRAMRGEYDPIGASTEHEEGQIMDTLTQFPTDYTFQVSGRKEDLGQDSALDD
FT                   LCGVIGHVCGCEISRETQVEIKERGSSGKFLSVWVTCRVYSAFMVNETLRQVKEDERVM
FT                   MAC"
FT   gene            <270400..>274078
FT                   /locus_tag="MICPUN_104321"
FT   mRNA            join(<270400..273247,274047..>274078)
FT                   /locus_tag="MICPUN_104321"
FT                   /product="predicted protein"
FT   CDS_pept        join(270400..273247,274047..274078)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104321"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000742"
FT                   /db_xref="InterPro:IPR002909"
FT                   /db_xref="InterPro:IPR013032"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI25"
FT                   /protein_id="ACO67609.1"
FT                   /translation="MINIPQEDGTCACKDGWTGEGCERATPGISKERRRDGTYGYSFTT
FT                   EAERGVGAAIFDPQKKVLYVSVYDAAAGADAVFEVDPLNPATFTASSLTSRGWGVAGPH
FT                   RADGATKQPVALAPDAGYCGTATGIQTAAGCSDGTHPRAHGHYNATLSGGWYSVFRGLA
FT                   LDLSGPLTGVFGSLNMHGAAQPTPYKFKIVKYVGKDCTGSSWDDCVIGSASSRNPSYVY
FT                   GGNGTLDAMASNEVTGQVVYKFSPHDGVSPGKVGMLAADLSTSTEFHIDPTLMDTRVSG
FT                   TCPACATHHEALRFETAMYAQTALDGKNWVIFAGAARMESDGTSYPALFKISADSSAFT
FT                   TGQGTGQEMYLDGSSEALKLPSACEGVTDAKQGRHTSFTSLTKHGSYGYAGTSGRDANC
FT                   DGCEHRSACVVMFSLDYNSLDSPTKVIVFEGGDGGLDEKDVWAAAVEPITEMGADGGFI
FT                   YFAVGDRSNSGFGRIVKVMIGGTDTASTCTSGCFKRVGTFEESAPFGGIVHVADLNGIV
FT                   SLSRSFTNTTYTKFSTASVTSISPQFVSSTTSGTIVTIRGTGFYSPWNDESTYNVSCRF
FT                   GHTSTLDSDFQEEAWSGAIYVSSTEIRCTVPSALDSMTSTKTNNRQTYTELEVSFDGFP
FT                   VDGVPTSGSLNPYWGKSMWTRHNAVVFYYDEPIIASFDVGHGDYGNKVLFTGENETNAP
FT                   VTLRLFGGPFIDSDGSDGGPARLKCRYNGDATTDVAATFVAVNQLHCPLCEVSNASGVD
FT                   RCGAHGTSGAAQYIPLPWLAGGQPKSDVDVSITMNGVEYHSSGSTVLHLYGSPHGLSVI
FT                   HPKCTMDGFSGVVTDSTLGVLNGGRDCRHNLLSYPGNAEADGTMKLDPVEVSLADINGT
FT                   VIKNDMGVGGIRGFKITAAVNATGSEGSSRNILTLAPGGVERTTVNGTTTFELSLSFVP
FT                   IQGVYEIFFTGEDCTDGSTWLEPMLMMLI"
FT   gene            <277998..>279688
FT                   /locus_tag="MICPUN_50755"
FT   mRNA            <277998..>279688
FT                   /locus_tag="MICPUN_50755"
FT                   /product="predicted protein"
FT   CDS_pept        277998..>279688
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50755"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI26"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI26"
FT                   /protein_id="ACO67610.1"
FT                   /translation="MTRPCQEVKPNSYSDWKGNCHCLPGYTEDTALPDQNGTGYFLDLN
FT                   NTQVAPMSLYEPVVFFEGDWVGALNPYGVCVPCRNGYYKEYPGSHPCTKCPENFDTARI
FT                   DGNWAPPHNSTSGKILAGPLGKTRLEDCHCIANTPIEGVVWVDEPELESYYRNYSREGY
FT                   RCDVCPHGGNCTGLDIPYIAAQPGFYRTSTVTTKFNKCPNPEACVGGFDSLCLVGNNSG
FT                   YTGTLCANCLPGYAHPTINGRFPPRCLGCGNVGINTAIFLVQLAGIVSIISIVVWTNVR
FT                   RGSDAICLIKTFITYMQTVSLAKDLDLRWPEATSGFMVFMEKLSTIDMRSFSVQCLFPG
FT                   NYYSETGLYLATPLIMGTALLLYYSVFQFFEEQRSSISSRRGRTSKIAEIEEESESDDD
FT                   GDRSPVVKAADLRTKVRVEAMDNAMFEESWEAKAFDKVFMLAIIMLWFMYPTLAKYMIG
FT                   LLQCKRLDTGSDNVFLVADMSIKCYDSTHSSWLFLFFVVLIIYVLGIPLLSMFLLQLEG
FT                   ENHDRLGMRFRVGFLYKGHDIERAWWWDLVIFARKFTMISVVVLGA"
FT   gene            279723..280502
FT                   /locus_tag="MICPUN_109560"
FT   mRNA            279723..280502
FT                   /locus_tag="MICPUN_109560"
FT                   /product="predicted protein"
FT   CDS_pept        279831..280439
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109560"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI27"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI27"
FT                   /protein_id="ACO67611.1"
FT                   /translation="MGYLFYERDEWWIHLIASFVFFAFNLFMWYLLFVCLKQELALEGE
FT                   TMRIARANHDYELEDKIADEFEKRRDKEKDQQKAMEEKAKLDQMVGRPLPFADDNLWEK
FT                   MRTATVPEMRQDHKELSDKLEDMRSKWKQRWNANVERKYRVDEVHRVKEVSAAEKWRER
FT                   KAAEQSATLKAREGTLRQTWQERMAQRKAERDKSNGGRR"
FT   gene            complement(280501..281670)
FT                   /gene="PSBQ"
FT                   /locus_tag="MICPUN_106554"
FT   mRNA            complement(join(280501..280977,281138..281260,
FT                   281519..281670))
FT                   /gene="PSBQ"
FT                   /locus_tag="MICPUN_106554"
FT                   /product="oxygen-evolving enhancer protein 3, chloroplast
FT                   precursor"
FT   CDS_pept        complement(join(280600..280977,281138..281260,
FT                   281519..281635))
FT                   /codon_start=1
FT                   /gene="PSBQ"
FT                   /locus_tag="MICPUN_106554"
FT                   /product="oxygen-evolving enhancer protein 3, chloroplast
FT                   precursor"
FT                   /note="Oxygen evolving enhancer protein 3 (PsbQ). TargeT
FT                   and ChloroP predict 34aa CTP; OEE3; GO_component: GO:9654;
FT                   extrinsic to membrane - oxygen evolving complex [PMID
FT                   19898]; GO_function: GO:5509 - calcium ion binding;
FT                   GO_process: GO:15979 - photosynthesis"
FT                   /db_xref="GOA:C1EI28"
FT                   /db_xref="InterPro:IPR008797"
FT                   /db_xref="InterPro:IPR023222"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI28"
FT                   /protein_id="ACO67784.1"
FT                   /translation="MAAISSAASVFTGKALVQAKTAPKAKASVAVTASADARKAASLLA
FT                   AGVIALQATPAMALNMIELQDERQTNKNGLQLIYEARDLNITQSVRQDGNSRFSFQKLT
FT                   TAQTATRASESIKRLNTDVGEYVGKAYWTQAANELRRQVGTLRFDMNNLVADKGGDKAA
FT                   AKAFYASIEKLDFSIRQKDQAAATAALASVQEQGNALIKQLA"
FT   gene            <282056..>283168
FT                   /locus_tag="MICPUN_64432"
FT   mRNA            <282056..>283168
FT                   /locus_tag="MICPUN_64432"
FT                   /product="predicted protein"
FT   CDS_pept        282056..283168
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64432"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI29"
FT                   /protein_id="ACO67612.1"
FT                   /translation="MSAAMRRTSGNELCVRTFLLVPVAAVCLLLARAALLMWFYSSPLV
FT                   VALSPAAETGAGAGWAGSSGLLDRVLALGPIEHARPRHPRRPKDEAAMFAVHVRRGDPK
FT                   NDGSQAGEVERLAAQRLARDDGAEMEVGDGLNIVRAHFVYENDLTDPLEPDEVERWLGG
FT                   APGSDSSRLVEASRRRERDAVGEAFDEFSGIYGAAVKTKAIRWLHESPSTYDRAWVIEP
FT                   DVVYTGRWAELFAFYDEKYPRSDLVSVNSTHSTGGSSWAHAAECTLCSEGDGRWQTAFL
FT                   PVFRISRRLASAVLETLRSNRTGHHEALLPTVCERLSWCEWTSISHGDIYRYRPFIALD
FT                   EAEQSAKPGRLYHPVKSADVLRALARVEEV"
FT   gene            complement(<283216..>284283)
FT                   /locus_tag="MICPUN_104324"
FT   mRNA            complement(<283216..>284283)
FT                   /locus_tag="MICPUN_104324"
FT                   /product="predicted protein"
FT   CDS_pept        complement(283216..284283)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104324"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI30"
FT                   /protein_id="ACO67785.1"
FT                   /translation="MEAAHHRLSDACLLVSRAAGTLEAACAEYETAQATVRRWSQTGTG
FT                   DPTSLDDVLDRAKGIRQMRLDDGDAPSTSSKRRTLPVDFVELKQRYMSVVPTNERVLLD
FT                   IRERVSEASRGFMDKLAARRRRRGGASGGSSDEREDCLNARSVLGALRWIQGTMKATDW
FT                   TRLRAEEMSTGELCDAAYALGNVVRLWKECGPVLDALMNSDDVKVLRRRDDFLTVLAQS
FT                   KHLRYANRNVYAEVDERALRQMDGATGEPSFLTWLPRECWLDGSAPPQPPEPNLSCDRT
FT                   QYVEIALVWQQIQMNFFMAHLENALYKEVVPELFDDIDDEDDDTVAYKLRLARSIVLAG
FT                   KSRRCATIGVYQDVE"
FT   gene            284548..285638
FT                   /locus_tag="MICPUN_95995"
FT   mRNA            join(284548..284714,284939..285070,285183..285315,
FT                   285450..285638)
FT                   /locus_tag="MICPUN_95995"
FT                   /product="predicted protein"
FT   CDS_pept        join(284598..284714,284939..285070,285183..285315,
FT                   285450..285574)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_95995"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1EI31"
FT                   /db_xref="InterPro:IPR001147"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018259"
FT                   /db_xref="InterPro:IPR036948"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI31"
FT                   /protein_id="ACO67613.1"
FT                   /translation="MGNQRARSRGLRHGTRNMFSRPFRKKGPNNATTYLRTFRIGDYVD
FT                   IKVNPSQQKGMPYLAYQGRTGIVWNVTPRAVGVEVNKQIGGRVARKRIHVRIEHVQHSN
FT                   CRADFLARRKANDEAHEAAHKSGQPAPQTKRTVPGPREGFTLENVKTEILTAVPYDIVR
FT                   EGIKY"
FT   gene            <285802..290064
FT                   /gene="FAP46"
FT                   /locus_tag="MICPUN_105008"
FT   mRNA            join(<285802..286659,287166..290064)
FT                   /gene="FAP46"
FT                   /locus_tag="MICPUN_105008"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(285802..286659,287166..289988)
FT                   /codon_start=1
FT                   /gene="FAP46"
FT                   /locus_tag="MICPUN_105008"
FT                   /product="hypothetical protein"
FT                   /note="Found in the flagellar proteome; conserved
FT                   uncharacterized flagellar associated protein FAP46,
FT                   tentative"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI32"
FT                   /protein_id="ACO67614.1"
FT                   /translation="MDARKNAAIRKLKRSNNAWGKLVAKYEAEMFASLPAEHAARAKPS
FT                   ERLIKYHATRDGQVVAGLVADILGVLGCESTLRVLNTESGVNEPMSRDALERTLRLEGS
FT                   EGPLLAGLLTRSDEADEGRESSRTRDRTPEVTKREPPEPIVLAVGVLEEKDTNRPERAT
FT                   GETAVKRTESTSPSTGAGPSTNLGGVERALEGSFELENSDDDEVVDAIEESVDDLEVSV
FT                   VSIEVDGRVSGSVKSGGGSSMRGNFSVDYEDVGMGSTPPTSAAGGDAAFDVERGGVSLD
FT                   DEDFEAGSRRVRRAAKSRTSVRASAARKDEDVQVNEVAAGVAGVAAAAVVFGAPDAAMA
FT                   DAYTDYLEAMKAQNIEPASVTLPAEAPAAKAIPAGAKKAAPAPKAPKAPKVAAPKVDKE
FT                   AAAAAKAEAAAKAAAEKAEAKAKADAEKAQKAAAAEAAKAEADAAKAEKAAAAEAAKAE
FT                   KAAAAEAAKAEKAAAAEAAKAEKAAAAEAAKAEKAAAKADKADNTASKQSLEEKAAARA
FT                   EKAAAAEAAKAEADAAKAEKAAAAEAEKAEKAAAAEAAKAEKAAAAEAAAAEKEAAKAA
FT                   LAEARAEKAAAAKAAAAKSKASKPASSSSSGDAGSFAPVAGIAVVGAAAALVGGGKKKE
FT                   PEPEPEPEPVNTPFSFFGRKPEPEPEPEPPKKKGFSFGAKKTPPPPPPAPEPVKKALFS
FT                   FGAKKPEPEPEPEPVKKKPAFSFGGTQKMKKAPEPEPEPEPVKKKPMFSFGGTQKMKKA
FT                   PEPEPEPEPEPVKKKPMFSFGGTRKMKKAPEPEPEFEPEPEPVKKTPPKPLFARKAPVK
FT                   KAPEPEPEPEPEPEPEPVKKAPEMPKMPAAPKVAFKNPFSFNFGKKKAAAPAKAVAAVD
FT                   AAPGAAEAATVTDEVIVEAVPIPVVPEDDIVARVLAEKEAAAAAAAAKAAKDRAAALDK
FT                   AKKEQEAAAKKAQEAAAKAAAKKEKELADKIAAYEKEQADKKAAAEKKAADIKAAAEAK
FT                   KAEAEAKRQEQIKAREEAKAAAAAKKKQGGGLFAFGGKKEEAKPAPAAKAAAPAAKPAP
FT                   AAPAGASDAAANAADAQKWIDAWKSGSSGSSKPAASGGKSDAAANAADAQAWIDAWKSG
FT                   SSAAPPAAKPAPAAKPAPAAKPAPAAQPAKKKIEYKGPFGNLFGGKKEEAKPAAKEAAV
FT                   AAKPAAPKAGASDAAANAADAQKWIDEWKGSSGAGGSSADTPEGRAKEAQAWIDAWKSK
FT                   Q"
FT   gene            complement(<290197..>291156)
FT                   /locus_tag="MICPUN_64435"
FT   mRNA            complement(<290197..>291156)
FT                   /locus_tag="MICPUN_64435"
FT                   /product="predicted protein"
FT   CDS_pept        complement(290197..291156)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64435"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI33"
FT                   /protein_id="ACO67786.1"
FT                   /translation="MSFTAASTMGKALVGVPVTQTKSFRQMRAVPAGRRSSKVVAMAGA
FT                   ETAVAVATRWALAVPTMYAVVSFNEYVTHRWFQHAEFNKTDWMKALWCKLTGAEVAPKC
FT                   DGGGHIEHHAETLDDMSLKTDPKWLKSEPAKMLVNSKYRGTAFEYDITGLMVLQMLPTS
FT                   IPILALMGFSAPSGMAIILGAVAIHAAVWNSLHPAMHGMEDIPLSEGLNVPLPLAKMLR
FT                   KTGYYNWLYKNHMGHHVMSGRMNYNVCCPGMDHILGTYCPEEEWYAKARMPAGAETRDP
FT                   YPAGEYNRRLQERAEKGMVAAELVDGVELELEPELVSA"
FT   gene            complement(<291542..>292417)
FT                   /locus_tag="MICPUN_64436"
FT   mRNA            complement(join(<291542..292072,292355..>292417))
FT                   /locus_tag="MICPUN_64436"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(291542..292072,292355..292417))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64436"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI34"
FT                   /db_xref="InterPro:IPR008253"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1EI34"
FT                   /protein_id="ACO67787.1"
FT                   /translation="MDDFDPTVTNSPKFRLIAVQCLFSITAFAAMLSQRHGLAGPDEMT
FT                   LEECGPQACGYQKFSNFKFLIAVCIIYAVFSLVVMAAYLLQRVPPPVTELTAYTVMNVL
FT                   LFAAFAMSATSCNITIVDPVYPVCKRATSAKASIAFAFFTWLAVCFSMLFTYKEWRDVD
FT                   YHVPGSGAYEFVPGVTSGSSRSSYPPQASSSSYA"
FT   gene            292650..294497
FT                   /locus_tag="MICPUN_109563"
FT   mRNA            join(292650..293161,293299..293373,293551..294497)
FT                   /locus_tag="MICPUN_109563"
FT                   /product="predicted protein"
FT   CDS_pept        join(292823..293161,293299..293373,293551..294237)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109563"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI35"
FT                   /protein_id="ACO67615.1"
FT                   /translation="MGVSAGSTLLDKNVERLLSEPWGAAQAGVQYNKEVLGSLCEQFSR
FT                   LEPQARRGALQGTLFMRKGQRDSLKEEIRTLVDLATNDKDQWVSLIARALGGLRERFDL
FT                   QQLQQDVPAVADAVASIRDKIQVDGTPDNYRPMEEMYLSPRLLAAAGAPPCEASAPTHG
FT                   HFTPRARREPKKRFAGTATASVAPKTTVQASRPASTSMFAPPSRKPATSFFRDSGPSSK
FT                   KTGAASAKSFLSKSRDTGTKTMMIDVNEAAALGQVMGEDLNRAQRELEKREEQEAREQA
FT                   REREREEREQKKKLEQEQKKLRIQKMMEEREQKKKLELERKRAREEELAKRKNDAKRPR
FT                   TEAPSREEVSTPSPHESDPMPIHGVI"
FT   gene            complement(<294515..>295243)
FT                   /locus_tag="MICPUN_64438"
FT   mRNA            complement(<294515..>295243)
FT                   /locus_tag="MICPUN_64438"
FT                   /product="predicted protein"
FT   CDS_pept        complement(294515..295243)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64438"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI36"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI36"
FT                   /protein_id="ACO67788.1"
FT                   /translation="MSVARICKQNFRLLCVNLPDSHSCLFQFWLVVHYDLGCYVFGESW
FT                   RDYSYYAYSKPYTRVPAHLVGMAFGFVNERWVSDPGVRPMRPNLNRAAVKTWGAAAVTA
FT                   LFACVLAPLSDYMDPESWSPWVNATFITLCRPMWAAGLGIIATLCAAGQLEGLNAFLAH
FT                   PGWTPFARLTFGAYLMHPVVIKWFAGTATSSYHFGWRYMMAHALFNSAFSFLFAAIAWL
FT                   LVERPVMSAMKRGTRARRPE"
FT   gene            complement(<295333..>297066)
FT                   /locus_tag="MICPUN_64439"
FT   mRNA            complement(<295333..>297066)
FT                   /locus_tag="MICPUN_64439"
FT                   /product="predicted protein"
FT   CDS_pept        complement(295333..297066)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64439"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI37"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI37"
FT                   /protein_id="ACO67789.1"
FT                   /translation="MWRLAVIILLLVGSARGGDGSEGGFADPSSGSVDCAAVYPGIDEA
FT                   CCRALSSNASSHLPMVRRPLARMAYASGSSLPYDAGHYTTCVNTEGAGYFTLAWHVDGR
FT                   DIPVAELGLCLPAACRKADVEKLTGAVSNGGISAGAIANGTQEAVAKAEAMLRPFGTSF
FT                   CARAGADSAAAAHCREYRAVIAVMDAAAAMANELASDDGGGGGVSLGPFTLGEDATVRL
FT                   RVASSAEDRVGFFTNAKSGWAAFFAVVLVALVAVAVVGTALDAFEAAGGEARDGTVSEP
FT                   LLGDEEDHGEESEEDHGEESEELVDAGDGGDRDGQSSRVPNQIADGLKMFSIRRNWPKL
FT                   VAAPAEPSPTDCLNGMRVLSMVWIVLGHTMMMPAPLNGFDNPEDLVASFGARSEVWFMT
FT                   VIGGQIAVDSFFFLGGFLIAYLGVRDLEKRGGKIPYGAMVLHRYIRITPAFAFTMVFYS
FT                   QIVSRIGDGPFFVRYQQSVFRRCDNASWVTSLLYLHNFVPFDSDQVCMGWSWYLGCDMI
FT                   FFVMSPGLLLLHHHRPKVMWTVMIAVALASSVLTVRSFISLSLPADLSYAMITELLDLI
FT                   L"
FT   gene            complement(297181..298094)
FT                   /locus_tag="MICPUN_64440"
FT   mRNA            complement(join(297181..297876,298050..298094))
FT                   /locus_tag="MICPUN_64440"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(297281..297876,298050..298071))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64440"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4784; nickel ion binding -
FT                   superoxide dismutase activity [Evidence 16209] [PMID
FT                   16151]; GO_process: GO:6464 - protein modification process"
FT                   /db_xref="GOA:C1EI38"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR014123"
FT                   /db_xref="InterPro:IPR019954"
FT                   /db_xref="InterPro:IPR019956"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="InterPro:IPR036502"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI38"
FT                   /protein_id="ACO67790.1"
FT                   /translation="MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
FT                   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGHCQVPCGIFDDPAMVAEVKEACATIRKA
FT                   MVQINELHAAGSSAQNFNQMTRWVMTKEEHCGKIIKIMSEYALCQRVKPEVFSKPEDYV
FT                   DALKAHHAVMQSAMKAKQNVDVAVADALEHAVGDMSKMYLKE"
FT   gene            <300636..>301691
FT                   /locus_tag="MICPUN_88613"
FT   mRNA            <300636..>301691
FT                   /locus_tag="MICPUN_88613"
FT                   /product="predicted protein"
FT   CDS_pept        300636..301691
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88613"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16773 - phosphotransferase activity,
FT                   alcohol group as acceptor"
FT                   /db_xref="GOA:C1EI39"
FT                   /db_xref="InterPro:IPR000403"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015433"
FT                   /db_xref="InterPro:IPR018936"
FT                   /db_xref="InterPro:IPR036940"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI39"
FT                   /protein_id="ACO67616.1"
FT                   /translation="MAEAIHHEIHAPLEALDATAAPPALTPTRPRSADASRPAPLEPGS
FT                   PTTPQIPSPWKRSAGGLGEKWCDKVERVRSSSPYGTLPGWSLKPVIIKAGDNCRQELLA
FT                   IQLTQQFRQIYRESGLPLWIRPFEVIAQSTTSAFIEAVTDAPSIHAIKSRAPRGTSLRQ
FT                   HFEARFGAPGQPRFRQAQRNFVESLAGYSILTYILQVKDRHNGNILLHDDGHLIHIDFN
FT                   FMLSTSPGGINFESSPFKLTREYLEVMDSDDTGAASEAFNYYKVLCIQGYLSVRKHAER
FT                   IVQLVEMMSASGCPCFKAGPKVLQNLRRRFNMECTEEQCVEIMLGLISDSMDAWCTRQY
FT                   DFYQRVLNGIL"
FT   gene            <302040..>302399
FT                   /locus_tag="MICPUN_64442"
FT   mRNA            <302040..>302399
FT                   /locus_tag="MICPUN_64442"
FT                   /product="predicted protein"
FT   CDS_pept        302040..302399
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64442"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR038934"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI40"
FT                   /protein_id="ACO67617.1"
FT                   /translation="MVQPVMIAGPVGLGVLVLQRTFRRKKGAREEDGRRREGEGDETSF
FT                   ACERVCASDRLIKRLGYLSKDPTPNSCVTVCGSSGIDACTEACQRCVCSLPHTVPAWQD
FT                   QCNKRCTQECLRGRT"
FT   gene            complement(<302440..>303479)
FT                   /locus_tag="MICPUN_88722"
FT   mRNA            complement(join(<302440..303060,303240..>303479))
FT                   /locus_tag="MICPUN_88722"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(302440..303060,303240..303479))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88722"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8168 - methyltransferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EI41"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR004551"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI41"
FT                   /protein_id="ACO67791.1"
FT                   /translation="MLYVVGLGLGDEKDITVNGLEAVKGCERVYLEAYTSILGVPKERL
FT                   EALYGREVVVADREFVEQGIDGMLNEALKMDVAFLVVGDAFAATTHSDLVLRAKGLGCK
FT                   VKHIYNASIMNAVAGCGLQLYRFGQAVSICFFTRTWRPDSFYDRIKENADLGLHTLLLL
FT                   DIRVKEPSVEALCRGKKEYEPPRFMSCATCARQMLEVEDARGEKVYGPDSMCVAVARMG
FT                   QDDELIKSCTLKEMCNIDMGGPLHSMVLVGETHPLENDMLAMHRAKDSDFLPEDQVPSQ
FT                   YLDDM"
FT   gene            <303629..>304570
FT                   /locus_tag="MICPUN_64444"
FT   mRNA            <303629..>304570
FT                   /locus_tag="MICPUN_64444"
FT                   /product="predicted protein"
FT   CDS_pept        303629..304570
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64444"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI42"
FT                   /protein_id="ACO67618.1"
FT                   /translation="MTTPTTTEADANRREHFPRSWSRPGTLLPRKGGGREEAVEGATLW
FT                   LEFYDAPEGPLGCAPSVSVACASRRLELVRMEPTPGGGEANVARSPRDRQVIIVRGPSA
FT                   LRARLLADREPGEEVLFRFRLDSSVDADECFHLLRHWLGAPFDSTRKTTSVILDPMPVS
FT                   ARLLNLSLGDDKDEEDKSDVSFEEVKPEEAKETPPALEGDDDSKAHHYDPIGWMFESTA
FT                   VRRYVRDMILALASDGGEVTEPVINFANTPVGAANDERGKLSFARYIVLADSVIEEMQA
FT                   TGELELLGELEEEEEEEEEEEDTQLEIHDEYY"
FT   gene            complement(<304884..>305099)
FT                   /locus_tag="MICPUN_74023"
FT   mRNA            complement(<304884..>305099)
FT                   /locus_tag="MICPUN_74023"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<304884..>305099)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_74023"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI43"
FT                   /protein_id="ACO67792.1"
FT                   /translation="EDPRNGNRALHIAAQNGFTPVCKLLIAKGAEVNAVNMKNNTALHM
FT                   ALGYDYDECAEFLYSSGADGTIVNSEG"
FT   gene            <306296..>307638
FT                   /locus_tag="MICPUN_64446"
FT   mRNA            join(<306296..307537,307576..>307638)
FT                   /locus_tag="MICPUN_64446"
FT                   /product="predicted protein"
FT   CDS_pept        join(306296..307537,307576..307638)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64446"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR041127"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI44"
FT                   /protein_id="ACO67619.1"
FT                   /translation="MSAFGTTLAAPAAAGGWAPALRRCRTRRVGITSRAAASSSGRGAT
FT                   DGEEEEPSDEKRFGFGRRDALIASATACLSTGLGPEGWTAARASTELNAIALGDDGIPD
FT                   YTVRGPYGVRRLPKLEHTCISCFPRCVGDACLVQIDAYVPSAPPPLPDTMFPLLGEDGA
FT                   PLRPVAGPTRGALSEVSRGPYPLAVFTSGFLVDSEATASYCRRLCSWGYVVLGYNKRDG
FT                   VGVAGGNALDDVVSAKMVDDLIGWARTDVLLAPLVRDGGAMDTADETDDDIVTAPAKGG
FT                   VYLIGHSRGGKISMLQACGDERVRAACLLDPVDNTVYAPLGEGFPSAVAKMRNTKDGGP
FT                   PLLVVGGKYGGDCAPKGSNYLSFLEQSNPKSWGLEVRAGHFQFLDSATLVQRAVCEENP
FT                   GVAEAQVREVSQALMGGSLATDDENAGAVMGRWCV"
FT   gene            complement(<307756..>310132)
FT                   /locus_tag="MICPUN_104334"
FT   mRNA            complement(join(<307756..309075,309521..>310132))
FT                   /locus_tag="MICPUN_104334"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(307756..309075,309521..310132))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104334"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8270 - zinc ion binding"
FT                   /db_xref="GOA:C1EI45"
FT                   /db_xref="InterPro:IPR001594"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI45"
FT                   /protein_id="ACO67793.1"
FT                   /translation="MPSRTSNAGSRGEYDLEEPAARWDWSKCERWCRTCNIWRPPRAAH
FT                   CTECGYCVKRFDHHCGAVGNCVGRDNHRWFVAFLCACSALVVLMLSVSVHRLRAGGWFV
FT                   GRGSWERLTPWILLGCAITYGYMSVLACFAASHVWIFCCDVTTKELMRPTGSEGDRLAG
FT                   RERRQEAWRRLCGDCNAFRKASLTNIIEGVACAKCRLRSATAVSDATGIILDPDTVLKE
FT                   VAKDGDSVLVRFGRGPEAFTTKWRNRPTARPFDWDAMDSKGVAIRPDHDAWLKDLDLYM
FT                   YGVDDMVEEIHAKTHENARADDVKNVKAVMTEFGGFIQAVFKLYEAKGDGDDGDVDRLT
FT                   LEQFRMLCRDFAKGLTNEYVDECFNAVLPQNMKGARKGSVSTTADLNGFFVAILKVAAK
FT                   VFGPETKGGFQELAPRLEHFLKRDAFPVLAPVFEKVHDELRGAVTPEVLSLLKRCKRLM
FT                   AKTLDSCQLRRTPATAGHLDVRYLSVHATRWGIVSEDAGEGRDDVVSLEQLTTYVVYVK
FT                   QLAAAGDVEKFTIQAAPYEVDQGEFERLLVSMAYFTYNAAMATEAKQREEEKKAKEAAA
FT                   AAAREAEGYEDGEEDEGMDEDGEAAEVTEAEPDGPSITFPEYLQTYLDSIFEKAGALVA
FT                   IEPPKIEI"
FT   gene            complement(<310815..>311879)
FT                   /locus_tag="MICPUN_88694"
FT   mRNA            complement(<310815..>311879)
FT                   /locus_tag="MICPUN_88694"
FT                   /product="predicted protein"
FT   CDS_pept        complement(310815..311879)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88694"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:9116 - nucleoside metabolic process"
FT                   /db_xref="GOA:C1EI46"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI46"
FT                   /protein_id="ACO67794.1"
FT                   /translation="MGLRGIKANRTNIGALLGCDREQCDVSTAALPRLQRLDKGNKYPV
FT                   LFYAPEMEALAQQIAGEDVCGSSVELGSIDWRTFPDGFPNLFVNDAYGVRDRHVAFLAS
FT                   FHSPEVIFEQLSVIYSLPKMFVASFTLILPFFPTGTSERVEREGEIATAVTLARILSNI
FT                   PPSRGGPCSTLIFDIHALQERFYFGDNILPCFESGIPLLLNRLTQCEDADNIVIAYPDE
FT                   GAWKRFHGFFKGMEEVVCTKVRQGDKRLVKLKEGEPAGRHVIIVDDLVQSGGTLIECQK
FT                   LLSRLGAVKVSAYVTHGVFPGNSWKKFCAGGGGQGFYKFFLTDSCPGTAEAVRGTEPFE
FT                   ILSLARPIAEALHV"
FT   gene            complement(<312673..>316231)
FT                   /locus_tag="MICPUN_104336"
FT   mRNA            complement(join(<312673..316043,316186..>316231))
FT                   /locus_tag="MICPUN_104336"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(312673..316043,316186..316231))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104336"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI47"
FT                   /protein_id="ACO67795.1"
FT                   /translation="MTDVEEFTAHLKDSKGNVKAELDLFISKGGLRLIKTDGKILGAFP
FT                   LQRIQQWGITQPDTFKLSVQNGDKVVSLVIHSEPSEVSAIIDCLERKVAQIIEDVRAEE
FT                   EGRPPQDVSSPPPRARTPRSRVPEPEPEPEPEPEPDEVRDMEPVPDDLPESYSDDAEEI
FT                   DDEEIERDVPRPFTSPVVRDDLDDLDDIEEIELEVGGTNQRDPDDDRARNAHTGYRVPD
FT                   LFDDSDDDVQVEVLDDAGGSSPRKGTMGRASGGGGRGGPSANWFASPAGKVTAEEAEDD
FT                   EEEEMMRSMMATRNGQASTTTNAGDDATRDNANRLRPLGPARPRPGALAPLASLSGRLS
FT                   NPASPARRPMPLSAPVNDEQEADDDELNDADAVRPASPPTSTLSPSPPSSPPRPTSKRT
FT                   PAVTTGHSPESRAAASVAAAAAREIGELRARVEELEETERELSKARFLAKGDADARVDA
FT                   ERRADAAEARLATAEDKLARAESTAAQAESRANEAKAQAEAMKKEAVADSAGVEEALER
FT                   ELATATSRATELERELESARGAARAAEDRARTAETRAETSDARREAAEEVAAEAKEAAA
FT                   EAKEAAAVAKEAAAVAEANFADLSDAVATREAEITSLKSSIASSGEASTRAARLETSLQ
FT                   QEKDARASVERKLAAAEAQLAEIRGSLAEADSARVTAANDAAAAGDRAMAATREADEAK
FT                   ARAIDAEAKLKDAEVTRDESIRGREEADERAAAAEAAAKEADERAAAAEARAAAAETSL
FT                   KEREAAHAENAVPGTATEIAELIDDLRRRANEAELARIEATKRAESAEAQIAAAAERAS
FT                   KAENLANQVDEAAAKALERADAAESAVHEKERATSEILSAMEGVSERDMAAVARAEAER
FT                   AAAAETRVRALEQRLAVAAESRAELSKLLAEAKAECAEHRGAAAAATDALEEAFASARA
FT                   VAQREASAREAQAIAEARLAAAGAETAAAEERAARADDLEIRAQTAEARLETQAREGAR
FT                   AVARAQAEASEWRAKAQLRERELEAVRASADTAASLASTYVVTSSASKREHARGTSEAR
FT                   DENENAYGLPPPLPPSVLSAKNSPAKKFHNMTSPYARQYHDFSTERGAGGARPTPALLT
FT                   ADFLDSLGSRLSSVRELLASDQVRVVQKGKP"
FT   gene            complement(317037..317850)
FT                   /locus_tag="MICPUN_109564"
FT   mRNA            complement(317037..317850)
FT                   /locus_tag="MICPUN_109564"
FT                   /product="predicted protein"
FT   CDS_pept        complement(317078..317827)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109564"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI48"
FT                   /protein_id="ACO67796.1"
FT                   /translation="MSVPASVPPPGLDSTANAATGSDPLKKGFDPLKKGFDPLASVPTP
FT                   TTAAPSTEEATAAVRAHADTVEADVDASRPPHSSAAGVDARVRFDARSGANPPGVSTDR
FT                   SRLQAIFEREMDETSEALLGGSVTAGSGGAADDVNDARATAPPLDGDGDGPDAPRTLRE
FT                   TRDRLPFSPALNDELMDALTSVVDSSRAGGVDAREMMAAASARWEARRGAGGRTRRDPM
FT                   NTRAGRLPTTASEEEDGEPEATATVPS"
FT   gene            complement(<320738..>321133)
FT                   /locus_tag="MICPUN_64452"
FT   mRNA            complement(<320738..>321133)
FT                   /locus_tag="MICPUN_64452"
FT                   /product="predicted protein"
FT   CDS_pept        complement(320738..321133)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64452"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1EI49"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI49"
FT                   /protein_id="ACO67797.1"
FT                   /translation="MAIITNQDDDANKKIKSSDRRKRAAAAKRMKNAEPGGWKSLSVED
FT                   RQFLAEVFKTYDKDGTGTLGENQLAPLLKALAGGVEPTPEEVQEVMDTADNDKSGAVSI
FT                   DELKDVIRVWYVMCKKKDKKSSGCVVM"
FT   gene            <321473..>321673
FT                   /locus_tag="MICPUN_88574"
FT   mRNA            <321473..>321673
FT                   /locus_tag="MICPUN_88574"
FT                   /product="predicted protein"
FT   CDS_pept        <321473..321673
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88574"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI50"
FT                   /db_xref="InterPro:IPR009653"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI50"
FT                   /protein_id="ACO67620.1"
FT                   /translation="LQSFLVTLLLFICTCTYVKMKAPRLVDPYRTGLRGMFWKAARIGE
FT                   RLSPWVAASCLIMAFYTLFGA"
FT   gene            <321720..>327275
FT                   /locus_tag="MICPUN_104338"
FT   mRNA            <321720..>327275
FT                   /locus_tag="MICPUN_104338"
FT                   /product="predicted protein"
FT   CDS_pept        321720..327275
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104338"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI51"
FT                   /db_xref="InterPro:IPR005158"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR039226"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI51"
FT                   /protein_id="ACO67621.1"
FT                   /translation="MSGTLKELRAHLVAAKTALSAGNLAAARESCKSALGVDDESYEAW
FT                   TFDGKVAFASGDATGALKSYKRAVGIKNDHPAAWQGIAEAAETTGSHAECAAALDALLR
FT                   MPVDGRSVTGDKKAEWRRRMASALGAAGAWGDASDVWTELAETMGPEGSTDAAEPTATD
FT                   ARRMAAECACSANAAAAEAAAEAAAAEAQRTSVTSRADVASIRSTAMRSHDARCDPRLE
FT                   RTLRTYLERLPRHSNEESDPKLISPYVHSLHGRLLTRALARTAATGTREDALAAMDEAE
FT                   AIVARHGEDVPEAAAACRAAALESICALNLGLDVEEEGWDSDQGGGRTTAGNDGDGDDG
FT                   DGDARASLERRAARLVSVGSEPSLESVDPCEAVAAAWLALRESGRSGRAAHPPGSAVGA
FT                   AALPHPGLVALGDALAADESARSAGASDPTSTRAITTAASEAAAAVKAAAAPDPLGPGA
FT                   RVVGWSAAAEAAHMAGDAAVALEHARKALKACGALGWTRGGSNPGHINPGPPTGCERRV
FT                   RIVAAEALLSIGRTREATAALGALNDATESPRTLRGLAMCLDGGEGSSHSGGEGRVAAL
FT                   KRAASLAPNAPRPLAELGWAMLRNGGNGVGVRATRLLERAATLTAGSVPPDVDAKLGVA
FT                   RWTEAIEREAKGDVGEAKSCALRRGPNTAHASLLAAAAVDGPFQPLAFAYLARMYDTAG
FT                   DASRSKKCRARALSLDPADPIAGPDECAARGDDHAYVARTCRDALRAKPRCLWAAVRLA
FT                   PAASRLGDHEAAVGALQTVLRSVPDSSAAWEALGAAYDALNRHSAALKAYGRAMDIERE
FT                   RSGLGSGLLGSGLTTNSIDDPGGRVFASVRSGRIMHQMGAVRESIAAYESALAVAPGHT
FT                   AALLGLAEAELGRARMAAGRAPGAAIASAERAAEAATQAIQAVTPGTDAPKRTAVKLIG
FT                   DAMMVVARCRDPKAIVQGSDDDAIDEREASKPSAATRAAQADAAAEKAARRARRAYARA
FT                   IHLEPNAACAWRDLAGACVAEGDACASRGVESPGSDESPGRAKCRDVAERCLRGALRVD
FT                   AADPATWTAIGTLPGAEGADPTRDTARRETALARAVALDPRCAPAWSALGRIYLRRAAT
FT                   EADPGERGVFISRAQRALDNARAADPSDANAWVGTALLHSARGDEGETAGAFRMASDLG
FT                   AGREADVYRALSGLRAAAELAAAAASEGPFKPTHDAGTKVTSVGGAYAAARRAVEAAPG
FT                   DPTARLSLALASEAKGLFVEAAFAYDDVAALLSHHATHTYEGDTRGIAIDPDVLAREAS
FT                   AGAERARAGAERGVGAPSALGELSGWESIANVDDVASIAAYVRSARATFRERFESHARV
FT                   ARVEALAGAAAALAGDPNAAARSLAKAVHLSPRDVAIRGDLARVLPATDASGAATRAAG
FT                   SLVPAPTAGSVGGLLLASPDASVEARESVTRATAASAAALSAAGTDLWTDKRTDKNAGT
FT                   LRAAGVRLAKAYHLSPSGVAGEDAYALMALVTARRAAVGDGWGPEFRLAAGRRCAAVAE
FT                   VIKGRDPHLAAAVLCAASESALAGGRVDVAAVHARRCAEVAFEETNDARDAVGVIPAVH
FT                   AATATARCAWASGDAATAAAELQLAISAAAEGAACASHAPAAIAGGTSFRSSTTATPRV
FT                   VSAAGDAAAASFALLPGASVDVPPGSCAALTMAAACASLAVGEFKAAEALLRDAQRGAV
FT                   DLAASSGGVQPLCASASKALLGAALLARAKPTEDGGGGDPKAAKEAWKVLARAMRGAGF
FT                   GTTLAAACGTLGVEAELAKGGKSEGEVEAELARLAGWSAAGVATPAAAHAAAAQLCGSS
FT                   PRGRVDAQKAVHAAPWAVEHWHRLWQRPDYHRRAEA"
FT   gene            <327354..>328313
FT                   /locus_tag="MICPUN_104339"
FT   mRNA            <327354..>328313
FT                   /locus_tag="MICPUN_104339"
FT                   /product="predicted protein"
FT   CDS_pept        327354..328313
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104339"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR018641"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI52"
FT                   /protein_id="ACO67622.1"
FT                   /translation="MPSEPAALVVFARLPIPGKAKTRLAKDVGDANAAEFYARMAERIF
FT                   TVTSRCERTSSRTVFFSERAEEDGIRRWLQGKRGTASDPRASSWTDIRLEPQAAGGDLG
FT                   ERMRRALDHALRHGGSDGGPCAKAVVIGTDIPSLDASHVDRAVELLDAHDVVFGPAVDG
FT                   GYYLLGVRDRGYVGDKKVGDSEGSERGGVDRGEGSDRGEGSDRGVAGQGGAHPAIFTDI
FT                   PWSTGTVLRDSLRACDAAGISAAAVGAMETLRDVDTADDVNAWIESRFEAYADTGVYVP
FT                   NELADVGWDLLKYSGYGSRSPKEDETRLPAGMKDYESD"
FT   gene            complement(328349..329017)
FT                   /locus_tag="MICPUN_109565"
FT   mRNA            complement(328349..329017)
FT                   /locus_tag="MICPUN_109565"
FT                   /product="predicted protein"
FT   CDS_pept        complement(328407..329006)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109565"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI53"
FT                   /protein_id="ACO67798.1"
FT                   /translation="MSFFGLTYLGSGNVFRNTRANRLDGLLAVPAEAFVDAFHQMSLER
FT                   TRPKLAGEIGVDGVSFMMRGELPELMERVLGRVPEREELDVFLTFFDITVTGVIDVREF
FT                   EDGIARMRNRSEHPASSRNYDSSIQMQRDRAKNRRHGTDPQMAYAKPLLASQEYGWFTH
FT                   QAQPSEIGFRREYRGVQKTDVTLNEGRSLQSYFGEM"
FT   gene            329117..331256
FT                   /locus_tag="MICPUN_109566"
FT   mRNA            join(329117..330751,331070..331256)
FT                   /locus_tag="MICPUN_109566"
FT                   /product="predicted protein"
FT   CDS_pept        329137..330372
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109566"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI54"
FT                   /db_xref="InterPro:IPR029399"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI54"
FT                   /protein_id="ACO67623.1"
FT                   /translation="MDSRGGQGRGDGSLGLSEPLLTGSTTDRGVASGPLHASRPPPQRV
FT                   GAHSHVTTQHSLPLGTAPRDVRAVARRGFRPLRGAWLVLLTWAGTCVATLWALLTDERG
FT                   LIGPFDDAHAARASLNAALLLASGALELTLRHVLKRRQRQGYLAFYRGVRKLIPQPFRI
FT                   VSLGTAVLFVIVTTGWSVEAARAVATLQCAAMVGCLLAIGERIRRHNAAAPSPDARVAL
FT                   GRGCEDGDVLPNAPWGDGSHRGDGDDVEDGFVGDEASVSEEQAEFNRYLCEQVRELGRE
FT                   CVRLQRRLAEGKRDGSGDDDDDDDDDDDDVYDSSLARRGGGSVRPSVRGGSSAPAELSQ
FT                   ARSELARCRAELDERQAEIARLHAANRQHESEQQRLRASMDEWSGQAARLERRLERAER
FT                   GRENAGGVTGRD"
FT   gene            complement(331578..333035)
FT                   /locus_tag="MICPUN_109569"
FT   mRNA            complement(331578..333035)
FT                   /locus_tag="MICPUN_109569"
FT                   /product="predicted protein"
FT   CDS_pept        complement(331668..332936)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109569"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI55"
FT                   /protein_id="ACO67799.1"
FT                   /translation="MDFVNEEANIRKFDGLYGPNGTNRKALPPPGYVRVPGLIPKLPAT
FT                   RRVLIMEWLDGQRVMSLVSNRKSCLDEDDEVAGLDEADECAPMTWEEKECVRKAASLPL
FT                   IELGIRCTLSQLIETGVMHADPHGGNLLRLRETGELAYLDFGLVSEIPPTVRDGLVAAV
FT                   TLLVFDRDYEAVAGLFGELQLVPTDVIENPYQFAALTTALREAAEATLSYPDDELGLER
FT                   GENETEEEARLRRAKSAVPDVRFDQLLGALLALVPKYRFLLPPYFLNNARALGTLEGMA
FT                   RTADPNFNILAIVYPFAVKRLLQNPTGSPVLRRVLRQLISNKRTGRMSLTRLKLMVEDA
FT                   AALTGVSRMAIIASAMKTTAGWRLAVESVFAGAFWCVGRCVSAVFFVTGITAVRNAWGR
FT                   FIYRLNRDIDDEERTPARVGSVF"
FT   gene            complement(<336529..>337401)
FT                   /locus_tag="MICPUN_88516"
FT   mRNA            complement(<336529..>337401)
FT                   /locus_tag="MICPUN_88516"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<336529..337401)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88516"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3910; ATP binding - DNA ligase (ATP)
FT                   activity [PMID 5524]; GO_process: GO:6260; DNA repair - DNA
FT                   replication [Evidence 6310] [PMID 6281]"
FT                   /db_xref="GOA:C1EI56"
FT                   /db_xref="InterPro:IPR012308"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR029710"
FT                   /db_xref="InterPro:IPR036599"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI56"
FT                   /protein_id="ACO67800.1"
FT                   /translation="MAEVTKCGVNDRRTGFFALYRLMLPHIDKERSAYHLKEAALARVI
FT                   GLALGLDRNRSPHFKKLEAWRKGGAGIFVDAVQECCAHHMVDGYVKRVDRATIGDVNDA
FT                   LDKLATLKTNNEKLPVVAGLMDKMDARQMRWLSAIIIKDMKLGYGEAAIIRHFHRDAED
FT                   LYNVCCDLRRVCETLHTKAVAFKRQDLQPGSLVRSMNAAKKRDCDEAWRHVQRREFVIE
FT                   HKFDGERIQVHRVDARTFHYFTRNNFDFGPRGYSVMNRLFRRRLATDRCVLDGELVLWH
FT                   KEHKAYVPFG"
FT   gene            337703..339080
FT                   /locus_tag="MICPUN_109570"
FT   mRNA            337703..339080
FT                   /locus_tag="MICPUN_109570"
FT                   /product="predicted protein"
FT   CDS_pept        337844..338995
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109570"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI57"
FT                   /db_xref="InterPro:IPR013518"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI57"
FT                   /protein_id="ACO67624.1"
FT                   /translation="MRKDTWADVEAAKATKYEMSAPLSSKAGPREYERRLAHDFNVHSR
FT                   ENIINSTSGGGAYEGVDDCQMSVSLAEDVWHLLTVDMSLQRLLALEIVLEFSFMLISSV
FT                   LLCVIAVCEGNTLDSEIMNQKLLLSLTTVRISSDSIYGWQERAPSTKPEIAMLALLGWA
FT                   HWLLLSVAGAVIVARALKPLQQVVFAPDCVYNDEFLSIRMMILRKHVILYDLQVRIQAF
FT                   SGGEIMDLPLSTGTTGYARWTGVFPLTMKHNIDENSPITKKGMDKITNIAVTVTAIDSD
FT                   GKPVYAVAEYYNPRGWIAGRPEFQGWFAKKACYPRMLRGRFGDQFRFFKVPNDSGMRHP
FT                   TMPETTHDDQATVNEPVTGPPVFLLDFDNFHVVHNEPDADSPV"
FT   gene            complement(<339085..>340481)
FT                   /locus_tag="MICPUN_64461"
FT   mRNA            complement(join(<339085..340143,340443..>340481))
FT                   /locus_tag="MICPUN_64461"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(339085..340143,340443..340481))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64461"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR041232"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI58"
FT                   /protein_id="ACO67801.1"
FT                   /translation="MPQFFGLEVPKGEAKKFAADEGDSIVLCQAALGLKPKAGERVTVF
FT                   IKTQDSPELAIGSLTMGTCDQFTLGTGLSFSAGETVTVRHNGSTSVFLTGRIEDDFEDD
FT                   LDLLNDDDEDDEASLSSDSDDDSDDDSDDSDEDPKDVKVRTQKLAAAAAAAKPGDAEEP
FT                   SEDSEDDSDDDEDDSDESDGSDEKPKAANKKDESESESDSDDDDDSDDSEDEEDEGKPF
FT                   MGKKPASAAKPFKGGADVGEESDDSEDDDDDSESESDSDSDDDDEDGDDKDGDKDDDDS
FT                   EDDSDSDSSSSSSSDEDNVLDDPDNDNGEKKRKGGPARGGGPPQKKFTPGKSPGGGRGG
FT                   GRGGRGTPGKSPGGRGGRGTPGRRF"
FT   gene            <341101..>342399
FT                   /locus_tag="MICPUN_68279"
FT   mRNA            <341101..>342399
FT                   /locus_tag="MICPUN_68279"
FT                   /product="glycoside hydrolase family 13 protein"
FT   CDS_pept        <341101..>342399
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68279"
FT                   /product="glycoside hydrolase family 13 protein"
FT                   /note="candidate a-glycosidase; GO_function: GO:3824;
FT                   cation binding - catalytic activity [PMID 43169];
FT                   GO_process: GO:5975 - carbohydrate metabolic process"
FT                   /db_xref="GOA:C1EI59"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI59"
FT                   /protein_id="ACO67625.1"
FT                   /translation="PSPTDPGNPLDWWKDAIVYQIFPDRFAPDPAGPPTGASLDPWGST
FT                   PTIRSFQGGSIKGITANLDYIQSLGINTIYTTPVFLSTANHRYHPSDFMKVDPMLGGED
FT                   AFRELIDEIHKRGMRFVLDGVFNHTGRGHWAFTSLLDGQEQSPYKGWFLPKSFPVRAYD
FT                   VERYHVNYECWWDLPDLPKLNFNNEGVVEHILDVGEWWVKEFNIDGWRLDYPIEIPNEF
FT                   WKEYRRRVRAVNPGAVTVGELFGVRPDCVGEGNHFDSLMNYAFGTCSLGFVGCGFELRQ
FT                   DDAIGGEYQVIAVDAKGFKDNFGEVCAAYQKAHTESKGGLGGGSAHPSMLMNLFDSHDT
FT                   ARALWMLQGDTAALKMLLLMMACAPGPSMLYQGTEVGQTSANGLKGAGRDPANREAFPW
FT                   HKKEDWDVDLLEHVKGVNHLRRDLYALRRGGLRW"
FT   gene            complement(<342930..>344357)
FT                   /locus_tag="MICPUN_104346"
FT   mRNA            complement(join(<342930..344125,344300..>344357))
FT                   /locus_tag="MICPUN_104346"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(342930..344125,344300..344357))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104346"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR029041"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI60"
FT                   /protein_id="ACO67802.1"
FT                   /translation="MDVGLVDALCDYSRPVFLFGLTPPLEGATQDELKETARKFVERSA
FT                   TLATDGFIVYDIQEEKGRTPEPRPFPFRKLDDPSHFAKVLKDVSGKESVVYKCVAESDP
FT                   GGFDGWLNKAIDDYGVNAYNLVGGASSANQYSGPTIPDVAAKLNKRKQCAHGGVTIAER
FT                   HVKKGNEHETLVKKGELGMRWFISQAIYDPEPMIKLLKEYGALCRQRNIEPKRVVLTFA
FT                   PCGREKTMRFIKWLGVTVPENVEREILDAEDKVGKSVDLLCAMCKKILDETKGCGVPLG
FT                   ISVESVSIFKNEINAAHELFRRTQSMLLDFLGEPWLVQYKLVSKGAKRTSFDYGSRKSP
FT                   ASPGAALPPVKEPKVAKKEGGNGGLFEGLSEEEQKKLGIAGAVGVVVGFILGAVLGGGK
FT                   SKPIAPAPEPPKKKGWGK"
FT   gene            <344693..>345766
FT                   /locus_tag="MICPUN_104347"
FT   mRNA            <344693..>345766
FT                   /locus_tag="MICPUN_104347"
FT                   /product="glycoside hydrolase family 18 protein"
FT   CDS_pept        344693..345766
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104347"
FT                   /product="glycoside hydrolase family 18 protein"
FT                   /note="distantly related to chitinases; GO_function:
FT                   GO:4553 - hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds; GO_process: GO:5975 - carbohydrate metabolic
FT                   process"
FT                   /db_xref="GOA:C1EI61"
FT                   /db_xref="InterPro:IPR001223"
FT                   /db_xref="InterPro:IPR011583"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI61"
FT                   /protein_id="ACO67626.1"
FT                   /translation="MWITRYRRPHPLAWRIVALALIAAATVTASGSGEDGGANPDRGAF
FT                   VVAGYLPEWRYEGADWDATCAHVTHLILFSMEVTEDAKLTASDRFPHAHLDAIKAASMK
FT                   HHCELVISIGGNKRTGGFPTVAKDKALTRKLARTLLFFVKQHGLHGVDFNWEYPNGKEE
FT                   WRGLHRMLKITRRVFDRHRDETGERLTVSTTYYPDGRQEKILADFGAAEHVDMAHAMAY
FT                   DFGPGGHSTMELAENVIANMERLGLNKSIATLGLPFYGRSKWQSGWRTYEDLASEHPSL
FT                   GTNGGGDEDPSGEYSFNGLDTIAEKVRLAKTAGLRGVMIWELGQDFHPGDGRSLLGAIA
FT                   REVWPEGRTKRLVRDEL"
FT   gene            complement(345780..347282)
FT                   /locus_tag="MICPUN_109571"
FT   mRNA            complement(345780..347282)
FT                   /locus_tag="MICPUN_109571"
FT                   /product="predicted protein"
FT   CDS_pept        complement(345953..347263)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109571"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI62"
FT                   /protein_id="ACO67803.1"
FT                   /translation="MSRLEFSRTAPAGGASPARTDSDGTTTDSDTTHEGDEDDAPQMPP
FT                   PVALLSMLGAVLAARAVGLEANPRLERGAAAMARYFCLEHTAARIGCASPAGMFKYGMR
FT                   YHPGRIGVGAYHDGGLLRGLFNALTAVIAALWHVRLVGFSCVVLAATVKTAMKIIGDGV
FT                   VGGVPSLTGDIALSPAFLASVASASVPAVLYREALRFDAEGIDEGNSGIKRGSSKRWST
FT                   AHAKHAVRAQNRGAMIWPFVAIACAAVQLLKLRSDASLNTAKLLLVAATEIVPAATLLA
FT                   SLQFPEWNTRSKRRANWPALSVTVHIARMIACLARGHTAYASRYSMYLGFCVDVVTSTL
FT                   SVAMFPMWRTADAVQAQTGVVACDWIGHYLRTGTTPAYLVPGDAPLTPVEIWCHVVREC
FT                   VWRVLTPAAVNALVMHRVVQSGRSKRRATVVEDAHSE"
FT   gene            complement(<350746..>351372)
FT                   /locus_tag="MICPUN_88651"
FT   mRNA            complement(<350746..>351372)
FT                   /locus_tag="MICPUN_88651"
FT                   /product="bromodomain-containing protein"
FT   CDS_pept        complement(350746..351372)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88651"
FT                   /product="bromodomain-containing protein"
FT                   /note="Predicted bromodomain-containing protein. ChromDB
FT                   ID: GTE20102"
FT                   /db_xref="InterPro:IPR001487"
FT                   /db_xref="InterPro:IPR018359"
FT                   /db_xref="InterPro:IPR036427"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI63"
FT                   /protein_id="ACO67804.1"
FT                   /translation="MGRGVQRGERVDTELGSAYFTHEDETPFDIGQKLRIHGNTLVSLN
FT                   SWYLPGLKLRSKLKAGTRLWLEARFDDEEEILNDDLKGRLEKVINALQRHRFYFIFAQP
FT                   VDPVALNIPDYFDVVKTPMDLGTVANKVRNGAYKGDVTDFEDDARLVFSNCRAYNPPGS
FT                   DAATMGDAVEKEFDKKWIELGFVFKDETREMPKPPGAGGDEMRTK"
FT   gene            354730..355856
FT                   /locus_tag="MICPUN_109572"
FT   mRNA            354730..355856
FT                   /locus_tag="MICPUN_109572"
FT                   /product="predicted protein"
FT   CDS_pept        354755..355741
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109572"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16021 - integral to membrane"
FT                   /db_xref="GOA:C1EI64"
FT                   /db_xref="InterPro:IPR007248"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI64"
FT                   /protein_id="ACO67627.1"
FT                   /translation="MHAAREVVGPTLALRHAGGSWRDVVSHPASSFFYGAFRAPLSVAE
FT                   AAGGKSLVGFTAESVRAGSSVAASSSSRRVSSGFVRHHYELMSPIEHSRVSSADALRHA
FT                   GASWIDVVTHHAFRSCFTNRAAANAYAAYVATFVRHPFPTALVTSVGKCVVSDVAVQMA
FT                   VEGKRYDEVDRRRVFCFFALGLTYVGAFQYGLYNRLMKPMGDLLTARFGTSASVATMVA
FT                   LDQFVVCPVIYLPTFFGLKQWSSGECGFVEVPGKIATKMAISEYDAGEFVTMSAMWAYW
FT                   IPAQAINFWIVPRHLTIPFMNLLGFGWNAIMSAMNGSAIGDKSKGGA"
FT   gene            complement(<355895..>357262)
FT                   /locus_tag="MICPUN_64468"
FT   mRNA            complement(<355895..>357262)
FT                   /locus_tag="MICPUN_64468"
FT                   /product="predicted protein"
FT   CDS_pept        complement(355895..357262)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64468"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI65"
FT                   /protein_id="ACO67805.1"
FT                   /translation="MRRFGTESTRRSSSREATAPRVDEAAMQAKLKELRGLMASEHAAR
FT                   ETIRDIAELNGGSIWRSSRRPEERTRDPVRTSAGSIPGRGAHAHRIGPRLRDLSAEDMS
FT                   LVERARARASAEVARVGPVASRRPDIPERRPGAASRGAGRVRTSVDVIDHLRPDLIARA
FT                   MGANSRPTPAHRSSRPGVSTPTARPQSPRVEHVVLHSADLRGQLGEGRLVPRPPPGLGP
FT                   SSRAMPRPASGGGARAGRFGGVGMTLDGAATLDDDLSAVEPVGGGGRPPTGERRRAPTD
FT                   PGGASSWRSSTRDGADVLTMRGDDGGDGDGVVGSVTAGGVEIVDESGGALLRGEFDEEA
FT                   NARAFAEALREWRGGGGGGEEGVGGEELVAGGDKELVVRESTRPTTAAAEIDVQTDGAG
FT                   GGLYTGARRSSSPWGVAARPLAAKPGASYFERLFAKNVERMAGKKVSAWMESTRAK"
FT   gene            complement(<357591..>359420)
FT                   /locus_tag="MICPUN_88562"
FT   mRNA            complement(<357591..>359420)
FT                   /locus_tag="MICPUN_88562"
FT                   /product="predicted protein"
FT   CDS_pept        complement(357591..359420)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88562"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:287; thiamin pyrophosphate binding -
FT                   magnesium ion binding [Evidence 3824] [PMID 30976]"
FT                   /db_xref="GOA:C1EI66"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI66"
FT                   /protein_id="ACO67806.1"
FT                   /translation="MQDLASQRPVANFQSRFGDDEPRKGADILVEALEREGVDCVFAYP
FT                   GGASMEIHQSLTKSKTGVRNVLCRHEQGEVFAAEGYAKCTGKVGVCIATSGPGATNLVT
FT                   GLADALLDSVPMVAITGQVPRRMIGTDAFQETPTVEITRQITKHNYLVMDVNDIPRIVR
FT                   EAFFLASSGRPGPVLIDIPKDVQQQMSVPYWGPKVSLNGYLSRLPSPPSHPQMERVLDM
FT                   IKDAKRPVVYAGGGCLDAAPELKEFIESTGIPITNTLMGLGCYPASDELCLDMLGMHGA
FT                   VYANYAVDSADLLLAFGVRFDDRVTGKLEAFAARASIVHIDIDPAEIGKNKEAHCPVFS
FT                   NIKPALRTLNSIIRADKPELDFSEWRADIAKQRAKFPFAYTETDDYIVPQHAVELLCKM
FT                   TEGKAIISTGVGQHQMWAAQHYKFDEPRNWLTSGGLGSMGFGLPAAIGAAAARPDAVVI
FT                   DIDGDGSFVMNIQELATLHAENLPVKMFVLNNQHLGMVVQWEDRFYGANRGHTYLGSPD
FT                   KDYAVTQDEADIFPDFVKICEGFRVPAERVVRKADLKDAIQRMLDHDGPYLLDVMFPHQ
FT                   EHVLPMVPGGGTFKDTITTGDGRTPETKDMKTL"
FT   gene            <360609..>361691
FT                   /locus_tag="MICPUN_64470"
FT   mRNA            join(<360609..361305,361372..>361691)
FT                   /locus_tag="MICPUN_64470"
FT                   /product="predicted protein"
FT   CDS_pept        join(360609..361305,361372..361691)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64470"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI67"
FT                   /protein_id="ACO67628.1"
FT                   /translation="MFVIAQTAPALSARRTRAPLRSRRSPAARPVRALQQIIRAQNVQD
FT                   DFSDSRRAVLLSGTALAANLCMPEFWMPPANAKKIISGSNPAAPGVTCAFLSHGKFPTQ
FT                   TVATASNIPLTDRSSFLSSGTPDFDAWYKVYEGAMNNLTGDMASIFRAVCAKGADGGVN
FT                   AVIVFPSEYTKGIQAFYDQKKNPLWEGGRKDGWLTGDFQQVYFTPTAFRGAVEGPPPPG
FT                   KGNGVTLCASGLSAPYDEWFAEFTSPESDQIHDKYGVIASVAGKVQPGSTGFGKSGGAA
FT                   VYHQHKTPKQATDFGKFIGAFLTGPDAPPSLDISKGFYFNYGGIVADVVYPDKIPKA"
FT   gene            complement(<361794..>364904)
FT                   /locus_tag="MICPUN_88662"
FT   mRNA            complement(join(<361794..362136,362185..363184,
FT                   363254..363746,364008..>364904))
FT                   /locus_tag="MICPUN_88662"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(361794..362136,362185..363184,
FT                   363254..363746,364008..364904))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88662"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI68"
FT                   /db_xref="InterPro:IPR000547"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI68"
FT                   /protein_id="ACO67807.1"
FT                   /translation="MEEPPDPHDPGEGPRVGDNPRADEDARSESGSDASTSGSESVSED
FT                   DDDEPMLKYQRLGGAVPAILSDDVASCACAGGNIIVLGTKRGVVIVLDRGGNELRRFTD
FT                   AHRAPVNDVCLDARREWVGSCADDGTCAAHALYDDDDAHASSASTRVVRCEHDAGPVRS
FT                   IALDPRFSSRGTRRFVRGGDDGSLVLSASNKNGGPRRDVVLHAGEGPVRRVRWAGTLIA
FT                   WANDVGVKVYDEARDRRIAHVDRPRGSPPPGAYPPHIAWCDGARTLVIAWADCVKVAVV
FT                   RTRTLTASERSGRPLRSKTTVARFVEVVAMFQTDYFVCGIAPFGPDRLVAFAFVDGGGG
FT                   EAAGDAADGEASRAPSSRPEVRVLTWKNEDLTCDALTMKGYESFQAGDYHLAACVPDDD
FT                   DRYDDRYDDASGSPSSDTAAYYLVSPRDVLVGKPRTVADRLRWLVEERGDYEAALEACD
FT                   AAVASAVPAIPRRRVRDVIADAYLQSHLDAGDPARGASLCPRLLGTDALKWERWIARFA
FT                   ATPRALPHLAPYVPTEHPRLSTAAYERVLNAFLHDRRDHARFLATVKAWAPTIYSVPSM
FT                   VSAVRRKMDTGAGGDSPTLREALAELYLADGQRDRALRLHLELGRPSVLDFVNRHGLLP
FT                   MCANMEGTTYDAPAGTNTLARLARLDPSRAATMLADASFVKGALCVPAEVTVRALTEAV
FT                   NAADVRGTRECLHLYLRELFKRDPDAGERWHRTQPALYAEFHPEELLNFLERANGYDLA
FT                   DALAVCERHLLLKEQVYLLSRVGDAPMALDVIVEGLRDAKYAVTSELDAYADELWTGLI
FT                   SRVVKTAGSSPALVGNLMDALGAVDGVDPRRVLAATPVGTEVEGARNRLRRILTRSRRA
FT                   EREAEARRAEAERELAEIEAMVDAARRRAFDDGAVEIED"
FT   gene            <367406..>367747
FT                   /locus_tag="MICPUN_73105"
FT   mRNA            <367406..>367747
FT                   /locus_tag="MICPUN_73105"
FT                   /product="predicted protein"
FT   CDS_pept        <367406..>367747
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73105"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR022042"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI69"
FT                   /protein_id="ACO67629.1"
FT                   /translation="PAYEAKDMAGVTFDDLEIVCGKPYLYVHMEEPHCEHPIVFRDVRL
FT                   AHPDDPVDRRDYPARLFVGRKYRRKCQMCDVFEARHVTHKDRHAPCHPCFFCDQCFNCL
FT                   HLNKDGEPWY"
FT   gene            complement(<368001..>368369)
FT                   /locus_tag="MICPUN_64473"
FT   mRNA            complement(<368001..>368369)
FT                   /locus_tag="MICPUN_64473"
FT                   /product="predicted protein"
FT   CDS_pept        complement(368001..368369)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64473"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI70"
FT                   /protein_id="ACO67808.1"
FT                   /translation="MDKQEIDWDKPAITDVKMVHKGPWGPEGTLIPISISDHEKKSSIR
FT                   RKVAAASGIPYEHVKLILVGIAQIGAGDRRSNVKYGNCGVAEGIGLTFSTAAAGNKPHQ
FT                   PRPTGNRVDNRGNWTQID"
FT   gene            <368534..>370036
FT                   /locus_tag="MICPUN_64474"
FT   mRNA            <368534..>370036
FT                   /locus_tag="MICPUN_64474"
FT                   /product="predicted protein"
FT   CDS_pept        368534..370036
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64474"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3684; oxidized purine base lesion
FT                   DNA N-glycosylase activity - damaged DNA binding [PMID
FT                   8534]; GO_process: GO:6284; nucleotide-excision repair -
FT                   base-excision repair [PMID 6289]"
FT                   /db_xref="GOA:C1EI71"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR012904"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI71"
FT                   /protein_id="ACO67630.1"
FT                   /translation="MPRASAVTQRAVTYAVDALRISGRASGGLTARGAATAPPHLRRGW
FT                   MGTTRAPGGAPPTRESRSVAAMNPPAAAVVDERGGGWVSLGTPRAELVLAHTLPTGQSF
FT                   RWRLTTRGDYVGVIGKRVVSMRQCEDDVLYRVHCRPAGEDATHDAAAVADYFNLSVSLG
FT                   ALATGWAKADARFAKLQPHLPGCRMLRQDPAECLFSFICSSNNHISRIHGMVERLCATY
FT                   GTKLAVDAALSEARKATANPTGTPKKKKKRKVVADNETKAEDNDDRDDDEGEPLGDFYS
FT                   FPTVSQLTNATEADLRAAGFGYRAKFIAGAVSALNEKPNGADAYLRTLRHECSYKEAQA
FT                   ALAELPGVGPKVAACACLFSLDKHEAIPVDTHVWHLATEHYCAELAGKSLTPRVMDAVE
FT                   EAVGEVFGSHAGWAHNTLFIAELAHVRAALPEELRTPPRAKAEKKTTPKKESNKASAGG
FT                   AGDAGEELDGLLASPSPERGSSRAPKKSKAAIAADDAESEYL"
FT   gene            <371252..>372454
FT                   /locus_tag="MICPUN_66423"
FT   mRNA            join(<371252..371455,371501..372177,372250..>372454)
FT                   /locus_tag="MICPUN_66423"
FT                   /product="predicted protein"
FT   CDS_pept        join(<371252..371455,371501..372177,372250..>372454)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66423"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI72"
FT                   /protein_id="ACO67631.1"
FT                   /translation="RTRAERLREGVASLGPVFVKMAQTLSTRPDIIGAEAADALKPLQD
FT                   QMTAFPSNDAYEQIRRTLNWDGPPIYAELSATPVAAASIGQVYKGKLHTGERVAVKVQR
FT                   PGVLRRIALDLHISRMALIWLEESGLNGSEGLANIVDRVGQGIFQELDYTREADNADDF
FT                   RRALRFLDFVVVPRHHASLTGRTVLTQEWINGEPMKNLGDDDQLKMVQMGVECSSAQLF
FT                   RTGLVHADPHEGNLLYTDTGKLALLDFGLVCRVNNAQQEAMAGCILNILNRDWMDLIDN
FT                   LRIIEMLPETPQTDDATFRKAFVDCMDGEDPSSKKLTNFTELVVDLTKLSTRWRFNLPP
FT                   YMVFIIRSLTTLDFCAVRTGAN"
FT   gene            <375703..379965
FT                   /locus_tag="MICPUN_64476"
FT   mRNA            join(<375703..375939,376123..379965)
FT                   /locus_tag="MICPUN_64476"
FT                   /product="retinoblastoma protein"
FT   CDS_pept        join(375703..375939,376123..379911)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64476"
FT                   /product="retinoblastoma protein"
FT                   /note="Retinoblastoma protein. ChromDB ID: RBL20101"
FT                   /db_xref="GOA:C1EI73"
FT                   /db_xref="InterPro:IPR002719"
FT                   /db_xref="InterPro:IPR002720"
FT                   /db_xref="InterPro:IPR024599"
FT                   /db_xref="InterPro:IPR028309"
FT                   /db_xref="InterPro:IPR036915"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI73"
FT                   /protein_id="ACO67632.1"
FT                   /translation="MPAAVAARPFPHPAPVAGTAGSPADALPLRRVFQADAFEEACASR
FT                   LGYDADEVKAASDILMEAAPLMVGKHVVVPDDSMNPEQWQACAAFIAAGIRRASEHAST
FT                   AASRSGGKKRPAPPAPPDAVASLTDVLRAFDVNCVDFFRALRKFMMAAAVPLNARLKVA
FT                   AKPTGRKAGGSDRRGGPASPAEAPNDDASCDDAGLQRSPGSNAENDVTNGGEGLNELEA
FT                   LLSVSELRTSFAFTKVAAQKYRQFLDVHFDVAAPGGVDLARLGWKLYLAAKHSLLPKFP
FT                   DLYSCYHLLVVVQAFLLVNAPRGLTRTELRNMVSMSVKDDAGDVDALASLSVTSKTKLP
FT                   LLRSTMEDFQRVIVQGLVAAELGGGVDSTRGAPTRRSSARGGGGAKAKDDPSPPSPSSS
FT                   ALQPAESPGEGLAKAGPARFPALLPDGGSSDEATRRGLAAAHAAADAAYAKACAPLGHL
FT                   RLDERLYLPTDAETEADSLRVLGDIKKPAAVGGSGGVAATPGPGKNLDGVHGGTQPGGV
FT                   PGTPWRLTSAARSLLTGRSPARLGTPYGAPGSARLPGGTGSTAAANGGGVVGGGQTTAG
FT                   PRTPAVPFTPISEAMASAAWLHAIVAPPSPNGTPKRPSGQLEPTQRLARFVSDEVAKKL
FT                   MDSVHNLAGKTSAALREDAFLVTINGVGLLAGQGHNVSLDNLVKRRQEEAVRVFAYFLE
FT                   LILENEQRHVIRQAEAAKPPAKPPAKTASPTAERRGSVADIAAIAAEQKEDALLPPPPP
FT                   TAAQRAGFEALLGSGRFVRSVLACSMEVVVASYKTATLKFPAIPRLLGLDAFDVSSIIE
FT                   PFVRADTTMPREVKKHFNALEETIMETLAWSKGSSLFGFMRAAESGHLPARGPAAAALA
FT                   AVSGRGQPGAGDGPGADDPASPAPASAELAGSPDGGAQTAMRRERSFSVAAVAEAAADG
FT                   EDLPGTPGGSPAGRTRRTDKGDHIAAFSTPLKGATTPARPGQTKPRLSMGGADAEPLPK
FT                   RFVRDALTLRKETPTNGRRSVDPSPNGGAASSSTSVPDPAVVNSLRVFFAKVMRLSARR
FT                   LADLCERLSLPAALTQQSYALVEHALYEHTSLLYNRHLDQVLLCAVYGACKVNKDMLLK
FT                   GRTVPFREIIYQYEKQPQCREEVFWTVILTQTDPELEVKQQGDIIEFYNKVFVPEIKAF
FT                   LLSLKSRSPASAGPSPMKSPSGGPQTANAAPMSPLPAGLQSPRVMLGGIRQNVYVSPMR
FT                   SDKALASLAGTFTPRSKSLYAFLGESTHAYQSPARDLNFINRRISSSAGGNGGVDGVGG
FT                   TGVGGGTGGGNGGVADVAGEAAALPRAATGGVKRDGPPTFDEGSPGDGKPPKAPRLA"
FT   gene            complement(<380024..>381019)
FT                   /locus_tag="MICPUN_64477"
FT   mRNA            complement(<380024..>381019)
FT                   /locus_tag="MICPUN_64477"
FT                   /product="predicted protein"
FT   CDS_pept        complement(380024..381019)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64477"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI74"
FT                   /protein_id="ACO67809.1"
FT                   /translation="MELDAPGDVVITDLSDAMSFGAELVEPAVRDRSANARAESPVATN
FT                   ARGDELVLVIHGMNSHCRNPNVRALAVGLAKRGARALTFDLPGYGSCDGSFWDVRGQWG
FT                   GAAKSLARIRRVLSHPAVRGEAFAIVGSSMGGALAIFAANELMDAGEHDITRIVLVNPL
FT                   MRMKTRFPTAVLLGLFILSRVPVLDKLEVSARPSDRKDGDKDMDFDEAGQAQCDADDTT
FT                   WRGGVSLLSGVELYRLTRVNGDGDATEVSVDRCALARLMRRAPTTLLTGAMDDVIPPAS
FT                   SIGRFDAAIGAGGCAEGCARYGFDRAGHSLTLQSRREVFFDLAAGSKPPL"
FT   gene            <381125..>381922
FT                   /locus_tag="MICPUN_64478"
FT   mRNA            <381125..>381922
FT                   /locus_tag="MICPUN_64478"
FT                   /product="predicted protein"
FT   CDS_pept        381125..381922
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64478"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI75"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI75"
FT                   /protein_id="ACO67633.1"
FT                   /translation="MALLAPRLVPCIAPARLARRARLVAGCAVNVVAPSPASAPVATSL
FT                   APATTPRVSRPGIRSPNGRAARAVACGGGAHALFDVAAGAFRVSSLAHNSAALACAVAL
FT                   AILVVQALDDTGASAGNDKRNASLLLLSAAIVAPPAVTAWWLTSAGRSVAFGALALRTF
FT                   LLNGSLSLFGALSTAVDAVATFGLLVITATPWANAWRCTRTAAVVNAAVCAYMLFSHMR
FT                   GGGDFATASQGKYLSAGAGLTLLATAGYVVLLALAVASTGARW"
FT   gene            <382518..>385136
FT                   /locus_tag="MICPUN_64479"
FT   mRNA            <382518..>385136
FT                   /locus_tag="MICPUN_64479"
FT                   /product="predicted protein"
FT   CDS_pept        382518..385136
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64479"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI76"
FT                   /protein_id="ACO67634.1"
FT                   /translation="MDIENMTRREVLDAKLGDEARQIQPRRFEIVLRCVARRPSSDDVA
FT                   RFSHPTQPRRDAISAPFPPPRRALSLTRPPLATPRRKPLAPVNGWSNVLAPKSAFKTPG
FT                   VTPGGGLTRRVSFKPDPAVADDAAWRSLETPAQRPPASRRRVTHRRAGMRARKGTGRAV
FT                   AARTFSLVLRAPHERVNTAVRSGDDDANTEPGDASRANGARSQSASADTGSHGGSGGSV
FT                   NAGDAFDEARDLGRYFSSAKPGIDVAPAVDTPASEDGFHTRVPAAGRPSLVPYALTPTD
FT                   TEEGTFAHAAGGSRGGAPAALADASDAAAMGGNPAMFDDDFNDGFGFEGGYDGDDADAF
FT                   FGATPAAIEAKMLVDGGNDPMTDRGEGKKPRTPLRRLAGVKRPAGTPHKRERKRFERRK
FT                   SLTSAGLRDDLMETEDGRPLRRSTRERTKPLEYWRGETKKYSRVHQSLPTVEVVRTRTP
FT                   NPAWPLLPTPYHAHGAGGEIVITDHVRDWSQKDSRRKKATRPTEEESRRAGEEARKRAL
FT                   ALADVAHLSDSELDDDELPDEVGGVELNGEDRGVSPSEGIEIVEEEEETPAMAIEPEAA
FT                   PEPETADATVDEEAAAEENVTPEKEEDEAPEPVVVEVPVVVEEPEEAVPAVDESTAVEV
FT                   PEEVMPAPEPFAVDDAATEEVPAIPAPDVDVTAMEEEEEVNLDEAAATTLEPTIEPVAE
FT                   ETAAADGTMADEPVAEENDADVFTRPESPPRRVTRRSARNLLDETADALEDATIDEKED
FT                   GAAEPEQAEPEQEPEPEPSPPRRVTRRSRSASLASTADADKTMEADEEEEEEEVDLEAK
FT                   TVSPPRRSTRRSARNANVDAADTEAKTVSPKSTGRRVTRRSSRAASVAGDLDETVRVDE
FT                   D"
FT   gene            complement(<385307..>385828)
FT                   /locus_tag="MICPUN_104357"
FT   mRNA            complement(<385307..>385828)
FT                   /locus_tag="MICPUN_104357"
FT                   /product="predicted protein"
FT   CDS_pept        complement(385307..385828)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104357"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI77"
FT                   /protein_id="ACO67810.1"
FT                   /translation="MHAYRLNRSPKASPRGNRVAPAPSSPPVVPRSPAAFAPRGGPQAV
FT                   SESVVVPSLGEAARMMEIFVQRRNERDADGCAAMLVDDDDIRGPASAYGAVGKENVRNA
FT                   LRAWIEAHPGLHYTWRNVKVESKGGYFLVTFDYERRCDDESQWGRGRETVTLDGTCQRV
FT                   RKVEEHGKKP"
FT   gene            complement(<386017..>386889)
FT                   /locus_tag="MICPUN_64481"
FT   mRNA            complement(<386017..>386889)
FT                   /locus_tag="MICPUN_64481"
FT                   /product="predicted protein"
FT   CDS_pept        complement(386017..386889)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64481"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI78"
FT                   /db_xref="InterPro:IPR018627"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI78"
FT                   /protein_id="ACO67811.1"
FT                   /translation="MDEALGMRAGPLPRGVHALVEDEIAAGGGFVLAHLLARALGRRDD
FT                   DDDDDGGVEEGGGGQRRASPRVCLVCAEQDFAHHARVMGKLGRNLRADVSSGALAVVDA
FT                   LTTPFAWCANPGASGLSRGKMGGVEAHTRRADASGLDGARDLFRAIARALGDDDDDGDA
FT                   VVVFDSLNALADGEPTAADADRAVPSLLASVSSLRRGRTAIVALAHRDACAWDGRGWLD
FT                   AARRRADVVVSCRALTTGHAADVHGHVSAEHRTGRMIKTTTNGAAAPRRVDARFRLTEL
FT                   GPKVSRVHV"
FT   gene            complement(386925..>388791)
FT                   /locus_tag="MICPUN_64482"
FT   mRNA            complement(386925..>388791)
FT                   /locus_tag="MICPUN_64482"
FT                   /product="predicted protein"
FT   CDS_pept        complement(387007..388791)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64482"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI79"
FT                   /protein_id="ACO67812.1"
FT                   /translation="MKLGAATAGGLIALACAWTLVCVIAFTRVLEGVERRHGRSFDEAH
FT                   PGWASRNGEARIGGANGANPRPRRVGPFDGDDDGDDDGGDDGGPDGALATDSSGDCYPT
FT                   CDPDAARRLDYWLGHQGFRDAMAGPPILPRWEEFLAEQGPATHVVGGPDFHGEWESPPD
FT                   PMDVLNHWLGHTSFEAAMRGDLDGMEFDPHRRVWVREGGWMAGGRRAGSKPEGEWTVAA
FT                   RENARGGDPNVLARMDEAVREYERSHDRSVEEPARTAPPDESSSQLSSHPPGSDETKKG
FT                   HHERRRERRTGHKGKGPPAPFAGRIRVVIAATPTRREHLTKALLPALAAESESEPPIEV
FT                   VVSTSDTQLCGLLEADGAPMTRCVTHRGRVGAPLTPSERDFVKRIPGDSRSRFEWYWRE
FT                   TVDTAVALVTSDTAVEPAMTLFLEDDVVPTKAWETKLRRLIAPYSSSVDGRTCEFDVFV
FT                   LYAEGLVQVDDGERGRFAANTQAMLFCPGMATRFAEAMLDRLGDAPPDWLVRDISAGAV
FT                   DDGDEPDDGAVGTPPRPHVIRFANPPLFQHGCEHSTLREKAGEAGANVRAMSTHRSRSF
FT                   REPAIGCVRHARQGGGGA"
FT   gene            <389130..>390827
FT                   /locus_tag="MICPUN_104359"
FT   mRNA            <389130..>390827
FT                   /locus_tag="MICPUN_104359"
FT                   /product="predicted protein"
FT   CDS_pept        389130..390827
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104359"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI80"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI80"
FT                   /protein_id="ACO67635.1"
FT                   /translation="MDSPDEDAWHRVVVGAGVAGVCCAEELARLRPSDRVTLVAADDAL
FT                   KAVTNVERVTRNLETFDVQNRPHSALAYPNLAVVRGVVEACDPGESTLVVRPFDSNSTA
FT                   ANTTETIAYDQLCVCVGAEPRRALDPCDRSADPHGVYDEAAVAVRDTESVEDLRERLGE
FT                   GARTVVLVGNGGIAMELVQALCWDEEPGAEGGAEGGAEGGADDDAPTLVWLCRHPAIGD
FT                   AFFDRDAAEFLADAVRSRTTAAGGVPSGVPSGVPSGVPSGVPSGSSSTTTTNDDDANDG
FT                   EHKRRRVRRGTGSRGGAAGPDWTRRLHRNQSSKGRRFRLRVRTDASLTRVERAGPRGGA
FT                   DDSNRTRGPYVAVLGDGERIEMDVLVSAVGVDPAPRVRWLPEGSFPRGADGGVAVDRAF
FT                   RTMGPHGHDVYAAGDCASCELREGGRSGGAAAVPWFQMRLWSQARTSGTFVARVMCGEC
FT                   DDDAWGFNYELFVHSTSFFGARCVFLGLYNGQLLDDVDEKDVTTYSRRGDGSFARVLLV
FT                   RGVMRGAVLIGDVESAETFENLILDGIDLSRFGPTLLDPEVDIDDYFD"
FT   gene            complement(390841..391789)
FT                   /gene="LI818R"
FT                   /locus_tag="MICPUN_105009"
FT   mRNA            complement(390841..391789)
FT                   /gene="LI818R"
FT                   /locus_tag="MICPUN_105009"
FT                   /product="chlorophyll a/b-binding protein"
FT   CDS_pept        complement(390990..391754)
FT                   /codon_start=1
FT                   /gene="LI818R"
FT                   /locus_tag="MICPUN_105009"
FT                   /product="chlorophyll a/b-binding protein"
FT                   /note="Chlorophyll a-b binding protein L1818, chloroplast
FT                   precursor; has high similarity to fucoxanthin chlorophyll
FT                   a/c binding protein; chloroP and targetP do not predict
FT                   cTP; role in light harvesting not well established;
FT                   GO_component: GO:16020 - membrane; GO_process: GO:9765 -
FT                   photosynthesis, light harvesting"
FT                   /db_xref="GOA:C1EI81"
FT                   /db_xref="InterPro:IPR001344"
FT                   /db_xref="InterPro:IPR022796"
FT                   /db_xref="InterPro:IPR023329"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI81"
FT                   /protein_id="ACO67813.1"
FT                   /translation="MACICALNVVAKAATTGNIKIQPGKKYADIKEAVKSGAVAGCAPF
FT                   PEGVDAFGFFNGIDAREAQRYADVEITHGRISMLAALGFLVGEQVEGSSFLFDSQVTGP
FT                   AINHFQQVPGLFWGLLGATIFTIEASRVQYAWQNPFDADKLFLLKTDYTPGDYQFDPLK
FT                   LSKGKDAAWLNDMKLKEINNGRVAMVAISGMVAQELVNGLNLIPADEVLEMGKEGALLA
FT                   LEKQCAGAPDEAACAKAFEAAERAAVFAADKL"
FT   gene            complement(<392476..>392763)
FT                   /locus_tag="MICPUN_98372"
FT   mRNA            complement(<392476..>392763)
FT                   /locus_tag="MICPUN_98372"
FT                   /product="predicted protein"
FT   CDS_pept        complement(392476..392763)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_98372"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:9055; iron-sulfur cluster binding -
FT                   electron carrier activity [PMID 51536]"
FT                   /db_xref="GOA:C1EI82"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR018298"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI82"
FT                   /protein_id="ACO67814.1"
FT                   /translation="MLEVAHKNDIELEGACEGSLACSTCHVIINDQAVYDALPEPDDDE
FT                   NDMLDLAFGLTETSRLGCQVIAAKELDGMTLSLPKATRNFAVDGFVPKPH"
FT   gene            <393327..>395896
FT                   /locus_tag="MICPUN_104362"
FT   mRNA            join(<393327..393395,393560..>395896)
FT                   /locus_tag="MICPUN_104362"
FT                   /product="predicted protein"
FT   CDS_pept        join(393327..393395,393560..395896)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104362"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509 - calcium ion binding"
FT                   /db_xref="GOA:C1EI83"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR008907"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI83"
FT                   /protein_id="ACO67636.1"
FT                   /translation="MATAHVVTTSLSALLKDAEVLQNALGSETAALNVSLAQARQILAP
FT                   DDPPFENPELDRLMKEAAAREKERRNSGGFDGRQRRSSNEKTPAAEITKASSLKVSAGK
FT                   AAFGTESLQEAFKRYDVDNSGYLDFGEVSVALADMGCLEGVLASKAGELFDDFDVDGDG
FT                   QVDFDEFEELAARVKELKGSVNQRPAPEVPAGFAESAAALALRRSFEAFAGYGSGGNAG
FT                   DGADAVTGRDWAKLVRDCGLIGGSVNKASCDIIFARATGRNSRTLRWEDGTFLQACAHI
FT                   AAEHRVTFGQVASRISQCAPQATNPGASASASAGAEERNAAAAARAAAESANGPVPGPE
FT                   ATSPGALRSIFGQYLAASGEAGAQALAPVEALHAYADLGLLRCVALDAAQSAVTAAVAA
FT                   SEGTPEANATKAASANGASTSSLVSPAPFAACAKKLAALQSRSAYKAPDVVELIGEDRR
FT                   RMLAAFEAFGGSKHGMRPEAFEATVRACGLIGAKVTEGTAAVIFAKCKHLAGNKSMVPK
FT                   VMTFEGFAQAMAHVASEYSVKFEVVKDRVFKCTPRTEAQKAQETAEKARKEAAKKAAAV
FT                   AEANAPVRKPWESKKNNDRAEAEARAAEAAEAAAAAAAAEAAAKAAADAASADPVQAPL
FT                   SNPCDVPGEAYTDAELIAAYEAFATHTQRGTMSVDAAGWNKIVRACGLVGGALTDAVAT
FT                   RIFDESGARSHPTGRMHFAEWVDALAVVGGTHGVMFKVVEARVKSVAEKQKAAGTASRP
FT                   IQVVEAEAPPPPAAPAQATAAAATDAGATKKKKKKGMFGSMFSSKSKK"
FT   gene            complement(<395973..>396935)
FT                   /locus_tag="MICPUN_88760"
FT   mRNA            complement(<395973..>396935)
FT                   /locus_tag="MICPUN_88760"
FT                   /product="predicted protein"
FT   CDS_pept        complement(395973..>396935)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88760"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI84"
FT                   /protein_id="ACO67815.1"
FT                   /translation="FREEMSKPDEEIDLARAAGYVAMHRRPDESRVADAVEELDVLAAE
FT                   LEATLPPPEQRFPLRTLKAISRYMFHTLGFKGNQEEFYDPRNSCLDEVLARRTGIPITL
FT                   ALVYMELARRVGVPMVGVNLPAHFMIRPVVEDMEVLVDCFNDGELKFVEDVEDMLKKFY
FT                   TMGEADKLTIDRSFFADNSMKPRAFLTRMLTNLKQIYFNNDEFAAALQIVAYQAHCAPD
FT                   EKVALFNRRDGGICLFLMQRHAEAAEELSGFLAECDAKGMWDGDGNPSARAQILQMIEH
FT                   AKAQVARESVKRSVEDALGESGDGEDDACGDDPKARDDP"
FT   gene            <398330..>399733
FT                   /locus_tag="MICPUN_64488"
FT   mRNA            join(<398330..398396,398559..>399733)
FT                   /locus_tag="MICPUN_64488"
FT                   /product="predicted protein"
FT   CDS_pept        join(398330..398396,398559..399733)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64488"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI85"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI85"
FT                   /protein_id="ACO67637.1"
FT                   /translation="MAGDISLTNTDTAGVVIFGLIMGALHVLMGADHLIALAVVASPGA
FT                   PERKPRRDVESRGGDHRDGDDDDDENRDAERDRPGMRRALRAGMLGVQWGIGHALGLAL
FT                   VCAVFFATRRRMNLDDFGDYADKAVGASMIALGLISLWHLRRWRTRRERERAHIVDERV
FT                   AGAGDPEVHDDVASASASQLAASQLASSRHASPAHVALVLEAGSEEHAAAHDMRLPHIH
FT                   VPRGSSPSSPSSSPAKPASSQRAAAERVTSPGGAARFGEQKIDDESKAEVESSTDDKSR
FT                   RGWSMSIGLVHGVAGPSGILAVLPAVVLADAGKSAAYLVAFFVASATAMGAFAAIFGYV
FT                   TDLAVRRQMDDDARHDGCEDVGAVVSRDGRRVTRATDAATRVAMGLNLGAGVLAVAVGT
FT                   LWLALSGLGLLGSL"
FT   gene            <400662..>401342
FT                   /locus_tag="MICPUN_73186"
FT   mRNA            join(<400662..400789,400961..>401342)
FT                   /locus_tag="MICPUN_73186"
FT                   /product="predicted protein"
FT   CDS_pept        join(<400662..400789,400961..>401342)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73186"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002800"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI86"
FT                   /protein_id="ACO67638.1"
FT                   /translation="LAMARGAMAPLLAAPWRLMLLSDGSVTRHLQLLTDAKVVVDVLSM
FT                   EPKGTTTIDSCTHLLHREVDLCDGRDGTPLVYASSWWTPEAAERFGILRPDGAATERAV
FT                   WMHLSERRTELFREVRRLYRGASPALEEAWGEVGPYWGRHYVFWAGEVPLCVIYEVFSP
FT                   RLGGFLG"
FT   gene            complement(<401720..>403162)
FT                   /locus_tag="MICPUN_66396"
FT   mRNA            complement(<401720..>403162)
FT                   /locus_tag="MICPUN_66396"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<401720..>403162)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_66396"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR006597"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI87"
FT                   /protein_id="ACO67816.1"
FT                   /translation="ALDLFRRAAKLGDPGAHEELGFAHATGWAGAAENPALAVTHQYFA
FT                   AMGGDPRGQMAMGYRHLHGLGVPKSCATAALYYEAPASRLIEIVRDPAAGPTPTVEKTR
FT                   LTPDTEGGDGGTARERDVVQYYQYSADMGNADAATAIGRIFAAGAKGLRRDRRRAYRYF
FT                   TQAAAAGDADAMSQLGHLFANGLGVRANNATAIGLFKAAAEKGNANAQFGLGYMHLAGF
FT                   GVERNEKKALNYFTKAAEQGSAEAQFHVGAMHAKGVGVRRDYTKAFYNFNLAAHQGHAV
FT                   ALYNLAMMQLAGVGLPASCANAVVLLKGLAERGPWNRRLESAHGAYRTRAYQKALVKYM
FT                   KAAETGVEVAQSNAAYVLEGAKERWDPDWSRDWWDGEERERRAIHYHRLAADQGNVRSL
FT                   LRIGDAYYYGVGVGEADRNKSAAVYLQASQKRSAQAMFNLGTMHEHGLGLPKDLHLAKR
FT                   YYDMVLSADPKAWVPVKLALWKL"
FT   gene            complement(<403880..>405295)
FT                   /locus_tag="MICPUN_64491"
FT   mRNA            complement(<403880..>405295)
FT                   /locus_tag="MICPUN_64491"
FT                   /product="predicted protein"
FT   CDS_pept        complement(403880..405295)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64491"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI88"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI88"
FT                   /protein_id="ACO67817.1"
FT                   /translation="MASRLSASPPVGRGFTAPLRRRPSSGSLAATADQAPAAPVALRPA
FT                   SSMTADDSVGASSSVLLVGLGDPVSDILVRLDDPSLAARVFDACGISEPGGCVPVDSDE
FT                   DIKSLLAACGEQWITGAGELETPSRSFSEDVPAQGVEPTYCPGGSAANVAKGVANLGGD
FT                   AAFVGMIGRDDIGARYRELLRSQKVTPVLLEVDVDANDPGATPRSAQCLSLVEKGGQRT
FT                   MRTYLGASLKMGASHFDENVERLAFGDDASPDESKAKSRSDDDAVPGHTRDRASLLHVE
FT                   GYTLYRPDLARAAMTAAKRRGALVSLDLASFEVVRNCRSQLVELLNEGLVDLLFCNEDE
FT                   AAELIGETRAPDAFAREDAGRAMEWMLRYVRVATVSLGARGCVSVDRDGSRGVSPGVRC
FT                   NVVDTTGAGDSFTAAFLWAYLRGGSLQACCACGCAVGTAMVQVLGAELAASRWGELRGD
FT                   LETVLRRDREPGT"
FT   gene            complement(<405507..>408083)
FT                   /locus_tag="MICPUN_104365"
FT   mRNA            complement(<405507..>408083)
FT                   /locus_tag="MICPUN_104365"
FT                   /product="resistance-nodulation-cell division superfamily"
FT   CDS_pept        complement(405507..408083)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104365"
FT                   /product="resistance-nodulation-cell division superfamily"
FT                   /note="Niemann-Pick type C1 disease protein homolog;
FT                   GO_component: GO:16020 - membrane; GO_function: GO:8158 -
FT                   hedgehog receptor activity"
FT                   /db_xref="GOA:C1EI89"
FT                   /db_xref="InterPro:IPR000731"
FT                   /db_xref="InterPro:IPR003392"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI89"
FT                   /protein_id="ACO67818.1"
FT                   /translation="MDKASIKAVPDERSTFERFADNVNHALTGGFFRLGYSVAKNPYKY
FT                   ALGSFLICLMLTVGIFAPGLTNENRSDKLWVPSDTQAQDDNKYVSQFYGAEARFGEVIV
FT                   KKAGGGDVLDPAVFAAVKTLVDRIEATSMQWDGATIGWQDQCLKIGAACAISHPIQAFA
FT                   TAADYDTRDEIVQTVNGGAGSYKNLATGQPLNLDGTIGGQVLDANGKVTSASAVRVGFL
FT                   TKIHETIVDGDEVDERGDAFERKLLDVFEAGIPGVELTFIVSRSFGDEFGAAIQSDLGL
FT                   LQAAFMLILAYAALMLSRWDEGCVGSRVAVTFSGVVSVGMAIAASYGFCSYIGLFFSPL
FT                   MNVLPFLLLGIGVDDMFVIVNQYDHMDPTLDPATRIGRALASAGASILVTSATDVFAFL
FT                   VGSNTTLPALRNFCFYASFGILFIFAFMVTWFVAFLVLDERRRARSQGDVICCFVTKNQ
FT                   ACCACCAPREDKRTRMERAFGDGLGGQLVKPWVKGAVCVGFAAIAVGGFIGCSQLEIDA
FT                   DVNDFIPAGSYVKDWFSDTNAYFAKLGDSIAVYSRDMDVHTADGAALMLAASTAFKADP
FT                   YVAETSVSSWIESFNAHRGATGAFALADLHAWTTTVGSSGMPFKGDIVWRNETNNVPNE
FT                   GIISTRMRGNHVKSYKSDDKVKSMDSLRDSLEAVPGNGAGNVFAFSDSWLSYEQYKSIA
FT                   SEATRNIASTMAGMVVIIAILLISPKAVLIVCLCLCLIIINIMGYMHFWGQTLDSVTII
FT                   MLIIALGLSVDYSAHIGRAFMEHRGTPDERLKNSLADMGVAVFNGAISTFLAVIVLSSS
FT                   ESYVFVTFFRQLFLCIVFGLGHGLVLLPVLMSLFPPKPFDAPAHLQ"
FT   gene            <408628..409734
FT                   /locus_tag="MICPUN_64493"
FT   mRNA            <408628..409734
FT                   /locus_tag="MICPUN_64493"
FT                   /product="predicted protein"
FT   CDS_pept        408628..409731
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64493"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI90"
FT                   /protein_id="ACO67639.1"
FT                   /translation="MIALLARVAVILCVATPRAAATETWEQRLRRESIKVDGDEVTTMS
FT                   VEALQAHIARHALDQEPREMSGPWVDDPAANDEDAKMMLDVDDAATTTSSRGPAPVPAS
FT                   RCAPPGANQLVKRGWQYNAWKYYPAPIDVATAPVYYSVGVGRDLTFDAALLRAHPNLEA
FT                   HAFDNTPVASQFVKALGRAGGVPTRWRWHELLLSSRDLREIEVALPKGRSDSFTPASTD
FT                   GVYHDLGGKGGQTRRVIGVNERADGRAKKLPARPLWRVMETLSHAYVDVLKVDVEGAEF
FT                   DVVDAWEAYYGDRGPPACQLLFEWHERFYPNGGGHASADKKSQTTSGRGLREGAEAALS
FT                   RMGFKKVDCDGSECVYWNCNRCPSLEN"
FT   gene            complement(<409787..>410773)
FT                   /locus_tag="MICPUN_104367"
FT   mRNA            complement(<409787..>410773)
FT                   /locus_tag="MICPUN_104367"
FT                   /product="predicted protein"
FT   CDS_pept        complement(409787..410773)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104367"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8146 - sulfotransferase activity"
FT                   /db_xref="GOA:C1EI91"
FT                   /db_xref="InterPro:IPR000863"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI91"
FT                   /protein_id="ACO67819.1"
FT                   /translation="MGGVDEAAMTPLELMRHRNGLMHSESSVANGRGFVPRPTDVFVVT
FT                   YPKCGTTWTTQICHQIRCVRAGRDDPSMDAMAFGEITQVVPWDILTLDCDQDLDADHVC
FT                   DPRVFKSHERWEDVAKGAKYLCVVRNPVDVFYSFYNFLPAYMGIEPGAIAPEEFADAIF
FT                   AGASHSGHCWQHFLGYLDARDGDEGKGEGKGEKIMMICFEDLKEDLPRCVRAIASFMGF
FT                   HDMTPREIDRVVHASSFEFMRANATSFDDHFVRRKMWARCGIPESDWRGGGVGKVRHGG
FT                   GCVGGGVIGMSEALRRRIDGKWNEVMRPRGFATYDDFRAAVNKVNTR"
FT   gene            <410932..>413361
FT                   /locus_tag="MICPUN_64495"
FT   mRNA            <410932..>413361
FT                   /locus_tag="MICPUN_64495"
FT                   /product="predicted protein"
FT   CDS_pept        410932..413361
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64495"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI92"
FT                   /protein_id="ACO67640.1"
FT                   /translation="MRPAPRGDRLHLWRVAEVAASLQAAVEPSFGPRYTDEDDDDAGLG
FT                   RKGWSGADALESTRSAHPAAALIARVVRQHADKCGDGSRAMVGAIAAGLRRAAEACGDG
FT                   PPDGPVARERRARLVNALVRLSRGDAAAVLFETLTRVAVVVPVPRHGRWARRRSGDAGA
FT                   ADDDGGTRWWHRDDAFRAAARSVAGTVIAGAVASRETRARLASVVASLVTNTLRAASED
FT                   DGAFEDDDDTAGGDTDHAAFVHRTLRALASDPPLVLAPGDGHHPRAGQSRSCVVEGVLV
FT                   RRNGRNGRRARVPGVDGECGVVVMYRTAPTDELDDRYDRYDAPTRVELACSETRLAGWR
FT                   RESAAQRAGVLARRRVRLVFCTEEAGDDAVDSFAENGIEIVQGVSELDALRVCRVLRVL
FT                   PCTSSLPNALETCDVGIVDGLSAQRIGGDAFAYLRTDRAFTGIIHGVDFVQARAARNLV
FT                   ARALAAVATASVPSVHPVAELAGEEGRAGAEGGAEGADGVPRGGSLTLVPGAGAADSCV
FT                   VAAVKERLDELRAGNMLRTRDKDGDGGFLPPADAAATTAAWEVLLATARACPAMLASSA
FT                   CDRRARRYRDEDGGGGCDDDDDDDAAASIVVRTWPPVDDRQRSDVAAIPVPSFRDHSGS
FT                   RSVKTRSFSAARLVATLHAVNASAMRSTDRRVPCVGLLVPGASCEAFVPGTASAMFDEP
FT                   PIPDALVRAIETGERRYTESTQLADPGKASTFEALAGKYAALIGALDVVTALARIDAVL
FT                   PVTRGVSVAAFSRTFGARRLRGSSFEGAEGAEGADSDGDGASSYAEDGDDTDFDDD"
FT   gene            complement(<413442..>414602)
FT                   /locus_tag="MICPUN_64496"
FT   mRNA            complement(<413442..>414602)
FT                   /locus_tag="MICPUN_64496"
FT                   /product="predicted protein"
FT   CDS_pept        complement(413442..414602)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64496"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI93"
FT                   /protein_id="ACO67820.1"
FT                   /translation="MSTIGASLERSGLGVDPVRIVSRRRTAKRAARSTPAAASGGDRIS
FT                   DVTAVASQTSQQPSRRVALASIVLAAASVGDVRDPSAIASTSEPIVGDCPECVGVVNDL
FT                   LNSCPPETEACVSSQDDDEYHFTAPWAYPGDRATAMRRLVAVATGAETGRIAGEASPGA
FT                   DAGASIDVYGRDKREVAEFIVGATGAFIRGGGRDSLPPKPPIRGAPSRGGGGMGVGLVG
FT                   KVFGADDAGAGSISATAVRVAAYDEAAGYVRLVAGGDTAGGDVDTAVARGDVDTAGGDL
FT                   GTFDVELLFWDDDEVVNVRVASRDAPTNGRWSLSYVDGVRFNKNAARDLAEALRISLGW
FT                   EVLPVISEFDPRFNNGKRLWFEKALSPFVDPSVMDAPRGGKGPYSR"
FT   gene            <414802..>421017
FT                   /locus_tag="MICPUN_64497"
FT   mRNA            <414802..>421017
FT                   /locus_tag="MICPUN_64497"
FT                   /product="predicted protein"
FT   CDS_pept        414802..421017
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64497"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI94"
FT                   /protein_id="ACO67641.1"
FT                   /translation="MWDLEGDDVVPESPRMRACRGGLDLGRSEVPSTKRSPAGRHRPLR
FT                   DVTNATHEPDDVVAESTDEDDDEDGDHRGGVGVVMGAAMDARRLARQRREGDVTVVDDE
FT                   VVIVHETMLADHDADATAEDDPLARFAAAPIPTEDDPGPATAAPTRRQNNLRLRPNAKK
FT                   RLAAAAARRRFASDDSNDDDSCDDDVRDRAPPPSNGDPPPRAEDFDAGGGDDDDDARFE
FT                   VDDAPVSEHSDGSQERTAGVKGLRMTELLGDGYGKGMRRRRGEGGARLTVADLIAARRG
FT                   RKPLLDPPSSDEEEEEEDARKGDAREEDARKEDAREEDAKEGNVREDVRGDDDDGEEDD
FT                   CDAYDDDEFSAFSRPPMDQEADIRADDGRVFAEELLAAARPRAEPRDAASHRRRRRRQG
FT                   RLDAFLSMNDDNKEEEEEDGEDGKDAAARRTRPARDAATNSSAPSTRTAVHDADEPARP
FT                   APAPRRFPHTLDSGSMINADEFNDAGTTADGERTLRVACALFKAGRRADGTATPAPTRA
FT                   ESIEWRRAVSFYTSGDGSSSVFTGGDATKSKGAFWRALRRIVADAFDDDERTGERHDLD
FT                   ERYDPAAAADAERGGDPSIACQGDRLFESPAAAQARRGELGWELLFRAAATWRAAGLET
FT                   ADGDDANGEDAWSKHAWDLVSDVLARSPLPTPFGSSRAEPEGIEKGARLREWRHRTAAG
FT                   SGPRGESIRPLDDGGFDPRAYAAAVADRVATLVREWPYCRGGSSSPVWELWRRLFVSSG
FT                   GVSAVTTTSKEPRIDPAGATWPLPSRTDDGIARAAVSTRGGIDRAITTTCACCDLATPD
FT                   NALRTADELGSGSRGPGAWLVPSNGACARATRALASHLAKAPEAKDLKRDLGRALQSAS
FT                   LLHAVKEHRGKTSMHSLAAEGGCVGAGSRRVVGGGGGGLFRAAGGASLRLTPLAADLRH
FT                   RAATHVLLFAACLDAGAIDQAGVCLRQLCAPLSCSNKGSNCALPAASADPAARAVAVRA
FT                   VGCAADAWIQRGSSLNEAVLQKNGQKTHLGRLAREGEAALAALAAEAVRAREDAADRRR
FT                   SSSSSLEDGEGVAAAHGAVVAEAAEAAAWMHAALVSCGACQRGAAAAQARFCEPELFRA
FT                   VGAGVESSKGNDDARVDDERYSAGCWRSRLFAQRALAALLAPGPPHLATTCATRGVHET
FT                   LGDALALWALGAGSDARAGGSGALASALFSHPAAMELAEGAPPSGPGAARVLRLRRAIG
FT                   DAAGGLWEGDDHPTRRALRGATGAGFDLLNPTGSQLDAFFRSAPGSLASREEGEFRVSA
FT                   GALVSRQMRAYGVGAWGCAMACAARLPRAARVSHDELSSVGGFAATNGGVGADLRAARH
FT                   ALASCAAGTVRWLVDLIARLPVGEIPGSIPRGVERIVAEEPVLAATAPHPCPARSPAWG
FT                   GWTVTTVTNVTTAAAASDSLGARVAALLHRDGGPRGSTCAAIVAATAKRFAVVRDASVD
FT                   NPTRGSPASAVVTPSGTRDFAAATAGLIEGVLDDDDGGAVAHLAAALVEPDVPALAAQF
FT                   FASELLPRFLARELRGTSQRRCARIWLTAIALLERLAREPEPDPDPDPDRGGVSPLGVC
FT                   AVLNDVLPAAATAMLELVVSSCGDGLDHQATAAAAALFEYVGARLEEAAARDDVIGRGV
FT                   TTPAPVPSVAASVVAAGEDGGESRRKKRRRMMDTSGPVGRRRPAPAATAVGYFPFPGAA
FT                   AAASYFPFPGAPAVTPAEKQEEDDEDDEDDEDVEDHEDEVSVQERARADAQALRWRLQS
FT                   TKRRRADEVACAFAASGAASGPCTSDAFKLLASCVSCATAVVCVVALAAPVTDSPTGGG
FT                   GAFRHMSGATERAREISRHRLQLQRELKRCRGEVEAHATELTRRRFGCGLRSAPNPPVG
FT                   SYGRGAAAGGEIFWGAEGPVPRGAHRVNELWSEPRSRLAFASDAACSLLARASRVCSGV
FT                   GAGVGAGVGASSGGSERRGFERATRDLLVAKAGALASAAALLAEPEASTAAGSKRVPAL
FT                   VDALGRCGVGGGSGLRERLPPRAASSGANGGFGGVGGRASSLRGGGVSSVRPETRPRGA
FT                   GGSGVAFRPFGSRGGGARRH"
FT   gene            complement(<421093..>421992)
FT                   /locus_tag="MICPUN_64498"
FT   mRNA            complement(<421093..>421992)
FT                   /locus_tag="MICPUN_64498"
FT                   /product="predicted protein"
FT   CDS_pept        complement(421093..421992)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64498"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491 - oxidoreductase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI95"
FT                   /protein_id="ACO67821.1"
FT                   /translation="MSTLVPPNVPNVVLKSRQYPLARHPPSSMVVAEKRDKTLCVLITG
FT                   ASRGIGLELVKQYLLRVGRGNYGRGGHVIACARDPDKSMDLLRCFTVDYVSYELVPLDV
FT                   TDPGSFGDLHEHLQDLDRIKEMDGVAQKIDIVFNNAGVALGRDCSLGTVDYDAWRTSFD
FT                   TNVMGAVRVVETVLPHLADDATIVNVSSGLGSIGRVANGGFNTLTQDVIYRSTKAALNM
FT                   TTACCAAELRARAPDKAMKVVSIDPGWVNTDMGSRGGTVKPPLEPEQVVRGMIDVVANL
FT                   KPEDSGKFLSWEGEEMPW"
FT   gene            422227..423210
FT                   /locus_tag="MICPUN_109574"
FT   mRNA            422227..423210
FT                   /locus_tag="MICPUN_109574"
FT                   /product="predicted protein"
FT   CDS_pept        422444..423130
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109574"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3824 - catalytic activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EI96"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI96"
FT                   /protein_id="ACO67642.1"
FT                   /translation="MPTSDQVRLFCLDRDGVINKDVGVPGVVDVDDFELLPEAARAIRS
FT                   LNDAGVSVCVVTNQTAVGKGLLPESTLNEVIHPAMRRMLHDEAGASIGSIFYAIKPRDV
FT                   PCDRRKPAPGMLVEAMNEHGCMDVYYGCIMVGDTVTDMQAAARAGARRALVCTGHGEAM
FT                   GAALAARNVELPCRISMRCDDPTMSFPDECFPMDVYASLGHCVDCVLAESSYQWSARAV
FT                   YDSLTQ"
FT   gene            complement(423184..424774)
FT                   /locus_tag="MICPUN_96004"
FT   mRNA            complement(join(423184..424142,424439..424774))
FT                   /locus_tag="MICPUN_96004"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(423258..424142,424439..424741))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_96004"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622; ribosome - intracellular
FT                   [PMID 5840]; GO_function: GO:3735 - structural constituent
FT                   of ribosome; GO_process: GO:6412 - translation"
FT                   /db_xref="GOA:C1EI97"
FT                   /db_xref="InterPro:IPR002136"
FT                   /db_xref="InterPro:IPR013000"
FT                   /db_xref="InterPro:IPR023574"
FT                   /db_xref="InterPro:IPR025755"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI97"
FT                   /protein_id="ACO67822.1"
FT                   /translation="MPAALPTVAVQGSADTVQLPEVFLSPIRPDIVNAVHTGLNKNNRQ
FT                   AYAVNKRAGHQTAAESWGTGRAVSRIPRVPGGGTHRAGQGAFGNMCRGGRMFAPTKTWR
FT                   RWHRRVNLKQKRYAVCSALAASAVPSLLMARGHHVESVPEVPLVLDDSSEAITKTAKAV
FT                   KLLQEVGAYADVEKVKASRNLRSGKGKMRNRRYVQRKGPLVVYANDSGITKAMRNIPGV
FT                   ELCSVDRLGLLTLAPGGHVGRFIIWTKSAFEKLDSIYGTSAVKSSAKKGWKPPANIMAM
FT                   PDLSRVINSDEIQSAINAPKEGKTRAHAPLKRNPLKNKSAMERLNPYAKVAAEMRAKAE
FT                   AASSAAKAKKTAGARSKVGQAFYEGMKKESNYEGELFDGFATWLKGKPSEEEEEA"
FT   gene            <425076..>426845
FT                   /locus_tag="MICPUN_104371"
FT   mRNA            <425076..>426845
FT                   /locus_tag="MICPUN_104371"
FT                   /product="predicted protein"
FT   CDS_pept        425076..426845
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104371"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16868 - intramolecular transferase
FT                   activity, phosphotransferases; GO_process: GO:5975 -
FT                   carbohydrate metabolic process"
FT                   /db_xref="GOA:C1EI98"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR016657"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI98"
FT                   /protein_id="ACO67643.1"
FT                   /translation="MDVDAFVAASDAYPIPTSPDGAPIRFSYGTAGFRTRGDVLASTVF
FT                   RCGAVAAVRSAVTGRATGIVVTASHNPERDNGVKLVDCDGGMLPVAWERHAEALANAPG
FT                   WDAMRAAIATMRTPAEAHLPKHAHPPAHAADPPPPHVFLARDTRPTGPALAAAAKAGAE
FT                   AIGASVTDLGLMTTPQLHYVVYASHRGWPSAEADYFARLARGFRRMVAGGTNDDDERRS
FT                   IVVDCANGVGAAKLAALAEAIGQSSSDGCVLSMDLRNVAGESGSLNNSVGADYVQKEKR
FT                   APAHGSFETLGPSQRCVSVDGDADRLVYFRKKPDGSNENSVELFDGDKIAALVATRVAD
FT                   LLRRCAPLNAFDHPPLRVGVVQTAYANGASTAYITNVLGVECACANTGVKFLHPEAEKF
FT                   DVGVYFEANGHGTAVFSDATIERIDAAIERVDAGADGGGRSSIEQCTDAVAALRELKAM
FT                   TEAINPAVGDALSGILVVEAVLLAKGWGLTEWGNMYADLPSRQVKVTVLDRSVISVTNA
FT                   ERVAVTPAGMQAAIDQAVGRHGAHARAFARPSGTEDIVRVYAEAATEAGAAELAREVCG
FT                   IVYDFAGGVGDRP"
FT   gene            <427063..429829
FT                   /locus_tag="MICPUN_106563"
FT   mRNA            join(<427063..427166,427309..429829)
FT                   /locus_tag="MICPUN_106563"
FT                   /product="predicted protein"
FT   CDS_pept        join(427063..427166,427309..429793)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_106563"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EI99"
FT                   /db_xref="InterPro:IPR000008"
FT                   /db_xref="InterPro:IPR031468"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR039010"
FT                   /db_xref="UniProtKB/TrEMBL:C1EI99"
FT                   /protein_id="ACO67644.1"
FT                   /translation="MSRAWAASGALLTVENLGMATIVYAVAFVAFWLGWKIRSLRPPKR
FT                   ERFSTTAHVIRALNDETYDQSILTQANLAKICGQLPKWITFPDKDRAPWLNRAAQQWWP
FT                   FLNRAISNSVVGAVEPILNKLVQGSPIKNLHFSKFTLGTEPLVFASVACVDDVPNEVGL
FT                   DIEFKWVAKEPEVQLDVSLLGMVLPIAIDKLEAFGTVRIVFGPLCDWWPAFSDMQVAFI
FT                   GKPKIDLDLRLIGGDITKFPVVERLLMNLIKNVLTKLMTWPNRLDIQITEDQGARCTAR
FT                   AGIVRVTVRRGANMSRGSALGGSVFSTKATPAVEIVAIDGEYGAPKTTRVTSSWRHSGE
FT                   DPAWEETFEVFVRDARHTVLNMCVVDTDAIAAPSMGSVKRAMTMSSKYRKKNVERDSDG
FT                   DGDGDDSETDQGADVYNPAEVKVAGGKDAVKALRTDKQASSWKGEKALYKSNMSVMGRV
FT                   KFEVGQLYDSPGITLQETVPLKKTKSVGGKMLSAFSSVKEENMPKLTYACKFIPLDDDP
FT                   ELEEARMKRLAGITAKDLKNPDSEKVDVEDFCGVLHCKLLRATNLVSRDANGLSDPFVR
FT                   CSFGRQIHKSSVKYETLHPVWDETFDFIVGVDDVYDSRTIECEVWDRDPYGVREYMGKV
FT                   RVDLIALLLRIKDLPPAAGQAYTKTLKINEEISEAASGRLEMEFQFYPAKGYAQGLSRS
FT                   AIGSRRQRRSGNEAGGGLTIDAGGSDGGTPATSGGLSPSNSLRSPASRRGMLALAEDFV
FT                   EREGTLSVDATDGKMLDSEIKALRKEKSKVDRARAKKEGGGCCSCFGGKGKKGKGNGGS
FT                   LRGKANGDSSGNDFLARIEEVAPDTPDSPAESVFQELPSPRPSEAEGDRL"
FT   gene            <430880..>431152
FT                   /locus_tag="MICPUN_73804"
FT   mRNA            <430880..>431152
FT                   /locus_tag="MICPUN_73804"
FT                   /product="predicted protein"
FT   CDS_pept        <430880..>431152
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73804"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002068"
FT                   /db_xref="InterPro:IPR008978"
FT                   /db_xref="InterPro:IPR031107"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA0"
FT                   /protein_id="ACO67645.1"
FT                   /translation="YVITADIPGANRDMVEVSVDEDRVLHIVDERADRHEERGGSDEDG
FT                   AKYVVYNRSFGRFERNFQLPQDVEDGAVDATMKHGVLVVRLPKKKE"
FT   gene            complement(431531..>433560)
FT                   /locus_tag="MICPUN_64504"
FT   mRNA            complement(join(431531..433137,433393..>433560))
FT                   /locus_tag="MICPUN_64504"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(431668..433137,433393..433560))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64504"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5737 - cytoplasm; GO_function:
FT                   GO:3824; GMP synthase (glutamine-hydrolyzing) activity -
FT                   catalytic activity [Evidence 5524; tRNA
FT                   (5-methylaminomethyl-2-thiouridylate)-methyltransferase
FT                   activity ] [PMID 3922]; GO_process: GO:6164; GMP
FT                   biosynthetic process - purine nucleotide biosynthetic
FT                   process [Evidence 8033] [PMID 6177]"
FT                   /db_xref="GOA:C1EIA1"
FT                   /db_xref="InterPro:IPR001674"
FT                   /db_xref="InterPro:IPR004739"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR022955"
FT                   /db_xref="InterPro:IPR025777"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA1"
FT                   /protein_id="ACO67823.1"
FT                   /translation="MSSPAAKKARRESGVGATGPDTVVVLDYGSQYTQLITRRVRELGV
FT                   YSVLLPGDADMARITSHNPSVIILSGGPNSVHVEGAPSVPDTFFDHCQAKGIPVLGICY
FT                   GMQLIVQLMGGEVKPADKAEYGRMPVHIVQESALYGEEMDPTQMVWMSHGDEAVKLPEG
FT                   FKCVGKSDAGAVVAIENAERKIFGLQYHPEVTHSERGFETIRHFLFHIAKVEAGWTMQN
FT                   VLDEQIAIVNQKVGPDDHVICALSGGVDSAVAATLVHKAIGDRLHCCFVDNGLLRYKEG
FT                   ERVMKMFKDHLHLPVTKIDDSARLLAKLKGVADPEKKRKTIGAQFIEVFKEYKDDVEKK
FT                   TGVRPKFLVQGTLYPDVIESCPPPGSDQKHSHTIKSHHNVGGLPKELGFELVEPLRMLF
FT                   KDEVRKLGLLMDVPQAFISRHPFPGPGLAVRVLGDVCADGALDTIRAVDEIYINAIKDA
FT                   GLYDKIWQAFAVFLPIKSVGVQGDQRTHSHVVGLRAITSSDGMTADWYQFEPKFLQEVS
FT                   AKICNEVKNVNRVVYDITSKPPSTVEWE"
FT   gene            complement(<433748..>435202)
FT                   /locus_tag="MICPUN_68238"
FT   mRNA            complement(join(<433748..433939,434018..>435202))
FT                   /locus_tag="MICPUN_68238"
FT                   /product="glycosyltransferase family 33 protein"
FT   CDS_pept        complement(join(433748..433939,434018..>435202))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68238"
FT                   /product="glycosyltransferase family 33 protein"
FT                   /note="candidate b-glycosyltransferase; GO_process: GO:9058
FT                   - biosynthetic process"
FT                   /db_xref="GOA:C1EIA2"
FT                   /db_xref="InterPro:IPR026051"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA2"
FT                   /protein_id="ACO67824.1"
FT                   /translation="RPRVQVVVLGDFGRSPRMQYHALSLADSLGADVDVVAYVGSEPRR
FT                   EVAIHPSIRMALIPPPPAWTNARHVPRIVALAVRVATQTAQMLWTTAVALPRPTHVLLQ
FT                   TPPCVPSFAVCWLVCLIRRAKFVIDWHNFAYTLMALKFGPSSPIVFIAKVYERMLGRLG
FT                   HAHLAVTDAMATWLDERWGIRDAVVLHDAPPEFFRPASVTETSALMRRLAPSLDASPAK
FT                   VPGDCCDAILVGGGDPLTTTTTGRGGARWREGRPALVVSSTSWTPDEDFGVLLDALTLY
FT                   DSVAGADANATTSRYPDLLVIVTGKGPQRAHYESRMRSLRLTRVAVRTAWLESGDYPTL
FT                   LGAADLGVCAHTSSSGLDLPMKVVDMFGCGLPVLAARYDVIHELVREDARFAGGSPNGC
FT                   LFGGAGELAAQLCGVLEGFTAGTSVAGEMRTRMRRELEEKGGGNRWRDNWERAALPVFS
FT                   "
FT   gene            <435480..>438368
FT                   /locus_tag="MICPUN_64506"
FT   mRNA            <435480..>438368
FT                   /locus_tag="MICPUN_64506"
FT                   /product="predicted protein"
FT   CDS_pept        435480..438368
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64506"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:3723; nucleic acid binding - RNA binding [Evidence 8270]
FT                   [PMID 3676]"
FT                   /db_xref="GOA:C1EIA3"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003604"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="InterPro:IPR036855"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA3"
FT                   /protein_id="ACO67646.1"
FT                   /translation="MSAIPATPAFEDETRAASPAAGLHPALTKNHAPRDDVPEKTTTTC
FT                   LFSSDEEPVGSTTPSNAEAPAPKSKRRRHRHPKHVRDAIKAGAAAASRVRSPYSPDPEA
FT                   EKSTGRGWENDSTAGTKIRTAETDATGDSAGKFICDDDWNLSHGRGSNTSKPAAIMSRA
FT                   GGLEVRVDRGRAAAEASRAREFGPKARWTCRVKRSPPKRGDETSRDRPPPHLRYAPRLR
FT                   SPDDDDDDGGSEPSLAPSSDDDDDDGWGPTVGLARKRHHSFNAVATAGAIAAAHERAAL
FT                   EAAHEALEALGDSEEERGTEDFPAPRAEEEKERVTDARATSTERVARERTRERRRSRSP
FT                   IRQIRVAARAKTLSPETRRGASPQPSRFSRRVSVTRGPQRWSPPRDRWHDRDARRRLSR
FT                   SRSRSRSPSPRRRHPSSWSPTHRRRDREDDWNPAGERNAFPYASRRDPYASPPRASPIE
FT                   RTCASDPRKATSSGLLQPRREEPYPTPPPRSESFPLPHWSTRTFGTVEAAAVQQTTGQP
FT                   MKFKSKLCEDWTRHGRCPAGDVCGYAHGASQLRDSVVPGFDPTNESHVRAHTYRACVHT
FT                   ALCHVSRSRVWVDEFADVFRYVWNTDLELPVRFGGVPYSMEEYLVRFMSPHTVRVFELD
FT                   GRAAVTLATPTFDEARRRETNDDDAFGVRRGVRGDGRENERPWAADDWSSDRDDRYDRS
FT                   NNLRRRDGDFFSADEERPRKKPRAIVVDRRDAWFIDTNGNNGLIIGAKGKTIKAMESQS
FT                   GANIDANSKAHIVEIFGRADAVRSARLMIEHKLGEFHKDFIGAATMRDLLNARRREPNR
FT                   STGARQSPHRQSPAADRGEDSRDSVTEPCATPIDNEQSPSRQERQSPMKPPAADHGCEA
FT                   CGLRFTDEKELRAHKLTKGHLSSIRAAAGFDSPKTLVEHKRPKCELCDVTCTSNVNLRA
FT                   HYAGRKHKEMLARREAEDRKTKAEDWKKKNSR"
FT   gene            complement(441105..441727)
FT                   /locus_tag="MICPUN_109578"
FT   mRNA            complement(441105..441727)
FT                   /locus_tag="MICPUN_109578"
FT                   /product="predicted protein"
FT   CDS_pept        complement(441164..441391)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109578"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA4"
FT                   /protein_id="ACO67825.1"
FT                   /translation="MVSGNLDLRVNATMRDLIRLVGRKLTVEGRTPVKEGGVENGSAVG
FT                   DESDLRPPGSPAARLARRPTFAEVCSPMPR"
FT   gene            complement(<441965..>442189)
FT                   /locus_tag="MICPUN_88847"
FT   mRNA            complement(<441965..>442189)
FT                   /locus_tag="MICPUN_88847"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<441965..442189)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88847"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002110"
FT                   /db_xref="InterPro:IPR020683"
FT                   /db_xref="InterPro:IPR036770"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA5"
FT                   /protein_id="ACO67826.1"
FT                   /translation="MSVALTRSCEHGCEDAVLVLLQHGAEHSRANGRGDTPLHVAAEAG
FT                   HLRCVEALLAAGADLTARNGDGKTPIAMSR"
FT   gene            <442538..>443078
FT                   /locus_tag="MICPUN_64509"
FT   mRNA            join(<442538..442645,442728..>443078)
FT                   /locus_tag="MICPUN_64509"
FT                   /product="predicted protein"
FT   CDS_pept        join(442538..442645,442728..443078)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64509"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIA6"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA6"
FT                   /protein_id="ACO67647.1"
FT                   /translation="MATGQFEMEPGEIDPYGYVIAAIGFACFTHFYGSIKVSLARKRFN
FT                   INYPKLYAESSDAHNVEFNCVQRAHQQTLEWLAMCQLLAAVNGMVFPKAAAFFLCIWTV
FT                   GKLLYIHGYSSGKPSGRHFGGMVAHMGDISLVVMSFVSANKLLGGLIP"
FT   gene            complement(443490..>445948)
FT                   /locus_tag="MICPUN_64510"
FT   mRNA            complement(join(443490..445503,445814..>445948))
FT                   /locus_tag="MICPUN_64510"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(443584..445503,445814..445948))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64510"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5634 - nucleus; GO_function:
FT                   GO:30528 - transcription regulator activity; GO_process:
FT                   GO:45449 - regulation of transcription"
FT                   /db_xref="GOA:C1EIA7"
FT                   /db_xref="InterPro:IPR007207"
FT                   /db_xref="InterPro:IPR007282"
FT                   /db_xref="InterPro:IPR012270"
FT                   /db_xref="InterPro:IPR038635"
FT                   /db_xref="InterPro:IPR040168"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA7"
FT                   /protein_id="ACO67827.1"
FT                   /translation="MGDKRKLQSEIDRTLKKIDEGLDVYDRIYQKVVDAESQSNKEKYE
FT                   GDLKKEIKKLQRYRDQVKQWASSNDVRDKTPLLEARKLIEGKMESFKIIEKETKTKAFS
FT                   KQGLEAARERKDPREQARDEAREWLNNSVDELQTQIEAFEAEIESLAETKKSKSKSSSR
FT                   PPRLGHLEESMSRHHQHIQRMELVLRLVDNEALQPEDVADLKDLVEDYIDRNQDDFEEF
FT                   GDVEDMYADLELDDLAEAVASGEVSHDVGKPAVLQKLESEEGANNKESADSSNDGAPSK
FT                   ALARGNANSDSSSSLVRQEALRKGKDGSVNDVAKPASPAPTLGSGGKKIPAPLGLSKPL
FT                   ASGGEVPGPSPGLQSGGPVPGPKGREGQLGGNGGSWGAPGGGNGQPLSGQPGSGPGLQQ
FT                   QQSWGFGSGGDPPVFGNQSPNQPTTQGGTSSGAAGVKFPLPKPAPGSPLLGGAQNNQGG
FT                   SPAKNLPAPKFGVDPSKAGGVNAAAQAQAQAQAAQLAGDPKPAADEDSLALDLPGGVAD
FT                   LADGSKHPLAVRLGGMAHEDPGVNIRLLESAYRNLPTPEDGTWTRRRVEPPAKPPPPSY
FT                   PSSTPPVLDNPALFERLDADALFFAFYHQQGTAQQYLAARELKRANWRFHKKYATWFAR
FT                   QEDPKVSTEEYEQGSYIYFDFNMSADGGWCQRSKGDFLFEYSQLESEMN"
FT   gene            complement(<447205..>447453)
FT                   /locus_tag="MICPUN_74645"
FT   mRNA            complement(<447205..>447453)
FT                   /locus_tag="MICPUN_74645"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<447205..>447453)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_74645"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIA8"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA8"
FT                   /protein_id="ACO67828.1"
FT                   /translation="CGHCKKLAPEWTKAAKALKKEVGDKAKLGAVDCDDATNKALCAKF
FT                   NVNGFPTLKGFASRGKESHDFDGARDADGIVQFVKTKL"
FT   gene            <447983..>448744
FT                   /locus_tag="MICPUN_64512"
FT   mRNA            <447983..>448744
FT                   /locus_tag="MICPUN_64512"
FT                   /product="predicted protein"
FT   CDS_pept        447983..448744
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64512"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIA9"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIA9"
FT                   /protein_id="ACO67648.1"
FT                   /translation="MTSTPNRRRSNATATRASADPAGSDAPYAPWRDPTRLGLLALWLG
FT                   LGSVAALVAPKGTTDFDAGLVTTLVSAPFSGAVNPIFEALFNSLGVVPAVYAALLLPGA
FT                   KDQPRIPTVPPLAASFALGFFALGPYLIAREPRTEPVPRSSLGWATRTIFESKVFAAFN
FT                   AAFAAFLIAYGAANFTSDAAEAFVAMWRDQSALACVSSCDLTVLSIAMYGALAEDMRRR
FT                   GCYDGAKAAAFCAVPVLGPCVYLLTRPSLPE"
FT   gene            complement(<448840..>450348)
FT                   /locus_tag="MICPUN_64513"
FT   mRNA            complement(<448840..>450348)
FT                   /locus_tag="MICPUN_64513"
FT                   /product="predicted protein"
FT   CDS_pept        complement(448840..450348)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64513"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB0"
FT                   /protein_id="ACO67829.1"
FT                   /translation="MREPLAVPCEVEAASFSGRVPPSTREAVAYVDLCGLALLDPRTLR
FT                   ASHRWLFTNLAGWHATSETTLSVRYIPRPNAGPRTITLLFPPGCAPEVQLDMERKVRMY
FT                   AEGMIPREKLDDDRLPEGATLSADSLRDARTLPDAPLSDAVLRAAHPRRGRVDRPPSVQ
FT                   NTPAGWAPRRIDLDDETIDDLTIAKPSSARNLDDTFATIRAAFRGAASSAVKPASIVAK
FT                   LKSTGKLHRGETGGRGGGGGGGGGGVFRTPAPNGADATPAMTERQRTVMADAVGAWRSV
FT                   GTALSDTPLDEHAVRAAWERREWARQAEEASHAAAARAEEERLERLERGPEPPAVRRWD
FT                   RGTSGAPPPRGHRLARRLAAEGPARRRGADRAPPPMFDATPSRGLDDSSIDGFRGAADE
FT                   WPGDEGDFFYDVEVGTTPNGRAAPGGGERRRGTESRETVDGFARDEDEEEEEEEEVAVN
FT                   RRVRTFAGVVKESLARVGRAASAGDVDAEVAALINRLRRLAAER"
FT   gene            <450512..>452887
FT                   /locus_tag="MICPUN_88790"
FT   mRNA            join(<450512..450668,450801..450868,450992..451632,
FT                   451759..452152,452216..>452887)
FT                   /locus_tag="MICPUN_88790"
FT                   /product="predicted protein"
FT   CDS_pept        join(450512..450668,450801..450868,450992..451632,
FT                   451759..452152,452216..>452887)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88790"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3677; ATP-dependent DNA helicase
FT                   activity - DNA binding [Evidence 5524] [PMID 4003]"
FT                   /db_xref="GOA:C1EIB1"
FT                   /db_xref="InterPro:IPR006554"
FT                   /db_xref="InterPro:IPR006555"
FT                   /db_xref="InterPro:IPR010614"
FT                   /db_xref="InterPro:IPR013020"
FT                   /db_xref="InterPro:IPR014013"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB1"
FT                   /protein_id="ACO67649.1"
FT                   /translation="MPTYGLKVKGRGEEVTYSVDFPYDAYDCQVTMMERVVEALHAGEN
FT                   ALLESPTGTGKTLCLLCAALGWREKAHAGGGPDDVTVGPDARAAAAARGDDRAPDRGPL
FT                   IVYASRTHSQLAQVIRELRATRYRPRMAIMGSRQQMCVHKDVRVLAGAAQNAACKARTQ
FT                   SRSCAHHNELEHFRRREPNFGRDDPVDIEDLVKLGERGVVGGGCGPCPYFMSLDMYKEA
FT                   DIVFMPYNYVVDPAMRDVLGDRLDGAIVLFDEAHNIESVCSDAAGFDIPASHLAQAINE
FT                   AQEAFEAAGADPGADARKPPRPAAEYKQLRGVLLALEDKVAAQVGNNGEECVKPGEWLF
FT                   ELLASLKITEQTLEMIKSIAQDAASLLAGEAAAVGQRSRARASGYRINELAEALELAFR
FT                   ARREGHVGSFRLRIGADESRGGFGAGHGAGPTLSFWCFSPSVTMSHLAEKGVKSVILTS
FT                   GTLSPMSSFASELGLNFRVRLENPHVVAPHQVWGGVVPVGPSGKRLNSTYRFRDTDEYK
FT                   SELGNVVVNFARIVPDGMLVFFPSYGVMRACVEHWRNTGTPSIWERICASKHAVVEPSG
FT                   KEEFREAFKEFNDALEATPGGGAGGRNGAAFFAVCRGKVSEGIDFADKAGRCVVLTGIP
FT                   YAPKADAKV"
FT   gene            <454818..457005
FT                   /locus_tag="MICPUN_64515"
FT   mRNA            join(<454818..454967,455456..457005)
FT                   /locus_tag="MICPUN_64515"
FT                   /product="enhancer of polycomb-like protein group"
FT   CDS_pept        join(454818..454967,455456..456919)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64515"
FT                   /product="enhancer of polycomb-like protein group"
FT                   /note="Predicted Enhancer of Polycomb-like protein, related
FT                   to the Drosophila PcG protein Enhancer of Polycomb. ChromDB
FT                   ID: EPL20101; EPc homolog"
FT                   /db_xref="GOA:C1EIB2"
FT                   /db_xref="InterPro:IPR019542"
FT                   /db_xref="InterPro:IPR024943"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB2"
FT                   /protein_id="ACO67650.1"
FT                   /translation="MSRPSFRARPIDISQALAIVRDESVLNDESQAVAREVTHAHKNLD
FT                   KDNEEVLTKPVDGSKSKDGKDKEIPIPEIRKVASYEQDYRPNFVKPATYLRSPTFGAPP
FT                   GEAVEYDLDNDDEDWLTAYNDGQNRLPAEKLELMIWKLEIACGEANEAWMAQSAATATE
FT                   RGQIVSYQDRCVQMASTAALPKEKALELLTDISGRPAILEAVYKYWTEKRLKTGKPCLR
FT                   RLQPPPAPGDSNPFNVFRQREKTNRPQTRRRRENDAGSYDKMRQIRRQMEMVYAVVELQ
FT                   LRREEKKLERSRCECDAQTLQIKLRHEPRTVHEEIEAEFAKRPSARALSPKELEWDPQR
FT                   PTSLPLSQADVVVGPDGAYRLGGERFAPRQTEQTGKHGKKRRRDDAMAVHLAQAKGYDP
FT                   RVMAQLGGGFGQHGMPAGYALGPNGQLLTDPAILARARSRPIVPIEVAPYQPPPEIPDI
FT                   EMIFAQTPAPERLGRFVLPLGMHKQHCRPRIARGGRIVFDRKDPLTRQPYFNAAEMLPM
FT                   DPDDDDDDNTPAKTPRMIRA"
FT   gene            complement(<457426..>458235)
FT                   /locus_tag="MICPUN_71437"
FT   mRNA            complement(join(<457426..458028,458167..>458235))
FT                   /locus_tag="MICPUN_71437"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(<457426..458028,458167..458235))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71437"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; zinc ion binding - nucleic
FT                   acid binding [PMID 8270]"
FT                   /db_xref="GOA:C1EIB3"
FT                   /db_xref="InterPro:IPR000504"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="InterPro:IPR003954"
FT                   /db_xref="InterPro:IPR009145"
FT                   /db_xref="InterPro:IPR012677"
FT                   /db_xref="InterPro:IPR035979"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB3"
FT                   /protein_id="ACO67830.1"
FT                   /translation="MAEHLASIFGTEKDRVNCPFYFKIGACRHGERCSRLHNKPTLSQT
FT                   ILMSNMYQSPAAAAIANPSAQINTDPRAIQEHFEDFYEDIFEELAKYGEIEGLNVCDNT
FT                   SDHLIGNVYVKFREEESALAALNALSGRFYSGRPILCEFSPVTDFRESTCRQYEENTCN
FT                   RGGYCNFMHLKPISRQLRKILFGRYKRRDDRDDRDDRGRDARDDRGGRGSGRRGDSRDG
FT                   RR"
FT   gene            <459554..>460166
FT                   /locus_tag="MICPUN_75716"
FT   mRNA            <459554..>460166
FT                   /locus_tag="MICPUN_75716"
FT                   /product="predicted protein"
FT   CDS_pept        <459554..>460166
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_75716"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIB4"
FT                   /db_xref="InterPro:IPR005612"
FT                   /db_xref="InterPro:IPR027193"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB4"
FT                   /protein_id="ACO67651.1"
FT                   /translation="QRTWLALLRSPFPDDIYRKILVRAHADVMPHMPSPVTLSDFFTAS
FT                   IDRGGLDGMLALNGIFHLMTKHQLEYPKFYDRLYGLLDSSCFRAANRRGFFELLDVFLK
FT                   SPALPAYLAGAFIKRLSRLAIHAPPAGAVLAVAYCHNLLRRHPGCGVMVHRENGKCTES
FT                   DPFVADEPDPASCRALESSIWEMEAMSRHYHAQVSKFSEVL"
FT   gene            complement(<460493..>461101)
FT                   /locus_tag="MICPUN_73195"
FT   mRNA            complement(<460493..>461101)
FT                   /locus_tag="MICPUN_73195"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<460493..>461101)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73195"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002800"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB5"
FT                   /protein_id="ACO67831.1"
FT                   /translation="AVADGALLELLSPAWRILLLSDGSVTRHLRLLCPRLRQTRLECLR
FT                   QGPVPSPSQVGAPAVTLGMPDDCDLIVGPMVQREVLLHISRGDFFADDHYLDAELNDGE
FT                   LAKDGDVPMVYAASWWSEDNFRKYMVDGSSPMWSNLRQGNVELYREVRRVYMGDNEELA
FT                   SIFGCDGPFWGRHYIFWHDQKPMTVVYEVFNPALERQLGP"
FT   gene            <461488..>463038
FT                   /locus_tag="MICPUN_64519"
FT   mRNA            <461488..>463038
FT                   /locus_tag="MICPUN_64519"
FT                   /product="predicted protein"
FT   CDS_pept        461488..463038
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64519"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB6"
FT                   /protein_id="ACO67652.1"
FT                   /translation="MLRRGGRELARAIAGVVDARSGAVSRAGDALQRLHAARGSRSSSP
FT                   RDVHGSTALLSSSSDASGGSSPRMDVWRAWMGYGEGERGRRDDGTHPAGALARGHRRLR
FT                   RTHAPRATWDPERVFNDLIIKHSRRTESLLALIGGTHEDAWEIVTFENDDAKADDHDAM
FT                   PVKREWRPVNVATAANRLVNVSLKASRASKEPSDRLGAALTVLRDERYATLVGMIASTV
FT                   DEFGPVETATTLKALACMQMYADNARVTSPHQTLSRSSRQPSAKKKENEDGEETNDARV
FT                   DLHLAEGLARAVTRNAHRMHARLLALTLPALRFLPGVSKLIDAETHSTLARAAKVAARS
FT                   GALGAVEAANVAYAMTRIPPLLRVVNEPTNRTKGGEEAEGGGEEEASCAAALAARIAET
FT                   AGDMDRRCVALSLDSITRLRLGGDDGGNGEPSHLLRTLREALGAAVARVELEVTPQRRL
FT                   GSGTEWERMRAGLRRLGLEPPGRWETWPAGGGRRGGRRGVDGEEAGEGGRSKEGAENE"
FT   gene            complement(<463156..>464016)
FT                   /locus_tag="MICPUN_64520"
FT   mRNA            complement(<463156..>464016)
FT                   /locus_tag="MICPUN_64520"
FT                   /product="predicted protein"
FT   CDS_pept        complement(463156..464016)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64520"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB7"
FT                   /protein_id="ACO67832.1"
FT                   /translation="MGGALQRRGVSKDDLAALLEISRACDTLYLHLTGLAREDDAEIVA
FT                   VLEDVYECVARVDPSAEVVPLLERCGWDADAVMALEDRIGDEDHVVTLSLELEEGGGVE
FT                   EGDETTGDDTSVDKTSVGGTFDRMHAGHRLLLATASAVTRSGDSPTVFIGVTGDVLLSN
FT                   KRHRDLIEPYEVRASKAKTFVAKTRPPTSPLTVECGPLDESPPLAATVADMRALVVSRE
FT                   TLAGGEAIQEARKEAGFPPLRVVCVGLVKGKVGKGRGDDGKVSSTALRADAADDRERRR
FT                   MRGGR"
FT   gene            <464387..>465532
FT                   /locus_tag="MICPUN_64521"
FT   mRNA            <464387..>465532
FT                   /locus_tag="MICPUN_64521"
FT                   /product="predicted protein"
FT   CDS_pept        464387..465532
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64521"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIB8"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB8"
FT                   /protein_id="ACO67653.1"
FT                   /translation="MHAPAFASFARSLAPRTSASASRASRESRRREQRTASPATSDVPS
FT                   ESRRLARRVVVALDAAAAAADPVHRSAAPRSRRAALASIALASAATAAGYAPHPARALV
FT                   DDANARRVFEQTRRSVVGLADYVPGGANGGYAPRGTGVVWAALQQQPGDDDVGVGYVVT
FT                   NYHVIAPDHLPGRNGNADDGGGKKGSPAAGPALRVAVADAVTGEPVWYDAAVVGTQRAS
FT                   DIAVLRVRLADTTRAGDSAAALAPVKMGTSGDLAVGQTCYAVGAGDAGLAAGGTGRSAP
FT                   STAPSASASFRQLATMSAGVVSGLRRSVPTKNATTVRGAIQTDAKVPETASGGALLDSG
FT                   GRLIGLTVTPYGKGQAGVGFAVAVDDLMQVVPSLITLRQIS"
FT   gene            complement(<465739..>467304)
FT                   /locus_tag="MICPUN_64522"
FT   mRNA            complement(join(<465739..466237,466304..>467304))
FT                   /locus_tag="MICPUN_64522"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(465739..466237,466304..467304))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64522"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4289 - subtilase activity;
FT                   GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1EIB9"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR023827"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIB9"
FT                   /protein_id="ACO67833.1"
FT                   /translation="MARRLLVVALAALLLAVASRARAHVVVVDDDDEGGLGYIVTLDDD
FT                   DADAEDLCAALEAQSDPPGSEPDLFPGALLRRARQVACARQVRGICRRVFRRGALGIRG
FT                   MVVDAISRARIAALARCLPRAVLEPDQPVRAQSPFDPTGAVPVWNLDRLDQPFLPLDGV
FT                   ARLASPANGGGAGVHAYVIDSGVRASHREFASPTGGSRVDRGVDLVALHSAGGGTRNSP
FT                   FNGGYNGGYGSTAQGLNSEDLAARDCDGHGTHIAGTLAGNTVGVAPSVRIHPARVLDCR
FT                   GDGRASDVVAALDWCAGHVLYNRAVKSPSGDVNDAAAHPAVATLALGLMAGARSLAMER
FT                   AVVQFTRRTGALVVVAAGNFRDADACDVSPARVNAALTMGASDAADRAYVHGATGACVD
FT                   AWAPGVDVLSACGGVRRCDSPGDDAYAAQSGTSMAVGHGAGAAALLLGEHPGADAVTVK
FT                   AALVEGATGGTVWGWTLPGTTTATIRVPAGGWGRLSPSPSE"
FT   gene            complement(467476..>473667)
FT                   /locus_tag="MICPUN_64523"
FT   mRNA            complement(467476..>473667)
FT                   /locus_tag="MICPUN_64523"
FT                   /product="predicted protein"
FT   CDS_pept        complement(467614..473667)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64523"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC0"
FT                   /protein_id="ACO67834.1"
FT                   /translation="MARAQKRANAGRASRGLIAAVAMFSVAAACAVTGAEATFHVSSEL
FT                   GADLPASIGTRAGSTARVATTGAHDDVPAVPHGDDCAMMKLVVDFAQHRGRQATHARFD
FT                   VRAIHHDAVPAGVQDHLGTLIGSSSAEGPVTIVERMCLPRDQGYVLIASGNATRGSSFD
FT                   RFNVTVINEEYLDLVAFRAGSDWTRGSSFRSDRLAASGAGASSAQLGGSNDDPHAEDYE
FT                   VEFFEDEGVGAPLFDSPDGGKTYRLHGRARFDVWPEAPIDGNGVWTECGVLAAVSVGAT
FT                   SYGNGAAPRDMSWALWDKADVDAATGTPAGDPLVAAGGDSFTWGSTMTAVACLRPGTYE
FT                   FIAEDGGDLNRGWGFGTTVEVTEIVLDKNTRAMRQRKIADVDGPSWFTGGRRKSLTFHV
FT                   DEADAVVEAAARALQPKTAPPTPEPTPESEIVEIETHDTVLQDDGTGRDEEESFVVEPT
FT                   VIDAMDETRSAGARLAQPQAGGSSEPAPVTDWSKYSSESGHKGITGGMAWASLGRPSNG
FT                   AVSGDAKNTRRTLLAAELDGGKASKQSAPGTFRTAAAATMALAAAAAGAAHLAHAAKRQ
FT                   RELRFGAAAVTAAVVDPEKQALLPQRLKLSARTRDQRTSPATAPLLAVAAMAGLVAFAG
FT                   PFAASSTAPSLGDAFSEAAGILAAREAAARLGEPGEPLCGAGIDRCRLLAPTDCRGRVF
FT                   AYHPGVLAHIQGGAQTADVLSPMGAVLADGSGNGQGLSLVDQNARACERRVDISRDRPD
FT                   ARGSTCVRAVGRFESSVSLEGCVKSCRETPGCEWYHAYRLASSPEDGQFDECRLCAGGG
FT                   EGVWAGPKDGADVVSVSGPAWCLTPHNLTSHATGAKRSVQQCRAACDATKGCDAFNFGD
FT                   ERGDCTLLRVGNGAKRGPVWRGSGFSPLGVTGYATYYAVSHAEVDAARGGAGSATLGAV
FT                   DPEDWTAPAPAESRRLAAHAADSRCVASGGQERVKPYENLAKGKPTTPLAAAAVVDGVV
FT                   VGGDEEGADLSGACPAVVKGLGAAGKADESVEIDLQGSFTLGALSVFAAPGDAAALAGV
FT                   DRSALLGSAKVPASALVTAVNADDGVERTCGEIVPGAGEKTEHTNGAVELFNVRGCAGF
FT                   VATHVRVESARAGAVTHLCEVLAHAAHQPAMTKFPALPKWLELREETRAAMEEAAAEFV
FT                   QGRADADDALIVNRDGDVDGKNDAQTHEPFITGEDAKAKIESLERDGDDDDWRVRAHAS
FT                   SAAAHIPDHDEHEARAQEEADALKLTEEAIEREEKERLHSYERDVDADRHSSDSIREKR
FT                   FEKRFERPTNSAYRADDIDAVPDDAMDLISQHFAVPKTVESSYDVDEAAARRERRAMAP
FT                   GPAPSHVPFSDVAVPDEDRAGHHEPGSHARVPHKGGAQGPTASAQGPAPSPASAAHHHW
FT                   PPVPTGTFYHTPTIVEPEADVEHVPEADVEHVPEADVVEHKSTQVVSPEVTEDSCERVC
FT                   EGHGFNKEQCDAIPGCEFGEDANCWSAVGPNPCPSQAEWELYVSKHPKSVPKDDFIEVV
FT                   TSLDNCEKVCGGHGFDRAQCLAIPGCTFATEGAYCYSAVGPNPCPSLLEWNFWHKHAND
FT                   HVFHDDHGHGEYKEEYNQQFIAAHPEYADHAAHDEHTDFHPYEIIDQMVHAHPKEENMA
FT                   IEPNPELHEDADGEVHMYHVDESLDEHYVDDLEHANEREHDEPYRPDPIHTHAEVLENE
FT                   DNHVVHEEVMHKPIETEATATMKAEVTTAAIPEHKSAEEEEAEILHEHEHEDHEHEEGH
FT                   HIGPVEITETHQHGDNSTFETSVVTEPVVDSEVPLPNPTTEHDPVPDIVEVHGSGNATN
FT                   APVAVPDDEAAPFPELHDDPAYNPRPAPAFPPGQSATLHDLQFVTCPGQAQCDKPPCVP
FT                   YVHDLLEAHLVEGATSCCQASDEWEYGNPRRFPHVCGQCSRNEHENYLTYAEAAAFCAS
FT                   KGGGLCRNNQVTVAGRADHCALDPDSVVWTDKLCDRGKGRQAVKLNGDYSHCVSDLAEK
FT                   LPVVCCANTCEGFTPKRMCPHVAAR"
FT   gene            <474106..>475257
FT                   /locus_tag="MICPUN_64524"
FT   mRNA            <474106..>475257
FT                   /locus_tag="MICPUN_64524"
FT                   /product="predicted protein"
FT   CDS_pept        474106..475257
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64524"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC1"
FT                   /protein_id="ACO67654.1"
FT                   /translation="MADSGAPPGENLTLAQIAAQQTAAMQAAMQGRGRGRGRGRGGEPK
FT                   PKKLTKAQIAAQERAAAAHAAQAAAVASAAPQIPMHQMPGVPIQMPPPGVPVPQQQQQQ
FT                   QQQQQQQQQAPGPGGGPPRPPPLRQRSPVDVQNELRQNLELIKRETVESKNAFERTGRT
FT                   YEPPKYVVKAQFDAAIGVELWLDDHAKNFDANELAKKIAMLQGIQTKCAKGILDENPFE
FT                   ALCCWVELTKTYYICVRESRNLTMRGVAGIVPPTFALPVDSPDPPPAIPDDDVIPVHEL
FT                   DEAMFQIVGPKVWVEAVQEDLLRRVGIEGIAPTYARSLRKGKEKGQPAGGEGGGAGEGE
FT                   GGEGGGGGGGDDGGGGDNGGDNGGGAETGAEGEAGGDATPMES"
FT   gene            complement(475301..476338)
FT                   /locus_tag="MICPUN_109580"
FT   mRNA            complement(475301..476338)
FT                   /locus_tag="MICPUN_109580"
FT                   /product="predicted protein"
FT   CDS_pept        complement(475422..476327)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109580"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIC2"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC2"
FT                   /protein_id="ACO67835.1"
FT                   /translation="MQAAAVNTMQAQQQAQQQQAAKAVKAAAAASERAVTARYAAKSVA
FT                   PRAPPPAENASGDIIEATTEPLDLARYLDAVRGGYDGEDSGPELATLISTVDSKHGDKQ
FT                   PLGESLAQHGALVEGALLRISQAIRKRWNCRRMALVLRLGAASLGDVSLIVACSANKWR
FT                   DAAGAAEHAAIEIKDKLIASIAPQCLSKQPMAAAALKAVAAAAGVGGEAGEEKPPKNDD
FT                   EADEGDGVASGGEDAKEADDEANNDEEGEGNDDGAAAAMDALADPGRTFKGGAHPASVE
FT                   VKSEDSEPKGLDTPDERAHA"
FT   gene            complement(<476994..>477287)
FT                   /locus_tag="MICPUN_73784"
FT   mRNA            complement(<476994..>477287)
FT                   /locus_tag="MICPUN_73784"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<476994..>477287)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_73784"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIC3"
FT                   /db_xref="InterPro:IPR001005"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015495"
FT                   /db_xref="InterPro:IPR017930"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC3"
FT                   /protein_id="ACO67836.1"
FT                   /translation="WTVQEDNQLRRLVDEHGHRKWSFIASKMSGRRGKQCRDRWLNHLK
FT                   PDIRRGEWTQEEERILVEGHRMLGTRWAALAKLLPGRPENAIKNHWHATLRCK"
FT   gene            complement(<478251..>478774)
FT                   /locus_tag="MICPUN_64526"
FT   mRNA            complement(join(<478251..478465,478750..>478774))
FT                   /locus_tag="MICPUN_64526"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(478251..478465,478750..478774))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64526"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC4"
FT                   /protein_id="ACO67837.1"
FT                   /translation="MPPKRAARGGAYAHGEEPDAGAAEPTSIPIPKRRRTQEKSAPRSS
FT                   ARAANKGEPGADEDDVNSLFWLVEVRTDHSGDRG"
FT   gene            <479279..>480139
FT                   /locus_tag="MICPUN_64527"
FT   mRNA            <479279..>480139
FT                   /locus_tag="MICPUN_64527"
FT                   /product="predicted protein"
FT   CDS_pept        479279..480139
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64527"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC5"
FT                   /protein_id="ACO67655.1"
FT                   /translation="MKSCVAASRPAHGFRGTRVWTRRPRSGEPVRRARALPPPRSQVSW
FT                   SNPSGSVLTPLREKVWAAERPFVWQGIDVGGKMGVVKMRDGSLWVHSPVDLDDDLRAAL
FT                   TEIGDVKHIVSPNFEHVKYAAQWKAAFPDAVLWGCPGMIDKKPLIPFDREVGVDDACPE
FT                   EWNGEFELAFFDCEVNPFVGDPFFNEVVFHHKPSGVVLVTDLFWNYGGGGEALPAATRA
FT                   WKFGMDKVYLPFYRAFMVRDRARFEERARRVIAWEFDSLLPCHGTFVDGRGKRALREHL
FT                   SGENG"
FT   gene            complement(480204..>482027)
FT                   /locus_tag="MICPUN_50794"
FT   mRNA            complement(join(480204..480589,481255..>482027))
FT                   /locus_tag="MICPUN_50794"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(480424..480589,481255..482027))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50794"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EIC6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC6"
FT                   /protein_id="ACO67838.1"
FT                   /translation="MRSYRRLDKVGQGTYSAVYRGQDLTNGRVVALKHIRLANMDDDSL
FT                   EFMAREIDVLARLGSHPSVVSLLDVACGKTKSSMYLVFEYVEHDLAGLLSVAEKHSLRL
FT                   GQVKRLASQLLSALAHCHARGVMHRDVKGSNLLVSDEGTLKLADFGLARRTPGKGMEPL
FT                   TNRVVTLWYRPPELLLGARAYDGVALDAWSAGCIIAELLHFSPILPGRTEVEQLHKIFK
FT                   LCGSADAEEVVKRIELQNRALKAKKRSSGKEGEQISRGDPPRRQGGLQGLRLQQVDAEA
FT                   GGDWGRAGQDGWIRPGHRQGGDARGWRRRRR"
FT   gene            <483754..>487341
FT                   /locus_tag="MICPUN_64529"
FT   mRNA            <483754..>487341
FT                   /locus_tag="MICPUN_64529"
FT                   /product="predicted protein"
FT   CDS_pept        483754..487341
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64529"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5664 - nuclear origin of
FT                   replication recognition complex; GO_function: GO:3677 - DNA
FT                   binding; GO_process: GO:6260 - DNA replication"
FT                   /db_xref="GOA:C1EIC7"
FT                   /db_xref="InterPro:IPR020795"
FT                   /db_xref="InterPro:IPR040855"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC7"
FT                   /protein_id="ACO67656.1"
FT                   /translation="MAPAADGAGRDRGWLNSTETTRPGDKTDELSRGVFLLRKAPAPRR
FT                   FTARKSFKPVVPDETVEGMERRHEAYVSCWRAADAHVSRVLADANADAFRRLEAFVVDR
FT                   FDERAAMRAANGGKTPQHLAQQIPAGLVLAGGVNSDDHEETFTKLTRHLRSKGCHAALL
FT                   RSRDLKARGAGANSAFDADGNLAPAVARAMSLAANGGGGGGGGGGGGGLGVAVRCIFNQ
FT                   LRAGTRGVGEFDAKGSFRTSGRSVRHLRRWYQAVTVAEEDAAVGGAVRDEEAVDERDGD
FT                   PGKEIGNPDPGKENDKRGAAAAAPAAPAAPAAPRALRERSVAVIGAAATLGSSRSAAAA
FT                   AAAAAETQLAAADASGPLLPPRPVVVIVEDTESFDNRVLSDLLLALSDAGDALPVCVLL
FT                   GVATSASMMHGIIPAAVAARLRVESFRLWSPRAIMTAVQERVLLDPGFVPAPSNASLET
FT                   LVTRFAEHDFSLSAARRAMHLLALDHFMTRELSSMAMCMTAASLAAAATTEEEEEEEDG
FT                   EKKENKENDADSASAKDGKEDAAYSVESRIAAVEKRAKTAARAAAAAAAAALASARAIA
FT                   AETLTRDSITWARKNLRDFRTGEAWVGRSRVTGAGDTDDDDDDAAREEIASAVANAYGA
FT                   RRRWATALRCVAAAADAVGYRRDEGRLAGLLVDASSTRWLPNYDGRNDEDEGAAAGKTG
FT                   EKKKTGEKKATTTTQGEKLLRLLCARLDAGTEECRMSDADICALALTWLELVSVDPAMY
FT                   AAEAAFLKRTARLCDPATAPRELREMEDVRAAREDAKRSKTADADAAARAAANDGTRRP
FT                   GGETVEKTVGVRAAFASPPSARRARRSSASAPAAAAAARDGEAFATPAPRPTEGGATRT
FT                   PSTRARSSKKGRSVEPASAVEPAAADVEETVGKTIAGAGERASEDAADARGALEAVDDA
FT                   PVPSVSRGDDGGGGGDGASDGADDDEVDPRARACSFLRRVALRHASEPPASLRARELFC
FT                   IGDASVRYLRSKAQAAPRLCVEQAMDNPRGVLGCACCPMDGGPSETLPDTCCAYTLLQD
FT                   MGDAANVHEWFREFCETNEPATGVPRGARTAAKGGRSGKGRGKKTSRVGAGAVSSLFSL
FT                   AAPGDDGGNGDGDGDGDGDGDDGDDDDDKKEKGTFHLERSRLWELQARFTRAVAEIEFL
FT                   GVGRPVKRRKVEYMQRTAFPLDKLLGGDD"
FT   gene            complement(<487612..>488001)
FT                   /locus_tag="MICPUN_88573"
FT   mRNA            complement(<487612..>488001)
FT                   /locus_tag="MICPUN_88573"
FT                   /product="histone H2A"
FT   CDS_pept        complement(487612..488001)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88573"
FT                   /product="histone H2A"
FT                   /note="Histone H2A, core histone required for chromatin
FT                   assembly and chromosome function. ChromDB ID: HTA20102;
FT                   GO_function: GO:3677 - DNA binding"
FT                   /db_xref="GOA:C1EIC8"
FT                   /db_xref="InterPro:IPR002119"
FT                   /db_xref="InterPro:IPR007125"
FT                   /db_xref="InterPro:IPR009072"
FT                   /db_xref="InterPro:IPR032454"
FT                   /db_xref="InterPro:IPR032458"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC8"
FT                   /protein_id="ACO67839.1"
FT                   /translation="MSGRGKGKSGKKAVSRSAKAGLQFPVGRIARYLKAGKYATRVGAG
FT                   APVYLAAVLEYLAAEVLELAGNASRDNKKTRIVPRHIQLAIRNDEELSKLLGTVTIASG
FT                   GVLPNIHSVLLPKKGKKSGSASQEY"
FT   gene            490566..491103
FT                   /locus_tag="MICPUN_109582"
FT   mRNA            490566..491103
FT                   /locus_tag="MICPUN_109582"
FT                   /product="predicted protein"
FT   CDS_pept        490591..491082
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109582"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIC9"
FT                   /protein_id="ACO67657.1"
FT                   /translation="MGGGFCSTAAVQLQYMAFHTSFDFAHATTGVSFENWSRLHQAVVG
FT                   TCNGVEYNSGGRTAGSLGGCPTIVSHDGTVGDFHAHMQACPGQSRALALMVNGGPLGEK
FT                   HNLIHAINRLMQEVLDAFEAKEAEFDAKQAEELKALIEEHTQSAELLEAESDKNENVMI
FT                   "
FT   gene            <493145..>493838
FT                   /locus_tag="MICPUN_72134"
FT   mRNA            <493145..>493838
FT                   /locus_tag="MICPUN_72134"
FT                   /product="predicted protein"
FT   CDS_pept        <493145..>493838
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_72134"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8236 - serine-type peptidase
FT                   activity; GO_process: GO:6508 - proteolysis"
FT                   /db_xref="GOA:C1EID0"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002470"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID0"
FT                   /protein_id="ACO67658.1"
FT                   /translation="LPTIVLPHGGPHANCPAAYVTSVAYLASLGYAVCYCNYRGSTGYG
FT                   DAPLQSLVGGAAGRADVDDCVAVAERAVADGVADPKRLCAVGGSHGGFLAAHLVGQRPD
FT                   VFRCAVLRNPVTDIAAMVPLTDIPDWCFVETLGREAYSDLPSTEALIAMREASPVRYVN
FT                   EVAKHDRPVLMLLGGVDLRVPPTNGLRYAAALREAGGRCEVRMFPEDSHGLLNPRTEFE
FT                   SFVTVAGFL"
FT   gene            <494294..>495181
FT                   /locus_tag="MICPUN_64532"
FT   mRNA            <494294..>495181
FT                   /locus_tag="MICPUN_64532"
FT                   /product="predicted protein"
FT   CDS_pept        494294..495181
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64532"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4846 - urate oxidase activity;
FT                   GO_process: GO:6144 - purine base metabolic process"
FT                   /db_xref="GOA:C1EID1"
FT                   /db_xref="InterPro:IPR002042"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID1"
FT                   /protein_id="ACO67659.1"
FT                   /translation="MPNLVHHVHGKKRVRVARTWREGSMHHFVEWNVEVVIESAMAHAY
FT                   KTPSNEGMTTTDTTKNQCYVVAKAMQKRCSPEEYALALGKQFVDSYPLISAVEVRVEQA
FT                   PWRRTRVHGADHDHGYTFTAPCLRVCAAVVSRTKPPAVRSGMRHLRVLKTTQSGYEGFL
FT                   VDKHTALKDTRERIFATAVDVDWTWSKPPGCYDNAYTAVYDALAENFFGPPRGGVYSPS
FT                   VQYTLYQMGSAAVERVDGLEQITLTAPNLHFVPANPPGAAPFADDVYVATSEPHGQISC
FT                   TVSAKHGFAPLAKL"
FT   gene            complement(<495302..>495841)
FT                   /locus_tag="MICPUN_88542"
FT   mRNA            complement(<495302..>495841)
FT                   /locus_tag="MICPUN_88542"
FT                   /product="predicted protein"
FT   CDS_pept        complement(495302..495841)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88542"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16021 - integral to membrane"
FT                   /db_xref="GOA:C1EID2"
FT                   /db_xref="InterPro:IPR008564"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID2"
FT                   /protein_id="ACO67840.1"
FT                   /translation="MAAPEAPDPGRPLPNPGTTFFHVFFKVTSLLYFFTCTWWSTHYAI
FT                   QFVGTIVLCAFDFWWTKNVSGRFMVGMRYWQMIDENNKEEWRFEHRDAEGMARVHPAES
FT                   KIFWYALYGTPPAWFLLLFMELARFNLDYAMMCGISLSMCSFNAYGYTKCSKDAQAAIS
FT                   TFATRTLLSSVVHALV"
FT   gene            <495983..>498547
FT                   /locus_tag="MICPUN_106567"
FT   mRNA            <495983..>498547
FT                   /locus_tag="MICPUN_106567"
FT                   /product="predicted protein"
FT   CDS_pept        495983..498547
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_106567"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676 - nucleic acid binding"
FT                   /db_xref="GOA:C1EID3"
FT                   /db_xref="InterPro:IPR001374"
FT                   /db_xref="InterPro:IPR036867"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID3"
FT                   /protein_id="ACO67660.1"
FT                   /translation="MGRTSQDGGDGGDGDTGDRRSRGGRRGRGRGGRGRARDGGDGGEA
FT                   SRASVDAVPNAAAAAPPGAPFGALRATSTPFIPRSVTVPNRGIAPPGAPAAAPLAPATK
FT                   HRASRHRQRQRPKREGGAEGDAPTPADDPRARDDGAAAGEEAGSTGGKDEDEGEGEGEG
FT                   KGKGKGKGKGTGGKPDGWWQDISTCDPITLEPLADLNHPPFELRAKPNPASPAVSHLFD
FT                   PTCLAEWVTGSKTFENPLTRAPMDATDCRRLDNHLRRCRLPKFAVHDAFVAAAHERRVA
FT                   EEQRAARANESVEAATARREREASELAASLFMSIRARERRSGNGRRGRDRDVGVDLDAE
FT                   GHRRRRGDAFTADGAFAMVDDDEGMRGRRLGRRQMPETERWVWEDGSHLLYDEGDDRDG
FT                   VRTRDDFPALGGVGGAAVVAGVPEAEASFPSLSGNSGGWAATAARARSLPPPPSRPPVA
FT                   PRVQSLPNRSSTHTDVAPSTNTTDATDDDDGSMAKLASEEDRAAREERRKKLADAFGVA
FT                   DPDSRPSSFAASSASFFAPDVLATARSNPDAVDAMESALERLVLAGADGQHSCTPRRVR
FT                   LDPMPRRLRAVAHALAATYGATSCSYGDEPRRRVDYFRSENTQFPSVRLSDALRAVAEG
FT                   GTDGGGSVVGGLVGVHADAARGNSRSLGPAPDSVWFPGYTEHHSRGRWSRLEVRFTDFN
FT                   DVHVALAAVREFTERGECACELVARATGASEGALGGSGRWSEGMDLVVHFWKRSRYESA
FT                   VGKLGGGIRGRFRATHACEVGPDPDPDDDESTRGDGKMSDKLDATREALRAKAKEISGG
FT                   RVGPSVPGAFGNPNKRRETPMAADPWADDSVEEWNGLLDDVD"
FT   gene            <500490..>501941
FT                   /locus_tag="MICPUN_50798"
FT   mRNA            <500490..>501941
FT                   /locus_tag="MICPUN_50798"
FT                   /product="predicted protein"
FT   CDS_pept        500490..501941
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50798"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID4"
FT                   /protein_id="ACO67661.1"
FT                   /translation="MPTDSPSTPSQGRREVAMGLIRLVRELTDFPIHKHAAHVIRKVSH
FT                   HPVTGVWRAEGWKTGEQHRFRLQIRRVLGTNVDINRLFERLQPARWTGDDIADAFWTFF
FT                   LRNVYGATAFPDVVDVKRELLVKKTTLTQHAGARSASATGARGKNTEPYVLSDVFFHRR
FT                   GLSRDAFVRALEACVKHPDTTFPGWLAAAGWDDVTTGPRDPAEYLLPEDPPPSKEPSSK
FT                   EPSLKETGDEKIVRHVGRGKKRGRGDEATHAGEVSETDGASGATDATRVSARVARRGKI
FT                   KTVDKNGRRSLGSLADDDDDDADDARSAPGRRARPDDAPTVTSDGTRNGAGKGTRTAAD
FT                   EDGQSRRRLVVAAASLAAATQLGDVESVAAALKTLVTHASPTTALAAFDAATDVGDRYF
FT                   ASLAADVFAEYNRDLMADDGDLTCTESVFDDDASVFDEGDVMTSRVRTLEAPPVEDAGI
FT                   ERLCSIPEDAETDLLGDLLAASPRY"
FT   gene            complement(<501991..>503391)
FT                   /locus_tag="MICPUN_64537"
FT   mRNA            complement(<501991..>503391)
FT                   /locus_tag="MICPUN_64537"
FT                   /product="predicted protein"
FT   CDS_pept        complement(501991..503391)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64537"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID5"
FT                   /protein_id="ACO67841.1"
FT                   /translation="METEGPSSSPAPEPARDGDAPTSETTREDLERRLRLSESVALELE
FT                   RALEGKCRSLDESTRAAESLRRELRAARAANEADGSVPAAAMDAARAEIERLRAALVDG
FT                   ERERAALKSLASKAMKGAEGGRDGGDERDAMMNGDDHDARLRAAVAEERLAMAERALAE
FT                   WREYASALGERCAVAEAAAADALRDARSASIRAKTETRAEALASAAGARVTRHENPRDD
FT                   GARAEDGGEPVPPPVPAQTRPPPPPPPPPPPPPYASEPSRVAFQRARIANGELAAALAA
FT                   ARSVARAAEEASTRAASALTRASSLHARVDDGMGGARGGPKARVGKDVAVNLSPSVQLP
FT                   SVAEWAAAAAGRTASGEAFEARDGDWDRGGAMRVDWAKAAADAGEEGKEEGDEGKEEGD
FT                   EGKEEGDKGKDEGDEGKEEGDEGKATGKDGGDGVDWVAKAAESRRAWAERRARGDIDPT
FT                   LEKIASEY"
FT   gene            complement(<503537..>507181)
FT                   /locus_tag="MICPUN_104395"
FT   mRNA            complement(<503537..>507181)
FT                   /locus_tag="MICPUN_104395"
FT                   /product="predicted protein"
FT   CDS_pept        complement(503537..507181)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104395"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID6"
FT                   /protein_id="ACO67842.1"
FT                   /translation="MSEEEELPMEGVARLAVTFTAVVAPPPPKEDANEPAKVRRRSSRS
FT                   YPSPHGGAPSMYDSSRELIPPSPRPPAQDEPPAETAETAVDEPAPEGEDAEEGAEEGAE
FT                   EGAEEGAEDPPTASMTVAYALPDGTEFVSTHEDHPLVVARRAAGVVSCDSWTGPTHELV
FT                   VNEDIVRTMARQGAALVVTFTRSKMDTGETSVDEGGTKSDGVVVATSVTIELASLVLGS
FT                   ESFAERVYDFDDREDVEGGAGSAEGTFPPAFAGYRRVRVGVRLVGAPKAEADTAVDDDA
FT                   AQLATSKPPPFLPAGLARDLRPFAVTLHRASNLPDVPASHVELDELCEPVAAHLAWRHP
FT                   TTKESLWPKTDDDDAARVVSWRTASSTTPWRTVQPLESFSAPFRTRDARFDSSLMFMAK
FT                   DLVTNLHDACAAAPLELRIHDRVRRAVPEKFPGLDKLEGNEDEGAAEGAEGAEGGGKNA
FT                   KGSFDADGFPVADAYARAFFELRSACEWPRTQTKFHLEANLEPVSSLPGGGVGASLDWT
FT                   CRPGRYVEAHATVTMTFETCEPLRDPRENKPASAIDVDADTEGTEAPAAGGAEGEGADP
FT                   GAEGAEVPPTPPDPRPFHRCVFAMHYSNVSLFREILDVVRSRNAKTLGVDGTPAHVLFE
FT                   LAHAKFEPSQIADPAFAVITGFHVIDGVTRLILIEGTYGEVMDPVYEIASREASNPGVR
FT                   VLFNRRLGYDARMYGTLGGDIWPVKLCETVPALAKSPKVLAGDGVRAITRECVLKLAQL
FT                   LDGIAGPSWMREVESSRAFPRVDALVSLDKRFGAELTVTDLTGEAPRLRGVHRTTRTDA
FT                   DDELEAYAGGSTKGGRVSDVEQTVGHVVGQDDTAVMSPGTARGKARRRVHPPLDMTTPL
FT                   DGSYLADLAARRRARTRRDLTADYLAHTERLQRTLGDEKRRAWREWNVRRITTEEEAEI
FT                   KAKEAAAEAARVKEEADKEAEEAARSGTKSGKPLHPSPFKWPVAPTYAGDHVHPKHPGE
FT                   RRAAELREPWEAPTIDFDVTMHCPDKWKIPSPTNKPNGKHFDKIPAPVDRLFETNRAFF
FT                   NSVHLYGEDLIKEKKDAVLQARKEWRAKCVVDNPGTMEYHGMKVTLPSKDYAAIPAADR
FT                   YRSILHDPPVKLGLTRSRVKGAEHPPPVSMFTREDPEVTNPHSKLNALTLREIDKTRFT
FT                   AGPGVDFKRHNLVAAGGVHTGTLDLVGAEDDEGNKPPRYRRDRSVRRG"
FT   gene            <507993..>508994
FT                   /locus_tag="MICPUN_67721"
FT   mRNA            <507993..>508994
FT                   /locus_tag="MICPUN_67721"
FT                   /product="predicted protein"
FT   CDS_pept        <507993..>508994
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_67721"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EID7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID7"
FT                   /protein_id="ACO67662.1"
FT                   /translation="SQHPRASGEGELHYNCSARDVVVLGALGAGAGGVVKKAVHVPTHR
FT                   FIALKSMTVFEREKRAALIAEMKLLCEQQGGGGGSNGEYESPPPANVVRFIGAFYSPET
FT                   NLINIALEYVEGGSLESLVKKGGAVPQDVLGKICGGVCAGLEYLHAHRRTVHRDIKPGN
FT                   ILMRLNGEPVITDFGVSAELGDSRALLDSFKGTLHYMSPERVENKDYDFAADVWSLGLT
FT                   MLECAIGRYPYDVTDGGPLGLMVQITRDECPIPRDARLGEHLAGLVKRCMRKKPKERPS
FT                   VTRLRTGPHPYIAENEAVDAGGWVRSVTSPLEILEGDANAFVRHYYRLVDRVD"
FT   gene            <509874..>510380
FT                   /locus_tag="MICPUN_88734"
FT   mRNA            <509874..>510380
FT                   /locus_tag="MICPUN_88734"
FT                   /product="predicted protein"
FT   CDS_pept        <509874..510380
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88734"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:16272 - prefoldin complex;
FT                   GO_function: GO:51082 - unfolded protein binding;
FT                   GO_process: GO:6457 - protein folding"
FT                   /db_xref="GOA:C1EID8"
FT                   /db_xref="InterPro:IPR004127"
FT                   /db_xref="InterPro:IPR009053"
FT                   /db_xref="InterPro:IPR016655"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID8"
FT                   /protein_id="ACO67663.1"
FT                   /translation="PTRQFIEDVDDYMKGKDFEQTMRELQTLFQQYKQIEQGLQQNRIR
FT                   LGNKLPEIKRALDTVKLLKEKSASGDELDMDYELTDSVFAKAKVKDAQSVYLWLGANVM
FT                   LEYSLDDAENLLQTNHENCARNLATNKSDLAFVKDNVTITEVSIARVYNWDVKRRKAAK
FT                   EAENK"
FT   gene            <510527..>511405
FT                   /locus_tag="MICPUN_64541"
FT   mRNA            <510527..>511405
FT                   /locus_tag="MICPUN_64541"
FT                   /product="Peptide-methionine--S-oxide reductase"
FT   CDS_pept        510527..511405
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64541"
FT                   /product="Peptide-methionine--S-oxide reductase"
FT                   /note="MsrA.Peptide-methionine-(S)-S-oxide reductase;
FT                   GO_function: GO:16671 - oxidoreductase activity, acting on
FT                   sulfur group of donors, disulfide as acceptor; GO_process:
FT                   GO:19538 - protein metabolic process"
FT                   /db_xref="GOA:C1EID9"
FT                   /db_xref="InterPro:IPR002569"
FT                   /db_xref="InterPro:IPR036509"
FT                   /db_xref="UniProtKB/TrEMBL:C1EID9"
FT                   /protein_id="ACO67664.1"
FT                   /translation="MAAPSLVVSNLGARANPRVARRASSRARRVAPPRASGGERRRTIE
FT                   EGDASEASVGAAGRASSLPLGLTRRNLIDAAFVAVSIPLWKDIAHDLGYLQGPEDAPAD
FT                   LPVPPPGSGYVTATFSGGCFWCMERPFDELDGVIATTSGYTGGVVDNPTYHQVGAGRTG
FT                   HRESVQILYDPKRVSYEQLLQTFWRQIDPTRDDGMFLDSGFQYTSAIYVADESQRLAAE
FT                   GSVRALTEAGRFPGPIKTAIEPARTFWPAEKYHQDYYRRNAARYGFYRFLSGRDEFVRG
FT                   VWGTDGGAHGR"
FT   gene            <512127..>514493
FT                   /gene="ISA3"
FT                   /locus_tag="MICPUN_105010"
FT   mRNA            <512127..>514493
FT                   /gene="ISA3"
FT                   /locus_tag="MICPUN_105010"
FT                   /product="glycoside hydrolase family 13 protein"
FT   CDS_pept        512127..514493
FT                   /codon_start=1
FT                   /gene="ISA3"
FT                   /locus_tag="MICPUN_105010"
FT                   /product="glycoside hydrolase family 13 protein"
FT                   /note="candidate isoamylase; GO_function: GO:3824; cation
FT                   binding - catalytic activity [Evidence 4553] [PMID 43169];
FT                   GO_process: GO:5975 - carbohydrate metabolic process"
FT                   /db_xref="GOA:C1EIE0"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE0"
FT                   /protein_id="ACO67665.1"
FT                   /translation="MSSRARVGGTNPGAFKPKSSPINRGGANLARGQPIAAQVEPYSWG
FT                   DIPTTPSATRDLPSWLPQPAPVHGDGGPGTFVPPPAFEPVTTPPVIDVDRIRISEGYAQ
FT                   FLGPTPAGDVINPGVNFALHSAAAAAVDLLIYFDPSSTSKQPSLRIPLDPKKNKTGDVW
FT                   HVRLDNIPRGGDGYVIRYGYLVDGGKSPHRWDYWEPNQLMVDPYAPLVEGRRVYGKNET
FT                   CPNGEVGQWLGAFALDETPFDWGGVEPPNIPPQDLVVYECTPRAFTASSSSGLDEDVRG
FT                   SFLGIAEKVQHIKDAGYNAVELLPVFHFDEMEFKLSPNPRDHMLNTWGYSTMAFFAPMT
FT                   VYASKGAGPQQAAREFKHMVKTMHANGIEVLLDVVYNHTGEGSGRFFSFRGIDNKSYYM
FT                   MEDLNGKVNYKNYTGCGNTFNCNHEPVMNLVLDSLRHWVDEYHVDGFRFDLTSCLCRDP
FT                   NSGAIMTSPPVVRAIAKDNTLARCKLFAEPWDCAMDGYLVGKFPNWDRWGEWNGIYRDT
FT                   VRRFLKGDPGLKSQFASSLCGSADMYNVNARKPYHSLNFITAHDGFTLRDLVSYNKKQN
FT                   HQNGEEGRDGCNDNHSWNCGQEGESNDQAVASLRWRQMRNMHLALMVSQGTPMVLMGDE
FT                   YGHTRKGNNNTYGHDNELNNFDWAALEKQRDHYFRYHAGLVKFRKNHPLLGRAEFLNDN
FT                   DITWHEDNWDNPDSLFLAYQLHDCGQGGGDLYIAFNQHDFFVDAALPPPPGGKSWHRVV
FT                   DTNLPPPADFVEHGEGGVGARYNVAPRGAVMLVAK"
FT   gene            <514812..>515648
FT                   /locus_tag="MICPUN_64543"
FT   mRNA            <514812..>515648
FT                   /locus_tag="MICPUN_64543"
FT                   /product="predicted protein"
FT   CDS_pept        514812..515648
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64543"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:3676; zinc ion binding - nucleic acid binding [PMID
FT                   8270]"
FT                   /db_xref="GOA:C1EIE1"
FT                   /db_xref="InterPro:IPR013087"
FT                   /db_xref="InterPro:IPR022755"
FT                   /db_xref="InterPro:IPR036236"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE1"
FT                   /protein_id="ACO67666.1"
FT                   /translation="MSLNDIDAQLAELKARLGGLDSEASDDESGGGAREESRDNDPKRK
FT                   SKKEKKSKKSKKERKEKKAKRARSSSSESASDGGEDSDSELVPIAPLPASCLPEHNAYA
FT                   AKSVGKRRKQSKAGSPATATAAAAWARGDGTVDAADASRAGASDASPSAQRPAILELLE
FT                   KRREKRAEHRCDVCDKDFTSHAQLEEHRRGKAHRSRAASHGGGAGRGGRGGGGRGGGGP
FT                   VRPAPGPRPPPGVPHCALCRKAFTSTAQLEEHRGGKWHKARASGELPPSRKPYNAT"
FT   gene            complement(515681..>517701)
FT                   /locus_tag="MICPUN_50801"
FT   mRNA            complement(515681..>517701)
FT                   /locus_tag="MICPUN_50801"
FT                   /product="predicted protein"
FT   CDS_pept        complement(515743..517701)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50801"
FT                   /product="predicted protein"
FT                   /note="GO_process: GO:6629 - lipid metabolic process"
FT                   /db_xref="GOA:C1EIE2"
FT                   /db_xref="InterPro:IPR001423"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE2"
FT                   /protein_id="ACO67843.1"
FT                   /translation="MPAGTRPWLEAFSVHRHHHIARAPAHGLAPAHAARLARSLRRQSV
FT                   GLVLAGGGARGFAHVGVLMALEEEGVPVDLLGGTSMGSFVGGLYAKEPTALLTRIIARR
FT                   LAVHMSSTWNQLMDLTVPVVSYFSGFRMNKVLEPLFRGAKIEDCWLPFFCMTLDLVSCV
FT                   PIVHRNGTLWRYVRASMALVGFLPPLCDWAPRERAGAQGTDPSSPRSSMDQPGGALQTV
FT                   NSTGGNGSSPINSVSTSGDAGNKSGQSRDRRLSGLGRQEPGRLHVLVDGGYVNNCPTDV
FT                   MRAMGARIIVAVDVSGHGLPESRMKPWGDALSGFTLIMKSWLPQWLGGGPSCPTMAAMQ
FT                   SHLPYITDYANAARRWRTVDVMVRPAVADIPILAFNRYAEVVRAGHEAGLRAIRAWKVA
FT                   NPDALPILDDGMWRPSNAGGGGGGGGLGGMTLREVGSKGRLASVAPGGGVGIGARLPST
FT                   ETLVRGGGLLGASSSYGGGMGGNSSGDLVARGFDSEMVEAMERDPFGDGRSNSAMDDPT
FT                   RERILPDDYVERHAIRRASAERTERAAREAAILLKDADARRAEARRMEAASAGSPSPGG
FT                   ESPGRPPARWTGDTLHDDGDDDGEGGNGGPGERSDVNAHPDPGRRRTEQWLTRVGSAPR
FT                   EFLTPDQPRVRRRGGFG"
FT   gene            <522057..522923
FT                   /gene="CUPC13"
FT                   /locus_tag="MICPUN_64545"
FT   mRNA            join(<522057..522355,522482..522923)
FT                   /gene="CUPC13"
FT                   /locus_tag="MICPUN_64545"
FT                   /product="hypothetical protein"
FT   CDS_pept        join(522057..522355,522482..522824)
FT                   /codon_start=1
FT                   /gene="CUPC13"
FT                   /locus_tag="MICPUN_64545"
FT                   /product="hypothetical protein"
FT                   /note="Possesses a Pterin_4a domain. Pterin 4 alpha
FT                   carbinolamine dehydratase is also known as DCoH
FT                   (dimerisation cofactor of hepatocyte nuclear factor
FT                   1-alpha)"
FT                   /db_xref="GOA:C1EIE3"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE3"
FT                   /protein_id="ACO67667.1"
FT                   /translation="MSRASLALCLAANHLRLFAPAASSASSRTWRRKDLNPFVDRARDA
FT                   SSVTRFPACGRAVPGASGGAKKRGTDVVAMASLPKGEGAQELIAQSCAALGACSRDTPK
FT                   LTAEEVQIRLKAVPTWTLDPSGAAISRSFTAKNWQCAVDFVNALSAVAEEEGHHPDVHL
FT                   TNYRDVRVTASTHAIGGLSLHDFVLAAKLDTIDVTYSPKWLRENAEPVGE"
FT   gene            complement(522846..523844)
FT                   /gene="CUPC12"
FT                   /locus_tag="MICPUN_64546"
FT   mRNA            complement(join(522846..523464,523720..523844))
FT                   /gene="CUPC12"
FT                   /locus_tag="MICPUN_64546"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(522939..523464,523720..523826))
FT                   /codon_start=1
FT                   /gene="CUPC12"
FT                   /locus_tag="MICPUN_64546"
FT                   /product="hypothetical protein"
FT                   /note="expressed; conserved uncharacterized protein cupC12"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE4"
FT                   /protein_id="ACO67844.1"
FT                   /translation="MGGAPQAEIGHDVAVIDLVLHMYSRAPTRKRLAELWAKYTEDSET
FT                   ERKSKGFELVRVHHQTLTRMFCDDPDGEFLDIDDIRCVWEEFVDALRDASAKAGDPQPR
FT                   ASSLDYSDVEQPAIKRSPSFAKLVKDLSSEATAPSSPAIERVSGKGMILGVGCSSRDNS
FT                   ARGGSEYFRRMQAEKGKMDGAALMDQLQKKGLTRNLSGTFDADAAKN"
FT   gene            complement(524227..524958)
FT                   /locus_tag="MICPUN_109586"
FT   mRNA            complement(524227..524958)
FT                   /locus_tag="MICPUN_109586"
FT                   /product="predicted protein"
FT   CDS_pept        complement(524357..524719)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109586"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE5"
FT                   /protein_id="ACO67845.1"
FT                   /translation="MAGAFSAMPGMGAAGYPYMGYPYMTPGMPPAAGYAVQSPYYGYPQ
FT                   ANMYAAAGVYGQQSGASGGGGGKGGKGGYGGYGGGGQRSNYSQPPAPPAPPSSGNGNDS
FT                   SQFNYYGNYGQSAYGR"
FT   gene            <527508..>528278
FT                   /locus_tag="MICPUN_64548"
FT   mRNA            <527508..>528278
FT                   /locus_tag="MICPUN_64548"
FT                   /product="predicted protein"
FT   CDS_pept        527508..528278
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64548"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIE6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE6"
FT                   /protein_id="ACO67668.1"
FT                   /translation="MSSRAHVTGDAKANVGTAGKGMTTNDRAAREILRRMFSVEHKMGL
FT                   QAWWMKILLLPDQNARVTRLAYTLELYAVISGLVLFFVADFVDVDADGVLGKISTIFAV
FT                   FSVLNLLSVIACCLSLGFGVVTTTGPAEVVLLLQPLGLEFIQIVFGTFCGLIAFALKLA
FT                   DQTDGIVLYGSMSMAALFLPYVFGQTSWYVISLDPLEQRHQWFWFKSAFGPLYMLAHVR
FT                   FGPNKPHAEEMLEQYLAQMPEDVRALALGEEGAA"
FT   gene            complement(<528474..>531590)
FT                   /locus_tag="MICPUN_64549"
FT   mRNA            complement(<528474..>531590)
FT                   /locus_tag="MICPUN_64549"
FT                   /product="predicted protein"
FT   CDS_pept        complement(528474..531590)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64549"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5622 - intracellular; GO_function:
FT                   GO:3676; 3'-5' exonuclease activity - nucleic acid binding
FT                   [PMID 8408]; GO_process: GO:6139 - nucleobase, nucleoside,
FT                   nucleotide and nucleic acid metabolic process"
FT                   /db_xref="GOA:C1EIE7"
FT                   /db_xref="InterPro:IPR002562"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE7"
FT                   /protein_id="ACO67846.1"
FT                   /translation="MGGGRSRHRAPLLGTAAVLASDDQSPPLEPPGREAMTSENLRAWI
FT                   AANDAPNVELVRCPANTPDVQSSADALGVAVDRIVKSIVLCCDGAFAVCVTNGTARVDH
FT                   KKIARRLGVANKRVRLATRDETLVHAGFAPGTVPPFGHRVALPTFVAIDLTTSFDPDAY
FT                   VYGGGGCVDVEVRCTVRDLLRLTNGTVMDVKRDDDVRVNKGAQLDGSTQLDGTAGSNVD
FT                   ATGDDARVLPLDPALDERVGPARLPIAKRVADVMGRSPEMESEVDGESDEIMSNVDGEL
FT                   REDVRSLAMPAWPAPRPREDDPTAPRAIETAAEVLRVRRVARFLAFATLRPLAPLRVLE
FT                   SDETNGLNPNSDAPAQARAGDTKRHALSLPAGTELQLIAGRTLLERVPGGEAAAESTLR
FT                   GLRPGAVVRVTGRLQANPRPLTVDVVASTVDFVEGNEAVGMLARATTVTTVTTTSIGDP
FT                   TRVMPPASPGVTHTAWSRSKRLDKKREKKRLEAEAKAGLGPDTDDRYDDRYDDADGRRE
FT                   LLRGLRVGERVGKMRKFPPLGSGRVTWVDDASGIGTMRTAVLDPSTRRRDDRYDDRYDD
FT                   RYDDDDGAAPDAPWVVGLDAEWRPHKHSPVALLQVATRREAFLVDVASLMRRDEGGDRY
FT                   DRYDDRYDANAEAFDAFLRDLLDAPDVVRLGFGFEYDLSRLRRGYAGRLSSLERRRENA
FT                   NDEDTDERRVNEFGETGHALGTRIVDVKALALCAFPDKQKLTRVGLATLVASVLGAYVD
FT                   KTEQCSDWERRPLTTDQVDYAAADAHVLTVLFDRCFNHAPAAVAEALADPAAPLARAPG
FT                   RTEGADERTRSRAGGGKSRRDEESRRRGGRVPGSNPTFVAPLGPPPRPDEVPSMVGDVF
FT                   EGRKQVAAAFGGGEGGERSGRGGGADECGDFLALFVNVGRTNRRYANEFWVEEVPGSNP
FT                   TSRGVVMSWFPGGGGLREIASALVEAPSEEGVAEGSEKSVSAVKTPLLFLRPAKGAYTC
FT                   VGRLAPVRTRVSGEGGARVDFHLVDAPVLRERDPEAFSRLVDVGPEGFS"
FT   gene            <531830..533919
FT                   /locus_tag="MICPUN_64550"
FT   mRNA            join(<531830..532735,532819..533919)
FT                   /locus_tag="MICPUN_64550"
FT                   /product="predicted protein"
FT   CDS_pept        join(531830..532735,532819..533082)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64550"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE8"
FT                   /protein_id="ACO67669.1"
FT                   /translation="MSSLSLACAPTPLARRRLSRAETRAPAVRAASARGTIDDDTSASS
FT                   DTPTAAAPVGRRSSLLAAATAMTTSAMTSFAPVPPRSFAASADAFGTTTNMRALAKAFE
FT                   EAMAAGADYDAADRAWTKAIELAPLNSAAWSNRGTKRLQAGRWADARADLERSVELSPD
FT                   QNNPDPLTLNNLGNAEGALGNWDAAMADYLEASKDPSREMESIALANLALAKFQVNDVD
FT                   GSLRVARTILRRDPEFWDVRALATAALWASGRETDAEAEWQALCRSGRGFGAPVSAENA
FT                   RDGRGGIEGDVAYAARLLEQQVAQQAAVVRGTIGADGARRDGREFGGNGGGGGGGGMGE
FT                   NAPCRMYESTAIVAPRWPPRCTAALDAFLKVARVGEALDYDGVVKRYEF"
FT   gene            complement(<536724..>538454)
FT                   /locus_tag="MICPUN_98380"
FT   mRNA            complement(<536724..>538454)
FT                   /locus_tag="MICPUN_98380"
FT                   /product="dead-box ATP-dependent RNA helicase"
FT   CDS_pept        complement(536724..538454)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_98380"
FT                   /product="dead-box ATP-dependent RNA helicase"
FT                   /note="Has WW, DEAD and Helicase domains; The WW domain is
FT                   a protein module with two highly conserved tryptophans that
FT                   binds proline-rich peptide motifs in vitro; The DEAD box
FT                   helicases are involved in various aspects of RNA
FT                   metabolism, including nuclear transcription, pre mRNA
FT                   splicing, ribosome biogenesis, nucleocytoplasmic transport,
FT                   translation, RNA decay and organellar gene expression;
FT                   GO_function: GO:3676; ATP binding - nucleic acid binding
FT                   [Evidence 8026; helicase activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1EIE9"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001202"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036020"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIE9"
FT                   /protein_id="ACO67847.1"
FT                   /translation="MVQGTVSSAGLPAPWQEVHAEGLTYYWNTETNVTQYERPVAGQAS
FT                   KPAIDYSYLGGATEGGALGNNEAGGEEEYNAPPPDAYKRGGGLGVTDLNYQTTEDGAEY
FT                   RRRNEITVKAPHGIVVPDAMQRFTDWEWPRELMDAVDRAGYKSPTPIQAQSWPIALQGY
FT                   DLISVAKTGSGKTVGYLFPGIMHIRGRQGPSFPRPVGPTVTVLAPTRELATQIQDETAK
FT                   FGRAIGMYSVCLYGGAPKGHQLRELRHGPQIAIATPGRLNDFLESGAVNLGSSTYVVLD
FT                   EADRMLDMGFEPQIRKILQRAPAQRQTLFFTATWPRAVVRVATAILTNPIQVNIGDTDT
FT                   LVANKDITQVVEVCGGFQKQQRLMEVLRNPPTQPLKAIVFCGTKKMCDQIGRSMGGMGA
FT                   VIHGDKEQRERDWILNQFRSGRVPVLVATDVAARGLDIKEVNMVVNFDFPNQIEDYVHR
FT                   IGRTGRAGNKGWAHSFIEPGEGNMARKLIPILRDAGQDVPAELDDMARRGGGSGKPSRG
FT                   RGGGRGGGFRGGGGGYGADRGGFRGGGGGYGGGGGYGGGGGYGGGGGGYSNGGGYGGGY
FT                   "
FT   gene            <538821..>540002
FT                   /locus_tag="MICPUN_104406"
FT   mRNA            <538821..>540002
FT                   /locus_tag="MICPUN_104406"
FT                   /product="predicted protein"
FT   CDS_pept        538821..540002
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104406"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIF0"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF0"
FT                   /protein_id="ACO67670.1"
FT                   /translation="MATTAATKASFTALGLAGGFAVSALAAPHVAAEDHAWMNHATSPT
FT                   VGYGTVDVANALLAALMPVARCLDMRDATTGKVYDVEIKTIGSQFTTSAIAMRLARNSA
FT                   MVYSQVVGKWITEMAEIEAEADLHKGVYQRPVPVIQWAEPRKRAMQGFVRETCVQLARR
FT                   LLERAAVAFLDARTCRKMIKDYARSATRKCVRASWEHGDLTRAGKALSMASTYARANVI
FT                   VAGGEFVVASTIMAFFCRALYSSRRSGKGFDTADAKDDDTADDEDDEDAGDASTASLPG
FT                   LAASEKKKGGKKATVAIDDSRLTFVVLELYARMLVGNAARGLCVVAGGAVGAGLVAALR
FT                   AKDCGSWDPKWCGRMTIVGAALGEIVGASVGTRAQRSVPGVGPVVEALARKRK"
FT   gene            <540063..>544184
FT                   /locus_tag="MICPUN_64554"
FT   mRNA            <540063..>544184
FT                   /locus_tag="MICPUN_64554"
FT                   /product="predicted protein"
FT   CDS_pept        540063..544184
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64554"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR002625"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR036063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF1"
FT                   /protein_id="ACO67671.1"
FT                   /translation="MANGKTPERDRAVISKCSVAIAGHTTRPLPCLFHHVALLRIGIGR
FT                   CGSAADMSAALRVATVTPRALPHRAASGATAGPSRDPHPRWARLGPRRRATPPLPESTR
FT                   RLSAERTRATARASTTDESSQRSGGEARQNTTDGVARIARREALARVEASLNRNDDWRQ
FT                   VLAVIEGASRASGVPPARCVRTTRLWGHAGARWDLPAVLAVLRALDGADFAACVRAVGE
FT                   KGGARDALEVYKEGIKAGYHRDDGGASRAAMAWVHDGIGQGKQADALWVDMHAEAKLGR
FT                   VDVAKCARVAAGLNNWNRGVRRRKDQSPPPDAASCADDDGLTNHRSMESIVEEVYALEI
FT                   ASKARRRPRAAADAYESLRDYIRRKNREDPSGDTSGAKNSSLRSRSLPTRVYTAACRAA
FT                   SALRDPRFARNVAVDIVGDGDCVADDYMVASLAPVIGASGTAAAADAVEALFQSARRGR
FT                   HHAWGAEGADGGADGYDDGHDGHNSLGGAAWSCVIGALCRAGRTTRASELLDEMASEPF
FT                   MRRWPSCPTPGGAMPVHATTGGGGARSSIFDLSVGADEKNDGDEAAAAWAADAKRARRA
FT                   AAQRRAAAPAYAQLMHALLASRSSRRGARAALDVHAKMAAHGVVAPENPRHYRALYKAM
FT                   LRGGGAGGRRMSPMQAAASCVADAVVRSEHLELTTGSSSNVVKSRAASAARASLHVAAV
FT                   AGLPDVSSRTLENLRAAGVAPVPEDLELTLEAFERAGDAAGAVALWEANLAALDQLKRE
FT                   SESVHGGREGREGRDKGAYDARRVGLGGLGCEPTRRAWTSIIKAYCDAGEPVGAARLLE
FT                   DAVRSARAVISADSRAAGKKTKKAKNGKANGTVGRRKNGATAGVELVAFNLVASAFSRA
FT                   NEPRRAEAILRAMLDDPHGDGVVPKPDRATFNTVIDAYAAVARPKRSTESQTHAQPTRS
FT                   QLNEDSNTELNGDGFDDRYDERYDDDRYDDRYDDDRYDDRYDDDSEDACDAASRLLREM
FT                   RSPKVRLEPCLKTWTSVLSACARAGAPDRASEVFDRMRAAGVTPDAKAWTALMQAHACA
FT                   GDLHATADAYWRMRTEGVAPNEGTLGAALAAGRVGGGDVGALIAIYRDMRALDVRPNNR
FT                   GFRQLTEMWVDQAFEPASGGASSGSVQSSHPSHVVHPNFMLADVLGPEVDGPAESIASH
FT                   ESAVVSRDASDLSGSMSDSPMNSPMIDVHGLSVPETRAAVLSVLQALRERRKLGLAVHG
FT                   NLVIVTGVGKRSPSEPPLRDAVVKLAGDLKLSVDVADDNPGRLVAREATLLAWLDRDRN
FT                   ETWSKERELVASVRVPRGKSSKSSSESRGFRVGANRSSRRSGAGGKAGGGGGAGRRYVG
FT                   RRGRGAPRPTPTTGGLDSALRQWLDENDGD"
FT   gene            complement(<544255..>545118)
FT                   /locus_tag="MICPUN_64555"
FT   mRNA            complement(<544255..>545118)
FT                   /locus_tag="MICPUN_64555"
FT                   /product="predicted protein"
FT   CDS_pept        complement(544255..545118)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64555"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF2"
FT                   /protein_id="ACO67848.1"
FT                   /translation="MGDDASAERLRRGGYTRERVRFTSRDGVVLAADLFLPAGASRASF
FT                   DDDGDDAPGPRTIVADPAFRDGAPHAMVTCHAHPKFGGSPDMMHRLCAHVASSGCAVVN
FT                   LHLRGAGSSGGRGSWQGTGGEVDDARAALDFAVARLRANTVHLMGYSFGATVLGAVIDH
FT                   APQVATYAAIAYPLGTYHAWSKGLAGFGAKLLMRAHCAPLRASAVPKLFVIGTADCFTK
FT                   RSTLERFARGCAGEEGSNAYVEFEGADHFGFVASPWSGRVCDTVRGFIADVAARSRATG
FT                   GTGPVG"
FT   gene            <545523..546670
FT                   /gene="FTN"
FT                   /locus_tag="MICPUN_96750"
FT   mRNA            join(<545523..545705,545951..546670)
FT                   /gene="FTN"
FT                   /locus_tag="MICPUN_96750"
FT                   /product="ferritin"
FT   CDS_pept        join(545523..545705,545951..546535)
FT                   /codon_start=1
FT                   /gene="FTN"
FT                   /locus_tag="MICPUN_96750"
FT                   /product="ferritin"
FT                   /note="Ferritin, an iron storage molecule. A chloroplast
FT                   transit peptide is present; GO_function: GO:8199 - ferric
FT                   iron binding; GO_process: GO:6879 - cellular iron ion
FT                   homeostasis"
FT                   /db_xref="GOA:C1EIF3"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF3"
FT                   /protein_id="ACO67672.1"
FT                   /translation="MSTVIASSLSARVAVAGTARGSSTRKSSSIAANPRSRRAVVAMAG
FT                   PSKDATKETALTKPFEAIVEARNSHPIADNRSDSFARTSHFTKECEIAINEQINIEYNV
FT                   SYIYHAMYAYFARDNVYLPGIAKHFLKESLEERGHAELLMNYQITRGGRVELQAIMPPQ
FT                   VEYDHPEKGDALYAFELSLSLEKLNNDRLVALHRIAEDAEDAALQDFIEGELLEDQVKS
FT                   IQEVSEFVAQLRRMGNKGDAVWHFDQMMLNREA"
FT   gene            complement(<547274..>547561)
FT                   /locus_tag="MICPUN_88779"
FT   mRNA            complement(<547274..>547561)
FT                   /locus_tag="MICPUN_88779"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<547274..547561)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88779"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5524; mismatched DNA binding - ATP
FT                   binding [PMID 30983]; GO_process: GO:6298 - mismatch
FT                   repair"
FT                   /db_xref="GOA:C1EIF4"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF4"
FT                   /protein_id="ACO67849.1"
FT                   /translation="MLLTGPNMGGKSTLLRATCVAVVLAQMGAPVPARSCVLTPADAVF
FT                   ARLGGAGDRIHAGESTFLVECAEASAILRGATRDSIVALDELGRGTSTFDG"
FT   gene            complement(550441..551430)
FT                   /locus_tag="MICPUN_50808"
FT   mRNA            complement(join(550441..550542,550924..551430))
FT                   /locus_tag="MICPUN_50808"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(550445..550542,550924..551260))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50808"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF5"
FT                   /protein_id="ACO67850.1"
FT                   /translation="MNNQFTRSAASLHADLLHGDLGGTLAGRAGDGLATLHADLLVGGD
FT                   ARRLGGDVRGGVLLHGHDGAAVGNERLRVLGGGAVGDVLDGEAVGEGGGGRHEEERGGG
FT                   TGSLGGEGRGLLLLGGDLGGLNLGDSADGGVGGDGEHFLV"
FT   gene            complement(<551460..>553819)
FT                   /locus_tag="MICPUN_88758"
FT   mRNA            complement(join(<551460..552054,552100..553439,
FT                   553583..>553819))
FT                   /locus_tag="MICPUN_88758"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(551460..552054,552100..553439,
FT                   553583..553819))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88758"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EIF6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF6"
FT                   /protein_id="ACO67851.1"
FT                   /translation="MSPPAVPAEGPVPAAVDGADGWTACFRDCCRSDRVNLAVPKHEFA
FT                   AKLLPIHDGPASAVFLGRFGDKAVAVKKPKLPTKAEIDRYHVELRLMLSLNHPNILTLC
FT                   GARASPPEYYLLFPYQENGSVSRLVHEQRWAPTWGAALILLQEIAAALAYVHDRGIVHR
FT                   DIKPANVLIGADWVARLADFGLAEDETALRESLQASIYQTEDAEGKAVAGRYVGTCRQG
FT                   TAAAPSGGFQKQHMVGTLAYMAPEVLMRRVPGFPADVYAFAIVTAEVCTGTAPYADRAR
FT                   NVALAHTVLDLSYNEADLAKAIASEGLRPSLPGEAGAAYFGARESEDGDDPLAWAPSAE
FT                   KLRAAVERGWSADPNARPTFIDVQRDLDAIAESYRASGGRLARVWRPPIGGVGQPRAFD
FT                   DLASVHSWPRAAPERAGTYPARFPPMTNRARVCNAGVFSTCGARGADKMEDRHVVCNAV
FT                   EGIEGAHLIGVFDGHRGAECADFASRNIAAALTSTWHAHGDPGEALREAFTSVDAAFVD
FT                   AFERSRSSDRSGVGARFPGCTACVALVLGDVAYVANAGDCRAVMCVDYDSDAHVALTRD
FT                   HAADTNEDERLRIENAGGSLRLVPNGRGGDTWRVGAAGLAVTRAMGDADCKRDGVTAMP
FT                   EVTKVDLTPAHEYLVVACDGLWDVVSDEECVKMIKDTVKEPNMCAKRLGSEALTRMSGD
FT                   NITVIVAFLKDLATSEKVTWERAFTTNAI"
FT   gene            <554194..555466
FT                   /locus_tag="MICPUN_64560"
FT   mRNA            join(<554194..554307,554420..555466)
FT                   /locus_tag="MICPUN_64560"
FT                   /product="predicted protein"
FT   CDS_pept        join(554194..554307,554420..555334)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64560"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:31072; unfolded protein binding -
FT                   heat shock protein binding [PMID 51082]; GO_process:
FT                   GO:6457 - protein folding"
FT                   /db_xref="GOA:C1EIF7"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF7"
FT                   /protein_id="ACO67673.1"
FT                   /translation="MRSGGGGKDFYNILGLQRNANENEIKKAYRKLAMKWHPDKNQDNK
FT                   DYAEKKFKAVSEAYEVLSDPKKKEIYDQYGEDGLRADGAGGGAGGFSARDAEDIFAQFF
FT                   GGGMGGGGGNPFGGGMGGGFGGMPGGFGAQFGGMPGGGFGGHGHGHGSRREAPARKKAD
FT                   PIEQVLRLTLEEMYYGVQKNLKLTRTVIRGGAEQRVSETLTIDVKPGWKKGTKITFPEK
FT                   GDESPGVIAADIIFVVDEKKHPQFERDGNDLITTKVVDLHEALLGTSVFITTLNGKSIN
FT                   VDIPEIVSPKYVKVLVGEGMPLSKSPNSKGDMKIKFDIRFPKELTGEQKAQLKSILGSA
FT                   QY"
FT   gene            complement(555398..557177)
FT                   /locus_tag="MICPUN_64561"
FT   mRNA            complement(join(555398..556174,556481..557177))
FT                   /locus_tag="MICPUN_64561"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(555546..556174,556481..556814))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64561"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:9523; integral to membrane -
FT                   photosystem II [PMID 16021]; GO_process: GO:19684 -
FT                   photosynthesis, light reaction"
FT                   /db_xref="GOA:C1EIF8"
FT                   /db_xref="InterPro:IPR007826"
FT                   /db_xref="InterPro:IPR037269"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF8"
FT                   /protein_id="ACO67852.1"
FT                   /translation="MRLPQQTRQPIRCSHSCTSKVINSTTVFGLPRPIRTRNWPNEIRI
FT                   RARESSEGTTASIVAWWGGIFAPASTQHTSQLQPRIMSCIAAAGLIPLRAAPVRRAASA
FT                   KSSKVRFPEERARSHPRAPPRTGDSTRASGRVRAERTGAASHARFRRAPRVLARSPPDR
FT                   AMTSPLIANPRARPRLATKFSPIPPPPPSPPSQTQAVVVAPRAAARTEVVAKASPQKLA
FT                   ASVAASFPAFAAPAAFAAQEVNQVALEGVNILGVIATALFIIIPTSFLIILYVKSASEG
FT                   NVSGGFSQKYYDESKKRGDKKTNEAAVLKGKGLGMRPSK"
FT   gene            complement(556491..>558459)
FT                   /locus_tag="MICPUN_64562"
FT   mRNA            complement(556491..>558459)
FT                   /locus_tag="MICPUN_64562"
FT                   /product="predicted protein"
FT   CDS_pept        complement(557158..558459)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64562"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIF9"
FT                   /protein_id="ACO67853.1"
FT                   /translation="MAPLAMSIVSTPLAGVAVHRPTPTGAADRRIPRALAVRCRAAAAS
FT                   SPADAPPMGATRVWHCPPPEKERKAQQACSTISKLPPHVLGDGGLDPATQSPQNQQAYL
FT                   GSLAERFLPVNLSYKDVRVLNVDPPVFAIPRFVPADECDAIVAIAKGGKKLVRNVKRVE
FT                   LGAKLPAPVADGAPALVQRLMELSEDCKTFVRCDGAWLEGSVASAWGADAGLKAAPPPG
FT                   AFAFEMPQLCVTAKGKTSDPLPDAYDTDAANAIGSQRRAMVRVFLSDPPVDASPGADLP
FT                   SPGADSSSSTTPDIDRDAYSLKFDILDLALAPAKGTAIVTFPSFADGAADERAACVVRA
FT                   PAEGPPTCWMDLPIAVGLDEGGIRKPVSMSDVVVEKVGTDVNVGDAARSRNRQEWRADV
FT                   KGAGPTGDAEATETDGAVAEAARKKLDELKKQGL"
FT   gene            complement(<558635..>560350)
FT                   /locus_tag="MICPUN_64563"
FT   mRNA            complement(<558635..>560350)
FT                   /locus_tag="MICPUN_64563"
FT                   /product="predicted protein"
FT   CDS_pept        complement(558635..560350)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64563"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EIG0"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG0"
FT                   /protein_id="ACO67854.1"
FT                   /translation="MFLDEFEFVKRLGEGAFATVWAARRKDPGGPNHGKLYAVKHLKQA
FT                   DDGVAGKGLLGTPEFRSLKFIARHPNVLRAVQVARERGQVFLVTEWCDDNLLSIVETAR
FT                   ERGLGRVPEDVTRAALSHLLEALAHCHDARWAHRDVKPENILVARGVAKLADFGEACEF
FT                   DGDDALRTYVGTRWYRAPEQLVFEKHAPNEYRVINARWRNPGAADVWAAGCVMCECYLG
FT                   HALFRGNSSADMLRKMADVLGDGGGFDDANQSSKELIREWPIAANDDACVPRGPDRLAD
FT                   AFGGDGIGADALDLVRAMLAVDPARRITARAALAHPFFSSREKAAAGAVVLPSSRMMEP
FT                   SAATVRAPAGASNGHARTFQKTDDDDDDDAERRRARIRAAALAQVSDSDDDEFDFSPSA
FT                   AAASASITSAPEATRTVAAALPEDAIPATPTPEAVAAMDAIRRAHSRAEASAAPPPPAA
FT                   GIAAGVAGVRLDASRPAGSGTKQQDQTASPRSNRPLPPPPPPARKKSLLDDSDSEDDGF
FT                   HAGVVRPTGRSALTSRRVGGAGVAADGVVPRGRTDGGGDSSSDEGDGARRIVPL"
FT   gene            <560616..563053
FT                   /locus_tag="MICPUN_64564"
FT   mRNA            join(<560616..560687,560893..563053)
FT                   /locus_tag="MICPUN_64564"
FT                   /product="predicted protein"
FT   CDS_pept        join(560616..560687,560893..562968)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64564"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:9055; iron-sulfur cluster binding -
FT                   electron carrier activity [Evidence 16491] [PMID 51536]"
FT                   /db_xref="GOA:C1EIG1"
FT                   /db_xref="InterPro:IPR000283"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR010228"
FT                   /db_xref="InterPro:IPR015405"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG1"
FT                   /protein_id="ACO67674.1"
FT                   /translation="MASLFRTGAVRAREALMQRARVFGAGGARGMSGETVPVFVNGEEH
FT                   QVPKGVTVLQACEQAGVDVPRFCYHQRLSIAGNCRMCLVEVEKSPKPVASCAMPVMPNM
FT                   NIKTTTPLVKKAREGVMEFLLINHPLDCPICDQGGECELQDQSLIYGSDRSRFTEYKRA
FT                   VEDKELGPLVKTVMTRCIHCTRCVRFATEVAGVQDLGVTGRGGMAEIGTYVSKLLTSEL
FT                   SGNVIDLCPVGALTSKPFAFTARSWELRTAESIDVTDGLGSNIRVDTRGTEVMRVVPRL
FT                   HEGVNEEWISDKARFSYDGLKRQRLDQPLVRDDKTGKLKPATWERALEVVAAKIKATDP
FT                   ARIKAIAGKLSDAESIVALKDLMNGIGAGNTVAEGMDGVAADARSSYLFNSNIVGVEDA
FT                   DVVLLIGSDPRVEAPVLNARLRRANVAGGTHVASIGPHGDLTYPVEKLGESASAVEALV
FT                   AGKHPFAQRLKEAKNPLVIVGAGLLRRGDRDALLKQIHKMCDDVGVVDPAAGWNGFNVL
FT                   HDAGGTVAALDLGFVPSTSAASAPDVAANPEMVFSLAAEDFDAPANAFVVYQGHHGDAG
FT                   ATKASVVLPGAAYTEKYGTYVNTEGRAQRAMPAVAPQGQAREDWKILRALSECVGAPLP
FT                   YDTLGEVRARLADIAPHFAKTDEVEPALWLNGATYAHVGAKAKVDDASPLASSVANFYM
FT                   TDAISRASATMAKCTKAKAAQ"
FT   gene            complement(<563177..>564223)
FT                   /locus_tag="MICPUN_104415"
FT   mRNA            complement(<563177..>564223)
FT                   /locus_tag="MICPUN_104415"
FT                   /product="predicted protein"
FT   CDS_pept        complement(563177..564223)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104415"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR005031"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG2"
FT                   /protein_id="ACO67855.1"
FT                   /translation="MRAAEASRPAALPASTPNAAPNAASADEDIESRANDRLRLKYRGR
FT                   RCPRWRLRGGDASTGAKVKTRSSRTKELMYDDDGGAPFERCANTKDGIAVWMRAVPGSN
FT                   AKEVLAEATFAKTPARAFWRAVCDVERYQEFVPFVKRSFVCKDARSDSAGGGGSVWVYN
FT                   VVKAPVVGPRDFVIKIESAPRGADGSMKCAWHVPDDGVGPPALSGHVRLLKNSGGWELR
FT                   EASAGGGVAVRYRVLTDPGTALPGFLVDLANQSSVPDVMRAFNARATSGVYEREDAAAA
FT                   AARTGAGSGSSRFLAGLVSGGVAKELEELLQWGDFGRITTSLSARLRKMATALDARVGD
FT                   RRSANDAS"
FT   gene            <564348..>566297
FT                   /locus_tag="MICPUN_64566"
FT   mRNA            <564348..>566297
FT                   /locus_tag="MICPUN_64566"
FT                   /product="hypothetical protein"
FT   CDS_pept        564348..566297
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64566"
FT                   /product="hypothetical protein"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG3"
FT                   /protein_id="ACO67675.1"
FT                   /translation="MRLPTGGFELRAATRGRAETLRRGRSRRRFAAAARRRLASRPSGR
FT                   TAGDDAGRTNGQRHARPSEVARDDRDWPRTFLSVASNAPVASDVAAVKRCASLKRVSTR
FT                   FVPFAHRKEGIFPTKDISPFWVGCTVRRSETYEGSWKIFAPPIVHQPELARRVTHTRKW
FT                   ARGAERGSRTAMSALATLLALLTLPVLCDAQFNLRPVIEPLSKWPCSDWTWQNCPQPIP
FT                   VGGLSGKEWYELTRWNDRTYGGTFGVDGKTPGLDVNVTSAQELYDALEDRRVARINVTK
FT                   SFSLEFVPSSTYYDDAFDDITGGEGGEAGGTTRVEPFRWPVVGYPISRDVTVRAGPQCL
FT                   ETTEGHCTIDVARATLFVVLEDGELTMADLRLRRGGGRLGGFMFMKGGSRGDFNNVHFL
FT                   EGQYFPDAGKEPTAHGGAVMIANADRTKKELVPPVDPDTGAVNKDAGSYRDVPVPGNIT
FT                   FTKCVFADNQVTNGNAGAAWVKTRPGSSGWVIFDECVFSRNQAPNGWGGAAWSGSGRVI
FT                   FAACQFIDNAAMGGGALQMVEGGLIGGSRFAGNRATERAGGAVFFYGHGNGLVQECEFE
FT                   RNSAVTEAGAVFVYGRAIFYKNEFAQNAVVNGLWKDVYICTDGDCKGYPDATRAFYDPP
FT                   YEPFAELYPRPPVL"
FT   gene            complement(566111..>567222)
FT                   /locus_tag="MICPUN_113700"
FT   mRNA            complement(join(566111..567153,567181..>567222))
FT                   /locus_tag="MICPUN_113700"
FT                   /product="DSBA oxidoreductase"
FT   CDS_pept        complement(join(566497..567153,567181..567222))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_113700"
FT                   /product="DSBA oxidoreductase"
FT                   /note="Blast hits of this protein are mainly bacterial DSBA
FT                   oxidoreductase. This locus has EST support for the 3'UTR"
FT                   /db_xref="GOA:C1EIG4"
FT                   /db_xref="InterPro:IPR001853"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG4"
FT                   /protein_id="ACO67856.1"
FT                   /translation="MAVKTISIDVVSDIKNLERALAAAKPRLVSKDTTFTTTWRPFFLM
FT                   PPEMWRRGVASGEFPPDAETVGINKLDYYHSKFGGPARVAPMVERLAGIMRSLDVEYNM
FT                   DGNTGPTLDGHRIAAYAERAEGLDKQNAFMEEIFKSYFTMAQAPCDPTVLRDAARRAGL
FT                   DMDEVDKVLATPTAELGEVDEQLQRFARGVSGVPYFILSDGKRRIRMSGAQPPEQFLDA
FT                   LEQLGAIEDA"
FT   gene            567767..569126
FT                   /locus_tag="MICPUN_109592"
FT   mRNA            567767..569126
FT                   /locus_tag="MICPUN_109592"
FT                   /product="predicted protein"
FT   CDS_pept        568209..568994
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109592"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG5"
FT                   /protein_id="ACO67676.1"
FT                   /translation="MVVCAGSPRAASTAECTLAEHVLEYMMEDEHRAGRLQQEKATYLG
FT                   YWNYHLHQLCSDGFDCENKYPADLRDLWTRDDWSNALSNVDGGGDIRTEMDNYYSKRDS
FT                   VEASSVVIAKSHEFDETLLTMCDRRLVLTSSRDKEEVFDSALSLGWFTQPKEESRWWFD
FT                   TYYDLWQQWGHCWVSATQGDENTARFDLNFKQLSTEGSFRAVVRLMAYELAKVLQLDDT
FT                   LMDMNGIVDKVVERDFQRELNPALTNGGLRTATAEAASN"
FT   gene            569485..570828
FT                   /locus_tag="MICPUN_109593"
FT   mRNA            569485..570828
FT                   /locus_tag="MICPUN_109593"
FT                   /product="predicted protein"
FT   CDS_pept        569497..570666
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109593"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG6"
FT                   /protein_id="ACO67677.1"
FT                   /translation="MHVPAAAPASATATAAKVAGATVALAALAVCALAASGTAGHLQSS
FT                   VSSLGAWGAPAEPNPFNTFAPQCEPDLRHNSCGAMGELCQCLDLQPGLVEISSRALKSV
FT                   LDKANVFILGDSTSKMMVHHACRTLIDPAADPQGAGCFKEDGMPTVYSQPQNLRPLSPN
FT                   PVLIPHDEKCCSGGQCCMTMLESMVSSTCGQYDSNGNFGGIGFVHMASSFKDGFDMPCE
FT                   YRHAQNLPFTFQERATEALRQFEKSVSFADERRAVIILDVNVWMGGTANAKAHYMNIVK
FT                   MTKNAIRNSGLPIDRTLLMIKTLYDCHDETQWHCARNNQLIREVSSESGMPLFDFDKLW
FT                   KEHGLDPTRALRRDGIHQMPDTALFEITSMLDFIARHHEELAITKQPPP"
FT   gene            <571203..>572480
FT                   /locus_tag="MICPUN_50816"
FT   mRNA            <571203..>572480
FT                   /locus_tag="MICPUN_50816"
FT                   /product="predicted protein"
FT   CDS_pept        571203..572480
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50816"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG7"
FT                   /protein_id="ACO67678.1"
FT                   /translation="MAPFNEDAPLLDAKASGAERAFIGVPVSSGGRSNHSRIASVARAV
FT                   LVAAIACTCVAAGANHVLHRISFEPHANGIKSFLGWAPDGLDVPLNPPEVTLLAACHLV
FT                   PERVPAFRTAINSWIKAAHDENGLKRSFDKVILVDWSSEADLWGETAKAWGGAGIPTPL
FT                   SFYKVYGTNGEPLKWQLAKAVNFGLSKVTTDTVLKVDCDTYVERGLLELNPLQNHAGDR
FT                   KIFRYGDYRSAKDENEIHINGCIMARMDTLRAVNMYDERLQQYGWDDSNLYDRLRDSGA
FT                   QDLNITRRNAAGHTYITHVWHPHSEMSQDARVGASCVNRCAVNRLERYNPWKNQQRAEY
FT                   NEIAEAPPNIPSSITFHSYRGGSLPSVLDILGKETADLLATYCKNSQYAAAKCYGWSDW
FT                   SDGWDFKEEPDTDKDVRWATEKLKAM"
FT   gene            complement(<572717..>576038)
FT                   /locus_tag="MICPUN_64571"
FT   mRNA            complement(join(<572717..575334,575681..>576038))
FT                   /locus_tag="MICPUN_64571"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(572717..575334,575681..576038))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64571"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5509; hydrolase activity - calcium
FT                   ion binding [PMID 16787]; GO_process: GO:9166 - nucleotide
FT                   catabolic process"
FT                   /db_xref="GOA:C1EIG8"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG8"
FT                   /protein_id="ACO67857.1"
FT                   /translation="MTSTATMTASARGRVACSPRAARAPLSGRHGWRPRLNRARGSSRR
FT                   RARLAAVVLASRRGDAPAGGSGETRRLKIFSVNDGERRTARGETRRFVGNLINPRVPAR
FT                   TAREGIPPRSMGMEKVYELHNLSALRCFIQDNLEPGEEFLCTLNGDFLSPSLLSSLDLG
FT                   AAAVSAMNAVPVTHACLGNHEFDHSIEVLGQRLAELDCDVVNTNVFACPPGEEDASAAA
FT                   AAAALASEASVPHPELSVGRRRRGGGGAADGEEDGGEDVEEDVEEEATSAFLDRLPRSR
FT                   VVTVGNVTVGLIGVCTTSTPLSSARKPRGVVFADAVPVAREHAKRVAPLCDAVVALTHQ
FT                   TLPEDARLAEEVPEIAVILGGHEHTPFAGRMGHGANAAASVGRSSDTECVNDLAGTLCV
FT                   KAGMDAENVVVVVVEAPGADPSSTIGADRGGECTAEAAAAAAAAAAATEAATEASAAGR
FT                   KNRDDFGEGGLWRNNVVADPGSAPAERTTTTTTDDDDRPSCADPAPSTNVALNHGHAHD
FT                   LHVAPASVAPGAEIGTEVTVRRPGSGVVVSARMYSLRGYRTDPGIDADIWRRSEVLRGL
FT                   NQHTLSLHEHAARLGLTPLSSRDARVAQCSLGTLFATILRDECRADVCLYNSGGIRGNV
FT                   AYGGEPLTYGDLVAEVPFENNIVTLEMYGSELSAAIAFSEAERVRVTRAGGSWGGYLQW
FT                   DAGVAVSRASSESPDESPESPESPESSSESSSESSSESSGAGGRGGASGTAAGREVDVD
FT                   PAEESSWRVDAVFGEAFDPNRRYRVVTWAGLLDGADDIPVFRDIGRRLAAGLADDCEED
FT                   DEHCEPATVAISGSDGIPFKNLVMRHLCRRRWLELVTACGSFEALDTDGDGAVTASDVR
FT                   DALIKHTHSLSADQEAEAMVRSFDGDGDGALCARDVDELMEHFRGERFERSERFAADRA
FT                   KTQAEETARFDALAAGGGGAKAARSAGFAKDALRRGVRGSGKSRGEEVQARGTRARRGG
FT                   EL"
FT   gene            <576792..>583694
FT                   /locus_tag="MICPUN_64572"
FT   mRNA            <576792..>583694
FT                   /locus_tag="MICPUN_64572"
FT                   /product="polycystin cation channel family"
FT   CDS_pept        576792..583694
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64572"
FT                   /product="polycystin cation channel family"
FT                   /note="Polycystin cation channel; GO_component: GO:16020 -
FT                   membrane; GO_function: GO:5216 - ion channel activity;
FT                   GO_process: GO:6811 - ion transport"
FT                   /db_xref="GOA:C1EIG9"
FT                   /db_xref="InterPro:IPR013122"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIG9"
FT                   /protein_id="ACO67679.1"
FT                   /translation="MFGGFMKTKKKDEIVEVPPPPEDKDSRWDLNEDGKLDAKEMTHLG
FT                   RADASKLERYLEADVDGDGVLSNNELRLAEEGEDQFARLKTLRKIKEAYVYRRNKKRDY
FT                   MSLFLFSVFLGLYLGILYEQTQAESAYGIVWTMQNSVVPQNENTDEDQLVYSSKDNIFS
FT                   WMKETFGPIWADPKCGDGECSRQTEYPGFGKFGCTADCGPYPPEFLSTLHIDIQPSYKV
FT                   DETDAVMSDLGDKFLSESSWNLCTKQLEKDDKTGAAVESCWYDVEQKFRARAGRTERSI
FT                   ISPGVPGMDWYVKLKTPYGGTRGTVYVVDTSTTPRKRTPVYAWDYCSHTWSTKEPKIIA
FT                   EEAGAPAGFIFNMYKHSDDTLIKPPTPAPPSPPPPPPPLPPMAAGLKASLSLKGYTKAT
FT                   FGLDEQLAFRESVASLLGGAKFRRDRIVITAIEDVAASSGRRLLRRLLQTSYEVKITFT
FT                   VALVSSADETAMATNITSRVLGDADAFIKKMNASGATNVSVPSGGKFVLNNEGVMAPPP
FT                   PSPAPPPTPPRPAKNTNCTWASLQSLKTSGNLPVNAELGPGAGQCEDTELNPNGIQNGT
FT                   SCNLKCTVPNPPWGAPTVKCGEGVPEPSGVCHFCVFAGDADGPGDFSMVCQMDSNNPNL
FT                   VDSCDESHARCAMNSDGDDDDYSCSTPHDGDTMDTCNMCLSSGHIGLDGIKNCDGTCTP
FT                   GNTSDPCFKGYTVSSGSHGRRKLLFEYDAPQPSYDPHGGSGGSFYDYNDPYGGSGGSFN
FT                   DPYGGSGGSGGSFYDPYGGHDTGSKTGDTFGSWGPSPSDEPTLLGGGPASNVKYDSPTS
FT                   KVFLGSKSKTCAAGEKKYLLLSHIDQMANEHRYKVWVTDYNSGRPFVDPANYLYQGDGW
FT                   ANNVDFMNGYDLETDTENYVDGDTSGTKAATKIYGKTPRYSNDGVDGEAEYRYDVFPNA
FT                   VELCVPTSGVTKLTMVINVITDGYGINNQATFGEDRADRISDREFIPSFAIIDEDGCFA
FT                   EPASGEACSDTYNPANAWDQPKQKGGAGANNHLFQFCPKWHSSYALAEGSRTVTVDLRQ
FT                   SGNECKKLSELQKISNPSNAIFLPEVALMEAIEEGYGETGKFELFSKLITDKKDGVACP
FT                   ANFEEIHLLIESPDATLDTFSYGIIAEQDYGGDATTGTGKYTNARMSGGTLLSPERYLT
FT                   SSTGAEISAKFPMRINGDVAFDCVQDVSTATPTVKSSYDDNVVYGVFNYEVAYKQANTY
FT                   YMTTVPKYLRGRCAYKGKKPKLEVVKKCVKTGEQYKLHVFRAERYVQANSSSTDSKIFI
FT                   TDKNGCEIADNATATVPKRAVDRFEPATDASNSFTVSQVAGSYKIDPETGIDNCPAGRK
FT                   KIYAPTFAARATGTKDGTVKATCPSGKKLVEVVTQNSWDGAKNAWTVQHVVFNDTELLK
FT                   GTKYTAAILSEATTFMFREQSVDNALQIDFWCLHPGNYSIKLTDSSVQSSTKDEGWRGG
FT                   GVLVTDQNDCEIYNEKPTKKVPDASYFVVKSTTSTTCSKKSYNKTQGFCTYDLDVMGKL
FT                   CNTKDTRSASADAVGKKCLASVCANPKCHTPMFLQDKTYLRTKDDLLKGCCKHYSNALG
FT                   DTLTGFPVPKPANATPPIPIVETVRKRFVATKNVIIGGLLLHQTRFAQEACTGKFGKNI
FT                   SGDVCPSSVKTASSPFGVDPTFIVGSNVYDAATQSMLCCRPETGAVLNATNASSPPAAG
FT                   SNNDADDDVGADDGAFAVKAGAFYKKSELNEEGIPLGFYHKSLGSREDGFSVLIDVNLR
FT                   ESQFNKVISYLEDGFYLDKYTKELNAELLTYNSMGRCFTYTKITFKFSEGGNIIVKYSV
FT                   DLAKPQPYWYAPGDAKGEQEHYGRIIAESVFCLLVLATAWGEFMELVSIVWKTGTAKEY
FT                   FSSAWNYIDLVSIALHITCVALWIAQLVALREFDTEARYDVYKDITQDARMLELKDGGS
FT                   HLEKFVTDVVDSFDAIIQIQGAYATMNGINIFLCLLRFLKYCDFQPRMGVVTRTLSLAF
FT                   QDLAHFIALLLIILFLYATMGTIVFGSKIEQFSTYIRSLRTVFTWSVLGDDVGVGDELW
FT                   DVDNLGPMALVGILYYMTFSVLMIVILLNFMIAILSEAYGEVQKASSETSSFVQEVATL
FT                   ISKYFKAKFSGGAILTDAAALKRIKGMIAAEERERQKFKKMYGMRDVANAGVGRSFTRD
FT                   PNDSDYSDEDDVIDKDGMVSFVGVDDDDINVDELRRTLEHGKAASRVAVGDGVAKAKSG
FT                   LGDTGPLFDSIITSIGERMEKRKLSDQEKKVNEIHSLSLLMYKQQQDMMKDMDQLRGRV
FT                   SAQEQKTQGAPKV"
FT   gene            <584001..>585320
FT                   /locus_tag="MICPUN_64573"
FT   mRNA            <584001..>585320
FT                   /locus_tag="MICPUN_64573"
FT                   /product="predicted protein"
FT   CDS_pept        584001..585320
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64573"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8168 - methyltransferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH0"
FT                   /protein_id="ACO67680.1"
FT                   /translation="MSSPAMCLARARRSLVAAKRASSGSAPWNQPRVAAARRSPAARPH
FT                   GASCAAVPRSDGAGLTPPAAETSSCFACPICAGAMIRRASSSSTGGGALACALGHSFDV
FT                   AKDGHVNLMVGRGSRATGDTAEMLAARRRFLNAGHYTDASNVANALIARALDDFLTRDT
FT                   GQGEDDREDSKTMAIQGDDVAITPRRRRIAANKRRSRAARPAPAAPPPPLVVDFGCGEG
FT                   WWLSRAIDAATEAADAGIAPGKMKNKKIVFAALDASPAAARLAARILPPDVAEVAVADA
FT                   TGAATPLPLADASVSVALSVFAPRRPSELWRVLRPSGVVVVVSPGDDHLAELRERGTRE
FT                   ALGVLDVAGNKRGAVAEAFVSVGFVAEAEERVAGSTALSLANLRDVVGMGPSAFHGTEE
FT                   SAAALEAFFEARAIAGEYGERRVRVTKSFVVQCFRKPLER"
FT   gene            complement(<585396..>586676)
FT                   /locus_tag="MICPUN_64574"
FT   mRNA            complement(<585396..>586676)
FT                   /locus_tag="MICPUN_64574"
FT                   /product="predicted protein"
FT   CDS_pept        complement(585396..586676)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64574"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EIH1"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH1"
FT                   /protein_id="ACO67858.1"
FT                   /translation="MSTETDELRRLETCAAGSYEIGELVARGGFARCVVRHGRGTSVVI
FT                   VFPFVVAAVACRATARFRAPRADLHRAPASLPTIRSVRACRRADDRGEPLVVKVTSLGR
FT                   GADGGGGISVAAARRVAAEVRALLALDGTGGAVPSDDDDDDDDDDASRALFPRLHDFYL
FT                   VTGSPSAPSHPVESHLVTTMCAGSRDLRAYIRAARADRRVGLPESQARFYLVELAAALH
FT                   AVHTRALLAHGDVKPDNVVVDAITGHILLVDYDLAKPLPNHRQTIAKRPPPNDHRQTAI
FT                   AKRVVVAGTEAYASPELAAGAAPDAASDWWAFAVVAYELCHGNVPFEPGSGVASTHRVC
FT                   FPPPTSGGPSPGVSEDMKGMIVAMTRRPVAAATDRLGGWSELVSCGVFVGLERARRGGV
FT                   PIEEGWVTLPGDAWGTGGSSFPARNDA"
FT   gene            complement(586749..588215)
FT                   /locus_tag="MICPUN_109594"
FT   mRNA            complement(586749..588215)
FT                   /locus_tag="MICPUN_109594"
FT                   /product="predicted protein"
FT   CDS_pept        complement(586787..588205)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109594"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIH2"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH2"
FT                   /protein_id="ACO67859.1"
FT                   /translation="MIKLFLLLTINSAVIPLLVFADIPKLKFVPYLFEGPYKDFSVGWY
FT                   QDVGQLISTTLLINGLVYPMSALSKGLTPKITRGCLAPFAATQRALNALYEGVEFPLSE
FT                   RYAQLMQMVFTGMVFSSGMPCLLPVAAMFCFIAYYEGKYTILRASRMPPSYDETMAKIF
FT                   WSVMPACAWIKILLSTWMFSYEHVPSYVNDGALDPATSPISSGSQFNFKTRLDRSNAAI
FT                   CVLVLVMLVVFKILNVYRKGLRAFFARVFPKGLVEEEEEEVSMTPELSIARSDGIMKGL
FT                   TTFLVQENPEYNEIVPSSATKSCGGPNGSVPEWEAAFAEADREESEAEAERQRKANERA
FT                   SRSLFGASDVQAEAAGEMPDAMKKRLKKDKNKSPGAERVPRRKNSQVAPLSGMDAGDDV
FT                   VDFGDDDYYSRGRRAVGEAFEGVTGGGLSAAMAMQPEGDVEAGMDAEEEEEERRRRRKE
FT                   RKREKKERERADRV"
FT   gene            <591023..592856
FT                   /locus_tag="MICPUN_64576"
FT   mRNA            join(<591023..591133,591273..592856)
FT                   /locus_tag="MICPUN_64576"
FT                   /product="predicted protein"
FT   CDS_pept        join(591023..591133,591273..592784)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64576"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIH3"
FT                   /db_xref="InterPro:IPR007064"
FT                   /db_xref="InterPro:IPR039768"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH3"
FT                   /protein_id="ACO67681.1"
FT                   /translation="MFGVQQHNAPGHVLCCMCGVGMPPNPAGMCVDCIRSQVDITDGIQ
FT                   KQCTVLYCNQCARYLQPPRHWIRADLESKELLTFCIKRVKGLGKVKLTDAGFIWTEPHS
FT                   KRLKIKLTVQKEVLNGAILQQTFVVEFVVEWHMCDACSRAAANADQWTACVQVRQKVEH
FT                   KRTFLFLEQLILKHGMEANTIGIKSQPDGLDFYYGSRSHGLKLLDFLQQVVPVRARHDK
FT                   QLVSHDANNNTYNYQYTFMVEIVPVCKEDIVCLPHKVSLGLGGVGPIMLVTRVGASFQL
FT                   TDPSTLRQIWVAADQYYRSPYKPIGSAKMMTEYIVLDIEPADMGRQRAGKYLLADVQVA
FT                   RLADFGVNDVILHAKTHLGHHLNPGDTAFGYDLASLQIVDPELEKYKHGVQLPDVLLVK
FT                   KSYQEKRRRRRQKGVGRGWKLQRMDIAEEEAAGGAKGAREEERRANDEELFMQELEEDE
FT                   DVRAQVQIFRDAAAQPRAAAATNDDEDDDDDDVPEVPIECLLDELSLNRRVDPDVGGGG
FT                   GDEYDEDDGDEYEEGEEDEEMAD"
FT   gene            complement(<592941..>594389)
FT                   /locus_tag="MICPUN_64577"
FT   mRNA            complement(join(<592941..594134,594330..>594389))
FT                   /locus_tag="MICPUN_64577"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(592941..594134,594330..594389))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64577"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH4"
FT                   /protein_id="ACO67860.1"
FT                   /translation="MTEVVQPVDIAPPPVNALVRGELAEFIDYQSFTQDTTDREDHSFC
FT                   GVFFDLSPSDELPLSYVEVTSIWVRGDLGPCTIWTTPDGHGGVPGPNRPNSKVYEQDAW
FT                   RCVYERDHGPSFDEFVEMRFDEPVRLERGKRTGFYVHSKAQGDRAVVYDDQRYGTRGVV
FT                   DDGRLVIWPAVAHLSCRPFGRRAPWGGNALRANRLFVGRVAYGVRWLLWQPEPQCHVRF
FT                   PAGFRRAVETMVLCARQPGCELSRLGDEVIFYIMNKCGWDWFGENMTADGPSFEERKAA
FT                   EQEAYRAREREERRTALRQMFGEGMSDQEVENLMEQVDDNPNLNYMLLNYLMYGDQDDD
FT                   DDDDGGEDEEAEWDPDDDDEEEDEEDEEDEAEWALNADSSGSDDDSDDRSEDFEDADGG
FT                   DEDEDGDGEEPASMDDDA"
FT   gene            complement(<594657..>595724)
FT                   /locus_tag="MICPUN_64578"
FT   mRNA            complement(<594657..>595724)
FT                   /locus_tag="MICPUN_64578"
FT                   /product="predicted protein"
FT   CDS_pept        complement(594657..595724)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64578"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16740 - transferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EIH5"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH5"
FT                   /protein_id="ACO67861.1"
FT                   /translation="MHAGSLLLGASTLRGLPPGASSPRDVPVRSVRALAHPRAASVDDA
FT                   STSSDVATGLGARSSRGDSTGRKGSFTPFIGRRPGSSAQTSSRPALETASTAASTSAPS
FT                   WKDEPAIGPLGIERAHLPRHVAVIMDGNARWASERGVAVATGHEAGVDTLRTIVRCCGA
FT                   WDVAALTVYAFSHENWRRSRSEVEHLMSLLERTLVAELPSLVDEGVRVTVMGDMGMIDA
FT                   NLRAAINDAVDATRRNTKLRLNVALSYGARQDIVNAARLLATEAAAGLIDPEDITEDVL
FT                   GEHLASRTLPAEVREPDLLVRPGGERRVSNFLLWELAYTELYFADRMWPDFGERDFREA
FT                   LAWYAGRQRRFGSRG"
FT   gene            complement(<595988..>597679)
FT                   /locus_tag="MICPUN_104425"
FT   mRNA            complement(<595988..>597679)
FT                   /locus_tag="MICPUN_104425"
FT                   /product="DNA methyltransferase"
FT   CDS_pept        complement(595988..597679)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104425"
FT                   /product="DNA methyltransferase"
FT                   /db_xref="GOA:C1EIH6"
FT                   /db_xref="InterPro:IPR017985"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH6"
FT                   /protein_id="ACO67862.1"
FT                   /translation="MAAMSASGAAAAARCGASILTPRRARRLVQLVRAATAAGGDVEVG
FT                   TAAERETYLEIASRPSRFQESQWGPEDVCVVLLEAMRVQWNHGYPSTPRGYPRTTHGFH
FT                   EYPAGMQAAAADRILDVLPGNSLLDPFAGGGTSLVVGMSKGRETFGVDVSPLAAFVATH
FT                   RTWRPAPGAEEETFEWMRATADAALDGLDAAAVASREEESSPTTGLEPETSSGSTSEEP
FT                   PTTKTGAKRGGGVPRAWLAIRRSLRTALESPTGIEAPPPGLGGTTPEGALWFCLSVALQ
FT                   RSQKGRGKKRHKRGYKNQRRKTRAETENAFKSQLATEAELDAAASFRKCVDEYCDRVNE
FT                   LCACVPVGTPPPVIVNGDVRTLPEASGGGQLPAGSIAAALTSPPYPGVYDYLSFARKVR
FT                   AGSGAALMADGDGSRSPGTDDGSRSPGNGSGSDADSDRHGSLRYFATAVPGDRTWPDEW
FT                   NVGEFGSRRELRRDPRAFKEAWQEDQTRWIDVVANALAPGGRVAIMIGDGANVDTRVST
FT                   IDAGVKCGLTHVASVSMALTHETAEGLVWNAARREHLVLLEKPRDR"
FT   gene            complement(597935..598996)
FT                   /locus_tag="MICPUN_64580"
FT   mRNA            complement(join(597935..598336,598448..598996))
FT                   /locus_tag="MICPUN_64580"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(join(597986..598336,598448..598978))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64580"
FT                   /product="hypothetical protein"
FT                   /note="expressed; conserved uncharacterized protein"
FT                   /db_xref="GOA:C1EIH7"
FT                   /db_xref="InterPro:IPR018714"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH7"
FT                   /protein_id="ACO67863.1"
FT                   /translation="MMRGSDARRKPAVTQPISGHGYGAASRARRGGEAEAASSPCDENV
FT                   ALEMHRDDRWTKHLCASTATRVLLAMALFGIIGTLLPVFAMRLGVRVPQVAKTGPRRHA
FT                   FTAVGLGDGRDHAARGVSTFSGRGVAGLGAYGGETSLIGTPLKPCSGPDQAEATGWDRS
FT                   GSCAWDPTDSGYHEVCVRMDERFLANSASVDGNDLSSVVGHGEHWCVCAWAFASAVDRD
FT                   PTGMEGLQLMCEESNAKLRDVYQHYIDAGEGLTGPTGNSYGPTEALNAVNRLCPEPDAN
FT                   WDVIAQSGLMAV"
FT   gene            <599121..>600587
FT                   /gene="PYR"
FT                   /locus_tag="MICPUN_64581"
FT   mRNA            <599121..>600587
FT                   /gene="PYR"
FT                   /locus_tag="MICPUN_64581"
FT                   /product="dihydropryrimidine dehydrogenase"
FT   CDS_pept        599121..600587
FT                   /codon_start=1
FT                   /gene="PYR"
FT                   /locus_tag="MICPUN_64581"
FT                   /product="dihydropryrimidine dehydrogenase"
FT                   /note="contains IMP dehydrogenase/GMP reductase domain;
FT                   expressed; GO_function: GO:4152 - dihydroorotate
FT                   dehydrogenase activity; GO_process: GO:6207 - 'de novo'
FT                   pyrimidine base biosynthetic process"
FT                   /db_xref="GOA:C1EIH8"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH8"
FT                   /protein_id="ACO67682.1"
FT                   /translation="MSPTAAVARRGARALAASITRLGFAPAHASSRRGLASTRPDAHLA
FT                   RSSSPSSSSPGSGPPRFAALLGTAAASAGAYAFLLDDEQSSAAQFKLFEYLAPAMRLMD
FT                   PETAHNVGIELLARGVAPVETRRDPPALAVDAWGLRFANPIGLAAGFDKDAKAFPALGA
FT                   MGFGFVEIGSVTPKPQPGNPKPRVFRLRELGAVINRYGFNSEGHEPARARLEAYRADTR
FT                   ATQSEFDATPVTPVTPEGAGVPRRLAERGAPVGVNLGKNKLTPEAAAADDYALGVRALG
FT                   HTADYIVVNISSPNTPGLRALQGKAHLKGLLRKVLAARDESALKSRTGGGQTHAHKPPV
FT                   LLKIAPDLTDGDIKDVVAAATSCAVDGIIVSNTTIARPEDVAAHARGGEAGGLSGKPLM
FT                   DPSTEVLFRVYQLTGGKIPLVGCGGVASGRDAYEKIRAGASLVQMYTAFAYAGPALVPA
FT                   MKAELAACLREDGYESVAEAIGAAHRKGGR"
FT   gene            complement(600637..>602369)
FT                   /locus_tag="MICPUN_64582"
FT   mRNA            complement(600637..>602369)
FT                   /locus_tag="MICPUN_64582"
FT                   /product="hypothetical protein"
FT   CDS_pept        complement(600858..602369)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64582"
FT                   /product="hypothetical protein"
FT                   /note="expressed; conserved uncharacterized protein"
FT                   /db_xref="GOA:C1EIH9"
FT                   /db_xref="InterPro:IPR026506"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIH9"
FT                   /protein_id="ACO67864.1"
FT                   /translation="MSLTIKKIPTVLSIHQMDEEEDPKFAGAVRRCCRAGKKLPTLTFA
FT                   PESARDSRLMKKVRSFGSFDDLRVPDIDGYSNEETGSYNSDSDSFSGGGYVQDVSPFDR
FT                   ILLAAWEDRFAAGLFRYDVTACKTKVVPGGYGFVAQFNEGRATKKRPTEFAVDEVVQAF
FT                   DGGKFNFTKADKAEILFAFERGDRAMKSSAYNSAKTIESSPNVMLINVSPIEYGHVLLC
FT                   PRVTDCLPQRISPELLLPPLYMAAESRNPYFRVGYNSLGAYATINHLHFQAYYLMEAFP
FT                   IERAQTTRLPQRVYKKRHRHGVAVNQVTGYPVRCLCFERKDATFEALADLLGNACERLQ
FT                   ERNIPFNLLIADHGARVFLIPQVFSHRVAKGEIPEDVAATGVNPAVFEISGHLLYKQQD
FT                   DYDACTQDAAFKMLACASLGEEEFYETCSHILAETESAKGLSDAMHAAVPEHTNAVVPD
FT                   SNATTEAIEIAARKHRDTADADPGSPTSPPLLSDGDSADGVVPGH"
FT   gene            complement(<602727..>602882)
FT                   /locus_tag="MICPUN_64583"
FT   mRNA            complement(<602727..>602882)
FT                   /locus_tag="MICPUN_64583"
FT                   /product="predicted protein"
FT   CDS_pept        complement(602727..602882)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64583"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII0"
FT                   /protein_id="ACO67865.1"
FT                   /translation="MKPGLKEALEYRSFLVKVQTKAFHVITGRGSSSIADGALPYDVVH
FT                   LAGGGL"
FT   gene            <603636..>606812
FT                   /locus_tag="MICPUN_104428"
FT   mRNA            <603636..>606812
FT                   /locus_tag="MICPUN_104428"
FT                   /product="predicted protein"
FT   CDS_pept        603636..606812
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104428"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EII1"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII1"
FT                   /protein_id="ACO67683.1"
FT                   /translation="MATPSPLRALVLVLALLVRPLGAGGANEPTAPSPVLAAVTTPSPA
FT                   TALLAVPTAGWGWEPDAPPAGWNASAVKIRHAVRAWRASHTLAGPPPPATQLAPPPSPP
FT                   PSPPLPPCLVAYAPSDGTDAPMRCSMPLADRNVALNGGARPLTNASGGTATHPERAVDF
FT                   AASTTWYESEATDGGQWIEADLGDVFRIVEIVARWTEEAYTPTGVRLSYGRKNDAVSDV
FT                   HDPGYVTRVVLGATGAGADVLGLDVGRDDPIVKSASPDGPVAHSWRAPGLNTNDAGYDP
FT                   SAPFAGAGVDARTVRVEALAVAAGGSRRVRMADLRVYGYKSGEFPPSPPPAVSPPPPPP
FT                   PPPPPPPPPNPDVVVADVVAGCDEGDGYVTSATRARTTGGDELGGDEAAGAKKIWRFAA
FT                   DPISFRAKAVLVAWTCAPGFAPSRTVTYAILTAANAPNLALVPPGESAQRVDVVNENEN
FT                   DGNSNNDGNSNNDSNNDKNNTVVAPASLEFAVDPSELAGATDATVLVSVRDVADPDRAP
FT                   TPDCDSSGSEPELASKGITRLSLASPHSSSPHLRASIPLATLGTIRVVAVTCPGDADKD
FT                   ARTNDDGLDPSASVSSILRVRSPTNAGGANAPAEVSASLALSGGGIGVDEARSVNSQER
FT                   IRRAVAWSLRRDGGSYGKAVVAEDVFIRSIRSTRARSDGGKRRALLSPNPNPNAGVSLD
FT                   VVLSVRDATEADAAAAALESIVASNSLKNSLALEQIVVAVHLGSSPAVRYSEADAANCS
FT                   LVLGEVGRCARGDAEGGGGQGERGCPTVTTVTDLGGLGSPGADGSASPAPCVTINGTGT
FT                   AFFRASSSANDARNETFLADLWSGLNATLNRALSAKTSPSNGTLVPGGSERGSENAAFD
FT                   FAEASPSVAGGCRRWRNVSVAVPTGRFGACVVDVSSTRVLGAVIAAAWEPCPVLEVDAL
FT                   SMDSSSSAAVAYSYCPAPDGPGGDGWFDPRVAVAFAVAVGGVVLVAAPVVWVRRRRREM
FT                   DARGMAIDWDKIAMDAESMDERRRARLETLGLWPGGVGRSARLGGMDGGRRGKGEGPGR
FT                   DGFARLGSRL"
FT   gene            <607250..>608506
FT                   /locus_tag="MICPUN_109597"
FT   mRNA            <607250..>608506
FT                   /locus_tag="MICPUN_109597"
FT                   /product="predicted protein"
FT   CDS_pept        <607250..608506
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109597"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:16491 - oxidoreductase activity"
FT                   /db_xref="GOA:C1EII2"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII2"
FT                   /protein_id="ACO67684.1"
FT                   /translation="PAGVVAITFADLRRRGVIDGMVLCDVSGARVRAARETMARKIGAV
FT                   YKDMDLTMTTLPDDDVDFDPDAFRAAIAHMKRGDVVTIFTPDDTHFKICMACVEAGLHV
FT                   LCAKPIVKRLEDHTALAEAAKRHGVLVAVEYHKRFDPIYVDARDRVRAQLGPFSYFSST
FT                   MTQPKAQLDTFAGWAGKSSDISYYLNSHHMDVHAWSVGRTSRPERVVAMAARGAAERRL
FT                   KPSDNRAIEDTITLMVHWRNDDDSAGVATYTASWIAPRADSHTQQHFHIMGHEGEIRVN
FT                   QAKRGYEMSTDENGFAQLNPLYMKYTPSPSGHFAGQGGYGYRSIEEFVRAAEEVNSGRA
FT                   TIGDISGRDVLATVDTTARVTAMLEAGRMSLDAGGAGVRILYPDDLRDENAAPEKEAKR
FT                   LKNGKAVDCEAEPVGLRLE"
FT   gene            complement(608548..>609874)
FT                   /locus_tag="MICPUN_64586"
FT   mRNA            complement(join(608548..609469,609599..>609874))
FT                   /locus_tag="MICPUN_64586"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(608681..609469,609599..609874))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64586"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII3"
FT                   /protein_id="ACO67866.1"
FT                   /translation="MFALASQATIAPIAAPLRARKAPKTALRRAAVRVNASPDAKSDND
FT                   RAMFSRRQLGLGSAALASLMATDMTVVNPAMAKKIISGKQDLPDIADLVMVFHGLGSYT
FT                   YEKWYKEVFSPFEAGLHSGEVGGPEVGPAFAKVVNLTILRGRNPDAPGGETVAVQMFVL
FT                   NENADPAAKGALTAIQKFFVDTGPGANPFWAEGRDAGWVGTDLTQWSASVGFIRGANPK
FT                   TGYPDDWKKGTGVGVYDFGLKIPYEEWVPQFTSPESDQLHDAAGVFFSAVGPDEKGTEH
FT                   QSKYRSVQVIHAHKNLKQARAFLDRVVKADAPPFDQIKDILDNPEAIALEVVSDTFFPE
FT                   YFPESLFPNPLLNA"
FT   gene            <610639..612154
FT                   /locus_tag="MICPUN_107249"
FT   mRNA            join(<610639..611047,611093..611644,611675..612154)
FT                   /locus_tag="MICPUN_107249"
FT                   /product="predicted protein"
FT   CDS_pept        join(610639..611047,611093..611644,611675..612069)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107249"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3924; GTP binding - GTPase activity
FT                   [PMID 5525]"
FT                   /db_xref="GOA:C1EII4"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII4"
FT                   /protein_id="ACO67685.1"
FT                   /translation="MHVVVLGHVDAGKSTLMGRVLHLVGVVDAKQLRRNEKDAAALGKS
FT                   SFAWAFALDTAETERARGVTVDVAQARFVTPVTPTRPEPTRVTLLDAPGHRDFVGNAIA
FT                   GAARADAAVLVVDAAPGGFETGFGDASSVSSNGQTREHVRLARSLGVSHVIVAVSKMDA
FT                   CGYSEERFEFIKNTLEPFLAKSGFGPEHVSWVPVSGFEGVNLVPGECAIPVPNALSEWW
FT                   SGGTLTECIDDVPTVDRGAPRPFRMPIADVIPNGTSRTLGAAAIGGKIACGSVRKGDRV
FT                   LVMPAGVVARVKAVEFPVGDGDGAGRAENVGHAGDACDVAPGGCLCHVDFPVTVAAGVR
FT                   AKIVTTESVRVPLLVGSRAVVHSNSYAAEATIASIVCKLDPATGEPVVGGAAPRCLTRN
FT                   QGAVVELAFGDRAMCCESYDAVPSMGRVALRRDGATIAVGTIQEAWPADDEP"
FT   gene            <613754..>614935
FT                   /locus_tag="MICPUN_88595"
FT   mRNA            join(<613754..614406,614491..>614935)
FT                   /locus_tag="MICPUN_88595"
FT                   /product="predicted protein"
FT   CDS_pept        join(613754..614406,614491..614935)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88595"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4437 - inositol or
FT                   phosphatidylinositol phosphatase activity"
FT                   /db_xref="GOA:C1EII5"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR006239"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII5"
FT                   /protein_id="ACO67686.1"
FT                   /translation="MPSAVATASTTDGDDKVTRHFPDEMRAACEAVRLASIVCVETQRT
FT                   LTSGEKVSKSDDSPVTVADFAAQCIVTSVLRESHPDIQMVAEESADDLRGEANAPLLDR
FT                   VTSLVNKVILRADSEKEKPEDGSMVRLMFNEEVADAIDRGGKTDPSRSGKYWILDPIDG
FT                   TKGFINKRQYAIALALMDDGEIVGGVLGCPNMPSEPIPPGSTEIPTEPPGVVFFSATDA
FT                   GAVMRIATEVTHTHGRDASYMESWGDSIVAAHDATRELTRALGVVNPPVRIDSMAKYGA
FT                   LARGDTDMYLRFPPKTYREKVWDHAAGAAVVTEAGGIITDGAGNGLDFASGRFLDVEGG
FT                   IVASSTAELHEKLLKQIEAQGLVEK"
FT   gene            complement(<615071..>619005)
FT                   /locus_tag="MICPUN_64590"
FT   mRNA            complement(join(<615071..618469,618565..>619005))
FT                   /locus_tag="MICPUN_64590"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(615071..618469,618565..619005))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64590"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR008862"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII6"
FT                   /protein_id="ACO67867.1"
FT                   /translation="MAPVGVPVRVRAPAADKDAIHGKKEKRERGVSLDLGSSERPQRED
FT                   EDREGGIDKPDTPGPFGSPPARSPLPKRLKMRLERQELPAEDIAARVDARLAAAERKRE
FT                   VRARTKKPSPRSCLKSQSAPEENGRETRRFSSCQTKENQNFASEEALERTRAKARAASL
FT                   RVRRAAVNRARHQSELAEAHRRKMDAASANRSSFLERRRTVARRLAAGARHRADDDDDD
FT                   DDASSPRAPAPSPDAAADSIRRAWLSFRSEGGTTEAVASRYRHLGLSSATAVSSVDFDA
FT                   FARRLSTPSVLRATRAMLTRAQHRLAARGRDRPSAGASTGGAAVTPGHRRFLPPRSAKE
FT                   NNPNGALDRRDSLDSVDEAFPTRVVLCAYMIVAHPETVLSPGSELRDDEDDENEDENEN
FT                   ENEKEDEKRGGLRKSNRRWGGRDGTLHASAGRLVAAVDAMVDTSVNGAMSRPSVDAFVA
FT                   AWDPYLTDFCAWKSADAVALERELVAAAVALETSHLRTCGSDSRSQPFHPNSDEAAVRE
FT                   ACDVDKATLRSKVVALGGVEAAARFDDAMASALAKVEAEEDENAAEKVSDKSETSDTSS
FT                   SGDAEEAARRRKERTARRMDARAAMREARTAAFRRRVAERAAGADPRAAAAAASSAGGG
FT                   LANEAMMHELLIDPDWRLAGPSDATRAFKTAQDEPNRHSGREQSPESRIREQMERAFWA
FT                   QAVESIAAVADVDERAERDAGPACDAGRARALAPVAELRAELESLARTREDAAAIDALR
FT                   DDAVAPALGLAARDPSVAGDVLGAAMRGAVAMIRRHESLQSGFDTKRAADARADEVERS
FT                   TAAETAAAVTHSKNGDYPRAARAMARAMTRSLRFCFEELRRVRREGANAALAALAPLAT
FT                   GAEGARWARHRFATRRRLPEPTSSFDADGREKVEVDARLASAALPVTRAWLAAAVPLAH
FT                   RADASLPRMPSAEEWRLKNGSKTLKNAGQNAGQNAGHDGRHDGRPASPSIPTPALIRSG
FT                   RVHAPRIPALLADGEERKVAKRLRADEALRQAWAPTNASTPEGLSRVALASLIADPNPH
FT                   DPHRTLPETLEFDAERLATLQNEFQRIAVSAACVKIARDAVVRAKTLDKSDAKIRDLPD
FT                   FRRRLDVLLADPTVRVPDLAAEIAARVARSAQKPPETFAAAAATSGQKYRPNSVDVAAA
FT                   EAELRGLTDPSAPGGAALLDAVRAALATRLLVGPDIVSATGGRDASAAAVAAAALAQAL
FT                   AAQGLDGEIGVAVAGDVKALAGGAMRSIGRVNWLVHGPMYESVGAELLAEDDEL"
FT   gene            <619346..>619807
FT                   /locus_tag="MICPUN_64591"
FT   mRNA            <619346..>619807
FT                   /locus_tag="MICPUN_64591"
FT                   /product="predicted protein"
FT   CDS_pept        619346..619807
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64591"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR040278"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII7"
FT                   /protein_id="ACO67687.1"
FT                   /translation="MLASTTALQRTSPTASTSAPRLRSRPRVNITRPVGSRAARTGRRG
FT                   GVARTRALFNPFDPESTDDPLLRRALREPVAFFGGVFAGMLGLSVDDEPLREWVDRTSE
FT                   AAGMTRAEEAAVEETAAGGGTGDDDGVDGDVNPGGGDATAPAKDPTPDP"
FT   gene            complement(<619893..>621075)
FT                   /locus_tag="MICPUN_64592"
FT   mRNA            complement(join(<619893..620852,620992..>621075))
FT                   /locus_tag="MICPUN_64592"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(619893..620852,620992..621075))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64592"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR023421"
FT                   /db_xref="InterPro:IPR025939"
FT                   /db_xref="InterPro:IPR035892"
FT                   /db_xref="InterPro:IPR036818"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII8"
FT                   /protein_id="ACO67868.1"
FT                   /translation="MSDVERRFLHDGIKRTYEKALECEGWGDVDAAEDTYRKLNNAVKR
FT                   DVVGNARDIGLTPFETQQIAKLTAMLSLRAKELRRGDDLGIGPDACRELREYMCAFLLD
FT                   PKAEFPFDVAPEAVGERPVELQMEELAIASSSYDANDDRSPPDRWDSSGNGGGGHREPR
FT                   FIPDGVKDGVGGAGGVNRTLTEREGGSLMPPPRLRERGDQALVTRILHFGCKDSGEFID
FT                   PFVTVTVVDGAGNLVEATQDTPVVNRRDVNKVLFDGVAVHAQTPLHELPDDAAVILEFK
FT                   HYKPKKRKISTRGWSFFRLSDLDPDKESQTLALEIYAKPTDLRCRKFGLLSVKPLYFHV
FT                   EAYVRTE"
FT   gene            <621395..>622648
FT                   /locus_tag="MICPUN_64593"
FT   mRNA            join(<621395..621526,621632..>622648)
FT                   /locus_tag="MICPUN_64593"
FT                   /product="predicted protein"
FT   CDS_pept        join(621395..621526,621632..622648)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64593"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:C1EII9"
FT                   /protein_id="ACO67688.1"
FT                   /translation="MERVWGSLAPFTRARCLQNERALFDHLLKDTVGTPPLPARTSRNG
FT                   LQWHAHDTRVSDSDPDDVVHSVVVEPAPAASGDEENGAKNPRVDLVLVHGFGNGGGCFF
FT                   RNVASFGAMGRTHLVDWRGAGMSGRPRSFPPRTYDECVDYLVDGLEAWRASRLDERTRM
FT                   CLVGHSMGAMIATHYAKRYPSRVAHLVLTGPASVKDDSDPARLANFLQGSPLRRLAFNA
FT                   VVLAWRAGVTPQAVARWLPASTAMRIGGRYTRVRWRSGDTLDEDGQEVLARYVTGVVRM
FT                   APGCSEKVMSVFLKPIGRARRALAAVLEDELDATVPVTFVYGDRDWMSPKSGKECAERM
FT                   RAGERRSRLKNAEFHLLPNAGHFAFVDQAAPFEAIVRSKWLG"
FT   gene            complement(622729..>625415)
FT                   /locus_tag="MICPUN_64594"
FT   mRNA            complement(join(622729..624614,625044..625144,
FT                   625345..>625415))
FT                   /locus_tag="MICPUN_64594"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(622867..624614,625044..625144,
FT                   625345..625415))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64594"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3676; ATP binding - nucleic acid
FT                   binding [Evidence 8026; helicase activity ] [PMID 5524]"
FT                   /db_xref="GOA:C1EIJ0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ0"
FT                   /protein_id="ACO67869.1"
FT                   /translation="MPGDWADDNDTLPPAPGGGGGDSGKPAYVPPHLRNRPAGDRDRDR
FT                   GGFDRRDDRRGGGGSYDRGRGGDYGGAFGGRRGGDDYGGRRDDFGGGSRGGGWGGRDDR
FT                   RGGGGGGWGGSSRNYREEDPFAKQEAEDRRANETMGEAGSIAIHKPGEDAPVYGESTGI
FT                   DFDAYEDIPVETSGHDCPEPIKLFADIDFGAAINRNIQRCKFKNPTPVQKYAIPISLKR
FT                   RDLMACAQTGSGKTAAFCFPIIHGIIDRGLQAPRGGRKTFPIALVLSPTRELAIQIHEE
FT                   SRKFAYQTGVASVVVYGGAPAAQQFREMERGCDMLIATPGRLIDLVDRAKISLERIQYL
FT                   ALDEADRMLDMGFEPQIRQIVEQRGMPPPGDRQTMLFSATFPKEIQRMASDFLQDYIFL
FT                   TVGRVGSSHTLITQTIEYVQSYNDKCQMLMDLVHAVQGLTLVFVETKRGADQLEDWLSQ
FT                   QGFPSTSIHGDRTQQEREWALKSFRSGKTPILVATDVAARGLDIPHVTHVINFDLPSDV
FT                   DDYVHRIGRTGRAGKKGLATAFFTDKDSSLARGLVEILSEANQDVPSFLNGFASRGFGG
FT                   GGGRRGGGRRGGGGFGGRDYRGGGGGGGGGGYGGGGGGGWGGGGGGGGGFSRGGGGYGG
FT                   SAWD"
FT   gene            <626042..>626686
FT                   /locus_tag="MICPUN_104437"
FT   mRNA            <626042..>626686
FT                   /locus_tag="MICPUN_104437"
FT                   /product="predicted protein"
FT   CDS_pept        626042..626686
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104437"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ1"
FT                   /protein_id="ACO67689.1"
FT                   /translation="MPKKRKAEANGLDEMDRQLYGTFRTAANSISALYTSSLSLQKRAF
FT                   NAGARHATERLLAWALSHGEGQLSAADLAAALQAELVVLEGEDAALQAAADGVGGGVDQ
FT                   QHGGGADHPGHQHHHAHHQPRGGRNASTSARCQLATIDVNATTHVLNDHQSGLGQKLGQ
FT                   AFTTTGGPVTRSGGGGGGGGGHQHQHQQHHHHPPGDRHHHANLGHESMDDE"
FT   gene            <627110..>629017
FT                   /locus_tag="MICPUN_64596"
FT   mRNA            <627110..>629017
FT                   /locus_tag="MICPUN_64596"
FT                   /product="predicted protein"
FT   CDS_pept        627110..629017
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64596"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ2"
FT                   /protein_id="ACO67690.1"
FT                   /translation="MSHVATPADSAGGSNAATADDGHGANLIAANPVAAAALAGPGGAP
FT                   AQPTPGAAPHHHAHPPPFASNPPGPAHALLHDADGQVWITPTNAASTQGGAQPHPLATP
FT                   QPAQSMQNSVFTARRWVERATGSTSTVGRGAHSGGGEGVDKEDSAGDSNTAAVSEGTLG
FT                   PADSTQAQHVKSGGGSPSRSVGGEEVEGGGSQYSDGGGSLRGGEAVDSHPGFGRAVGGI
FT                   GDGFAEGGDLGGAFAFGAATQGGGGGLNEIGLNETISFVPGAGGGVSGNGSRRTDRRGV
FT                   RGGGRRGAQGGRSSSGMGANERDAPVQVAGAPVQVQSFGAPKPAGSALKGGSVLPPVPL
FT                   FNAAPPGHVRGIDSPVPPGTAAAARAAQTQEAEGECDGLTNPGGLSGMDIGDGDGGPGM
FT                   GYVVPAHSEEHGYAPALASGDMTYSGDGGYVSGGGNSGPGSIGGGGGPGSGPNSGAPSS
FT                   GGLGSGGAVVGTAGGALFDSNRLNSGGNQPSGGFEFGRAPNVPAVAAVSGAGAVVGSPS
FT                   LGGDPFSGPDGSGRGFSGGGDAAAGAAKSQFSNGVPPGGFVYRDTTQHGGNQTLQGQHR
FT                   AVSGSLGHVSMHKNGPTTMARAVVEDGGDDSEEDGEEGVSPAFVPEDGGGEESPADVDM
FT                   "
FT   gene            complement(<629213..>630415)
FT                   /locus_tag="MICPUN_64597"
FT   mRNA            complement(<629213..>630415)
FT                   /locus_tag="MICPUN_64597"
FT                   /product="predicted protein"
FT   CDS_pept        complement(629213..630415)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64597"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5737 - cytoplasm; GO_function:
FT                   GO:8276 - protein methyltransferase activity; GO_process:
FT                   GO:6479 - protein amino acid methylation"
FT                   /db_xref="GOA:C1EIJ3"
FT                   /db_xref="InterPro:IPR004498"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ3"
FT                   /protein_id="ACO67870.1"
FT                   /translation="MASVCNVRCAVRALLRHARRVPSTPSTRVLSSAPRASAAAAAGFN
FT                   GFTRASNPTVGTHRGRPPRTQTALASTLNPEGTIDANLGGGSVDQVRITRVDGSNVGEL
FT                   SDVLLSLGATCCSVEDADLGTERETELYAGDDKVWHMCDVTAMFPSGCDIDAVMADAVD
FT                   ILGVKSIEYVVETIPDNDWVNVVMDSFVPIKVGDGLWIVPEWAKTLPEGEEGALSVVLE
FT                   PGLAFGTGEHPTTRLCLGWLRDNAETCVKGKHVVDFGTGSGVLAIGALLMGAAKATGVD
FT                   VDPLSVKSARRNAQLNGIGDERLALFCADGSDGSDLPQDCDDAVDCVVANILVGPVTQL
FT                   APLFARYAKRGVGRVCVSGVLATQVPTVREAYGKWFDDLTYTEEGGWAVVSGVRNSTPA
FT                   P"
FT   gene            complement(<630590..>632278)
FT                   /locus_tag="MICPUN_64598"
FT   mRNA            complement(join(<630590..631837,632219..>632278))
FT                   /locus_tag="MICPUN_64598"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(630590..631837,632219..632278))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64598"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR009604"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ4"
FT                   /protein_id="ACO67871.1"
FT                   /translation="MSDRLAFLCKVLRGYAVEVTLTKDTFQVVLKMAELKVTTKGERAA
FT                   RAKPVASMSLRLSDLVAIKACDVGMSDLAVGPSRTAGDLFTDAGISRGERFERELVAWA
FT                   PTGDDHGLSDAGGLLEDPAMRSNKNGKGGWGGSGQSGAGGWDQFAANKSKFNVDTTFDE
FT                   NLYTTSIDKNAVGISEAEADRIAREIMSQGSTNVHVQEERGLRVTADYDEEDRYGAVIG
FT                   TGAAAGGAHSAKPAVPKAPAWGGSGAGVTAITGKAAPPPKPHSPPPPPKAKDTDEKKPA
FT                   TADGEKPKSTLNPNAKAFTLSAKAAEFKPSFLTKKPAAPAAPAIPPAPGAYPIGMPGMM
FT                   PGMMPQYPMGMPGIPPNMMPHMPAYGAPQYRGAPPQQFQGGRGGRGGRGGQQMGGFSPQ
FT                   QQAAMAAAAAHAAHAAASAGVPPPPAAPAPPPAESA"
FT   gene            complement(<632668..>635244)
FT                   /locus_tag="MICPUN_64599"
FT   mRNA            complement(join(<632668..634959,635092..>635244))
FT                   /locus_tag="MICPUN_64599"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(632668..634959,635092..635244))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64599"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ5"
FT                   /protein_id="ACO67872.1"
FT                   /translation="MKVPRPGERMRSHPLYRRKLKSKVVFDDQRPGWDSTSRDLTKYKL
FT                   TDEQVEARRKQFVSKNLAAAKEELRAREDPTTLVVHPWNPPHRSPIHPAKSFGRIVDKA
FT                   NGGDGPRADESPSPPKVRGRNMAARGGGLGPVRFSPMKTSGGQHTRASLDRTFESVPGT
FT                   NPSTNSSPAKPAEPHPPRPTPLSHEAETSGSARRLGEPPTQHNPRAEVPFAKAKSPITK
FT                   TQKLDAASRTKKATDRARSLGFRPTRAPEAFTNPNGTGKPTTTDRGAPTSSGPTVPFEE
FT                   EVERFRVARLRRKMEHSFEEDKYDDDEAFDEEEAPVASDSPRRIHVRDEDDAYDPDVDP
FT                   FGSGVRARDAEDPIQAVRDARIELRAMQQLREAATRTGNENHKNRVGWSDGWMAGTSTA
FT                   DVRARQHELMAAQEAIKRQFGEQTEGGSPGSADAAPVSPEPPSTDGAVRRAAAAAANMT
FT                   PMHLREEDAQEMARILRVPPMPTPRAFRPDLKPESGTPLKWGTPAPTKVPPNFKPNDWM
FT                   TKTANDTFQFPPPPPEERGLMTYAAMRDAQVAAFAEHAVRRSIEAENLGPAAVDSGTVH
FT                   TNTPAKPGRKVLAEVGLGVHQGFPEPIKPSTTPAKLPFETMYGDDVDGVARRHVEDAFV
FT                   RLSVGDENFAALRARETEATRAGPGVGASSARFGATTMPDALSALSRDGDVRRSFSNDE
FT                   RLQFGLRDEALAMKRLEAMKTAALKGVDANMAATFPGIRQSLEAEGRIEAGDATGEFVR
FT                   VPRDAGGLSGKGFGGFVRVGAPPTSSGRTPPAWVRVTDAAKAEEAATGGGGVPVPWFAA
FT                   RK"
FT   gene            <635683..638733
FT                   /locus_tag="MICPUN_64600"
FT   mRNA            join(<635683..635750,635870..636074,636134..638733)
FT                   /locus_tag="MICPUN_64600"
FT                   /product="predicted protein"
FT   CDS_pept        join(635683..635750,635870..636074,636134..638647)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64600"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIJ6"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ6"
FT                   /protein_id="ACO67691.1"
FT                   /translation="MSTDERPMRGRQVGHNRWTWGAESASVRNGTDTSSSFYDDDDDDD
FT                   TTDEIYRYGVGPAGDVSVRARPPSPHFTSSSHSRQKKVSEGARCPEDDDYDEEDGRGPG
FT                   PSGRTNGARRAPKLPSPPRVSRPIAPNPPRLSPRDETPDSPLRLTHPSHSSRVRSPVSS
FT                   GSSKDSTEKDSLVGGAAGRGDGGAPVVVPESEWNATMAALFGVPPSGGRRKKKPRDASA
FT                   ADAARRMEAAKKAAARDALRRKAERRVYKPANAWMLGKLAAMYGGFVSLLIAQLFFSAL
FT                   AGYVNPNALWLNERQDQAWRCAVCVALLGVPAMAAHLCGYLLFPPVWGERFPDRDRALE
FT                   ELGGRLYFRFHHSRRRGDSPGRTKKAVEVCVDVLSRTLPSALWEVEVVTDDADLYVASS
FT                   NVREFVYKPDASGDVSKRLQTSPTGISHPRACDLLAHASAQSAAHWGDWIVHMGTDAVL
FT                   NQRAVDSVVFHCARESRLVALSPGKRPCARRGAQGAAYPGLTRTANDVHHGVGPGVFAW
FT                   IPAMAEVARAGECHGSIRVAYGLSQRVTSPIPECFVVVPLELEQSVGHVPAPPRTEMTS
FT                   FALRAQARGARFAWLDAGVHVPSTPGLWRLFRLRVADSAANYALWRQLSSIGTDRVGSD
FT                   RVGTDQKREGNEGNDGGVTVTQSGNNGIDVATRFWFATHCVSSAFAKLAPALVVLGAWA
FT                   KRMPSGSDSLYLACALGGVAALVHFQYAVGFYASSGARHLARGAPGYVLYWILFAFTLA
FT                   LVPVFSAFELVATVTGLFWTPAHTASRRVRGPKEAGSKESSPSRPGDESSDGLLGSDGE
FT                   VRRRVPARKRVPFAWRPRGGDSKVPSGDLEAPLMDRAGGGGGGGGGSSSGDGTDSGEDA
FT                   ERLRRVERESSEKERRRRMSASTTSGLSGSTRGNKQRWGLGSSKASAAPVKSGNHQA"
FT   gene            complement(<638727..>642224)
FT                   /locus_tag="MICPUN_104442"
FT   mRNA            complement(<638727..>642224)
FT                   /locus_tag="MICPUN_104442"
FT                   /product="predicted protein"
FT   CDS_pept        complement(638727..642224)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104442"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ7"
FT                   /protein_id="ACO67873.1"
FT                   /translation="MTVEVARAGRRDDRAPRTPAASVDRRAASPWTDAPGPASPAGPFA
FT                   FRTPGATSATMWSPSDERGRPTSPPRAGAAAPPPSGNVFTHEEKHAQAVRAGEARRASS
FT                   FTARETILDAVRQMMERRAKERERDGRDPPPVDDDDDDDDIVKLRTSRGSLFSVEQIRE
FT                   WRRRAIAAQVAMRWRRKQQRESTWSFAVEDGVRHVLGLGPAPDDPDDGVGPVRAPPSDE
FT                   GYTRRRSGYAPHVLARGGAVAWYPKTKRKPNSKEAPGATGPFGDAREPWEIAADERDAR
FT                   TYERTSRLPYVTAVTPVTPDESPDPAPETSREEREVRREAEKERARRAAAEKKARSATF
FT                   VARAVSVVSAFSPFKKAASSVGAFKESAEDVQELEELSREEEGARIMRAITPGRNGILG
FT                   ALADQRRREREANMPLAMKLAGAAAEQREREDAARKARDAADGKVTAVTRVFQTTRGWR
FT                   FSKEEIDAWREAAVVADVRMRWKRRKRKESTFAWKLEEAARAMLAMGPNVEDMRVARVP
FT                   GKTHSRNVVVSASNGNGNDGNGDSSSVAGASKASRRYDAASTRYEHVSDASLSRGAFVT
FT                   APLAHKLPRVDAIKVAAPAELSREERARIIEGETRGLTARTRSIQANGDFKTASKWRVA
FT                   LKAPTDALKSDVPMDDLDASLAVTKGGVYYQEKNRDLPLATEPKDDTDVAAPVVEKDDP
FT                   YSLEGRRCTCDDTDAIVSGPGRDARTLAKTVRRCPVHFPFGWHSEHRPPPRPAPSKTHG
FT                   VTSDRNTSVGLVTAAGGTDAGYVMYQTSSHFYLASHDYSGTRWRLAKIDRRADSLNVVE
FT                   DENEYTAQDIWALIFAVHRGNEHAGGCEVLARGSGVVAFLQLSATREDDDPAGAAATST
FT                   AAAVARAQALHADRVLRDRRKTRALGDDGRPLDRWEERGDAPYAGGHVAATTMDACLVF
FT                   SGGDAVTVNRRARTRSEALGAQVDGGALVAEVRRATRALMFEEGAADGGRGDDARAAPP
FT                   LGHRVAPAESEFATLEPGETLRLGATHIARLTVGHLTSTEPIRRLGIGRDKDARRIGCG
FT                   ARKCAGGCRGGWSGVVGWGGNCHSCGDAGADDDDDDDDDDDAKEPPPLRELARLEKDAT
FT                   LEAWFGRYVWRGMDDDSESEEDDAPSARLIPANKGRRRGSDPTLIKLRFRRYQAHART"
FT   gene            <642838..645365
FT                   /locus_tag="MICPUN_64602"
FT   mRNA            join(<642838..642922,643084..643330,643573..645365)
FT                   /locus_tag="MICPUN_64602"
FT                   /product="predicted protein"
FT   CDS_pept        join(642838..642922,643084..643330,643573..645223)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64602"
FT                   /product="predicted protein"
FT                   /note="GO_component: GO:5634 - nucleus; GO_function:
FT                   GO:3700; sequence-specific DNA binding - transcription
FT                   factor activity [Evidence 46983] [PMID 43565]; GO_process:
FT                   GO:6355 - regulation of transcription, DNA-dependent"
FT                   /db_xref="GOA:C1EIJ8"
FT                   /db_xref="InterPro:IPR004827"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ8"
FT                   /protein_id="ACO67692.1"
FT                   /translation="MKFGFDASSRDVHRVVQSSDRAPNERGEHSGFRTDVPMTKASVAV
FT                   AAPAKPTGAAKAPKAKADGTKQDPQAGTLSREDIANFKLEDDGGSSDAHSDDGNVEENG
FT                   DLDETKRVRRMLSNRESARRSRRRKQAHLGELQLKVNQLQSENQDLLNKLHQLHVSFNS
FT                   MMARNRMIKDNMAYLRMQIMSGEPLSREALVAATQAVAAGAQTNLQDLNHLVVGGPGAA
FT                   GMNTMLMSSGGQMGVPYVGGMGGMVQGGAGGMNGLVAPQGVGSMAGMGSMGSMGSMGSM
FT                   RAYNLQMSQAMNRGVNGVNTGMSGMFGGAMGGTAQNMAAQNGLGNFKLEAGGGVSEFSN
FT                   ASSLTQQGSMGAGDGPSIRGVKGPSCISDADPDAFIDGGGGPIAEREAALAAAVAAQLR
FT                   MGTPIGSGEVLHQLADQEAALAAQLKTFAAGAAGDGAMRAGAMQAGAMQGAGGVVGGRK
FT                   ISGDEDFRLPDGAAAATAAAARAAAQGRNGRQASDGSCADARRKQRAGSGDSSDARAGG
FT                   GSGSGSGNNSGDGGDSELAGKGQQQQSRGALSPLDHDASPLAAPIAEKPPHIVDQVGVD
FT                   AADSTVLGFLSSPILEGEVVDGWRHGGVDFDDWASTVIDGGGGMGTETKEPGTLGKNAR
FT                   TASMNRVASLEHMAKRAQAAGGPVS"
FT   gene            complement(<645376..>647794)
FT                   /locus_tag="MICPUN_64603"
FT   mRNA            complement(join(<645376..647379,647501..>647794))
FT                   /locus_tag="MICPUN_64603"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(645376..647379,647501..647794))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64603"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIJ9"
FT                   /protein_id="ACO67874.1"
FT                   /translation="MFRRIFGSSSKAEKPNRRGSETRAGGPGPVEEDAPPEPEIVDTGS
FT                   EDDFDDGDATAEPCADACAPELRALFDSNLLSDRRVHAGRISALAASLEAHPAPVPNDL
FT                   APRVVDAIASALNAKTTVTTVTSREQCARLVSAIASHPWNVDVALECLRRCDEAFEFAF
FT                   EGEELQRDVTVVTGHSKRGRKGKRGVSSAKVTWPLHLHVTVAMLRIFGDSFGAPELLEM
FT                   HRDDCDAAVVATLQLLDHAVSSSQGDASRLASRACGLLHALTTPQAHFLEGDRNETPMT
FT                   ELAKGFRRIVGDLTRAFIERDAPRRLVSALETMAIVSSSKAGSREDADASSAAIKAMRN
FT                   LLLHTDERGAQLRKALAQSEMTVRVLEPFLARAVRDARDAETSLCDEEDEDDHRAVTHR
FT                   AVTHREASDDGWRERRVYERKRALRTASAAVADALNALVVATHKDGTLRQRLLCGVGGD
FT                   RVSDTKVGQSATEAASLVPGGVLGVECLACNLNVVDALLRLACNLGVGCGDDGGGAPAK
FT                   GGRERWVRTLTERCIDRLDDDAAVILSTRFAEEVRSAPVVRDCKTHGWLVSLLPEPTAP
FT                   RVVVEAALKGGGGGGGGGKRNRRNRGKSQPGAGGSNNKQRPGGGKTEKEKARKREQRRR
FT                   KKRREKEAKEAGRRRDEASVEGESASSPAIARSPPPRVVGCDAAQVIEVRRSTPKVEDD
FT                   EVVSDDGDGDEGSSLGGDSSGDDVRGVNEFKIGFGASSSQRPVFVNPMFDSKEDTLEGV
FT                   DKLLEEVDRLGF"
FT   gene            <647922..>648989
FT                   /locus_tag="MICPUN_104444"
FT   mRNA            <647922..>648989
FT                   /locus_tag="MICPUN_104444"
FT                   /product="predicted protein"
FT   CDS_pept        647922..648989
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104444"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR019410"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK0"
FT                   /protein_id="ACO67693.1"
FT                   /translation="MSAFGVGASLIRRATSVIASTRRHRVLRRRMHHESGRSARGAPPT
FT                   RTWPMRRRPLGWCVRAGASSYEPPPGGALHTHPLMSITTGGRFTVRDLDLVVDEVDIGG
FT                   ACGTIKLVRPKSEDDVLDMYVEIGREDADPYWAALWPSSVALARGVAGVVLDGREGMDG
FT                   TEQVAMDGGDRYDSSLAGLSVCDMGAGLGLAGLAAAKRGAKSVSFYDREPLALQCCLLS
FT                   AEANGLTVGSVGHAGTVSDRTDADGTVCVAEVFDWNAVSADQRTFDLVLACDVLYEAHA
FT                   VAPVAALIPKLTNEAPRPGRWMLADPPDRAPKNRAAFLEKVKLDHGMELVRERRETVTR
FT                   AGSTDDVLVLDLRLR"
FT   gene            complement(<649075..>652869)
FT                   /locus_tag="MICPUN_64605"
FT   mRNA            complement(<649075..>652869)
FT                   /locus_tag="MICPUN_64605"
FT                   /product="predicted protein"
FT   CDS_pept        complement(649075..652869)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64605"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIK1"
FT                   /db_xref="InterPro:IPR001494"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK1"
FT                   /protein_id="ACO67875.1"
FT                   /translation="MALADATNVVATDAPIATATKTMSQASEVPNAPNPEKLVAALDDV
FT                   ASFDAAKRDAAAAKLDAASAKDAPGLCIALLRVASDDAHGSARRLAAGTFARNLLRKAF
FT                   WTPEKDGASFPDAYRAAVRVAALDALCVAPDGPSRALIAECLRLAGAVPASAIGGSSQF
FT                   TDITSSSSEDPRADLALDVCERLAKRGSFAAAKHESSFVLSPGFLLATHAAARPFQYFR
FT                   DAAKAREAAPEALETLCVKVIAPHVVPMCGCDDARVRRAALKVVFRVVRAYMPDALRGE
FT                   VLRSIVASISRSTLILRARSYEGTASEEDWIAAKRALRLAKALVTRHASMLDSSAFLAI
FT                   VGACVGAAGVEDPTADAADAAVAEAFACLESVLAATREPKPTSDAAWAGLTDLASVSGV
FT                   GSPVGALKDLILECVVPHANLRKIDEERLAEDPEEYARVNAVGDVAIVDVIEEALADGG
FT                   GSGSGVTARNAALEFVQALVTTVGPAVSPGAEPPAKKHKKDTKKDTKRDGEDGDGKAPS
FT                   PTPGESALKDVVDAILAEAPKEKIEKVGKSAAAAGAVATYAAPAAEASLGASKYFGLFQ
FT                   LAASLASAQAQRGRGAKDGAMRLFCQRHAFPAAAATDSPHVAAAAAKFIADALVVGPRT
FT                   SSAAPLLREGVAALIAAIEREWDLKGSNDDDTNDDDGREIDEEGVAAVKDIASWAAKSV
FT                   LEDAPAASEAFGTLAVGAVDAACERLLALVESSPAHSTPALRVLGAMAGAASGAMTPTA
FT                   AAGRIERIVAAFAPFAPSTDEEDDSIEGNDSSIDVPLDAWEASVDACAALVEAANAWDA
FT                   PEGASEGAVDEAREGEMAAAAAAAAHVAAYWRAAESLEPSDDEDEEDEDTAGDGDETDG
FT                   RYDRYAPPPAHAAVASLLRAAAEVLASSRVTDKKTANSARLAANVPRVCAEWARHLPAW
FT                   RRQGEAGLVDDACLDDLRDIVAAVSTAGTAGDDAVAAIAGFGAATAAAVLEDSDDEPTR
FT                   RAAAGALAACVSAPGFPGWSHVPGVPTFPLRFNLLRVALDNAEGATTGRRSARAALHLL
FT                   AAVAASSGFAGDASFAQEWLRVRCECAGVAGWTVTGVDGALLGAHVASLHAALVALVAP
FT                   GAPQPDKQVFGAALDEAVRAAATLLASPEDGCDEDDDDEEDEDDSDGEDDSDDEATIND
FT                   GLENETEEEFLERYAAIARDMADGTADDELNDDDDEGCDEEDSAYQVAFEATRGDGSRD
FT                   AMAFAAWFETWRAGDTRGVRVSSVVDGAAAKALAKAAAR"
FT   gene            <653653..>654232
FT                   /locus_tag="MICPUN_71972"
FT   mRNA            <653653..>654232
FT                   /locus_tag="MICPUN_71972"
FT                   /product="predicted protein"
FT   CDS_pept        <653653..>654232
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_71972"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EIK2"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK2"
FT                   /protein_id="ACO67694.1"
FT                   /translation="LILVWELVRGLDVLDYLNDRGGHVGEDEARHLFRQLLAGIACVHD
FT                   NGFCHRDIKPENCMIETATGVLKIIDFGLSKHLDSARTLGIGTPDYMAPEMLMAASNPG
FT                   APKMAYDPEAVDVWAMGVMLYLMLTGRYPFEDPKQPGVVTATLVRVRAGRMTPLPPGLS
FT                   VEVRDLIGGMCRTDPRRRARIADISRHPWV"
FT   gene            complement(655749..>659561)
FT                   /locus_tag="MICPUN_107250"
FT   mRNA            complement(655749..>659561)
FT                   /locus_tag="MICPUN_107250"
FT                   /product="predicted protein"
FT   CDS_pept        complement(657333..659561)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_107250"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:3924; GTP binding - GTPase activity
FT                   [PMID 5525]"
FT                   /db_xref="GOA:C1EIK3"
FT                   /db_xref="InterPro:IPR000375"
FT                   /db_xref="InterPro:IPR001401"
FT                   /db_xref="InterPro:IPR003130"
FT                   /db_xref="InterPro:IPR011993"
FT                   /db_xref="InterPro:IPR020850"
FT                   /db_xref="InterPro:IPR022812"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030381"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK3"
FT                   /protein_id="ACO67876.1"
FT                   /translation="MPGAHIHQNTLGDGLVPLINKLQDIFTQAGVDNVGGDLELPQIAV
FT                   VGSQSSGKSSVLEALVGRDFLPRGPDICTRRPLVLQLVHTPYQHASHHNQAPMEWGEFL
FT                   HRPGEIFTEFEAIREEIECETNRGTGTNKGVSDKQIRLKICSPHVLTMTLVDLPGITRV
FT                   PVGDQPADIEKRIRDMILSYIKRESCLILAVSPANTDLANSDALTLSRLVDPDGKRTIG
FT                   VVTKLDIMDRGTDAVAYLRGEVVPLRLGYIGVVNRCQQDIAQRRSIREARASEAEFFRH
FT                   HPAYAEVIDKCGTEALGWTVSRILADHIADLLPALSDKIATRRAEAQRELKSLGEGRPE
FT                   DPGRQSAMVLEKLHGYAAGFTKSVVGKSDDLSTASLEGGARIHFVLQDIFVKGLESLDP
FT                   TRAMSEEDIRTAIQNAAGTKGVLLLPDDSFEVLVKQAIRKMSDPCVKCARIVHDELGRI
FT                   ARTLINQQDLQRYPRLAQSVEDATRDFLVEGLVPAESMINSLVECQLAHINTSHPDFVG
FT                   GSQALRMAQQELKRRRGASTAAGTGADDDEMSGDENDFGEDVLADVTQRNALQRKRDAK
FT                   NKAKTALGRKLSGGSSVDASIDKVKDKENDVKALYSHENGVVSLKEPPGRIQASEPETD
FT                   EELLQVLVTRILLGSYFAISRGVLADTVPKAVMHFLVNSVQRGLQQHLIQSLYHPNLVP
FT                   SLLTEHPETEAKRLAARNKYKALSAAAAAIGAMPADLAAAGVGVGGRR"
FT   gene            complement(659813..662121)
FT                   /locus_tag="MICPUN_109598"
FT   mRNA            complement(join(659813..659829,659938..662121))
FT                   /locus_tag="MICPUN_109598"
FT                   /product="predicted protein"
FT   CDS_pept        complement(660683..661996)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109598"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIK4"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK4"
FT                   /protein_id="ACO67877.1"
FT                   /translation="MDSIQSLGGKCTVGDVASAAGVKLSDAENAMKAIAADTGATLEVS
FT                   AQGDILYVFDRDFRSLLNAKSTKIKTVEPLVEGAGKVGGYLLRISFGTTLLASIVIVYT
FT                   AIAALLSNRDERDRDERRGGGMGGGMFFGPRMYFSPFDMFWYWDPYYYERRSYYAAMEG
FT                   AKDMDFLEAVFSFVFGDGDPNADFERKRWALVGLCIQRNNGVVTAEQLAPFLDRDEDSI
FT                   GTDDESFVLPALTRFNGAPEVDPASGEIVYRFEDLESTAGGVAAIQAVLDEIPRELGVT
FT                   TSVAEEERYKFSLATGGQRTMAAALGVFNFVGVVALGVLSSDPQIAMQKAQLVAAVGSL
FT                   LPGLQAYAVAFFAIPAVRWFVCQRRNAQIDARNAARLEASKQIARPGKLLKEKMDAARR
FT                   MATGRRTVTEGSGVFSSGKSAADYEAEDFERRLRERNQ"
FT   gene            complement(664447..666977)
FT                   /locus_tag="MICPUN_92573"
FT   mRNA            complement(join(664447..666403,666517..666977))
FT                   /locus_tag="MICPUN_92573"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(665548..666403,666517..666896))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_92573"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIK5"
FT                   /db_xref="InterPro:IPR001998"
FT                   /db_xref="InterPro:IPR013452"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK5"
FT                   /protein_id="ACO67878.1"
FT                   /translation="MKDWLRFSVAFWHSIRNDGSDPFGFPTKRWPWDAAPAGCEDPPPP
FT                   IELAKRRMRAVFELMRKLGVDLWCFHDRDIAPRGDTLEETNANLDEIVEYAAQLQEGTD
FT                   IRPLWGTAQLFAEPHYMHGAATSPSVDVFVRAAAQVKKAMDATARLGGENFNFWGGREG
FT                   YAFLPTTELKTERTHAAMFFKMARDYWVKDLKQKGKPLLIEPKPQEPSKHQYDWDVGTT
FT                   AGFLREFGLEKDFKLNVECNHATLAGHSCSHEIETAVAMDMLGGLDANTGDPQVGWDTD
FT                   QFMTDGREAALVLSAIVRSKGFAPGGINFDAKTRRESTDVNDLLYAHIGGMDAMANGLK
FT                   LAAKLVDPDGALERVKRERYSSWASELGAKIEKGKATLKELEKLALEADGEPAVGSGKQ
FT                   ELADNIIAAVVG"
FT   gene            <667821..>669119
FT                   /locus_tag="MICPUN_88835"
FT   mRNA            join(<667821..668798,668844..>669119)
FT                   /locus_tag="MICPUN_88835"
FT                   /product="predicted protein"
FT   CDS_pept        join(667821..668798,668844..669119)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88835"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK6"
FT                   /protein_id="ACO67695.1"
FT                   /translation="MASPNPRAYFQRYPTLFAPFYGDDERATMLKTIVPNRVWCLEQNL
FT                   AVGPLETPLRCVVIRLEDDSLWVHAPLAPTEEFFRLIERDGIGGTVKHVVVPTYALEHK
FT                   VFARDACDRWPDADLWIAPGQFAFPLEVAAERIYGRTPAGVLGDVSDNSGVYGGAGRTP
FT                   PWTNEIDVKILNSGSFRLGGRDVGLREATFFHRATRTMVVTDCIALIPDQIPPLIDPEK
FT                   LLLVGKRSTADPTPAVGSPGDTPAARLAGWKKMTLLINYFFPEHEEPAPGAPGVVEWTD
FT                   GWEDNFAAISGRLFVPPVVRSLLYAQDPAGVRAWADSVAEDWFKPVVSTPASLTIVPAH
FT                   WDGPVENVRVEDFLRAYRWLDDPTSDPFPEADMARGLQPVIDAVFGTKTKADESQGSGL
FT                   DLFFSSFPTLASRFKGGE"
FT   gene            complement(669152..>671062)
FT                   /locus_tag="MICPUN_106589"
FT   mRNA            complement(join(669152..670661,670760..>671062))
FT                   /locus_tag="MICPUN_106589"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(669207..670661,670760..671062))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_106589"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIK7"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK7"
FT                   /protein_id="ACO67879.1"
FT                   /translation="MDANKAMKTAVQTARGLAYTTSKFTRIKDWRIAVLHIGLSVAIVI
FT                   GLIFQLIGNKSFLLTEVPLGTVTSWSSASDTAKYTGQKTFDAIQTEWSTNNKCSDMSAY
FT                   KFEYDADFNYNNPICSYMSPDELVKKKFDGGLHLATHIHYRKTLRVPAASKAACPDPVP
FT                   NNFNDTTATSAQAKLTYSNGICRYNAEQNLFPLGIEGMNFNIIPGYDTTSKNYAGVKPK
FT                   TFVRRKGSDADVYTFAAGQNIALDVQQLMDLAGLDLDKTWDAQPNGYKPADSEKGYGSS
FT                   ANAYPTLRLTGARIMIDIKYYNYELDDPTTTEMGTDEVYAVVEVGGKVQWESRGQAITY
FT                   RNKVDEWDSPFNKLGQPNGAFEDFYVYGINIDVTSSGIVAKFDIMLFINTVIAALVLLG
FT                   TAKSICDVVATNLLGVKSQLFSKFMREEVDLERECARFAVQALVATHFFKQKDVDGSGN
FT                   LDLEEIVQMLHGAFSKEAFAVATEGLDPEDPKYKKLMKSVLDDDEISALALYLMRCVDP
FT                   DRAKHKLEGTELKIEDIAGKSVNLNDFIGIFTEDNMDIATMRTIITQTSLDEQVAAAEE
FT                   RKENPNTFV"
FT   gene            complement(671342..>685527)
FT                   /gene="ODA-DHCG2"
FT                   /locus_tag="MICPUN_105012"
FT   mRNA            complement(join(671342..678621,678832..682479,
FT                   682549..684774,684856..685255,685289..>685527))
FT                   /gene="ODA-DHCG2"
FT                   /locus_tag="MICPUN_105012"
FT                   /product="dynein gamma chain, flagellar outer arm"
FT   CDS_pept        complement(join(671614..678621,678832..682479,
FT                   682549..684774,684856..685255,685289..685527))
FT                   /codon_start=1
FT                   /gene="ODA-DHCG2"
FT                   /locus_tag="MICPUN_105012"
FT                   /product="dynein gamma chain, flagellar outer arm"
FT                   /note="Flagellar outer dynein arm heavy chain gamma (PF28);
FT                   GO_component: GO:30286 - dynein complex; GO_function:
FT                   GO:3777; ATP binding - microtubule motor activity [Evidence
FT                   16887] [PMID 5524]; GO_process: GO:7018 - microtubule-based
FT                   movement"
FT                   /db_xref="GOA:C1EIK8"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004273"
FT                   /db_xref="InterPro:IPR013594"
FT                   /db_xref="InterPro:IPR013602"
FT                   /db_xref="InterPro:IPR024317"
FT                   /db_xref="InterPro:IPR024743"
FT                   /db_xref="InterPro:IPR026983"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035699"
FT                   /db_xref="InterPro:IPR035706"
FT                   /db_xref="InterPro:IPR041228"
FT                   /db_xref="InterPro:IPR041466"
FT                   /db_xref="InterPro:IPR041589"
FT                   /db_xref="InterPro:IPR041658"
FT                   /db_xref="InterPro:IPR042219"
FT                   /db_xref="InterPro:IPR042222"
FT                   /db_xref="InterPro:IPR042228"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK8"
FT                   /protein_id="ACO67880.1"
FT                   /translation="MGDARVVFLLEKIGETFGVSPDELRGDMDGLGDKVRPFFEPEGPP
FT                   KLIFVYQAPDTVDPKTGAVTRVGAKRLALTDGDGENNPKGITEKFDPKDMSAGSIKGGV
FT                   LSSFNAVLSQMFHPALRVQHPAGWGKLKSKSETEDFVGNVRRFGAVLKEAAASVDATVQ
FT                   LARPDQKYVDSIPLKPLAFKDAADTVETVNHMDSVLLRWVADAEACVEETGASDDDDMG
FT                   PDTELEYWRQRMGLLNSIIDQTKTDECRLVLGVCMAARSHAHKAWKQIDLRLTDASNEA
FT                   KDNVKYLTTIEKSLEPLYASGPKQVLEGVPSLLSNVKMMYTIARYYHTNERMTRLFSKI
FT                   SNQMLMCCKTHLLDAGPDPWTHDKAELLAKLRLTIALYDKYYSEYQATKEKLASQIPKP
FT                   RQFDFNEDKIFSRFGLFKRRCEKLADMFSTIIQFEELAEHKEIVGMEVLITRFFRIVNE
FT                   FKRKPYNLLDFQQNAFDRDYMEFIVGVNELEFSLQELINKAFEKISSTESALTLLGQFT
FT                   AVMRRDALKDDLDNKYVKIFRNYADDLESVQKLYEKQKHAPPLPRNAPPIAGDILWSRQ
FT                   LLRRIEGPMRHFAGMESIMAMKESKRVVKLYNRVATALMTYETLWHQAWVKGVEDSKVG
FT                   LRATLLVRHPNTGQLLVNFDREIAQLIRESKFMMRMDVEVPESARIVLAQEDKFKSYYN
FT                   QLTHTINMYTHLDDEIAPVTRPLLKAHLAELEMVVAPGMTDLTWTSTNIDMYLKRVHRT
FT                   IDNLELVVSKVNDMLHHRIDDNLKDAARIIMVDLPKDELVTLEEFAAIQTKHVKEAADI
FT                   LAIKSEEVRRGCDDLVELIRDTMPEAEPGSLMPLPTIDDEAIAEFKAHFARLMYSAVLH
FT                   STRKSFDVLKQRIASKVSGGFLFIERPLFDVDVELSVPYVQMSPSLDDVQRAVNGVAKK
FT                   MLNASRSIKRWGNTDLNGDEENQPGLCLLLTGAMHGCRTSVEQYLTAFTEFDFLYLQDL
FT                   QQAYEEFMAKKPNLDMFETELQKYMSIEQHIGKIAPVHNIGALSLETQPLKVSLKAEAA
FT                   TWKKQFAKNLHAHGKDQLETIVQYMKDTTLQLNRKIEDLEDVRHVMAIQQDIRIKESEI
FT                   DSIMNPIEEVYGLLTRYEVKVPKEETDVVAELRGNWTTMNALAVSVGENLQRLQAGFKR
FT                   DLVAQVKVFVVDAQEFRKDWDANGPMVDGLAPAEAVERLKDFQTKFAPRKAKWDNFSSG
FT                   EALFGLPVTLYPELEKTEKEIEFLDKLYSLWTNVTQTIGGYVDILWTEVRENIDVMTET
FT                   VTSFQAQCKKLPKAMRDWPAYVDLRKKIDDFLEMLPLIQMLAAPAMRPRHWTRFQEITG
FT                   SELDMAEDTFKLQNVTECSILKHYEDIEECAAGAVKEEQVEMKLKQVDGDWEDLIFVFN
FT                   EFKQHGRVVLDMVATAELIEKLEDTSMALGGMATNRYSAPFKGKVQDWITKMATIEEII
FT                   NMWLNVQNMWMYMEAVFSGGDIVKQLPSEAKRFKNIDKQFVKMAKVAADVQNVVEVCCD
FT                   SKMMMEVLPVLTEQLELCQKALTAFLDTKRAMFPRFYFVSDPTLLEILSLGSDPPSVCP
FT                   HFQSGLFDSVTAIEFDKEDKYKMLKMFSQQNEEVVFQTFISGEGGHGHLEEKPVIATGN
FT                   IESWLQALVDGMQDSVKSIIRKAHDEVQTQQLEEFIFGHPAQISLLGIQFMWTNDMQSA
FT                   LTIAKQSKEAMREAFKKQADMLKEMIVITTRTTIGKNDRKNLETCITVHVHQRDTSEEL
FT                   MKKRIKDPADFEWMKQCRFYWNKGRETVIISICDVDFEYSYEYLGVKERLVITPLTDIC
FT                   YVTLSQALGMFLGGAPAGPAGTGKTETTKDLGNTLGKYVVVFNCSDQMDYKGMGKIYRG
FT                   LAQSGLWGCFDEFNRINLDVLSVCAQQVYCVLQAIRERKTEFIFTDGARVSLDPRVGFF
FT                   ITMNPGYAGRQELPENLKALFRGVTMMVPNRQIIKKVKLAACGYMQNEFLAKKFFVLYG
FT                   LCEQQLSKQAHYDFGLRNILSVLRTMGASKRANPEKSEPFLAMRTLRDMNMSKFVAEDV
FT                   PLFLSLIADIFPGIKADKAVFPEVEEAMAKVATEKGLQLHPSWLAKCVQLYETYLVRHG
FT                   IMLVGPTGGGKTAIIETLAGALTELGTKHVIWRMNPKAITAPQMFGRLDATTGDWTDGV
FT                   FAEKKNNTWIVLDGPVDAIWIENLNTVLDDNKVLTLANGDRVQMSGIMKAMFEPENLNN
FT                   ASPATVSRAGIIFVSETELGWKPMVDSWLDTRAKHEAAALKPLFEKYVDALLDVIRIEC
FT                   KPVMAGSPWAHVSRDFCQVSTLVTLLKGILKPSEEANEQLSSGHYERLFLYCCTWALGG
FT                   LLEMKDRPPLNKAMVRLAESEAPNFDDPEDTFFEYFVSDEDTEWRHWNTQVPAWEYPAA
FT                   EEKPKFARLIIPTLDSVRLESLLKIVTSVDKQALFVGGPGTAKTTAIKQFMAGFDSDTT
FT                   ATKDITFSSLTQPGTFQVAIESSVEKRQGRTFGPPSGKRMIVFVDDLSMPVMNEWGDQI
FT                   TNEVVRQLLEQGGMYSLEKPIGDMKMIVDCVYLAAMNTPGGGKNDIPNRLKRHFCIFNV
FT                   PLPSVAAINNIFGQLVAGRFSADVFSPQVVDVASKLVPVTVDLWNKVQAKMLPTPAKFH
FT                   YLFNMRELSKVFQGLILAERDRFRENNRFVQPFGGKVKSPEAYLVALWRHECERVFCDK
FT                   LTTHEDKDWGDKLIMKLIDETYGEDIRAQVEDRVYFVDFLRPPKVDEETGETVDANPSY
FT                   YESTESLDSLRAVAMARQASFNETSKSLKLDLVLFEDALKHMMRISRLLCMERGSALLI
FT                   GVGGSGKQSLTRLAAYIAGAFPFQIQITKTYNQANLFEDLKSLYKVAGLKGQKVAFIFT
FT                   DAEVKEESFLEYINQILMTGEVAGLFPKDEQDMIVNDARGPYKKECPGELDSYDNLWSF
FT                   FMSRVRDNLHLCLCFSPVGDKFSRRARDFPGLINGCTIDWFLPWPQDALIAVSTKFIGD
FT                   FSMACDDDDKTKLQEHMGHVHVAVTQACKEYFEKFRRNVYVTPKSYLSFLAGYCALYAA
FT                   KLSEVNVLADKINSGLSKLFTAKEDVGTMKIELQQKNVDLEEAQKMSEKLLKEISASTA
FT                   VAEKEKARVAVIVEGVVAKANEIDAKKIEAEEDLKLAQPAMDEALEALNSIDQKSISQL
FT                   KTMKNPPDLVKRIFDTVLLLRQLPMSKIVWKMKDKVGMVIDGSENYKEEAMKMMADTGF
FT                   LNKLLNFPKERINDETCELLQPYFDAPDFNFEDAKKSAGAVAGLCNWCRSMVKYHWVAA
FT                   VVDPKMRALREAQAELDEANREKAKAEGELAEVQAGLDAMQAKFDEAMAEKQRLIDDAA
FT                   ATQARMDAAAALITALAGEEVRWTEQSKQFAAQIQRLTGDCAMASSFTSYLGPFNKEFR
FT                   DLLLTRDFFGDLSKRGIPVTADLDVARFLVDDSEIGEWTLQGLPTDELSIQNGIMTTRA
FT                   SRYPVLVDPQGQGINWIKNREAENNLKVTNLNEKRFRDILEESMSYGLPMLIENIQEEL
FT                   DPILEPVLEKRIVRKGKQAMIVLSDGKEVDYDDNFTLICTTRLPNPHYSPELSAKVTVI
FT                   DFTVTMVGLEDQLLGKLILKEKNELEVQRKTLVEEVTTYKKKIKQLEDDLLFRLSNSQG
FT                   NLLDDVELIEVLNVTKKTAQEVNEKLANASETNAKITETCEEYRPVAHRATLIYFLIAE
FT                   FASVNVMYQTSLKQFNELYELAIDNAEASQKPATRIKNIIDHMTYSVYLYIQRGLFERH
FT                   KLTFALMMTNSILVSDKILPPELVSVFLKGGGSLDIKSVKKKPKEWIPDKSWLDCVALS
FT                   AYPTFANLLESMVTNDKQWQNWYDKEAPENVRIPDFEDVVTPFERMCLVKALREDRTQV
FT                   AAQAYIADAIGQQFVESVPLNIEATWEESTPYVPIICLLSPGSDPTKLIEELAKRQKIT
FT                   VNGVSMGQGQEIIARRLMTSATREGHWVLLQNTHLGLGYMAEIETYMTKAAEEGKIHHD
FT                   FRLWITAEPHPQFPIGLLQMSIKLTNEAPVGMRAGLRNSYNWVSQDMIDAVPLFEWRQL
FT                   LYIMCYLHSVVQERRKFGPIGWNVPYEFNQSDLSACVQFLQNHTSEMDVKKLKSPTWAT
FT                   VTYMISSIQYGGRITDGFDELLMDTYAAKYFNKSNLEKGVELFPGYPVPDTRDIDIFRA
FT                   DIEKLPPVDSPEVFGLHPNADLTFRTLQVRELVETVVSTMPKSGGGGEGKSPAEVVDAI
FT                   AEDLLSKVPTMFETERTKIALNKLPGGPTQPLTVHLRQEIDRLNIIVDLTTKTLKNLRL
FT                   AIAGTVALSGDLVDALDALFDAKIPPKWLKKSWESASIGTWFQGLLQRHKQLETWLNKG
FT                   RPKAYWLTGFFNPQGFLTAMKQEVNRQHAKDKWALDDVVMTSEVTHPPQSLEKLKAAPN
FT                   EGVYVYGLFLEGCTWDGKKNMLTDSEPKKLYTPLPVLYVTGVLSSDYSKKDTYEAPTYR
FT                   VKKRTGLNFISTFPLRTEDPPSKWVMRGVALLCSVD"
FT   gene            <686303..>696754
FT                   /locus_tag="MICPUN_104455"
FT   mRNA            <686303..>696754
FT                   /locus_tag="MICPUN_104455"
FT                   /product="predicted protein"
FT   CDS_pept        686303..696754
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104455"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIK9"
FT                   /protein_id="ACO67696.1"
FT                   /translation="MLVVEPAEPCIYNVRLHQAYRTTVTLRNDTRNALELTVRAGSPER
FT                   WAVAPSTVFLEAGRTMRVDLRLKLAREIRPKKTAGAAVREGDDEGGGAVRQRDVFHVKG
FT                   EFFEQKFHASFVMATREEVAAAERRESDARSRSVDHPGFGERGRAPIASTSSRDTTHQR
FT                   PRSHSPASSAKSDEEIDEAFDRARARYGGGSKVWAQAGRSTSAPAGRGRGSGRGDEGPR
FT                   APLGRGPTSQQRAHRAVHWEDETAKKVDAYRRRVDELEKLRAQSELATSDKDELIRALY
FT                   ARLELAKTAEDDAVERMKLTQGNFGDESSAGSAGADLHAARVEQAELHGANAALRGRVQ
FT                   ELDGEVQAAREEIAGLRRRCRLLEQDIAPELSDLVHAALEQERAAFEAQSLKALRVLEA
FT                   KDAVLLARERETAEARAECGALSTTLTATRRELDACEARVVSILEEREGFRKEFDDIRE
FT                   QWQGTEKSLRVQVEKLREELGIANERLDRTKEELTEARQAEEESAFSRAEAAASTAALE
FT                   AANEEASELRAALRAAAEARISERERLAAHIASARVDLEALKRRAGPEDADATRLARDL
FT                   AAAHESLAAALKDSNADRILSSASDIPESPGMSAKTPAPRPTRISASRRGVAAAADDDD
FT                   DVSRLRLERDEALERLERLTGKETAVAELAEGHAKETAGLRLKVRELESALKLKDGEHR
FT                   REKSSLAAEHAAESESLRTELAALRDRLRFVDDERAAGGDLTDEARRAIEHANEKARAA
FT                   ESEAFLAREKLAEMEAAAATERESGKRKDKDPAPSRKGQGTTIEQKLSARVSELVRELR
FT                   DSNDRVAELEDLLAREVGDGQGRFEDSAAASAMRQRVSDAEDAARDAVERLASSELRWG
FT                   NERARLESKIRAAKEDGGVRIQSLEATVASLRARSGLHSEVARLGEEASRIRRSEAALK
FT                   NDLVYAEERLGHALLEIQRLGGEATPGNTPSDARRTGALALRSGNLPSTAAKSHGQTTP
FT                   ATLDRVVSLEKENSRLVAENERLRNDVEAHSLERGREAAARADASRELAAALDRVAERD
FT                   RALHDARETAALGKERAAATRAQELTAATRRSAAAEARASESESRASLAREEANEARAD
FT                   CTRKVAAADGARHAAELDAAAAREEAANERSNAQASEREAARLSQLLEERATQLQILTE
FT                   TVEALQAAAGSGDREQRVVTLAAQAATARASESALERRCAELSRDSQRETARCARIESQ
FT                   LASARRDIQSAEQRAREAAAREELAREETSAARQEAAARTEELAALARRCDAATEAKVA
FT                   AESREASARVALEKQHARHLEQLTAEREAAADRLKTAELNAARAVQVAAGGVVERDGAV
FT                   GARIFVRASEDIASIVSMQPEDAVAAVLEATRVRERIEHALEEVVAATSRRVGGADEND
FT                   PIAAAVVGARRELEAERRWSGAVIQRMRQLVLEAEREVGRAFAQARGAQAGEQAAKARA
FT                   AAVEAALDARTAAWEEATAACVAAEERLARRSTVDTSCADQRFQLAQRRIVQISEQLAS
FT                   AQRRCVAAESAAQAAKETARTETNRADAESRRARVAEADAAAARQAAAAAAEELEGSPA
FT                   AADAVRELKSYLEKEVVRALVGDGKAKPDDASAKLAGVTRELCASKLTERSLLASLAAN
FT                   RRRADAAAGHAAELQQALKMAETRIQALVSGDRGAAAADPVSPEDSAEALSTQLAHKAH
FT                   EAYQAREEVLRLRARVSELELEVADLAGAREAAAAAASSAREGARMEIAAAAARAADDF
FT                   AAKSASLRRELDTERSVLQAAVREAQATANRARMDAAASVADSERLRVESQTQVAPIHV
FT                   SQSASYADAEEEMRALRLECARQEERARRTAAEAADLRDEVQAKDGALQQLKRAFASVD
FT                   DGGLGLGARTPGSGPASSAKKVAGRRTQKSPASEPASSSGALGRRLVEAKLAEADAQRR
FT                   LKIATRAETELRDIVAKRDARIADLKKKLSAKPGQSVPSPSPGGQTQVDDESRAALEAE
FT                   CAKLRAEKSRADAESERLRAELEAHGAHAPSPEEMDALQAEVIELRRAAADASATASQR
FT                   AKSDKKSEKEAAERRDLQKDVNTAVSSAAAALVGSPLPHAARNPASGTATAAVAQLANA
FT                   LKESNNSLQKARQESTDAKRVLRERGKERETKELADASQRSVIRELTQRAAALGRDKAE
FT                   LVEERDRLKERLRGLRGIEDWTPKEDPKPSSEAATQSGSLGGRSVLVDAAALVKLVGAH
FT                   VDAIAPSAAVIAERAAALGDGKVAEIANTLSVETAAMRAALNALSDPTCEGLTPTELVT
FT                   KAATAAMRAMPSAPLVHHIVPSVVAPVMRVAPLLADPNVTDAPVARIAISRADAGTDVA
FT                   GLADVRDLGVNTAPVTAETRCGPDLPREDPHLFGVPRDATTSPGVGPRVAMVDIDAPRM
FT                   VEAGTYSAPISHDAGVGTEVTGAADEQLMEVTQRWEAALEGEKEKAAALEEKVGKWKDR
FT                   CESLRAELAAVMEKTAETERSLRDRLAKEEKIEGVPKERVEELEGLLHSVGSAGGAAMK
FT                   ASLEASRKESAAIKLQLERAQNELVAASRETERLRNEVRSRDAEHAHMVASLRTTIRGM
FT                   RNATPADRAAYLEALRIHSENADRSRREREAAAEASVSVSTPEPARVEPVGEDRVDPKL
FT                   AVDQSLAKVPSPVEDILGGADDRRRIREAIRAEEDAEREAVRARAVADAAEAATKLWER
FT                   GGEMAEQISLAERRLEQAVATTAAALQAADRGAANAGERAAKQSRVLAKRLEEVDGAAV
FT                   SLCAQLTDALARAVEKGEATTAAATRYKEMAARLREEHEADKKRAKEALKKAKQKEEAA
FT                   EAKAKKEETRAKRAEADAARKKTALEIEVNRLKATIEEIAARRGSSPSGSDSESPPELG
FT                   PAAISAHPAPASESAPSAPSAPPAATLMPPLLHASTRPPWSAPGVEEQVEDAVPAPRQP
FT                   ATAPVPETSLSRVVSGPTAAQTAAAELAKRLSDEKVAELQKRLDQYERDLDKARTAAKD
FT                   AKDERAHAETRAKNAAEHLKKFKAASMADQAAMRGKVTDLTAQLAERGPDKWKAMEAQL
FT                   ADTAERLKRARAEIKRLQAVTADTKGSNEALRQEKEKVAGLEEQLKEEMKRIKEARTTA
FT                   KRKDTFAADLKKRLDAATAECDKLKEAAANDESEVKLREMREDVDRKQALIVQLRSKAE
FT                   EEAKKAAALAAMSEQERNSESTQRLRREVDRKTEIIKTHDKKIDAMRAEVEAAREAAAL
FT                   AEAGAAKVSAEFGGKSQHLRVRSVTMLTGVRKLAARLLRLSAAVGHTVGAAARADAPQP
FT                   GPVETGIAELVDMSPDEVADLLGADSDDADDFARQRPRRIRGGRASNPSTFAALISAMD
FT                   IKADELATSLSGRDGAVDHAAAEDATWREDALRWIVQAAEAEAEHAEAALKSAVPAMQE
FT                   WWIQVLSRGRFPDVSGITTGFEAVSPGKSPTLRGSRGRDTARAPKREKAPSGPVTGTRA
FT                   RLAGAAALLASPERDD"
FT   gene            <696982..>697509
FT                   /locus_tag="MICPUN_88806"
FT   mRNA            join(<696982..697197,697267..>697509)
FT                   /locus_tag="MICPUN_88806"
FT                   /product="predicted protein"
FT   CDS_pept        join(696982..697197,697267..>697509)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88806"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIL0"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL0"
FT                   /protein_id="ACO67697.1"
FT                   /translation="MSRVWVIMGAAGSGKSTTAEKVSFELKRIYKNRPAPVFIEGDDHH
FT                   PPENKAKMSRGIPLDDTDRAPWLEAIKKGMIDPIGGKDIFVTCSALKKSYRDTLASVAE
FT                   TDVVKSVRFICLKVTEDELRSRLEKRQETDPSHPLGAALLQSQLESLEI"
FT   gene            <698619..>699203
FT                   /locus_tag="MICPUN_64618"
FT   mRNA            <698619..>699203
FT                   /locus_tag="MICPUN_64618"
FT                   /product="predicted protein"
FT   CDS_pept        698619..699203
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64618"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL1"
FT                   /protein_id="ACO67698.1"
FT                   /translation="MTSPFADPDVLFGLELKEPWASMVLEGSKTIETRTYDLPPELIGR
FT                   PLVLLATPEDSGAPGTSGLADVVTIRGAATILGLVTFDDVIQWDSRQTWAKDCDRHGVP
FT                   DVDDGPYANYVWREDDAAEPGKSTMRGWTVSEVIPLPNPVESPPMRRVLRSIFALDTSV
FT                   EELLAGAYGDDDGDDGLGRWDDEGENDRPWH"
FT   gene            complement(<699599..>699895)
FT                   /locus_tag="MICPUN_74035"
FT   mRNA            complement(<699599..>699895)
FT                   /locus_tag="MICPUN_74035"
FT                   /product="predicted protein"
FT   CDS_pept        complement(<699599..699895)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_74035"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIL2"
FT                   /db_xref="InterPro:IPR012479"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL2"
FT                   /protein_id="ACO67881.1"
FT                   /translation="MPPAPEGECETYMSNGESLQSRVHQWLQLKRRGISINDQISGTKG
FT                   FRNPDFLQSALEHFKVEERGTMISPDVFDPSDYPAEDYYDELASAQRRENERRE"
FT   gene            <700762..709185
FT                   /locus_tag="MICPUN_64620"
FT   mRNA            join(<700762..700911,700972..701489,701866..709185)
FT                   /locus_tag="MICPUN_64620"
FT                   /product="SNF2 super family"
FT   CDS_pept        join(700762..700911,700972..701489,701866..709048)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64620"
FT                   /product="SNF2 super family"
FT                   /note="Predicted protein with DNA methyltransferase domain
FT                   and SNF2_N domain. ChromDB ID: CHR20102; Snf2, Ris1, Rad26
FT                   superclasses; GO_function: GO:3677; ATP binding - DNA
FT                   binding [Evidence 3676; helicase activity ] [PMID 5524];
FT                   GO_process: GO:6306 - DNA methylation"
FT                   /db_xref="GOA:C1EIL3"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001525"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038718"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL3"
FT                   /protein_id="ACO67699.1"
FT                   /translation="MSKLGGKKALFEERGIRRNRARSTLTSRVARTRGSNTATQRRNQK
FT                   GTSRDARDPGRALILRKPRVQLNSLKMVATTPRKKTGASPAKRGPKPKGIGKLSPAKNA
FT                   LNSPLSSPTPEIKASARRKLIIKDEPSDSGVRENLSPNVASPRGTPRRGAANKAREAMA
FT                   KAAEDDGMEVDRQTASSRRRKTKVEDDDAFDSDMEELSGDDDFEDSPKKRPRKPPIARA
FT                   SGGSATAESQSKVRLAEELPAIRDVQGMFTDMVKKLPELQGLIKALGRPIRVATMCSGT
FT                   ESPLLALDKIGNATQIEYGQKLGVDHVFSCEIEPFKQAYIERNFAPPILFRDIRELDGD
FT                   QATTAYGALVDVPGNVDMLVAGTSCVDYSNLNNEKKTLDQKGESGQTFRGMMTWVTKHL
FT                   PPIIILENVCNAPWQQIAEEFQRKGYQCHFMRLDTKHYYIPHTRTRVYLFAARTKDPKK
FT                   CEQIPIADTNSSKNKASPQIVEDWKEKVRSLRRPASATLEAFLFDSDDPRVHKGRQMLA
FT                   MPGEDNTRVASEWARCESRHQRARAEEGLGQRRPFTNWEGGCTMPDYAWNDWGKAQTDR
FT                   VLDLMDIDFLRLAQADTDSMHKTLVWNLSQNVDRTTGSGAAGICPCLTPSMVPFVTNRG
FT                   GPLVGVEALSLQGIPVEDLLLTRESEGQMSDLAGNAMTTTVVGACMLSALILMKDELVE
FT                   HGHKVASLLKKDEALRMSAAGKSLGNKAQQLSAGGAAGAQGLVGKVAGADDLKEKDLVL
FT                   CSVVDKTCKSFGDLCKQAVGASRMCVCEAQTGIASEIWKCADCGHTACVVCKGRPEHNY
FT                   GTKPHSGARIAPAFFTDTLKKALPMRVVLAGLDVSKAVQEAKKLGKAAGAKIMGASDST
FT                   EDDSEMETWTAWERAMRSIADAEFMYRDVKRADLWTVRYACPANDEVVLELRVGAEGKG
FT                   GEWRITVNPAPHTAKAPHKIYQHVLARMRVAPDAKSALDGQWQLLAPVSHEFEVTLQGT
FT                   GQKVDSWQETLGMSSAKTEVDVVGKTQWSNKRWSEWKVGYGKGVDKGALDHDISGTYKL
FT                   HQNCGTAQASLHKRAGDDFYLFMDPQRNTKGQTDFFVFADNHRRLQYGEHRLHTARLMN
FT                   QRGGHPETLTPAEQAKNVVRDYDPHWRPSDRAGAETYKVHTDGRWFSPMPVKLSQVTPG
FT                   AVIAVPKDVQALGAKSGGCGAAVAIMKARVPLPAVDAAAWPAGPEYETIRNDRSHSTYS
FT                   KLAWFTSRLELPEGVQTFVPLDNGARKGSCAELCDASCPRCAPQPPRLQWVRQASNEIE
FT                   AGNDEATKKPKKPKIIARENPQEAAKYEQALKRRPAPFVVQWRKDEVGKGANKEAVGDL
FT                   VIAVNPATLVHRALANITGGIARERSAAPAAKSAPDCEWQVVRHEENDAAEALPPFALT
FT                   SNRRDPQVAQPPGWSTKYPLRPEQLRSLGWMIRQEQTTVPFVEEEVAESILPSLGLRMD
FT                   GRARVERMVRGGIIADQVGYGKTAISIGAVLASQIQWPKKGVKPSDTCRAVPTKATLVL
FT                   APSQLLRQWPREVEKFSQKGKLKVVVIRTVADITHLTVKEVQEADVVICATTVLRSPAY
FT                   FERLARLAGCNRLPDCKSTTSGRQFADSYRKTLDALENQVETLSGEGAAAASAGVRRGS
FT                   GDIPEDEEIVNIAPKRLKGAKLVTVTTLVGAEGFTAIEAKNKAAAEAAAKAQAAKSVKK
FT                   AATPGKKPAASPAVFRKTKPKATPVKSPKATPKKAAVEPLSPRSRNTPRRASAAKKIKY
FT                   AESESDDFEDDSEFEAETAVEESEDEFSGIDSESDEAETKRKKAAKARAAKAKKRTKAT
FT                   SDDEDEEPGDKDHWGFDTAEVQADWTEATSPPLEMFHWRRVIVDEFTYLKPSDRCVVLG
FT                   LKSEARWCLSGTPPVGAFGEIKETAALLGTNLGSDEAPRFSKQEITKAETFQFFKEKPT
FT                   QHWHETRHKVAQGFLDRFVRQNIAEIDEIKSEEIPMDIQLRPAERAIYLELDHYLQAMD
FT                   MKAKKKKRGATEGDRDKRLALVLQGSATAEEALIKRCAKFELDDDTGKALRTCQDIIEV
FT                   REKQLEACKSDLDMMIVQARWMMHRLEDLASKKGLPFYDEWYLEEDQPFLRWLNQIETE
FT                   GVGDAEATEMMREIVAGATEARARAAKETEFKTITMPEIGSVCRIKVSKKPFTGGFADQ
FT                   VFKMHKDKWIEVTMVGSDGQHQQKMTCEMAGFEHHFNVDIKKLIREDYVLLRSAKPAPL
FT                   GEKVAAALKGKKGKKETPAATPVATPVASPRKGSAAVARSAAPTPASVAKKTGVTPSDG
FT                   EKKKETAELRAPRWGIREHVSDPQNSLRKLTEELVGRVRSLRFFRSVRDLQQMVSTDDV
FT                   PCLVCSAESGAPAKGGKRKGGGDICKPKAESGLLSTCGHIGCLDCLRRNAANTECGVPG
FT                   CECPTRFSSVIHAQSLGTERVTKRGAAAVKSPVKKAKKSANVVEEGPSLEELECGVHGT
FT                   KMAHLVQRIKDTPADERILVFVQFPDLMKQIADVLQEANIKTLKLKGSVHQQTGALDEF
FT                   QKEDLRKGDARVLLLLSRDESASGANLTTANHAIFVHPLLTTTQYEYEASETQAIGRIR
FT                   RYGQTKMVKIWRMIVRDSIDAEIIEQRANANAEK"
FT   gene            <709980..>711539
FT                   /locus_tag="MICPUN_104458"
FT   mRNA            <709980..>711539
FT                   /locus_tag="MICPUN_104458"
FT                   /product="predicted protein"
FT   CDS_pept        709980..711539
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104458"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIL4"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL4"
FT                   /protein_id="ACO67700.1"
FT                   /translation="MEVEEMAEEARVEAEQAAIAERLGANPAATSALGGDGGADGWIGG
FT                   ALPGPDTRLPRPTTGRLAATGRTALADVRVTRRKRLPPYALRDDEIPGALADELGRMHR
FT                   GVTSRRVGGAKAPVRVTTANNYLEVAKGLLGWYCRCKLGGWDGATPPQDPTLLKTHPAN
FT                   APEDLSLRDVFPSSDAEGAALAIEYLQWLDEKRGVLPSTEAFQLRCLIALAKWLHGSQT
FT                   NEHGAAMEQPVVMELVRVQRGNVTLATKGEHAADEAAKWLDWPDYLRLVERLKWECAPL
FT                   THVGDQRPDKDVAMAVQRYLLFAILACVPDRQRTLRELELGRTLVCEEFDDAVDGENGE
FT                   VKLTRRRVWTVKHSPDDYKTGGAYGARPSLVLDERLYPALEAWLFGPPDPEEDARGFTD
FT                   RGYSGWGWRACLAPNHDYVFSRPNGEPWNVSELSRTFSRAAMRLTGKKTNPHLVRDMVI
FT                   THVRGEGIATDAELEALSLYMGHSIAMQKGTYDRRTQEQKVAPAIGLMSAINARAAEKK
FT                   AR"
FT   gene            complement(<711594..>712433)
FT                   /locus_tag="MICPUN_64622"
FT   mRNA            complement(<711594..>712433)
FT                   /locus_tag="MICPUN_64622"
FT                   /product="predicted protein"
FT   CDS_pept        complement(711594..712433)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64622"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIL5"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL5"
FT                   /protein_id="ACO67882.1"
FT                   /translation="MAKVHSIHVSDASMRPMRSIESARLIAGKGIEGDRYATGEGTYVA
FT                   FQEPGRQLTLISKESAEAHLAGVARGQVSVGNLRRNVVVSGMSARDLEDAIGCVLMLGD
FT                   ACRVRVHRLCVPCLYNEKLNQAPGLMEAVWSEAGVNCEILAGGSLKVGDVVKVESGSFD
FT                   ASSIDDGGKKAAFYKRPSLRTEDEIESLRTLPMGKPGVDRIAEAYATVGANEAVGIDDD
FT                   SAHAIRTKAELRAVTSATKARRREAWRAQLILWAILIVVVSGVYTICVRAISSPGFT"
FT   gene            <712812..>713729
FT                   /locus_tag="MICPUN_88696"
FT   mRNA            <712812..>713729
FT                   /locus_tag="MICPUN_88696"
FT                   /product="predicted protein"
FT   CDS_pept        712812..>713729
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88696"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:4672; ATP binding - protein kinase
FT                   activity [PMID 5524]; GO_process: GO:6468 - protein amino
FT                   acid phosphorylation"
FT                   /db_xref="GOA:C1EIL6"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL6"
FT                   /protein_id="ACO67701.1"
FT                   /translation="MRKALKDVGLSSGAKQGSATAGGRPSDLSRATLSVAGRHWLVEEM
FT                   FAEGGMARVYKARELSTSTRVAMKQMLVPADRQDAQSEAEREADLHARLSDHPNVVTLF
FT                   SRDVSRAEAHRSDGGFVQTLLVMELCERSLAQHINAHVEAKTRMTEEEVLKAFAACSSA
FT                   VGYMHSQTPPLIHRDVKPENLLLAPDGIWKLCDFGSVAVGELVMNTPMERARAETDVGK
FT                   NTTPTYRAPEMWDVFRWGAIGKPADVWALGCLLYQLCFQRLPFGAEAKMPALNGSYSLP
FT                   SGHGRSAGVVRLISELLRVEPNERP"
FT   gene            complement(<714601..>715434)
FT                   /locus_tag="MICPUN_104460"
FT   mRNA            complement(<714601..>715434)
FT                   /locus_tag="MICPUN_104460"
FT                   /product="predicted protein"
FT   CDS_pept        complement(714601..715434)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104460"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIL7"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL7"
FT                   /protein_id="ACO67883.1"
FT                   /translation="MSQPPGPGAPGSAQSTNPFAPQPTLLQPTFQREETAAPQQAAPPQ
FT                   GGPVLISQPGEERPVIGREDGSPRVAPAPVEYQVTHTQFAPQPMPHQNVFYPSVPHGSS
FT                   AAAHYGHQYGHHRQAMREGGGYVVMMPDGRSVTVSEDSGSLEMLITRQYSRALRIFAFI
FT                   DILLCILYTLSGYYWAIFAVVGPICGYYGAKHYHTGNTLVYLTFCFFNLILRCSLLVMS
FT                   RGAVAVVLTVLMVIVEVYITRLVIIFYKLLKSLSDEDLTLLRVLDNAAPVRPMYY"
FT   gene            <715875..>716906
FT                   /locus_tag="MICPUN_88657"
FT   mRNA            <715875..>716906
FT                   /locus_tag="MICPUN_88657"
FT                   /product="predicted protein"
FT   CDS_pept        715875..716906
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88657"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8168 - methyltransferase activity;
FT                   GO_process: GO:8152 - metabolic process"
FT                   /db_xref="GOA:C1EIL8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL8"
FT                   /protein_id="ACO67702.1"
FT                   /translation="MVCVSAATPGSANRTSVAAEIVGAILKFPPLWEAASKGAKEKMVK
FT                   RAGELGIEWEAEVNQLRSAADWEQALKDATDPEVVENMPAYYKTSFHAYPEGNLGWDPA
FT                   LEVEVAAKAVHAPVFSEDGKTLEKDGDEKLRAGYHRAQAEAMDFIDPDMRKKAKKVVDV
FT                   GCSSGLSTRALVGAFPDAEQFVGIDLSNYFIAVANHALGARAGDPNGYDRSKVRFQHGA
FT                   GENLPFENDSQDLVSSCLTFHELPASAAQDVIREAYRVLKPGGCLSMMDMDPSAPAFQR
FT                   IANNVFAFTAFKSTEPYLEQYAALDVQEVMRRAGFETVETRSSSPRHRTIVARKPAAAN
FT                   KMK"
FT   gene            complement(<716983..>718252)
FT                   /locus_tag="MICPUN_64626"
FT   mRNA            complement(join(<716983..716992,717045..>718252))
FT                   /locus_tag="MICPUN_64626"
FT                   /product="predicted protein"
FT   CDS_pept        complement(join(716983..716992,717045..718252))
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64626"
FT                   /product="predicted protein"
FT                   /db_xref="InterPro:IPR000408"
FT                   /db_xref="InterPro:IPR009091"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIL9"
FT                   /protein_id="ACO67884.1"
FT                   /translation="MADGDAYVWGDNTCQVLGLTTKAQSRKRPFPVALLNKEHPSGYTR
FT                   LLPKCQIVVAGGLHSVAVSVEGDIYTWGTHDEGQLGRNVPKDDDEAPAVPGKVTLPAEC
FT                   KGAEVINAEATDSATFALFDDGSVFGCGVFKDDGELGFSPDNPGRQHGMAPVAGPRAPS
FT                   HTAPIESMAAGNGHVVLLTSRFGRDGKAASKPKVLTLGAGAQGQLGRVGTRIGPRAHSR
FT                   TLLAPAAVRMPRGAGQPVAVFAGGFHTFVLTDLDKVVAFGLNNFGQLGLPPDDSMAVFI
FT                   PKIVPSLSGKGITELACGEHHTVALTRSGHVLTFGRYAYGRLGRRTEEEMVDGDAADPT
FT                   PTRVAFPAGAASVCSVAAGSTTSGAIDERGVLYMWGCGEGHMLGRGDDEDDVFAPEEVP
FT                   VKEGTS"
FT   gene            complement(<718520..>719632)
FT                   /locus_tag="MICPUN_68969"
FT   mRNA            complement(<718520..>719632)
FT                   /locus_tag="MICPUN_68969"
FT                   /product="predicted protein"
FT   CDS_pept        complement(718520..>719632)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_68969"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIM0"
FT                   /db_xref="InterPro:IPR002812"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM0"
FT                   /protein_id="ACO67885.1"
FT                   /translation="SKRDDKEVWIQTTNVQVLLAALECGLSTTALFPSQNAGLAEEWRK
FT                   VGRFSALALTEDGTVTEEDGDFYRAVGITLKVNGPEDVDAIARMAGVEPLVVVDSSAWR
FT                   IIPAENLVAKFGATDESRLFSVSETAKDAEAMFEALETGVDGVVLRTDDPAEPRELAAY
FT                   LKKRGMIGGGGEGPGKLELTPAAVTRVETVGTGDRVCVDCASAFHPGEGLLVGSFATGL
FT                   FLVHSECLDAEGYVNSRPFRVNAGALCSYVVTPGGKTAYLSELRVGDDVTCVNRDGETR
FT                   VMTVGRVKVEQRQMVLVEAESLVGGVRTGKRFAALLQNAETVRLVTASGEKERVVSVST
FT                   LDVGDVVLVHLQEGARHTGLKIVEEEWYEQ"
FT   gene            <719911..>720729
FT                   /locus_tag="MICPUN_64628"
FT   mRNA            <719911..>720729
FT                   /locus_tag="MICPUN_64628"
FT                   /product="predicted protein"
FT   CDS_pept        719911..720729
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64628"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIM1"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM1"
FT                   /protein_id="ACO67703.1"
FT                   /translation="MGGEGEGSEIRPEEPEPKVVDATESDGDVRPSDPGFDASDGDRDR
FT                   PGAHHNNEGAPSGSSAGDEATGDDTGRKGGRETDSDGSDRLRRGAPDSPPAPSTPRNRT
FT                   AWEWFVFFLGILGQVLYDIILLASPDTTRRQRRYGSLMHDGHDSNGEFRSRKRGGARSA
FT                   GTNQGGRDGTAGGAEETHVRRRGLTGVRQRARDASEVPEELRGLVSPAQWRAEMRQFHE
FT                   AELKRRATEVFRAEMAKERELEKEIAAQKKLERRRRREEGMKKVGEWSAE"
FT   gene            complement(<720858..>722609)
FT                   /locus_tag="MICPUN_104463"
FT   mRNA            complement(<720858..>722609)
FT                   /locus_tag="MICPUN_104463"
FT                   /product="predicted protein"
FT   CDS_pept        complement(720858..722609)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104463"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:8270 - zinc ion binding"
FT                   /db_xref="GOA:C1EIM2"
FT                   /db_xref="InterPro:IPR004808"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR010666"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM2"
FT                   /protein_id="ACO67886.1"
FT                   /translation="MAPPPSDSDSPNVTLPEALTGLEGDAIVSWNIGLRGLRQLVASDR
FT                   GADKTAAKDQHGVSRQLGYGCIDSLLDSLGSDVDVVALQECKLTSRSDLSPEIACPSGW
FT                   DSYHAVCGDASGGAIPTTSRGRSKTGYAGVATYVRIGKRVVAAEEGVTGALTPPERIAR
FT                   GDAVGHYGRMSEAFDRARMLELDSEGRCVLVDLGAFVLFNVYVPSLSSDDEDRERFKLD
FT                   FLVAVEIRYRALLDAGRRVVLCGDWNVSYGVIDSAVAIEERLMDEALCERNQSRQWLRR
FT                   QVSGGEGAKGAERDPLVDVFRRDYPAARGAYTCWNVSAGAQLTNYGSRIDYFLCDEVTA
FT                   ASVARCGIAPKHEGSDHAPVFIIVRRGSDCSLKDTGNEGNAVNPLASSACVAAAGRQAR
FT                   LTDSFFKAGAGAPNDIWGSAETVGGGVHAMANANGGDRGCLARSQPALAGVKRKHGGGG
FT                   AGGAASIKSFFGPKDVGKKPTSAASADDTNPPPDVPIDLGTRDVPAQELTPAPTASIET
FT                   VAAWKAIQKRMAPPKCRGHGLPCKVRTVKEGANKGRGFFCCPKPKGMKGDKNADCGFFQ
FT                   WEKVYRK"
FT   gene            complement(<722863..>724083)
FT                   /locus_tag="MICPUN_104464"
FT   mRNA            complement(<722863..>724083)
FT                   /locus_tag="MICPUN_104464"
FT                   /product="predicted protein"
FT   CDS_pept        complement(722863..724083)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_104464"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM3"
FT                   /protein_id="ACO67887.1"
FT                   /translation="MATDTKRRRITPVAMVLHLDEEEEVDEDAEETWEEEGYGDDEKQQ
FT                   FAAAAADDDRGEARNRESVAIDVEGRVGGVSDCGLDFSFRSYPESFDRYAGLSSPEARD
FT                   VITEDCRKCFVGESFWLAAGSEPRCALEELARKVFELHVAGIDGTWDAAKSGAEWWVQV
FT                   RHEDDGQKEAVSFHWDKDEDLVDDFGVNVHPAISTVTYLTTSGAPTLVLDHVPPMMYED
FT                   VEQFRGPVGQGYLSFPKRGKHIAFDGRLLHGAPRELAKPRHVEKGYERVSFLVNIWLNY
FT                   RPRAIEPFPEEEIGNLGLRGCFPGTSASPTGDRPEGVGGDRYPSTSSRNDRFGDMREFR
FT                   YDFGETGTEHTLVLPVSIKALDSVTDARVGKGGSPVDCVRLRFARGAEAAVVEQEPKEP
FT                   RRSGRRS"
FT   gene            <724683..727766
FT                   /gene="GDH"
FT                   /locus_tag="MICPUN_107252"
FT   mRNA            join(<724683..724931,725059..727766)
FT                   /gene="GDH"
FT                   /locus_tag="MICPUN_107252"
FT                   /product="glycolate dehydrogenase"
FT   CDS_pept        join(724683..724931,725059..727689)
FT                   /codon_start=1
FT                   /gene="GDH"
FT                   /locus_tag="MICPUN_107252"
FT                   /product="glycolate dehydrogenase"
FT                   /note="PUTATATIVE Glycolate Reductase; GO_function:
FT                   GO:9055; iron-sulfur cluster binding - electron carrier
FT                   activity [Evidence 16491; FAD binding ] [PMID 51536]"
FT                   /db_xref="GOA:C1EIM4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM4"
FT                   /protein_id="ACO67704.1"
FT                   /translation="MYTDPVKTFAYGTDASFYRLLPQVVVKIHDEDEVKRILPVASKHQ
FT                   TPVTFRAAGTSLSGQAVTDSILLKLSHTGKNFRNYEIRNEGKEITVEPGLILGEVNRLL
FT                   AKYKQKNGIKEQYKMGPDPSSIDSCMIGGVVANNSSGMCCGVKQNTYHTLKDMRIVFVD
FT                   GTVLDTGDKASREAFLKSHKSLVDGVVALASRVQADEELTALIKKKHAIKCTTGYSMNA
FT                   LVDFPTSDPIEIIKRLMIGSEGTLGFVSQATYNTVIDHPHKASAFIVFKDVKEACRAAA
FT                   VLRRETKVDAVELFDRASLTQCEGHEQIIGLVPTIADAPRTGAALLIECRGATDAELNA
FT                   SIKEVCDAMDNADMQYLNDRESTYPFNKDEAVYKVYWDVRKGLIPLVGSSRSAGTSVLI
FT                   EDVACEVDKLGDMTQDLIDMFERFGYEDASCMGHALEGNLHLVFSQGFRNDEEVKKYSA
FT                   MMQEMCEIVAVKYSGSLKAEHGTGRNVAPFVEMEWGKKAYDLMWELKELFDPNYVLNPG
FT                   VILNRDPDTHQKFLKPKPVADPIVDMCMECGFCESNCPSRDLSLTPRQRITVYREISRL
FT                   QAIPSRTQAEQKRLDEFLDNFTYEGNSTCAADGMCQVKCPVGINTGELIKSIRERELKN
FT                   QGTANSGANFLAKNFGAVSGVVPSFLNMVSTFHGVLGSGVLKSVSSALNSATGNLVPVW
FT                   NPHMPTGAPKLPEPHKPAKAVTTEAGLPRKVVYLPSCVTRMMGPVKGEESIGGVPDAMM
FT                   SILKKANYEVVYPEGLKSQCCGMIFNSRGFKSTASSKGSELEEALMKASEGGKLPIVVD
FT                   TSPCLAQIKEQLSNPALRFALYEPTEFISNHLVDKLEWKQVRDHVAIHVPCSSKKLGVE
FT                   NTFAKIAGMCAKEVSPSGIPCCGMAGDRGMRFPELTGSSLSYLDLPKGCSDGYSTSRTC
FT                   EMSLSNHSDVNFRGLVYLVDEATSAKAAN"
FT   gene            complement(<727778..>728854)
FT                   /locus_tag="MICPUN_64632"
FT   mRNA            complement(<727778..>728854)
FT                   /locus_tag="MICPUN_64632"
FT                   /product="predicted protein"
FT   CDS_pept        complement(727778..728854)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64632"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIM5"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM5"
FT                   /protein_id="ACO67888.1"
FT                   /translation="MAPTPTYDFVVVGGFHAPDDHAKSHPIAAANASFLNEQDSERLTA
FT                   SVTSALKSAGGGRNLVRRIDGRNADDRSLLADVLEAAVREGGRDGDVKPKGARAVVLVG
FT                   FGAGGGAQCDEFLSDERLKSCARHFAARGGVVLIQGRGGAIDLISRHWFQKTWTSGLKR
FT                   GAERSWRYNSDSAWGGGYFARFSDAASAQGEPSLRKEVRFGVVYEVERVKPVDAMYLSV
FT                   PHKDEEDEEDEGDEKLVIGYRNGGVTLGATCAVAFGAFGGGHVGCIGAGEDHQETTMRV
FT                   IQGLCEAAPGVGTPDALKRLKKSGMKGFDLREVAIGGGGQVTVEPSMTKFAVFAVFAAV
FT                   VSIMVVVYLAMLVIRSNM"
FT   gene            <729169..>730281
FT                   /gene="RSP8"
FT                   /locus_tag="MICPUN_96753"
FT   mRNA            <729169..>730281
FT                   /gene="RSP8"
FT                   /locus_tag="MICPUN_96753"
FT                   /product="radial spoke protein 8"
FT   CDS_pept        729169..730281
FT                   /codon_start=1
FT                   /gene="RSP8"
FT                   /locus_tag="MICPUN_96753"
FT                   /product="radial spoke protein 8"
FT                   /db_xref="InterPro:IPR000225"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM6"
FT                   /protein_id="ACO67705.1"
FT                   /translation="MSRTQNQSHATRFYDGQALQERHPDLSEPFHGDVVKDEIAIAFGR
FT                   RHVHKLVELVSLPKEDLTPEKRATALRYLLGVLTNQESKAEAIGTNVAAPLVVHITDDS
FT                   DDVRRIACEVMASLATSRDGRTSLIAADAVTATAMKMLKDRNPDVRGAACSFLAAFSSA
FT                   HDGARHVLEAADGSVFEKIVKLLDYDLTPTSAKTSACETLGGCTLTDEGVHAGLEARLP
FT                   KALLRVLDREEARMSSELRTQAARALKNLCQVEIGRTQCLVAGAVKAMAPLLRNTDADV
FT                   RLQASGCLQAIALERDAKMPVCEAARVNLVMLLRDPVVGVVQNAVAAIRASSDLPDARR
FT                   KFFPMLAPKDKDHVFPNHHTWSRDLRGPLF"
FT   gene            <730440..>730949
FT                   /locus_tag="MICPUN_64634"
FT   mRNA            <730440..>730949
FT                   /locus_tag="MICPUN_64634"
FT                   /product="predicted protein"
FT   CDS_pept        730440..730949
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64634"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM7"
FT                   /protein_id="ACO67706.1"
FT                   /translation="MYASAKKGTSPHSGCTPVPLVVIMGYPIITQENSPRVAVSPRTNA
FT                   KSAAPTEKKLPAITCVILLPNTFETLRKYVLSSSVSTESFHGGGQGLSHRSEGEDLDVA
FT                   QTARCQSPRASSPGYINTLAASPGSSPRFALSTNCEATAATGVNGLTSSPPKLIRGTLR
FT                   METRIE"
FT   gene            <731482..732945
FT                   /locus_tag="MICPUN_88502"
FT   mRNA            join(<731482..732471,732598..732945)
FT                   /locus_tag="MICPUN_88502"
FT                   /product="predicted protein"
FT   CDS_pept        join(731482..732471,732598..732942)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88502"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5515; serine-type peptidase activity
FT                   - protein binding [PMID 8236]; GO_process: GO:6508 -
FT                   proteolysis"
FT                   /db_xref="GOA:C1EIM8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM8"
FT                   /protein_id="ACO67707.1"
FT                   /translation="MLRGAAGKVIVSTAAAAAILLGAPVVTSTLLEAVPLGVPAAHADE
FT                   DIDERASNAFESAAEKEKKADAVNSTASEELTDLQIVEEVWKVVDDNFLPARSVDGFDR
FT                   AAWAKLREDFVRSPPADRDEAYDTIRSILRTLGDPFSRFVEPSDFAPLLKYDISGVGMN
FT                   VAEDPDDSTRLRVLGLVLDSPAAKAGVKQGDEVVAVDGVEVRNKSAFQAVSLIQASPGP
FT                   DVKVTIRSDAGEPGAGPTRDVTLRRSSNAVNPVASRLEGGNVGYIRLKEFNALAEPNVA
FT                   KAIESLRSQGATSFMLDLRDNPGGLVQAGVEIARLFLPSGVNVAYTEGRLKSIPSASAT
FT                   APATEPLVVLVNGRSASASEILTGALKDNCRATVAGSKTYGKGLIQSVYELSDGSGLVL
FT                   TVGKYVTPGLNDIDRQGITPNFAMFPGFQKAQEELGACERPSGPR"
FT   gene            complement(732956..733789)
FT                   /locus_tag="MICPUN_109602"
FT   mRNA            complement(732956..733789)
FT                   /locus_tag="MICPUN_109602"
FT                   /product="predicted protein"
FT   CDS_pept        complement(732995..733765)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_109602"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIM9"
FT                   /db_xref="InterPro:IPR005344"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIM9"
FT                   /protein_id="ACO67889.1"
FT                   /translation="MADAAKPKMDFRTMFFFAMTLSLCLNTVVCFIGSLGLPFVKAFTL
FT                   VTYRAALMSASVAFLYRIAYSLKPPASMMSIAGWRASLAPVLNSNGAHYVIYSIVFAMG
FT                   RPVPTVLFPLTICGGYQLLTIANKHFPATLKRVRGDRLFALAQQEMHKMMAMCATMECS
FT                   MLPLLIMELFTPARSVTRVFMYVNYLRRRYACKDDTVFRIKYTYGNAGQFHQQVWGMLD
FT                   QRTSPILRRVPGIDKVLGPLKRWFTQGAAPMKTQ"
FT   gene            <734467..>737004
FT                   /locus_tag="MICPUN_88660"
FT   mRNA            join(<734467..734988,735136..735386,735498..736392,
FT                   736501..>737004)
FT                   /locus_tag="MICPUN_88660"
FT                   /product="predicted protein"
FT   CDS_pept        join(734467..734988,735136..735386,735498..736392,
FT                   736501..737004)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_88660"
FT                   /product="predicted protein"
FT                   /note="GO_function: GO:5524; protein binding - ATP binding
FT                   [Evidence 8270; DNA binding ] [PMID 5515]"
FT                   /db_xref="GOA:C1EIN0"
FT                   /db_xref="InterPro:IPR001025"
FT                   /db_xref="InterPro:IPR001965"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR011011"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR019786"
FT                   /db_xref="InterPro:IPR019787"
FT                   /db_xref="InterPro:IPR020793"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041083"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIN0"
FT                   /protein_id="ACO67708.1"
FT                   /translation="MAARRYYEQVKVDGEVFNRGDCAYVIGDKTRDLDDDELEPCGACG
FT                   ECGDEDDVMLECDACLRGWHMRCLHPPLEEVPEGEWYCPKCLSSATGVAAPAENGRRMA
FT                   HTEFLSGNLHLCRIECIWQEANGKFMFVGRWFATPEETHTGRQAHHSRREVFLTNNTDE
FT                   NCVDSLLRKAASNKDPALVAAEAAGDDVFLCEYTYDQHFHRFKRRTEWDDDDLSDDDLP
FT                   GGRNFFHGGLTLVDEDDEDEDLDGEDSDADIDDWGGRHIAASRREAAAAAGEYGGVMGL
FT                   GAVAVPRIDKPVPTTALGRARQALSLAHSPGTLPCRDIERKKIVDFVEQSINAGAQCLG
FT                   RCLYISGVPGTGKTATVREVIRTLRKKSRDGSLPRFNHVELNGLRLQTPKHAYSAIAEE
FT                   LMGERLSPQVANDVLDRRFKEGRGSDGRVTVLVIDEMDLLVTRTQQLLYNLFDWPTHRA
FT                   ARLVILGIANTLDLPERLLPKILSRLGSNRVSFQPYSADQLMQIVKGRLHNTGGPGLIN
FT                   SPFEDTAVQLASRKVAAVSGDARRVLELCRRGAELAEARKKRSNAVDIKDIQAAQREMF
FT                   QTPHMHLLEAASRHERIFLAALVMELRRSGLSDACITNVMRTHEQLCRQFDEPLPPAGA
FT                   AAAIACRLASIRLLLADPGRKRSAQRVSLNVPRDDVVYALKQRENNAAKAAAAAMKEKG
FT                   LKTSAVSKEEFAEFDHGEIPWLRNHPGLG"
FT   gene            complement(737037..738207)
FT                   /locus_tag="MICPUN_50838"
FT   mRNA            complement(737037..738207)
FT                   /locus_tag="MICPUN_50838"
FT                   /product="predicted protein"
FT   CDS_pept        complement(737077..738075)
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_50838"
FT                   /product="predicted protein"
FT                   /db_xref="GOA:C1EIN1"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIN1"
FT                   /protein_id="ACO67890.1"
FT                   /translation="MGSAVAKYENRRDGNGVDVTLEDGQVITADVLVGADGIWSKVRAQ
FT                   MFGEPSGVKGAGSTASFTGYKLYSGLPLFKPYYYEDVGYSAFIGPDHYFVTCPDRAGRV
FT                   QWYGFIKATQPNTPDKENPAAFLEETLKGWAPEVLELIRATDPNEIEQRDLWDRFPSVT
FT                   KSWADGNVTLLGDSCHATMPNIGQGAGLAFEDGYELAKILEKVKNRSEVPSALDSFYKK
FT                   RILRTAAVQGLGRMNSEAIKILTPLLPIRPLVEYFIGPFLPLVFRTQFGYCYSFCPQKM
FT                   DAGEARALADDMRARHKKEAEAAWAEAEGRGIQLTGVENKHENPALEVIAN"
FT   gene            <738793..>739008
FT                   /locus_tag="MICPUN_64639"
FT   mRNA            <738793..>739008
FT                   /locus_tag="MICPUN_64639"
FT                   /product="predicted protein"
FT   CDS_pept        738793..739008
FT                   /codon_start=1
FT                   /locus_tag="MICPUN_64639"
FT                   /product="predicted protein"
FT                   /db_xref="UniProtKB/TrEMBL:C1EIN2"
FT                   /protein_id="ACO67709.1"
FT                   /translation="MAPSKRRKTSAAPEPASGNATQGVRTRRSASARGDLPDAPDADVD
FT                   AEPEVLLCPITRTMYRDPVMVLGFRV"
XX
SQ   Sequence 739136 BP; 125097 A; 243040 C; 244911 G; 126088 T; 0 other;
     ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac cctaaaccct        60
     aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta aaccctaaac       120
     cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa accctaaacc ctaaacccta       180
     aaccctaaac cctaaaccct aaaccctaaa ccctaaaccc taaaccctaa accctaaacc       240
     ctaaacccta aaccctaaac cctaaaccca ataagactct aaaccctaaa cccgaaccct       300
     aggatgtacc ctcaaccaga accctcaatc agaaccctca agcgaaaccc cgcatgagga       360
     tgcgtgttcg cagaaatgct ggctgttgtg ccgtcgccgc gagcgaggag agacgaccgt       420
     ggaggctttg ttcatatcgt gttacttaca atctactatc gcgcgacacg cctacgctgg       480
     aaagtgctgc gatcactcgt ccaccgtcac accacgatcc agatccacgc ggcagcccgc       540
     cgctctgagc tcgcgtatcg cagccggcac actcgtcagc tgattgccgc agaggtacaa       600
     ccactgcagc gacgtgagct gcccgatctc cgccggcagg ctcgtcagct cattgtagcc       660
     gagccacaac ctctgcagcg acgtgagctg attgatatca gccggcaccc ctccgctcag       720
     gccaaaccca tccaacacga gctccacgac cctgccgttt tcccacttta cacctcgcca       780
     atcctccggt cgcgcagcct ccggccacct ctcctgcagt tcagggcaca tcgcccgcca       840
     tgtccggagc actccggcgt catctctttc caccatgtgc gtcccgtcat ccttcgacgg       900
     ctccaggagc tcgcgactgt cccacccgtc gggcgtcacg tccgagtgct tgtccagcca       960
     atcccgaaca atctgtctca ccgcccagtt cgtcatcacc ttcgtgctgc tcagggcgag      1020
     acgcgtgagc gggtccttgg ccccgttgcg accaaagtgc gacaagatag cgctcctctc      1080
     gtacgtgtgc cccgattcaa ccaccatcac cgggtcgcgg aacatgactc gcgtgatggg      1140
     gcacaagagt acgtcgggct ccacgtccag atctgcgacg gaagctgaaa ggtcgcgatg      1200
     tgcatgcgct ggttgcgggg tgcgcccttc ggaggtttcg tatccgggtg caagcggcga      1260
     tgaggtggac atcctgcgcc gattggcggg cgccatcaag agaacttgct tttgggttcg      1320
     gccctgactg cgcgctcggc tttgcgcctc gtccgaaccc ttcgacaacg agatttagaa      1380
     gcgacgttga cgcgatgcaa gtggacattt ttcttgccaa cgtagcatct aaacgtccca      1440
     acttgctacg aaggtacgaa ggtagtagca agaacgtcgc gacggcatat tcgttggatt      1500
     tcgctatcat attgtaggta tcacgacatc gtcgactgat gttcttctac cactagaggt      1560
     acgccgccgg gggtacaacg agctcatcgt tcaccgatga gctcaaatat tggttgagta      1620
     gaccccgaag ctcgtcattc tgctctcgca gcgactccgc gtccctgagc gagtcccgac      1680
     gcttcatcag catctcgcgg taccgttcca tcgacctctc cagctgtctc cataccctga      1740
     agttcttctc cccaaccgcg ttggacatgc gctcccagaa ttccttatcg agctgctcct      1800
     tggtctttct cgtagccggc gcgtcatcgc cgaacggttg aagctgctct ctgccgccgc      1860
     cgccgtcgcc tgatttggcg aggttctccg ccgctgcaaa cttcgtcgcc gccgacacga      1920
     ggtcgacgct cgggagcatg atctccgcca cgtcaccgcc gccgcccgcg tgcatcacgg      1980
     ggtccacgcc gtcgacggtg agggcgttgg cgagaccgtc aaacgaggat gcatccgtca      2040
     cacccaaagc cttgagcacg ctctccgcct ggagccgagc gacggcagcc gcggtggtga      2100
     atcgctcctc atccgacgcg ccggtgccct ccgcgacggc cgcctcagcg gctctcacgg      2160
     cgcgctgagc cttgggatcg acgaggaagt agaacacgtc gaccagcgtc gccaggtagt      2220
     tttcgtgcgc cgggtccgcg atcctctgct cgaacgggtt atcctcttcc tcgacgtcga      2280
     catcttcgtc ctcctccatt cctactgtcc cacccggctc cccgctgctg gccctggcgg      2340
     ctttggtggc ggcggcgcgt tttctcctgg cctcatccag cgccagctgt tctgggtgct      2400
     tgaaaacatc ctccgacggg ggatgccaca ccatgccaag atgctgctcg tggaggatcc      2460
     ggtcggcgtc caatgctcgt ttcaccttcc tcgcaatctc ctcctccttc atggcccaca      2520
     cctcctgaaa cttcttgcgg tcgctcgcct ggaagttgcg aaacttgatc tcgagctcct      2580
     tgaactgctc cgtcaccctc ctatggtcat ccgtcagacg aacgttttca tcggagaact      2640
     tcttgtccat cgcgtggaac ttgtccttga ccttcatgag cgtctccctg agctttgcga      2700
     ttttgcgtcg ctggatctgg agcgtcccgg cattctcgtg gtccctctcg acgagcaccc      2760
     tgtagttgta ctctagcttc tccgcgttga gcaggtaggt cgacttcatg tcagccaggt      2820
     gtcgctgaag gttggcgatg tccgtctcga gcctgatctt gagcatcgtg tactcctccg      2880
     cgtcgtcagc ctcgtgcttc tcgagctcct tcctgtacgc atccgctgtc gccgccacgt      2940
     cctccatgta cttgagctca gccgcgtctc tccgttggaa gagggcgtcg agctcctcca      3000
     tgttcgcctt gagcgccgcg ctcctctcct ctaaaaacac gcgctcgatc tcgtcaaatt      3060
     cagacatgta cgcggcggag agctcgttgt attgcgagtt catccgcttg agggtctcgt      3120
     caacctcctc ctcctgcctg cgaatgttcc tctcgaactc ctcgtcctcc ttgtcgagct      3180
     cctcggtcat ctcggcgatg agcgcgtttt tgctcgcgac gatctggtcg caaagcgcct      3240
     tttgcgcctg aatagcggcg ttcaaatcgt gagccacctt gatgccccgc agcttgtccc      3300
     actcgcctgc cacctcgccg tccctctgca tggtctcggc gcgctcctgc tcgatgcggt      3360
     tcctccgctc gaccctccga tcgtcgcgaa cgccccgtcg atgcgcctcc ctcgcgacgg      3420
     caaccgcctt tatgtcggtc acgtcttcaa agccgagggc cttgagcctg gcgagccttc      3480
     gcttactgtc cctcacctgt gtctcttccg cggtgggttc gggttcgggt tcgggctcga      3540
     tgaggctggg atcttccgcc tcgcgcttag ccttgagccg cgcggcgatg cgtgcgcgcc      3600
     tcgcggcgac gcgatcgtcc ctgtcgcccg attcgagctt acgcgcgatc tctgcgtcgt      3660
     ccatgggctt tgaggtggac gtctcgacgg gaagaggatc gggctcttcg acttcgaccg      3720
     gctccgccac cgtcccttcc gccgtctctt ccgccgtctc ctccgcggtt ccttcgaccg      3780
     gctcggatgt ggacacctca ggaggaggaa cctcacccgc tggcgcgtcg ccttccgtcg      3840
     tcgtcatgac gctccctcgg cgacctaaat tcggctggga tgtagaaaac accagcgggg      3900
     gttcgggttt cctcgccgag cgtcagaccg gtcggagatg tgcagtgatc aatcacgcgt      3960
     tgattctgcg cgcggtgact cgggtgcgat tcgagtgctg cgcaagcgcg tccggcgctc      4020
     cgccccagcg ccaccgagaa tgcgacctaa aagaggaatt tgactctgcg tgagagagaa      4080
     ccggacgaga ctcgcttgac ttgcttgagc agttgcgcgg cgtttggaac aaaaatttgt      4140
     actggatcac gcacaactcg gaacgcgatg acgacttcgg cgggtgcggc gacgacttcg      4200
     gcgggtgcgg cgacgactcc gccgggcgat cccctcaggg aattcgagac ggatcccgtt      4260
     ctggagccgt tcctagccga cgacttcgac gccgtcacgt acgccagcga gtcgctcaca      4320
     gcgagaacat caaagacagt tctgccggcg ctggacgccg ggatcaagtc cctaaacgcg      4380
     gcgctgcggg ggacggttac ctcgcactac gatgaactcc tccagcaact tggcggtatt      4440
     gacgagagcg agcgcgtcct ggagatcgtc agggacggag tccacaatct tcagcgatcc      4500
     atgggcaagg ttcgagtcga gatcgtcgag ccccacgagg tggtcgcggc gaagacgaag      4560
     cagctcgaga acctgacgag gacggtcgag acgctgcatc gcgtcatcag aaccttgaag      4620
     ctcaccggca ggctcaaaga cagtctcgga gcttcgggtg gtgacgacgc ggagggcggc      4680
     gctgctgttc cccactccgc aacatcgggc gatctggcca aggctgcgaa gatgctcgcc      4740
     gacgcctccg agctcgagcg ggagggtgtc gtcgaggacc aagaggcatc ggccctcgca      4800
     ggtatcgagg tgattgaccg cgacgccaga tggctggagc gagcgggcaa ggacgtcagg      4860
     tcacgagcga cgcaggctct gaacgcggga atggacgcga cgagccaagc tgaggttggc      4920
     gcggcgctgc aggttttcca caacctgggc gagctcgatc gggcgaccga cgcggtcatc      4980
     gctcggctag ctaacgacgc ggttgacgtg ttccgagagg cgctcgaccc gagggagctg      5040
     gcgagggcga tgggtggagg cgtcagcgcg agcgagcgcg ctggaggagt gggtgtgggt      5100
     ggaggtcgcg gcatttggcc gcctgctggg caggagcaca gatgggcgga ggcgctctgg      5160
     cagcgtctcg gcgccgcgtg cgagcgcgca aaggctgccg gcatgggagc atggcacctt      5220
     cagcgtgtcc tcgcgaagaa acgcgacccc atctcgcacg cgctcttcct ggacgaggtg      5280
     atcgccgcga ggaagaatct ttggcgcgag aaggtggcgc agagcacgga agccgaagcc      5340
     gccgcgagta acccggaaga tgccatttca ctcccgtgcg agcgtttcgt ttggcagctg      5400
     agcaaggggg cgggggaggc tttcggacgc gcgcacgccg ccgcgggctt cgcgcgggat      5460
     actctgctga agggtttccc gagactcgtc acgctcatcg agggtcttca cgagggtctc      5520
     gccaaggaga gcggcgcggc ggcaaccgcc gcgaagggcg gggttccccc cgccgtgcga      5580
     aaggacggct cggacctcac cgtgttgctc cacgcgtgcg atgcggtgtc caacgcatat      5640
     ctcgcacgct cgttccagag gctcagcgag cccgtcaacg cgttgctgtc cccgtcggcg      5700
     ctccagtcgc tacaaggtat cgcgtctggc caaatatcgg cgagcggcac ggttggtacc      5760
     cgcgccgccg ccgaggacgt gcgacgtttc cttctccgcg tcagggagga gctggacgcg      5820
     gttgcccgcc acccgactct cgtcacgcag gtaaccgcgg gcgccgtcgc gaaggcgctg      5880
     cggctgatgg cacaaaaggc tgagattggt gtcgtggacg gcgccgaggc tcgcgttttt      5940
     gtcgtcggaa ccgcgcagac cccggcgcaa gctaagaatg cagctctcgc gggtgtcctc      6000
     gaagagattt gcgccgctct cggaaatgta gttcccttac tgcccgacga gcccgccaag      6060
     gctctggaga acgcgctcgc tcaggttgcc gagacggcga cggaggcttt ggagccggtg      6120
     atgagcgcgg cgcacgcgga ggtacacaag aggctcgcgt ccatgcacaa ggaggactgg      6180
     gccggcggcg acccgccgat gggtgaaggt tgctcgacgt acatgactca ggtcatcgac      6240
     gtcgtcgctc acgtctcgga ggagcactta tccggggtga ggcagggttc tctgctcggt      6300
     cacgcctcgt cgagctccaa gggagcctcg ggctttgtgc cgtcgacgat tgccgcggag      6360
     gcgctcgccc gacgttgcct cgagctgttc gtccgacacg tttccctgct ccgcaacctg      6420
     ggcgagaacg gcaagcttcg cctcaccaag gacatgggcg agctcgagca ggctgtttcg      6480
     gcgtacctcg ttccggcgac gagctcgctg ggagacgcgt acaaggctct gagggccctg      6540
     cgaccgtttc tgtttttgtc gctcgatgag gtggcatcga gcgcgctcgt cgaggatatt      6600
     cccgcggcga acgtccttct gcacctgtat tcgcacgcgc cgaaggagat ggcgacgcct      6660
     tacgagcgtg ccggactcgc gccgccgcag tacagcgcct ggctcgacaa gaactcagac      6720
     gccgaggtgt gggccggggt taagggaacg ctcgaggcgt acgaatcgca gtgcaagaca      6780
     aggagagtca ctccgcatgc ggcggtggac gttatgagac tagtaggaag cagagcgttc      6840
     gagaagaggc gaagctgata tcgataggat gggcagaata caaactacca acccgataga      6900
     gctagctaga gggtgtgcta gtatataatg aggatgatgg gccacccatc aacgtcggta      6960
     tgtcgaacta aacagcgaat ccattgcgaa cgccgttgtc cgccttgggg gtgccggcct      7020
     ctttggcgac tttggtgatg acggtgtctc agacggcgtg ggatctgcgg aggtgtgatc      7080
     gtcccctttg gcctcttcgg cttccacatc tgtccttggc gcgctcggac cctccggatc      7140
     cggtacgttc cccgatgtca gcgcagcgag gatccccgcg ccgatgcaaa tcggacactc      7200
     cgacgcaaac ttcttgtgcg gacacaacac tcccatgcga tcgacccgat cggatctcgt      7260
     cacctcgttc tcggaaatgc gtctcaaaga ttcacccaca gatccagatt tgatcgcctc      7320
     gccctgcgac tccgaggtca agtccacctt cggctcgacc cgcgccagat cggtcgcttc      7380
     cagcgctggc gcgtccgaga cttcgggatc cgccatcgcc gccgccgcgt cctccatcgc      7440
     cgccggcact tccgccatcg ccgccggcac ttccgccaac gccgccgccg cttccgccgc      7500
     cggcgcttct gccatcgccg ccgccgtttc cgccgccgct ggcgcttcca ccatcgccgc      7560
     cggcacttcc gtcatcgccg ccgccggcgc gtccgatacg ttgggatccg catcaaagga      7620
     gcgcggatcg tggaccgcct cgttcggcgc tggtttaggc atcggaacgt cgccgacaat      7680
     tcccagatcc ctgcaccacc tgcaccgtga cctctgctta ttgtgttggc acaagccccc      7740
     gccgccgcaa tctacgcact gggtccgacg acgaccgtgc tcgcagaatc cagaccctcc      7800
     gcactccttg cactgcgact tgactctacc gtgcgagcac aacgatattc ctccgcactc      7860
     tttgcatttc gacttctcct tgccgtgccg gcagatgtgc gcgccgccgc attccttgca      7920
     catcgtacgc cgacgacggt gcggacaaat cgaaacgccg ccgcaatcct tgcactgtga      7980
     acgctgacga ttgtgttggc atatccccgc gcctccgcac tccttgcatt gcctcttcct      8040
     cctcccgtgg acgcacacgg agcctccacc gcagtccctg cattttgact tttgccggtc      8100
     gtgtatgcag tatcccttct tcttcggttt ccagccggga ggaacgacga cggggacgga      8160
     ctttacgccg gcgccctctt tcggagcggc tgtgtccttc gtcttcgacg gcatgacgaa      8220
     ctttccccca ccagataaag agcgttttct cgaggcaccg ctgcgatgtg acggtgctcg      8280
     ccgacgcgcg gagccgcggt ccggaccgac gatgggccgg gcccgttcct gtacccctct      8340
     gagattcctc tgacgcctgg aggcggtacc ctttgggcca gctcgggcgg tgtcgccgcc      8400
     cctgccccga ggtctggcgt cgtccgtggt gggctcgccg tcaaaaagct gccgaccttt      8460
     caagccgtcg tgtgtcacaa aatttcggac cgatgggatt ggctcgtcat gcacagtggt      8520
     ccagtcagat tcctggaggt agggtcgaat ttgaggtcgc cccttccatg accgcgtcac      8580
     cgtggcgtgt ctaaatcgga gatgggaaat gcaaacggaa actcgcatct aattacgcaa      8640
     gggggcctcg ggatgtaaca gtattttctc gttccaacca acacccgtct cgagcgcacc      8700
     gacgcagtgg gacgagcgcg acgctgcgtt agacgcagcg cttcgcggtc gtgagcgaga      8760
     tttggcggcg ggtttcgttt agcgggtcga gatgggtttc cgcctgtggg gtcgaaagaa      8820
     ggatgaggag cagtcgtgga gcgagttcgg ggagctcatc gtccacgtct cgctgttcat      8880
     gctgtccggg ccgactttga ttctgctgca gaagtacgtg ctgggcaacc tggtgttcga      8940
     gtatccgatc ttcatcgtga cgatgtccac gttctcgagg tggttcctga ttctgggcct      9000
     ggtccacacc ggcacggtca ggctcggggc gcacagggac cttacgttca tggagtggac      9060
     caagggcatg ctcccggtgg gtgtcttgga gtgcatatct ctcgcgacgg gctcggccgc      9120
     gtaccttcac ctgtcggtgt cgttcgtgca gatgctgaag gctttccagc ccgtggtgct      9180
     gaacgtgctc atcacgactc tgggcctgga gccgttcagc atgcgcgcgt tcgtgtgtat      9240
     cgtgctggtc acctttggca gcgtcctggc agccatcggc gaggtgaact tcacgctcac      9300
     cggtatgtac ctcatgctcg tctccgagct ggcagagtcg gtgaagtacg tcgtgctgca      9360
     ctactttctg cgcaacgagg gatactcgct ctgggagggt atttatttca ccacaccgtc      9420
     gagcgcgttc tcgctcgcgg tgctttgctt cgtgtttgag cgcgacgtgg tggagcagga      9480
     gaacctgctc gtcgtgcagc acaactcgat tgtttttctc agcctggtga cgctagcgat      9540
     catcaccagc gtttcggggt tcgggatcat caaggagctg ggaagcgtgg cgaacaaggt      9600
     gttggtgatg ttgaggaacg cgctgctgat ttatccggcg acgcagcttt acgacgaggt      9660
     ggtggctccc atacaggtga ttggatactc cataactctg ctgggcaccg ctggtttcgc      9720
     gtttttcaag gtgagccagg aggtgataac gcgcacgcag tcgcagatgg acctggcgtc      9780
     gatggcggaa ctgagcagca gcgacgacga tgaggggacg gtgccgtccg acgtggactc      9840
     gagcggagga cggggacggt acggcgccgt cggcggatac gccagcgacc ccaccacgca      9900
     gccgctgctg gcgagtccgg tgaaggcgag caggctgggg acgccgccgc gttcgccgat      9960
     gaagcggaac gggtccatca agcggtcggg gagcaatagc ggaaggggcc cggggctacg     10020
     aaggacgtcg ccgccaaaca cgggcgggta ctgggattga tgacgcggag agagcgacac     10080
     gataagatta gcgggaaaaa aaaattaatc acacgcgcga attgtggagg aacaccgaac     10140
     cattcagaac gccgccgcgt gaaccggcac gcccttcacg ccgacgtcga tcgcgaaaac     10200
     gccccccgcg gtgggttcat ccgcggacac gtccaccgcg tcagcgtcca cggtcgtgtc     10260
     cagggagcaa gacgtcacga acagcgtcgt cccgtctttc ccgccgaagc agcagctcgt     10320
     cggccggctg cacgggaacg cgatcgtccg atccagccta gcgttcccct cgccgtccgg     10380
     cacgtaacgg agcactttcc ccgcgtccca cacgcacacc caaacgcccc caccctcgtc     10440
     gacgcacatg ccgtccggca ccccgacgtc gtcgggcatc cgagcgaaga cccgcccgtt     10500
     tcgcaacaat ccgctctccg cgtcaaagtc gtacgcctcg acccttcgtc tcggcgagtc     10560
     ggcgtagtac atcgtgtcgc cgaccgggga ccaagcgata ccgttgctcg tccacacgcc     10620
     gccaacctcc gccacggcac ccgcgacgcc caccttcacc atggacccgt tcctgaagct     10680
     aaacgccggc tcgacgcaaa acaaagcgcc ggaggggggc gcatctgtac tcggcgagaa     10740
     gtgcgccgac gacgcgttgt tcgattcgtc gtcgttttcg gaacccgtcg gcgtatcggg     10800
     accggcctgg acgtatcgcg cgtccatgtc cgggcgaccg agcaccttgc ttcccaccca     10860
     cacgcggccg cgagcgtcgc acttgccgtc gttcaggcac tgcctctccc cgggtttgtc     10920
     cgcgagcgga cggtggacct gggcgtcgag gacgttgcag aagaactctt cggacgtgtc     10980
     cgcttcgagt gtcccggtat cgtcgtaacg cagcacgacg cgtcggagct gaccgcccga     11040
     cccgtcgtcg tccaccgcca gcgcggcgag gaacccgccc ttggacgagg ggacgatcga     11100
     acccggcatc tttgggagct gcgcgcgacg cacggtgccg tccctcaggg tgcagatctc     11160
     cttcgccacc acatcgatga acacaagttc gccgttgatc cagacggggg attcgcccag     11220
     tttggcgcga taatccccgc cgacgatctg cacctcgctg ttcgtggtcg ccatcgctcg     11280
     ccaaaaagtg tcggcgccct gtagaagcca gccagctcga tgccagagtc agccttggcg     11340
     ccaagacggc gcgggttgta tgacgtatga gggtgccgag ggttcacgaa cccttgcgat     11400
     cattttgcgt ttttggctga ctgatttctt gtacgaaaaa cccaaacaca gttcggcgtt     11460
     gcattctgac cgtgcagcac acctctggcg gagaaacggt aaggcgctcg cacttctcgc     11520
     cgcgccgggt gactaggaaa tcacccttcc cggcgaccat gaagttcggc aagcagctcg     11580
     agacggagat caacgccgcg ggcgtcctcg gtgacagggt gccgtggatc gactacgggt     11640
     gcgttccctg tgtgtcacgc gtcgaccgcc aaaaagatag atcgaatgcc cccttcgagc     11700
     gggagagcat cgccgcgtcc cgaggcgcct ctcgcccgtc cccgcgaccc tcgctgacct     11760
     ctccctgctc acccaaatcc tggaaaacag aaagttgaag aaactccgca actgccgatg     11820
     ccacaaggac ggcgttcaga aggaggagga ggagaacacc ccgctgaagc gggccgaccc     11880
     ggaggaggag gcagccttct tcagcgacga cggcgacgcc gcgacggagg agaaggccgt     11940
     cggggagaaa tccgcggcac atgacgacgg cgtacctcag aaggacgacg cgccgtgcga     12000
     gcgttgcacc cagctcttct acgccgagct cgacaagtcc atgaatgcca cctccaaggc     12060
     gtacttctcg tgggtgagcc ggatcttgtc gcgcgctccg tttgagcaca gcaagccgtg     12120
     gtggcgcaag ggcctgaacc tggacgcggt gaactgcggc cccgggatgt acggctcgaa     12180
     gggccagaag gtcaacgcca gcctcggctt caacgagccg agggacgagg atggaaaaga     12240
     ttacgccccc gacctctccg gcgtggacat tgacctggaa cacgaggcga aggagtgcct     12300
     caactggatc gagctcaact ccaccgcgct gcgcaaaatt ctcaagaaat gggacaaggc     12360
     caaccacagc accaagggaa ggcagaccct gcgcaggtac tggaccgaca gccagtacca     12420
     gatgctcttc tcgcccctca tcctggagct cagggcggtg gcggggatga tggagggggg     12480
     cctggaggga ccgcactgga acctgcacga cgacgagcac gacgacgacg agcacgcgca     12540
     cgccaacgtc gatcacagcg agggcacggg cgtgttgacg tgccccattt gcttcgacac     12600
     gctctacaaa ccggtcggtc tgcagtgcgg ccacgtgttc tgccgcgatt gtctgctcca     12660
     gtcggccggt gtcctgaagg agggtgcgac gctcgcggac ctgcgcatgg aacccgcgca     12720
     ttttcacgac gaccgaatcc cgctcaccaa cggcttgagg cgccactcgg agggtcagga     12780
     cagcgcgcac agcgcggagg gcgacgagga ggacggggcg gcgaggagca acgagggtgg     12840
     cgcggcgcct cccccggggc gcaagtaccg cgccaggagg gatcgatgcc ctcagtgtcg     12900
     aacggaggat gtcttcggca gctctgttcg tctacgacac gtccaggact gcctcaggcg     12960
     cgtcgatccc gagggataca aggctcgaaa ggctgagagc aagaagctgc ggagtaagct     13020
     caagtcggag gcggtgatga acaacatcgt gaacggcttg atcaagctcg tggcgccgac     13080
     gaaccggggg atgaacctga tcgaccctcg caccggccag attcgcacct gatcaaaggt     13140
     tctcgtgttg taatttatcg cgtactcgtg tcgacgatcg tcccgtcgct tgcgatgctc     13200
     gtgtaataaa ctctctctac aaagccttta aaaaataaac tgatcgggcg atccagggtc     13260
     tactagtaca gggtcgaggg gtcaggtctt aggacccgcc ttgggcatct ccgaggtgcc     13320
     gaacacgatc ttgttcatgt acctccgcgc gggcccctcg atcgactcgc tcatcatcat     13380
     cgcacccgcg gcaaccttgt ggagcacgct gtgaacgcgc ctgttcatgg tcgggtccgt     13440
     gacgtacctg ttgttcagcc gcataccccc gcggtacagc ttcttcaggc cgtacacccg     13500
     caccgcgagc agcaccgcga tcttcttcgc cagccagagc tgcacgagca cgatcggcgc     13560
     ggccggcatc acttcgcctt cgcctcaccg gcgcctcacc cccgatgacg ccgcggactg     13620
     gccacgccgc gtttcctttt tcctggtttt cttgctggga cgcgagggag atccgctccg     13680
     ctcccgggac cgctccccct cctgaccttt gcccggcgga agacctccga agcacgagag     13740
     agttcctctg gggcctgtga ggcggcgcgt tcgactgcgc tctcgcgtgc cttcgcgccg     13800
     cggccactcg atatggtgca ggggccggga cttcacgcgg cgcagagacg aggacccgcg     13860
     tgtgctgaca gccaggcggg agaacaagct gagtaatcac gcgactgctt gcgcagcagc     13920
     caggccgaaa atttctgtta ccagtcgctg gcgcaccgag cgagatgccg cgcccaacac     13980
     gctccgtgtc cggggccgtc gccgacgaca aagagttcgg ccccgaggtt tcatcgcgag     14040
     gcggaggcga tggcgagccc aagtcggggc ggatcgtcga cgctcaggag ctgctggacg     14100
     cgatgacgtg cccagtatcg ggtctcgtct ttgtggaccc ggtgaccacg acctgcgggc     14160
     acacgttcag ccgacagtcc ctggcgcggt ggatgacgtc gacgggatcg aaccagcggg     14220
     acggcgcggg cccgtcgtgt ccgacgtgca gggctccgct gtaccacgag tctccccacc     14280
     agtggccggt gaacacggtg ctggtggacc tggcggagag atttctccga gacgagatga     14340
     tcgaggcgcg gacgctgacg tacaagatgc ccggcgcgat cgcgggtgga tcgggggtgg     14400
     acggtgactc tcaagccggc cagatcctcg gtgagctccc cctgttcgtc ctggactcca     14460
     tgaccccggg gcaggagctg acgctcaacg tgttcgagga gaggtacaag ctcatgataa     14520
     ggcggtgcct ccaggcgacg cgaaagttcg gcatggtggg attggcgcga cccgcggcga     14580
     cgcacggacc gtcacgaggc gtgggaggag acggcggttt tagcgtcgag gcgggtgaat     14640
     cgaacgggag ggatggcgtc gaaaggaggg aaggcgtcga agcgcgccac gagcacgcgg     14700
     gcgcgagtcg gctgctccgg tacctcctcg ccgacccgtc gccgccggga gcccggggcg     14760
     gcacgtttca cgccgatcac gcggtggagt gcgtgataac cgcgttccag gagttgttgg     14820
     acgggcggct cctgctcagg tgccgcgcca cgcgacacgt gcgcatcgtg gactccaggg     14880
     acgaacccgg aggcgcggga tacacctgcg ccacggtgga ggcggtggtc gactcggacg     14940
     ttcacccgcc ccgcccggga cgtccgtcga ggtgcgcccg gcgtcgtcgt gagtgcgccg     15000
     tccgtcgcga gtacccccgt gattcgcacg cgttcgagag atggcgacgc gtccggtggt     15060
     gacgcgtcgg cgtcgatcct cgcgcgcgtg tgcgccgggg tagcgccgga cgacctcgcg     15120
     gaccgggacc gggcgaagat gctgctgagc atggagatgg cggcggggat ccaccacgtg     15180
     tggctggcgc acgtggcggg gcgcaccatc gggtggcaaa ggcccgtgga ctgtcccgcc     15240
     gcggacgacc tggagcgatg gtcgcccccc tcggacccgc cggaggactg ggtgcgctcg     15300
     cggtatcccg tgcgcgagag cggggcactc ggggggcgat cgggggtcga tcggttccct     15360
     tctcccaacg atttcctgcg caggtcgtac ggcggtgacg tcgagaacct gctcgcgatg     15420
     tgcgggagca ggccggcggc gcacatgccc accgagctct cgtggtggtt cacccgagtg     15480
     gccaaccctc tgccgccgct gggagccgcg ctggagcttc gacccgacgc gttgcggtgc     15540
     accagcgcga cggatcggtt cagaaacgtg tgggctaagc tgttcgcgtc catggtatcc     15600
     cgccacggcc tcaagcccac gcagttcagg ggcgcgagac ccatggccga cgcgacgatc     15660
     gcgagcctcg tgtgcgaggc gctcgacccc gacccggcca ccgcgttcgg agcggtgtgg     15720
     tacccggcca tcgccgagct cagggaccgc ggaacaacta ccgcgacagt tccgtcgtcg     15780
     tctgatggcg cgccgcccgt gatacaatac gagggtgccg tggaggattc cgaaggacgc     15840
     gcgtacagac gagcgcgggt cgaggacgtc gaggcgttga tcgacgcggt gacgcgaacc     15900
     ctggagcttc caatcgccgc cgacgagtgg tcacccgtag agggaaggtt cctttcgtac     15960
     gtgtacgtgt cgccgagcga tttcgaggga cccggacccg ccatgcgatt acccccggtt     16020
     ccccccgacg tcgatcgcga gggacccgga cgatcgacgc gcgtaccccc ggtacccccg     16080
     gcgagccccg gatcgcgatc gacggcccgc tctggaattc tcggcgggcc cgggtcggcg     16140
     ggtgggctcg cggcggtcgc ccggcggggc ggcgtgcccg cggtgtgctg gtgcctgcac     16200
     ctgaggctgt cgtcgatgct tccggtggag tgggacgacg cggtgtcgcg catcgccgcg     16260
     gcgttgcggg gcttggatcc cacgcgcggg gcgcccgcgg tggagggtac cgtcgtcccg     16320
     attcccgagt acgcgcccca gcccggggac tggttctcgg cggggaagtg cgtgggacgg     16380
     cgacgcgcgc gactggcggg gcgggtcggg gcgtcgtacg gtagggtcgc gggtgcgacg     16440
     gtgggcgcgg tcgtgtgggc gtactacgtg gtgtgcgagc tcttcctgtt gacggcgctg     16500
     gcgctcgggc tgtttgggcg ccccgggcgc aatcgattcc cgcagtcgtt tgtgaggggc     16560
     gccgccttgg cactcgcggc tgcggcgctc ttcggcgtcc tctcctacgt gccgtagcga     16620
     tgcgtgacat gaatttgaac gccaacgtcg tgactctgct attacaatcc gtagccctct     16680
     agctaggaga ctttcgctca ctcctcggat gggatcagac cctgttggtc aggttgtcgc     16740
     ccatcgccct gcgctggttc gaaccgtacg ccccacccgc gcgtctcttc ttgttcgcct     16800
     tgaccgtgtg cgccaccgtg agtttctccg tggtggagta cttccagtcg tggaacgcct     16860
     tcatgctatc ccgccccgcg tccagcagct tctcctcctc cctggacagg aggtgcctgt     16920
     ccttgaactc cgacgtgctc agcgcggcgc ccaccaggag cttgctgtac ctcgcggtga     16980
     acgccttctc gagctgctcg tggagctcct cgtcgcgcag gagctcggtg aacctggcgc     17040
     caaactcgaa gaagtgcggg ttaaagtccc tcaggggcac gttcttgggt tccgcctcca     17100
     ccacctgcca cacgcgctcg tcgaagcagt ccggcatctt gggccccacc atgttctgct     17160
     cgaagagctt gggcaccagc cagaagggca gctccacctc ctcgcccatc ggaaggtccc     17220
     gcgtctggca catcttgtcc atctctttcc ccaggcccgt gcacccgctg ttgaacacca     17280
     ccggaaccct cgtctgctcc gcgaggaagc tgtcgatgtc aaagtacctc gacatcgcgg     17340
     ccgtgcgtcg tgcgctctgt cgcgattgcg tttgaaaaat ccgctcgggt ttcaaatccc     17400
     agctgacagg tgggatcgat tcaccaacct ccgctcctac gtcgcggcct gggcaatctc     17460
     aaataggcgc gatgagacac gatcgacgct ccgaacgtgt tctgcgcgtg tgtgcgcctc     17520
     cctctcgcgc gttcgcctgt gcgcttctac ggcctgttga aaaggatttt caaataaacg     17580
     ttcggccgac ccgtttcgtt gcggggggaa aatttcaatc ccaaaaagcg tacgacaccc     17640
     agttatgaat taaataaatc taaacataaa ttgactcaat tttacaacta aacgtcggtg     17700
     ttcttatact catccgtagg gtatccgtcc agaagcctca cgtccaccac cgtcatcccc     17760
     gcggctttcg cgctctgcat ccccagctcc gcgtcttcgt acgcggtgca cctcttggga     17820
     tcgacgccca acttctcggc cgccaggagg tacaaatcag gcgcgggctt gccgtgcttg     17880
     acgtcctcgc acgtcaccaa agcgtcgaac aggtcgagga tgccgtgccc cctgaggtgg     17940
     cccgtcaccg tgggcttcac tccggaggaa gccaccgcga tggggaggcc cttcgctttc     18000
     gcgtccctcg cgatggccac caccggatgg atcagctccg gtccctggct catgatctcg     18060
     tccgcgagct cctgcgaggg gaacggaagg agatggaata ttaatattcc tcgtcagcac     18120
     ggtttcgacc cctcgggacg gtgcgacggg acgaaaggat ggggatttcg acgcgaggcg     18180
     ggggtacggt gggcgtgcat acgttctcac cttgcacctc gccgccatgg cgtccaggtc     18240
     cggggtcttc ccctgctcct cggcgagtat ctcgaatatc ctccttatgg gcactcccgc     18300
     gaggtcgtag aactgcttct tcgacatggt catgtcgaac tcctcgcacg tttgcttatc     18360
     ggcgacgtag aaaccgccca tggtgtccac cagggtaccg tcacagtctg cggggatggc     18420
     gtttcggggc gtgggatggt cagggatcgg gttccggcgc tagggtgccc aagggtgccc     18480
     agacgcgtga gaaaaggccg cgtgggagct tttcgtgtgc aaaaggtcgc ggcggcgggg     18540
     gcgggtcggg aagggtcggg acgcaccaaa aacgagcgcg gctgggtcct cgagaccacc     18600
     ccacgtgggg tgcgtcttcg gctcgggtcc ttcgctacca cctcccatct ctccgtgtca     18660
     cgcgcgcccg ggtgcgggtc caaatggtcg ctatccgtaa agttgcgtcc gtctcgtgat     18720
     tttctcgcgg acggtgggca gctgactcga tatttgggcc ccgcatcgcc cgggctatcg     18780
     tcacacgggc acggcggagg ttgccgccga cgacgctgat ggggggcgag cgaggtccgg     18840
     agaagcctcg tggagcgggc ggcgcgttgt cccccgcggc acgtcgccag cagaggcaac     18900
     gggaccggcg cgagaagctg gcgagggaga agaaggcggg ggcttccaag gagaaggcga     18960
     gtgcggcggc tggcgcgggt ggagcggctt ccaagcgacc gccggcggga ggatcggcgc     19020
     gtggcgaggt gaaacgcgcc aggagagagt cgtcttcggg ctcggaggac gacgtcggcg     19080
     atgactcggt ggacgagagc ggggacgacg ccgaggggcc cggcgccgcg ggcggggacg     19140
     atgatgatgc ggtcgagcgc acgggcgcgt acggcagcta cgggaggacg gacggtcgga     19200
     tgtctgtgga ggatgatgag tgggcgacgg cgccgaggac gtgggccgcg ctcgcgcctt     19260
     acctctccga ctatcacgac aagaagatct gggcgccgtt ctactacgac ggagccgccg     19320
     gcaagcgact gagggatgcg gggttcacgc gagtcgtgca caagagggag gatttcttca     19380
     agcgcgtcaa cgaccgggtg ttcgtcaagt ccgtgtccgc ggtggtggat aacccgccgt     19440
     acacgggcaa agggatgaag gagagggtgc tgagggcgct ggtggcagtg gacgtgccgt     19500
     tctgtctgct cctgccgctg ggcgttttgc acacggcgac ggtgagggag atcctcgacc     19560
     ctgagcacgt gcaggcgctg atacctcggc ggtgctgggt gagcaagagc gggcagcggg     19620
     aggtgccgtt caagtacctg gtgtggctgt gctacaagat gagactgccg cgggacctcg     19680
     tcctgatgcc ggacacgtga gattagccag tatatagcga gtagggaaga cgtgaaatca     19740
     tttcgcgatt gcgacgacgc gttattcgtc aaaaagttag tggtgggcgt cgtggccggc     19800
     tctctggaca gggatcgcgc ccggcccagc cttggcctgc gcctccgcct tcttcgcctc     19860
     ctcctccgcc ttcttcttgg cgagctcctc cctccgcgtc ggcgcgtacg ccaccagctc     19920
     ctgcagagtc tgctgacccg ccgcgtccaa cccacccgcg agcgcctgga acctctgaac     19980
     atccgtcgac tgcgtcacct ggaccgtctc ggcgaagaga atgaacgggt cgacgtcgtc     20040
     gatcggcgac gtgaagttct cgtcgtcggt cagcataccg tcgtcgaagt cctcgtcgtc     20100
     gtcgtcgtcg tcctcatccc cggtcctcct cctgtacggg ttcaccgccg tggcccgctt     20160
     cgccatcgcc tccagctccg cgtggtcgag ctcctcctcc tcctcgtcgt cgtcgcccag     20220
     gtcctcgtcg cccccgaagt cctcttcgtc ggagccccaa ccgtaaaaac ctcccgggtg     20280
     cttggcctcg aactccttcc tctccttctc ctgctccctc aggtccacca gcaaactcac     20340
     gacagccgcg caaatctggc ccatacccgc ggcaacctcg gcggggaggg actgcgccgg     20400
     ggtttggatc aacgccacca gcccgaggat gcaaaccttc ttgtcgtgct ccctcctgtg     20460
     gtgcttgcgc ttgtttccac cttttctggt tcgatcgccg agcatgccga accaggtctg     20520
     cagcgcggtt cccagggcgc cgttcttgac cagtatatcc agggtcagcg ccgcgttgta     20580
     ccacaggcag ttggccacga tctggatgag aaggtccttc aggtaggtca gctcgcacgt     20640
     cttgagcctc tccagcgcga cagccagata aggagccacg caatcgtcca cccgaccctt     20700
     gcagttctgg aggacgcact cgagcagctt gggcgcgggg agcatctccg gctcggggat     20760
     gtcgttattc aggagcacgc cggatgcgac cctgaggcag tcgcctttgc aggtggggtg     20820
     cgccaggaac gtttcggtgc cgcgcgagat gtagttgtcc atcggaacca ggatgttctc     20880
     gaagtactgc acgccgtact cgccgtcgag cgcgctgatg agcacgggcc acagctccca     20940
     catcgccggg gacacggcgg gggcgtagta cgtcatgtaa gacaaaatct ccaaaacctc     21000
     ctcgtacacg tcgtatccgt cggcgccgag catcttcctc atgatgggca tcagcgccgg     21060
     ctcgagctgc gcgtacatgt ggggcagcgc ggagagggat tcgaggatgg tggctatcgc     21120
     gcgtaggcac cccacggaag cgagcgcgcc ggtgaagtcg tcttcgtcag tctggtcttg     21180
     cgacccgttc agtttccaaa acgcggcaac caggttctgg gtcatgccca tggcgtacgg     21240
     tgcaatctcc tcgccgaact tctccacgat cgtctccagg gtgaacacca tctcttccga     21300
     ctcgacctcg ttcatcagcg cgaagaactc gtccaggagc tggggcagga tgggccgaat     21360
     ctgggagatg tcatccgccg tctccacgaa agacccgagc gacacgatgg cgtcaacctt     21420
     caccggcagg tcaggatcct tgaggcagtt caccacaccc gcgaagagcg ccatgaaatt     21480
     ctgcgggttc gcaaactcga tttcggcgta cacacccgcg caccacgcag ccttggccct     21540
     gacgtgaccg tgcggggact ggaaggaggg gagcacgtgc gccgtgagca tgggctcgag     21600
     ctgttccatg taccccgggg tggtcttgag cttctcctgg agcgacccga tgcagtggag     21660
     cgcaccggcg agctcggggt gcggtgcgtt ggcgcccaac tcgttgcacc gggtgaatat     21720
     ctgcacgatg aaccccatga gcttgggcat gttctccttt gtgcggcacc tgcaaacctc     21780
     cacgagaaag ttgacggcgg cggctcgggg cgagtacatc tcctcgatga tgtcgttacc     21840
     ccggcggatg tactcctgcg ggtcctcctc ccacagctcg gcgtccacct ggttaaaaca     21900
     cacgatttga aaaaccacgt tgaacatgag ggtctccatg tggggcttca tgagcttgta     21960
     cgtgttgccg tgcgacagcg cggtcgtgag gtactggagg gccaggttta tgattcggtc     22020
     cggcaggtag ccaccgccgg aaagcgtggc cagcagctgc atgtacgact ggaggaacac     22080
     gcacgatacc tgctccttga acgtcttggc gaactccttg tactcgggct tgacctgctt     22140
     ggggttgccg tacctgctga acagacggtt ggcgatgtgc aggctccatt tcttcgcctt     22200
     ccaccacggg aagttctttc gctcggtcct gtcgctcggc tgtccctcgg cgggcacctg     22260
     catgccgatg atctggtgga aacacgtgat ccacgcgccg aacacgtccg cgcgcatcaa     22320
     cgcgggtggg agatccaggt aggtggcgtt ccagtacgtc ttcagtatga gcttcaccaa     22380
     cgtggccagc gtcttgtccc gcctctgcgc ctcgttggcg atgagcgact ggagcatctg     22440
     gagcaacctc gggaaggcat tctcgatgac gggggcgaga acctccctct cgtccttgtc     22500
     tttgaattcg tacttgcggc agatgacctg gatgacctgc acggcgccgt acacgcgcgc     22560
     gatgtcgtcg gtgcctaggt gacccatgag cgtgggcagg aggtcgggcc atcgctcggg     22620
     aaagtcgtgt tgcaccgcga cgcgcatgac ctcagtgagc tggctgcgga tgagctcggg     22680
     cgattgaatg aacgactcga ggatgttggc gcggatggtg gccttgtcct cgtcgtgcag     22740
     cctggcgctc tcctcctttc tgggctccca ccccttggcc gagatgttct tcaggtggat     22800
     cgccgccgcc tgacggatgc cgaggtccgc ctgaggggcg gaggcgacct gcatgaggcc     22860
     gacgatgtac cccttggcgt agtcgtgctg cttcaggtac gcctcagcct gctcgcgggt     22920
     ggccacgtcg ggcgatagcg tcgcctgaag cacctgcacg agctcctcga cggacgccac     22980
     catcgtgccg agcgctcaga acgacagcgc gaggagaaaa tccaaccgcc gactgccgac     23040
     gcgaggtttg gcggcggcga ggcgcgcggc ctttcgctgg cgattcgcgt tcctgcgacg     23100
     cgttcgctcg acaaacgaga cctcaagcgg atgcgttgca ctcgcgaaag gcgtgccctc     23160
     gaccactcgg cgggtctggg cgctcgatga tgtggcggaa gccgaccagc cgccgacgag     23220
     gaaataaacc ctcagctgcc accgttcgtg cgccagcggg gggagtggaa attgaaactg     23280
     accagccaga cgttgactca cgcgcggcgg ggactggcat cattcatcac tcttctcttt     23340
     cttgcacaac gacgcaaccc aataaaagtt agtacgtaga gtcgcggcgg gccacacttt     23400
     aaggtccgcc gcctcgcatc ctcatcacac cccccccaca caagttcagc cgcgtccctt     23460
     accaggagta cttggcctca atcagcttct cctcgtacct ctcggcggcg agtccccacg     23520
     agaggtcctg ctgcatgccc gacagctgga tcttcttgaa cgtatcctta tcctccctgt     23580
     acgtgccgag tgcccatccg acagcctcct ggaacttgtt cgtcagggcc tcgtcgaact     23640
     gccatcccgt gccctccttg gtgtgggggt tgtaggggcg aaccgtctcc cgaagtccgc     23700
     ccaccgcgtg aacaaccggc accgtcccgt acctcatggc gtagagctgg ttcaatccgc     23760
     acggctcgaa cctggagggc atgaggagga tgtcgcagcc ggcggtgatg cggtgcgcca     23820
     tctcgacgct gaacccgacc cagcacctgc acttgtcctt gtggtcgttc tccatgcttc     23880
     gcagcgactg ctccaggtcc tcgcggcccg agccgagcat cacgagctgc acatcctggc     23940
     ccatgagcca gtgcctggcg tccgtgatga ggtccacgcc cttctggtgg tccaaccggc     24000
     cgatgaaccc gagcagcggc acgtcgtccc tctccggcag acccagctgt ctctggagcg     24060
     ctcgcttgca ctccaacttc ccgtcaaagc cgctcgcgtc gggcgcgtac cgcgtgtacc     24120
     cgtcgccgtc gaggaagttg tcgtactccg gggaccactc ctcgaggtct atgccgttga     24180
     cgatgcccgt gagcttgtcg ccctgctcgc ggagtaaggg cgcgaggccc cagccgccca     24240
     tgtcggtggt gatctcccac gcgtatccgg cggagacggc gataatcttg gacgcaaact     24300
     tcagtcccgc ctgcatctgg ttcatgcact cgccgccgaa cgggtcgtcg aggtagaagt     24360
     gctccttgta atggtcggga agctgcaggg agtagaactc gtcgagggga ccgcggccct     24420
     ggaacgccat gttgtggatg acaaacaccg acctggcgta cggcaacttg ccgtggtcct     24480
     ggtagtacgc cgagaggtac accgggagca acgacgtgtg ccagtcgttg gccatgtaca     24540
     cgaggtcgct gtcaccgtac ggggtgcggt cttcgccgca cggcacgtgc cagacagcct     24600
     cgatggccgc ctggcagagc attgcgttgc ggaagttagc cgcgtgcctg tcacccgcgt     24660
     agatgttatc ggcgacggag tggtagcact ggtggtcgat gaagacggtg tccacgccgt     24720
     tcttgtgcat gtggaagtac ccgacctccg cttggttacc catcacgttg aacgtgatcc     24780
     gaaccccggt gtcgatggca ccgtcgtagt ttttatacct gggcatcacc accatcactc     24840
     gatgaccccg ggcctgaaga cccttgggaa gcgccgccgc gacgtcgccc aagccgccag     24900
     tcttggcgaa gggcgcgcac tcggacgcca cgaccacgat gttgagcttc tccttgcaga     24960
     gcatcttctg cgtctcctcg gtcatcggcg cgttgggatc aatcaccagc gggttctgcg     25020
     ccgagccaac ctggccaacc tccacaacct gctgctgctg ctgctgcgcg aggttggggt     25080
     tgggcggcgg gatgtgcgcg ggcctgtcgg tgctgggcac gcccggcgcg gacatcggcg     25140
     gcggcgcggg cggcgcgggc atcgccgggg gcgccacgta cgcgttctgc tgcgccgtcg     25200
     tcggcggggg cggcgcgggc gccgtcggcg ggggcggcgc ctccaggctc gacgacggag     25260
     tagcgttgga gtccgaggga cccgcgtacc cgaacgggtt gtacccgcct cccgccgacg     25320
     cgtgtccggg gatgctgaac cccgggggaa gcgatggcgc cttcggggtc atgtccggcc     25380
     tcgcgggtcc cgtcacgggg ggcggcgctt cgggcgcgtc cggcatcccc tggggcctcg     25440
     cctgcgggac gggcggcggc ggcatctgcg ggggagccgc gggcggcgcc tgcgcccggg     25500
     gcaccggcgg cgggggtacc ggcggcgggg gcaccggcgg cgggggtacc ggcggcgggg     25560
     gtgagaaatt cggcgggggc gcgccagcca cgggcggcgg ctggaacgtc accggcggag     25620
     gctggaacgt gggctccacc ctgggggctg gcggctccgc ccgcgggggt tccttgggcg     25680
     gcggcggcgg cctcggcatg gtgaacccgc ctcctccgaa cggcatcggc gggggtggaa     25740
     ccgcgacgtc gtcgccgccg aaggggtagt tgatctgcgg cggagccggc ggcgggacgg     25800
     gcgcgacgga gttttggaaa gccgtcttgg gcgccgcatc tttgcccgtc ccggtgcccg     25860
     cgtacccggc ggtgggatcg ggcatgcccg ccttgttcag ctgctccctc agttcctgcg     25920
     gtgtattcgg ttcgtgaagg ggtcgcgggt cagccgggac gttcggatgg gccgacggga     25980
     cgcgcgtcgg gcggccatct tggcggtcta gatctttcgg gttttttttt tcacgcaccg     26040
     cctggagctc cttgcgcatc gcgagcttgt ccatgagctt ctgctgcttc tccttcagcc     26100
     tcgcccgcat cgccgccacg tctgcgtcgg acttgggcgg ggtgagcgcc tcggtggaca     26160
     cgtccgggcg cgtctccgag acccccctgc gccccggcgc gatgggacga acccacctct     26220
     ttgttccgtt gtttcgacgg tgtgtcgaac ggtcagttgc gcggttgccg cccatggcgc     26280
     gcgcggcgcc catagcggcg tgcgggcaca acacggcgtg cgcggaagac atcgcgacgg     26340
     tgtgttcgtt tcacgcttcg cgtccgaacc gatcaagttt cggcggtggg tcgactcacg     26400
     ccccgctcgc gcaccccctc cggtggatgc tgacaagaga tccttccctc ggacgctctc     26460
     ccgcgtttcc gcgaatgctc cttcgcctcg gcctcaaccg ccgtcgacgg gactcgtgac     26520
     gtaccctcgc tccgagggac ggttcgctgg cgtatgtaca gtaccagcag ggcgatccgc     26580
     ggctcgccgg gacgcgcctg tgtgtgtgcg cgcgtcccgg ggcgccgtat cccatcaaac     26640
     accgaaaaca cccccaaccg cggaaacgtg cctgctgact caatgccctg ccgccgtggc     26700
     acattcaacg gaccaaacgt cgaatcaaga aaccatcaaa cggtcaacat tggcgatact     26760
     ttcgggacgc aatctgattg gtcgagagag ctgaatcgtg agagcgaaaa gcggcaaaaa     26820
     agttcacctg ttccgcggtg catcgaaccc cgcggtccaa aaacgccaag gctcgggaag     26880
     aagacacgtc gacttcgagt tccctccaag cctcaagcgg tcgcgccgtg ccgaccagag     26940
     cagcgaagcg ccgcgctgcg ttggagactt taatcgacgc gatcgtgagc taaagtgtcg     27000
     atgccgacga cgatgtccgc cgtcgccgtg agcatgtccg cgacgacgca cgcgcgcccg     27060
     agggcggcgt cgtcgtcgcg cgccgagggt acccgcgcga cttccgcgat cggggcgacg     27120
     atgacgagct cgacgatgac gaaacgtcgc cgccggcagt cgcgagccgt gaccctcacg     27180
     gttcgagcct ccgcgtccga cgagccctcg tccaaaccca agaagagcga cgagaagtac     27240
     agcaacctga ccaagatgcg gtccgaggcg caggcgccct tccgcaccgc gcgcatgttc     27300
     gtcttcggcg ccttcgccgc gaacgccgcg ctcggtctct ccatcgccac gctccaggcg     27360
     gtgaccaagg cgctgggcgc gccgtccgcg ccgccgctcg accagtccct ccagaacatc     27420
     ggcatcgacc tcggcgccgc cctgttcttc ggatacctgt acaagaagga cgcggagaac     27480
     agggagaagc agatggcgcg catatccagg gaggagaggc tctcagcgct caagtgcgag     27540
     ctctcctctg ggaaggtggt gtcgctcttc gaccttcgcg ggttctcccg ggtggtcatc     27600
     gcggcgggcg acgcggacta ctgcaacgcg tccatcgcag ccgccgaggc ggtgaaagac     27660
     ccgctgttgg agaggggcgt gctcgtgata cccctcgtgc tcggcggcgc agccgaaagc     27720
     gtagacgcgc ccgacgacgc cacggaccga cggttcaggg ccaccccggt gtacacggac     27780
     aagtgggtca agtggatcga cgaacagaag agggaggcca aggtggcggc tggtaagggc     27840
     gtgtacgtgg ggctgaggat ggacgggcgg gtgcggagca gcggtgtcgg gacgccgccg     27900
     tgggagaagt tcgcgaagga gctcccgccg gcggacaagt ggggaggttt cctggacggg     27960
     ttcgacggca gggtgggcgt ggacacgtga ccgacgggag aggagaaggc gccgatcgat     28020
     gggatgggag agtagaccgc cgcgagctcg tgttcaatac gacaccacga tgaatacgcg     28080
     ctcgagctct cgtcgagttc gacgccacga ggcgtgtttt cagatttctg ttttcgtttt     28140
     ggcttggttt tggcttcgtt tggcgacggc tttccggggc agaaccagac gcaccgaccc     28200
     acgccaccat gctgagcaag caagtcgagc acgtcatcga gtcgaagaac cccgccaaga     28260
     tggcgaagca caagggcgag ccgtggggac cgatgaagat cgggttgggg atcgcgatgg     28320
     gcatgttcgg agctcccaag tccgaggctc gtgacagtcg ccctcggcgc ggacccgacc     28380
     ccctcctaac cggcccgatt ccctacgacg agtggcgcaa aatcttcaaa aatgccccta     28440
     tccccctatc gaccttaccc gaaaagtgtc cacccgaccc tcgtgaccct cgggagttcg     28500
     acgaggcctc ggacgacgag gcctcggacg acgaaggctt tcgtgaggct ttcgcaaaaa     28560
     ggcttaggtg aacctcgtgc cctcgagaac cgcccacacc gcgttcccaa cacgcaccga     28620
     gaccttcccc accgacatca tgcacaagta ccgacgcgcg actgacgcgg tcgtcctcgc     28680
     cctcctcgcc gccgcgctcg tctgcaccgg cgcgcacgcg gctgagacac ccgacccgcc     28740
     ctgtctggag ataagcaccg agggtatcga gcaactcagg gagccctgca tggaccccgc     28800
     gctcgcttgc gcggacgagg ggtgcctcgg cgccatggtc gagtggctcg cgccgcagtt     28860
     tgaagccgcc gacgtcgata cctcgctcta ccaggacgtg agcccggagt ggatggttca     28920
     gtgcttcgcg cccaacttgt ccgcgtacat ggagacgatc ccagtcgcaa cctttatgtc     28980
     cctgcgcgag tgcgactacg ccccgtacgt cgagcggtgg cccgagctcg caaccttcga     29040
     cttctccgcc gtgtcaacct ccgacttcat gcgcgccatg cccccgggta tgctgatgga     29100
     gatcctgtcc aaccagcgga ggcagaaccg agggtggtga gtgatgactt ttctgaaact     29160
     ttttcgcaaa cgtctctcgt ctgatgaatg aaaacgtacg tctaagactc acgtcgtcac     29220
     ggcgaccgac gccgccgtct ccagcgtctc ccgcacgaac gccctgttcc tctccgccac     29280
     gaacctgtcc gcgccgcccc cgggttcgga cgacgatacc gatcgcgcga cgctaacctc     29340
     cgcgacggac gttccgatcg attccgacgt cgacatcttc ccggctccgg cggaaacgac     29400
     cgaacccttc cccgccgctc gcctcctcgc ggtcgtcgcc gtcgctcgct cgcctatcgt     29460
     ccctccgttc gcccgcgccg cccgctcggc ctccacggat cgtcgatcgc gtcgctcagc     29520
     ctcggcgtcg gccctcgcgg cttcgtacct cgctctgccg ccgcgcgagt gctccgccga     29580
     cctctgatac gtccacaccg cgtagcacat gtcggtgaag gaaaaatccg gccagagcac     29640
     ctcctggaag cacaacacgg cgtggcccga tatcccccac agcataaagt ccgacagacg     29700
     cgtctcgccg ctcgtgcgga tgagcaggtc caccggcggc gcccccggtt tgcgtcccgt     29760
     ttcatccgac ggcccttcgt ttgcgccagc cgtggtccgt cgccagctgt gttccctccc     29820
     gttcgtcgtc gtcgtcggtt ccaccccgtc aaagcgcccc ccgtcgaaat cgaactgcgc     29880
     gccgtgcatg caccgctcca tcgtacgttc cgtcacgtcg tccacggggt ccagggttcc     29940
     ctccccaacg cccctcgcca tggcgcccac cgccaaacaa acatcctctc gtcccgtgta     30000
     cgcgaagcac acgttgagca ccggtccatc gctgtgcgcc gcggtggccg ccatgacgcg     30060
     cgccgcggcc cttcgcaccc cgggcggcag catgtgcagc tcgccgagca cctgcacgcg     30120
     gacgtttcgg tcgtgaatca cgcgggacgt cgccatctcg tccagcctcc gctcggcgag     30180
     ttgaaagagg acgtccacct ccgtctccga tcgcttgaag ttgtcggtgc tgaaggcgta     30240
     gacgctgagg cactcgacgc ccagcgcgag ggaccactcg agcacctcga gcagcttctc     30300
     ggctccgaac tcgtgcccgc tctccttccg tagtcctcgg gtctcggcga accgcctgtt     30360
     tccgtccatc acgatggcga cgtgcttagg aatcggaccg ccgctcctga ggacgaccgc     30420
     cacggcttta cggagccacg cggcccaacc tttgccgacg gaatcgcgtc gcgacgacgg     30480
     cggcgcccca cgtgcgaaac cgaaggcccg ccaccaccac ctcgggctcg tgagtcccat     30540
     gccgggcgcg agacacgcgg ctcggatctg gctggtgtcg atccggtgcc gtctgcgtct     30600
     gcggacgtcc gggcctcctc tgctagatct gcgccacccg tttcgcgggt cgcggtcgct     30660
     acgcggctgg tagtcagaaa ggctggggca aatggttaaa tactcgattg acaggaccat     30720
     caaatgcatt tgcgctccat cgtgacatgg ctgattggga ttagccgaaa attggctcgg     30780
     agctcgggca gtctccgact gatcaggggg acaaagagct ttcctcggac gatgtcgaat     30840
     tcccccccgt ccattgttac cgtcgccggc tctcaccctc ggtcacagta acatgtccgt     30900
     cctcgcgacg gtcgccgccg atatcgactg ggccacggta ctcgcctacg cgttcaccgt     30960
     catggccgcg tacgtcgccc tcaccgtggc ggcggtcgcg tctcccatcg cccgtcggat     31020
     acttttcaag tcgaggctgt acgctcgggg aatcgcgcac atggtgctga gccgagagaa     31080
     gaagaactgg cccaagcagc gaggcaacgg cgttcccgtc gggaaaaata tcatcaccaa     31140
     gcgcatcgtc ttcatcaggc acggcgagag cacctggaac caggtgttca accgaggatt     31200
     cggataccga ttcccgttcc gcctgttcga gggtgtcctc accgaggttg tcggcctgct     31260
     ctcccgctcg tccttcttct tcgacgcgcc gctgtccgac ctcggaaacc tggaggcgaa     31320
     gaagcttcgc gcgttcctca cctccaagga ggacggacca gtcggcaagg acgcagacgc     31380
     cctcgccggc gtcaagggca cgtcgatcct ggtcacctcc aacctgcgca gagccgcgca     31440
     gacgatggct gtcgcgttct gggaccgcgt cgcggtgacc ggcgagaaga tctacgtgct     31500
     gtcgtgcctg caggagatgg cgcgtaacgt ggacacgtgc gcgctcgcgg gtcccggcga     31560
     gcccgtcccg ctccgcggca tcgaggaaca gatccccgac attcaaaacg tcccggcggg     31620
     gcccatccgc gccttgctgg agcgcaggcg ggtcaccgac agcggcagcg tcgtcgccga     31680
     gagcggacac ttcaacgcgg gtaacaaacc gctgatgcgc aacggccacg cgtccatgct     31740
     cgagtttgcg cactggtccg ccgcgcagga cgcgtcaaca ataatcgtcg gcgggcactc     31800
     cctctggttt aaagagttct tcaagtgctt catcaaaccc gagcaggagc acgtcgcgca     31860
     gcgcaagaag atcgtcaact gcggcgtcgt cgccttcgac ctcaagtgcg ggacggacgc     31920
     cagcggaaac gtcggcttca gcatcgatag ctcttccgtg cgcatcgtgt acggcggatt     31980
     cggcaagtga agtctgctct tattatcatc ctcggtatga gctacaaacg ctcgacttgt     32040
     aaccctcatc acgcatcatc gtatcgtgaa ctactcctcg ccctcctcct ttctccacca     32100
     ctgcagaagc tccatgacct cccgctgcgt cgtctcgcag aacccgtcca tgccgaggtg     32160
     attcgtccgc ttcgggctga acgggttctc gcactccgtc gccgccccct cgatgcccag     32220
     cagcgcaaac gccatcgccg cgacggctgg aatcgtgccc catccccagt acccctcgta     32280
     cacgaacggc aggcagagca cgaaccccat caggatcgtc cgcaggtgcg acacgtaggc     32340
     tatgggcaac cgggtggcct tgatgcgttc catggttccg cagtggtcga tcagggcggc     32400
     gatgtccttc tccatcgtct gcatcagctg cgccgccatg tgcggttcca tctttcgaac     32460
     agggtggtgc gccgacgggt atctcagctc cggcgtaacc tcgcgcgcgt cgctcttcca     32520
     cgtgcgcatg gcgcggatgg actccaccgc cgcgttgggc tccacctgcg ccttgatcat     32580
     ctccattagc ttatcctccc cttccaccgc catgagcgcg gcggtggcgg cgcgtctcat     32640
     cttccgagcg cagtacagcg caaagtgctt cgcgtccttt tccatcgtct ccacctcgtc     32700
     cgcgccgagg aaccccgcga cttgttcgaa cggaaacctc tcccgtcgta acacgcactt     32760
     gacgcccacg ccaaaggcga cgcaccagcg aacgagctcc tcggcctgcg acggcgcgat     32820
     gggtccgatg gcgacgatgg cgttgtcgca cagcgagtac gacttgaaga ttatggcgcc     32880
     ccacgccgct cggcagtccc agaacctgac cgccgcgcga gccatgcgga acacgagcat     32940
     gaaccccagc gtggtgaata tgagcgtgta catccgctcg aactcctcga ggtcgtagag     33000
     ctcgctccgc agcgcgtccc atcgcttgcg cgccgcggtc cacgccgcgg ccacgacgac     33060
     gcagagcgcc cacgcccacg cgtagttgcc cggcgccctg tccacgaaca tgaacgtcgt     33120
     ctgcgtccac gagcggtagt cgtagtaccg cgggaggccc ttggaggagc tctggaaggc     33180
     atcgcatcgc gccttcaccg aatcagggtg cagcgcggtc tcccacagcc gacccggcgg     33240
     tcgactcgac gagttctccg cgcgccccgg gctcgtcgcg cgtacgtttt cgacggcacc     33300
     gtggttctca ttctttgggg tgccgtcgac cgccttgccg tccccttcca cgtccaccac     33360
     caccgcgctc gcgctcgccg ccgcggcatc gatcgcgggg ggctcgatgc tcgtccacga     33420
     ggtgtctcgt ttcatcgtag taccggctcg agacgcgcgc ggctcgaagt gcgccgctgc     33480
     gagttcgttg gaaaaacgtt gcttggcgcg tcatccgctc acatccggca gtccccgacc     33540
     taccgacacg gccacgtctt cgcgcggaca ctggagaaga cgcgggcgct atccgccccg     33600
     accctcccgc gatgatgtcc tccgtgagcc tgcgtcgcgc ccttctcggc gcgatgacct     33660
     cctcgcgcgc atctctcgcg cgtctgggct cgtcccgcgc ccggctcgcc ccggctcgcc     33720
     ccggcgcgac ccccaccgcc gccgggcgat cgtcccgccc cgctcgtcgc ggtcggatgt     33780
     cgtcgtgcgg aacccctcgc gcggccgcga cgctctcgtc gccgcccgcg tccgaacggc     33840
     catcgcccga cccgcccggt ccgctggacc acgcgcggca cagggacgcg gtgctgtccc     33900
     agctgccgcc cggtaagctc gtgtacgtgc ccgcgggcaa ggcgcagacg aggaacggcg     33960
     tcgagggaaa cgcgaggttc cgccaggagc cggattttct ctacctgacg ggcgtcgagg     34020
     agcccgggta ccacgcgctg tttggcaccg gcgccgacgc gccgttcgtg ctcatcgcgc     34080
     cgaggcaaga cccggagatg gacgtgtggt gcggcaagca ggcgtcgagg gacgagctca     34140
     gggcggtcac cggcgccgac atcgtctact acgacgacga attccacaag gcgctcgacg     34200
     ccgtggaggc ccaggagggt cagaccgtct tcgtcccttc ccacgacgcc gcgacactgc     34260
     cgaacgaccc cgacggactc ttcctggggt tgcgcccgga gaccaccgcg ctgggcaagg     34320
     tgatggccaa ggccaggtcg ttgaagacgt ccgaggagat cgattgcctt cggttcgcga     34380
     acgaagtctc cggagacgcg cacgtcgcga tgtggcgaca cgcggcgcgg gcgtttaggg     34440
     ttacgaacgg gcaaccggga cagctgtggg aacacgagct ggaggcggtg ttcgccgggg     34500
     agacgatgaa aagagggttg aggcacctcg ggtacccgtc catcgtcggc gcgggtgttc     34560
     acgcggcgac gctccactac gagcgcaacg acgcgcgggt gcgctcggcg gatgacttgg     34620
     tgctggtgga cgccggcgcg gagtggcggg ggtacaccgc ggacatcacg cggacgttcc     34680
     cggcgggcgg caagttcgag gcgaggcgca gggcggtgta cgaggcggtg ctcgacgtgc     34740
     aggtgcgggc catcgcggag atgcgagccg gcgccaactg gcagatggtc ggcgcgaggg     34800
     ccaagctgaa cacggtgcag aacctgatcg atttaggaat cgtgcggggt aacgcgcagg     34860
     acgcggtgat ggcgggggtg tgcgggctgt tcctgccgca ctcgctgggt cacctgctgg     34920
     gcctgcaggt gcacgacgtc ggtccgggcg ggcccgttcc ggatggcgcg ctcgcgcccg     34980
     gacacgtggt gacgtgcgag ccgggcatct actttgtcga cgggttactg gaacccgcgc     35040
     tcgaagacag gttcctcaag gactttttgg tgagggacga gatcgagcgg ttcaaggcgg     35100
     tgggcggggt gcgaatcgag gataacgtag ccatcaccga ggacggagcc gagaacctca     35160
     cgacgtgccc gaagacggtg gaggagatcg aggcaatctg tagggacgct tgaggcgttt     35220
     acgatgggtt ggtatcgtgg gttgtcatca tacatttgat atcgttacgg cgtgttctcc     35280
     ggggtgtccg cgagcaggtt catgaaccag ttccctcgcc tgttgggcgc cggggtcgtc     35340
     tccgcctcct cagagtcttc cccgcccgtc tccaactttt tgatccgcgc tcgcaacgca     35400
     tcggcggcgg cttcgagctc cgccaccttc gccaaagacg cattcgcccg ttcgcgttcc     35460
     tccccgaggc ggttctccag cgcctcgcac cgccgtttct gctgctccag cgccgtctcc     35520
     atcgtccgct gaacgttcac gaccctgcga gcgtcctcgc gaagctgcgc gttttcccgc     35580
     ctcagacgaa ggttatcggc ggtgagggcg tccaccctga gccgagcgga agcctccgcg     35640
     gacgagacgc cgtctccctc gatcttcatc ggcgagaaca aagtgcccag tccccgcgcc     35700
     accgccgcgg ccacgcccgg ggagtgcgcc tgatgcgaat cgggagtcga ggcctttccg     35760
     accccgtttt tcccgtctat attcggctcg acgttccgta cgtcgggcgc cgacgccgtc     35820
     agttttggga acctgaacgc ctgcgcgtgc ccgcggcacc tcccgtcgta ccccccgaac     35880
     gcgatcagca ccccgtcgcc ccccgccgtc tccaccgcgc acatgctcat gccctcgccc     35940
     gcggtggacg gcgacgggag cgtcagaccc ggttgaggtt ccgtcgttga actcgccctc     36000
     aaccccgaac tcgaggtctc cgattccctc tcgtcggctc ccgatccgca ccactccatc     36060
     gcgtcaaggt ccagcacggc gcacccgagg tcgccaccgc tccgaccgtt tccgcccccc     36120
     acgatgcacc agtaccggtc ggcgacgacc gcgcccgcgt gacccgcccg tgggccgggt     36180
     ttgtgacccg gtaccaaacg cgtcaggtcc gtccacgccc cggtcgcgac gtttaagagc     36240
     cacaggtccc cgaggcaccg gccggacgcg tcgacgccgc cgaacacgat cacgcagtcg     36300
     tcgctccacg cgcacgcgac gtgctccgac ctggcgacgg gcatcggtcg tttggacccg     36360
     ttcgcgccgt ttcctctgtt ggtttctcct ttggtttctc cttcgttcga cgcggatccg     36420
     tccaaacacg cgacctgtct ccacgccatc gtctccaggt ccaggacgtg cgcgtccccg     36480
     agcgggcgat gcgggtgcgc cgggtcctcg ccgccgtgca cgagcagcgc gtcgacgccg     36540
     acgacgcaaa cggcggcgca ccgtcgagcg agaggcgcga cgcccgcggt cctcacctcc     36600
     tcccactcgc acctccctcc aaccccgtcg tgccgcatgc ggagcaacgc gatggtgcta     36660
     tacgacgtgg tgccatacgt ggtgctatac gacccgacgc cgccgccgcc gggtttatcg     36720
     gcagccttga accctccccc caccgagtac acgcacccgc ggtgagcgaa gagcctgtga     36780
     ccggagcacg gcgcgagtcg gccgtgtgtg agaacgccgc tcgtctcgtc gggcacattg     36840
     ggcacagctg gctgcggcga gccgaactcg tcgtcgtcga ggcccagcac gcgtcccaac     36900
     cacccgaccc cgacgttcgt ggattggggt ttaacgggag gttcgatcga tgcatttgtc     36960
     ggatccgtct tcttctcggt tttgggttcc agagacctcc atcggagcgt cgccaggtcg     37020
     agctcgtgcg cgtcgcccgc gagccggccg ccctgcttcg cgccgcccac gacgtacatc     37080
     ttggatcccg cgacgaccgc gccgtgctgg tgcctggcgg ccgggggctt cgcgtccggg     37140
     ccgccgtcgt ggtcgaggtt cggtctcgcc catcgaccgg gcgccagatc gcggaggccc     37200
     gcgggtagct cggcgaggac caccccgccg ctgcctcgct gccgccgtgc cgtcggtctt     37260
     cgaggaacgc cgtgctcgtt ccgcgcgtgt ggccgggaag ggggcgtctc gacctcgacc     37320
     ccgggtgtgg tcggcgcgcc gtcgccgtcg tcatcgtcgg accttcccgc cgcgcctccc     37380
     accttggccg gggtacgaaa cccatcctcg tcgcgcgcgt ccgggtcctc gcccctcggt     37440
     tgccgccacc accccggcac ctcctcgtcc agcagcttga cgtacagtcg catggcctcg     37500
     aacgcgtcca tcttgcccag gttggtccac gtctcgtgct tggcgcgctc ctcggcgctc     37560
     atctgccacc ggctgccgcc ggcggggcac ggcccgttgc gagcctgcgc gtcgagcgcg     37620
     tacagcagga gcttggtctc atcgctgaac gcgtccccat ccgcgcgcac cttcgcggcc     37680
     ctgacggcgg cgtggaactt gtcggggtag ggcatcgccg ccatgattct cgcgtcacgc     37740
     cccgcgcccc gcgcgccgcg cgccccgata cgacggacca ctcgaaggtc cgcgaagatc     37800
     tgttcaacct cgttcgcgtg tcacgtcggg agtggcgcta acaacacaac acgacacgcg     37860
     gagggcgggg cgcgcgcgat ggcgggcgac gagacgccgt cggcgatgga cgacgaggcc     37920
     gtgcaggtgg cggctctcgc ggatgccatg accgacgcca tgtcggtcgc gacgcgcgca     37980
     tcgctcgacg acccggaggc gaacgagggc gcgtcgacga gcgcagtctc cgcgctcctg     38040
     ggcgatcggg cgtcggcgaa ggcgtcgcgg tgggcgcgca gggcgaagga gcgcctcgag     38100
     gaatcgaggg acaggctgcg cagggtcatc gagggcgagt gggacctcaa gacgacgctc     38160
     gcgcaccgcg aacgcaaggc tgtcgccggg gcgctcgcgt gcgtcgcccc ggggctgaac     38220
     cgcgacgacg acgacgcgct ttcggatctc ctccgctggt tcgtcgtcga cgccctcggg     38280
     ttggacgagg attccctcct ggcggtgtcg ccgctcgcga cgccgccgcc caccaccgtg     38340
     gaggaacaga tccagcgcac gacgacggcc gcgggcacct tcgtcggcgc gctcgccgtc     38400
     gccgagtctc tccccggcga cgacgatccg acggaagacg accacgatcc gacggagcgc     38460
     tcggactttg gcgaccccgc gaacacagct gtcgacgacg ggaactcccg cgtcaactcg     38520
     gtggccgggc ggctgcgcga gagatggacg gacgtcatcg gcgcgttgat gaccgccgcg     38580
     gtggcggcca agaggtacga cgcgcgatgc gccgccgcgt tgagacgtct gagtgtagcg     38640
     gcgggcgtgc gttggagccg cgtcgccgcg ctcgaggatt cgctcgcgct gcacctcaag     38700
     tccatcctgc gcagccagag aggtgccgag gggggtgccg aggggggtgc cgagggggct     38760
     gccgagggtg cgacgtcgtc cgcgatgtcc ccgtccaacg ccgtcgtcgc caaacatagc     38820
     ggcggcggcc aaacgcaaac aacagacggc gggtggctct ctcagcttcg gaacatgtcg     38880
     gcgtcgcgcg cgctgtccgt gacggcggct gcggcggtgg gcgggtcggt cctgttcatc     38940
     accgggggtc tcgccgcgcc cgcggtggtg gcgtcgctcg cgtccatggg cgccgcgggg     39000
     gggatactgg gcaccgcggc tctctccgtg ggtacgctgc tggcgtattt cggcggcgcc     39060
     ggcggtatat cgatgatctt cggcggcgtc ggcgcgggct tgaccgggtg gaggatgctc     39120
     aaccgaacgt cggggctgac gcagttcgcc tttctccccg tgcggggcac cggcgcgggc     39180
     atgagcgtct acctcttcgt cccgggtttc cttcgagacc ccgcggatct cttccggacg     39240
     tggggtgcgt ccgacggcgt ctactcggtg gtgctgcaac ttcctccgtc tcctaaggac     39300
     gataagggta acgataaggg cgataaggac gataaggacg acgacgtcaa gggtcagctg     39360
     gtggcggggc tgggtatgtg gctcaagagg gacccgatca ccgacgacgt gttcgtgtcg     39420
     tggatcgacc cggggggagc ggcggacaga gcgggcgtcg ccgagggatc cgtgctcacc     39480
     gctctcgcca cccgggtcga tacggataag gagagtttgg acgatacgga tgatgacacg     39540
     ccaaggccgg ctccgagggt gcgacgcgtc cgcgggcgcg gggacgatcc gaacgacagg     39600
     tcgttgctca ggctgtcgca ggtgcgcgcc gtgctcgcgg gacgggatcg cacgaggtcg     39660
     ggcgagaggc tatccgaaat ttcacccgtg gaagccgccg gggcggctgg gaacgtcgtc     39720
     gtcgccgagc tgtggctccg gcgcaacctc gccgcggggg acgacgtgga gaagatcgcg     39780
     aagcgtcggg gtttgcccaa gctgaggctc ttcaggcgca gagccgaggc gaagaggaag     39840
     gcgaagttgg cgcaggcgat ggtcggcgcg agcgaggctg aaatcatcgc cgggaaggac     39900
     ggggcggtgc cggagcagga taacgacgaa gaagaggacg acgaggaagc gggcgacgac     39960
     ggggatgacg acgaggacga cgaggacgag gacgacgagg acgaggacga cgacgaggac     40020
     gaggacgacg acgaaaaagc gacaaaaacc gaggcgaacg aggcgggtcc cccgtcgccg     40080
     ccgccgcccg cgcccgccgc tcaacacagg tggcaccgcg cgggcatcga cgccctgcgg     40140
     tccatcggca acggcgtcgt ctccgtcgcc tccgtcgttc ccttcgtcgg cggtaccccg     40200
     ggtgggggcg agaagaggac accgtccggc ggcgacggcg gcgacggcag cccggagaag     40260
     acggaggacg agcgacgacg cgactccgcg gcggctgcgg ctgagctggc agcctcgtgg     40320
     ccgctgccca acggcgaaca gcacgtggtt gggtgggagc acgccttgct ggtggagctc     40380
     gggctcgcga tgacctcctt cgcgcaggac gctgtgacgt cctacgccgt cggacacggc     40440
     atcgggtaca cctccctcgc cggcatagcc gcggcggtga cgtggccggc gctgctcctg     40500
     aaatcgtccc aattcatcga ctcgccttgg gccctcgcca tcgcccgcgc cggggacgcg     40560
     ggcgaggcgc tcgcgtccgc gctgctcgag cggaagcagg gcatgaggcc cgtgacgctc     40620
     gtcgggtaca gcgtcgggtg cgaagccatc gcgcggtgct gccgggtgct cgcaaacgcc     40680
     gagggcggaa aaggcttagg gttggtggac gccgtggtgc tggtgggcgc gacgctggac     40740
     accgggttcg atacctgggc gccgatcagg gctgtggcgt gcgggagggt ggtcaacgcg     40800
     cacgtcagcg gggcggcggc ggcgaacgat tggctcctgg cgtttctgta cagggcaaac     40860
     acccaggtgc tcgcgtcggt gttcaacccg acaaacgtcg tcggcgcggc gaagggtctg     40920
     gcggcgtggt cgacggtggc gcacccgggg gttgagaacg tggacgtgtc ggacgtttgc     40980
     tgccagcaca cggacatacc ggacgagatg ccgcgcatac tgaccaagtg cggcatgagc     41040
     tgacgcgacg ggcgttgagt aacgcgtagg taggcgcctt cgtagacgag tcgagacgag     41100
     ccaaattcac tcaagtttcc gctcgccaca cgctttgcag ctttgagaga tttcccaccg     41160
     cggcgctggc gagctggagg atgcgcattc atcacgactc tcattaatgc gcggcgcgac     41220
     actccttgca tctgttgcgc tgacgaccgt gctcgcagat tccagaccca ccgcactcct     41280
     tgcactgaga gcgctgacgg ccgtgtgcgc agatttgaga cccgccgcac tccttgcact     41340
     tagagcgctg acggccgtgc tcgcagattt gagacccgcc gcactccttg cactgagagc     41400
     gtacacgacc gtgctcgcag attgagcccc caccgcactc cttgcaccga gagcgctcac     41460
     gaccgtgctc gcagattcca gacccaccgc actccttgca tctatagcgg tgacgaccgt     41520
     gctcgcagat tccagaccca ccgcactcct tgcactgaga gcgacgacga ccgtgctcgc     41580
     agattccaga cccaccgcac tccttgcacc gagagcgctg acgatcgtgc acgcagattg     41640
     aggccccgcc gcactccttg caccgagagc gctgacgacc gtgctcgcag atttgagacc     41700
     caccgcactc cttgcactca gagcgccgac gaccgtgctc gcagattgag cccccaccgc     41760
     actccttgca gtattggcgg tgacgaccgt gctcgcagaa tgagccccca ccgcactcct     41820
     tgcacttaga gcgccacttc ccgtgcggac aaccgctgca taccttgcat ctcgaccggg     41880
     gcttcacccc gtgctcgcat ggccccttcg tgtaaggggc cctcttccgc ttcgtcccct     41940
     tgctcgacgc gtcctccgcc acccccacct caacgtccac atccgggagc ggcccactca     42000
     cgttcggccg ccagatcgct ggcatccaaa cctcgcgccc cgtccaagtg ccccgccggt     42060
     cgatctgata ggatctgata ccttcaatac ttcgcagctg gggagtttct tttaccagcc     42120
     agccagggca ccctcagatc gatatgagca tccacagccg gcgcggttga acgcaagccg     42180
     ccctcccggg tggcggcgga cgccgaggct gcgctggcgg acgccgcgcg ccgaggcacc     42240
     gcgcgtcaag tccgcgccgc gtccgcgctc gtgcggtcca cgcccggcgg agacatcgat     42300
     cgtaggttcg ggctcgggga cgtcaccccg ctgcatctcg cggcgtggcg gggcgacgcg     42360
     cgcgtcgtcc gcgctctgtg cgacgccggc gcgtcgctca ccgcgcgcga cggcgagagc     42420
     ggatggtccc cgctgcaccg cgccttccac cacgggaacg cgcgcgccgc cgccgcgctc     42480
     ctcgcgcgcg gcgcgaccct ccacgccccg ctcgaccggc tgggcagatc cccgctggac     42540
     gtcctcaccc gagcgctccg ccgacgcttc gacgacgacg ccctcgaccg ttcgcgtccg     42600
     catggaccga ccgcgtcccc gacccgcgcc gccgccgcct ccgcctccgc gtcgtcgtcg     42660
     tcgtcgtcgt cgtcccgacc gtgcgatctg tactcgtggg gcagcggcgt caactttcag     42720
     ctcggcacgg gcgcggtgaa cgagcaaccg acgccgcgac gcgtcgacga cgtcgccgtg     42780
     gcggtcccaa cctcgcacgg atccgcgggt gggggggtcg agcacgacga cggctgcggg     42840
     tcgggcgggt ccggggatac gaatcgtcgc aggagggaac cgtgcggcgg cgtcgtctgc     42900
     gcatccgccg gtaagtttca caccgtgtgc gccaccgccg acggagccgt gtacgtatgg     42960
     ggacacggcc gcgggggcag gctcggcgtg aacgtgaagg cggtgtacgc gggggacgag     43020
     gcgatcgtcg cgcccgcgcg tctggcgacg tttggggttc acccacgtaa cggtccaaac     43080
     tcggtccaaa gtcttcgcgt ggttgcggtg gcggctggga agcaccacac gttggcggcg     43140
     acggagtgcg ggctcgcgtt ctcgtggggg ctgagcaggg acgggtgcct ggggtacctc     43200
     accgcggcgg aggagaccgc ggccgtttcg tcgtccacca gggccgtttc gtcgtcggta     43260
     accgccgtcg gacccaccca aactgaagaa cgattctcgc aaaacacgcc caggcgaatc     43320
     gcggggaccc tcaaggggat acgaatcgtc gccgtttccg ccgccaaccg tcacagcgtc     43380
     gtgctcaccg ccgacggcga cgtgtacgcg ttcgggagca acgcgcgagg ccagctcggc     43440
     gtcgcactgg gttcgcacct gctcgaccac tcgcactcgc ccaaacgagt ggacctgact     43500
     cgtggtaagc gctcgttcgc cgacggcggc ggcaggcggt gcgtcggcgt cgcgtgcgcc     43560
     aaggctcaca ccgtcgcgct caccgccgac ggggacgcgt tccagtgggg ccacggcgcg     43620
     tggggtccga ggcgggtcga catcgggtcg ggtttagtcc atcgcgacgg aggaggaagc     43680
     cccggcaaaa atttcgtcgt ccaccagggc gtcacctcca ggccgacgcc cggtcggtta     43740
     gtcgccgtcg ccgcgggcgc gacgacgtcc ctggcgctca ccgccgacgg cgcggtgctg     43800
     gcgtggagga gcgacgataa ggcgcttcga tgttcgcacg tgcgcggcat tcccgacggc     43860
     gtcgtctccg tcgcggcggg taagcgcagg tgtgttgtgg ccaccgccgc cggcgacgtc     43920
     tactcctggg actcgacgga tgaaaaagaa aaagaagcgg cgccgttcag ggtggccggg     43980
     atcaagcgcg tcgtgtcggt gtgcgtcggg gagaagcact cgttggcgct gcagaggata     44040
     gcgcggccgc cgcgcgagac gattctgacg ctcgccgacg aggaggatga cgccgacgag     44100
     tacgccggaa acttcgccgg agacttggat gacgtcgacg aggtcacggc gagcttggag     44160
     gcgatgtact cgaccgccgc ggacgacgtc gcgcgcgtcg cggacgacga ctgggacgcc     44220
     caaccaccaa acgccgaacc aaactccgac ggggactcgg actccgagga cggcgacgga     44280
     cgaaggagga atcgaaggag ggcgtcaaag tgcccgtcgc tgaaggacct gtgcgtttta     44340
     gtcgtagccg agcgcgtgtg cgacgtgcga aacgcgacgg acctcgcgtc gttcgcggcg     44400
     cacctcgacg cgcccagcct tcgagcgtac gccctgcgag tcgccgccgc caacctcgac     44460
     gcggcgctgt gcgaggttgg cccggaggcg ctggtggagt gcgacccgtt cacggcggcg     44520
     gcgttggagc ttttattgcg gcgaggggac ggggcgacgt tcacgggtaa ccgcgacgcc     44580
     tctcgaggca ccgacgacga cgacgcggac gacgcggatg cggacgaccg ttacgacgac     44640
     cgttacgacg acgacgacga gcgggtgttc agggagagga gagacgcggc ggagtttctc     44700
     gctcgcatcc gagccgcgtc ggcgtttgat cgagccgacg actctgaacc catggaatcc     44760
     gccgccgcta cgcataaacc gcgccgggcc aggggacgcg cctcgaacga cgcgggctcg     44820
     ggccccgccg cgagcgtgcc ccccgccgct cccaccgacg aagcctcgag cggcgacgcg     44880
     gggggaccga gctggctctc cgctcgcgtc cgaggaattg ggaaaacgcc gattgaatcg     44940
     gaggaccaaa ctccgcgcaa acccgcgagg ggcgcgggga cgagcaggcg cgcggcggag     45000
     gccgcggcga gccgggcggc gcgcggcgcg ctgtcgctct tcctctcggg cgcgctcgag     45060
     gagggcctac gccgcggcgg gggcgcgtcg aacgtcgatg cggcggcggc tgagacggcg     45120
     gagcgaagaa cgacgccgag gacgtggaac cgttccgaga accgttccga gaaccgttcc     45180
     gagacggccg acgcgaaccc ctcgccggac gacgtcgacg tccacacccg ccccgtcaat     45240
     cgtcgtcgcg gtctcctgga cattcaactc gcgcaggagc gggaggcggc ggcggagcgg     45300
     gaggcgcgtg acgcgcgagg tttcgcaacc gccgcggctc gccccgtccc cgcgtatggg     45360
     caaaacgggc aaaacgggca aaacgggcaa aacgggcaaa acgaccccca cacgccgtcc     45420
     gcgcccgccg acgtccacga cgcgtctcgt tcgttccctc cgtcgtctcc caacgcgcgg     45480
     gtgttctcgc tcggcgccct catcggagcc agtcgcggcg gcgggtacgg cgggcgaggg     45540
     tcccgttcgt tcgccaaaaa cggccaaaaa cggccgcccc aatcacccgc gtggggcggg     45600
     gttcgttcgt cgtcgatcga atcgtcgcgt tcgcggggcg acgacgcgtc ccacgggtcg     45660
     cctcctcccc cctcgcttct ggacatccag cgcgaggagg aggccagggc ggagagttcg     45720
     tttggttccc cctcgccaaa aaacttttcg ccaaactttt ctcggctcgg cgggtcgtcg     45780
     cccgcgagtg ccggtcggtc gtggtacgtg ccggactcgg ggcgcggcgc gccggtgggg     45840
     ctgagggcgc tgttggcgga ggaggaggac gcgcggttgg ccgccgagct cgccgccgcg     45900
     gaggctgacg ccgccgcgaa ggttaaggtt cctcctttgg ataaaaagga aaaaggcaaa     45960
     aagccgagtc ggaggactcg cgcgggtaac ccgcgacccg gtgggaaccc acgatcgacc     46020
     gacggaacta aaggcgggaa ccgcaaggat gacaagtcgg gcgacgggga ggacgaggct     46080
     gtgcgtcggc accgtccacc cgcgaagaag aaggcttctt cgtcgcccga ggcttcgaac     46140
     cgaggaggcg cgggtgcggg tgccgacgag gcggctctcg ggggtgggag acggggccga     46200
     gtcgggggcg acgggtgcgt cggcgcgcgc gggtccgggc cggcgaagcc gagggcgttc     46260
     ccgaaaggga cgaaagctcg agagtcggag cctccgcagc gcgggaacgg tcgaggagga     46320
     cgctcgcggc gcggggcgcc acaacagccc taattttaat tttgggcgaa ataggaaatt     46380
     ttaatgccaa atggagcggt gttcacctat cgtgactgga ctcgccgctg gggttgccgg     46440
     gcacccaatc cggcgtggcg tcgtcagcca atgaaaacca aatactttat ccagcctggt     46500
     tcttatcggg ttcgaccgcc cgcgggggcc catagccgca ctcgtcacgc cgaggggagc     46560
     cctgccatcc cggtcgggcc gcactcgcgc gaaaggtaag ggttcgtgac cgcgtcgacg     46620
     cgcggcgctc gaaaccgaag gctttcgaag gctcgaacgc cgggcgcgac ccgccccgcg     46680
     atttgtgtca ttccctgcag ctttatacgc agggagtttt tgttagcggt ccagtcagca     46740
     aacctacgga ggggcgaccg cgcgggacgc cgctctgagc gagaggtgac gctcggttcc     46800
     gtaagaagcg tctcgagggc atcgagttga ggtgctggac attttttgtg gatcgaaacg     46860
     gtccttcggc ggtatcgaag cgcggtcggg cggtccgagg gatttggcgc gtccatcgcg     46920
     agataagagg aggacggaat tgagccgacc ggggcgatga gcgagccggc tcccgccgtc     46980
     gagccctcgg cggctgcgcc ttcggacgag gtgccaaaat tcgacgagac caagacgcac     47040
     gagagcatcg acatcggctt cacggtggac gccggcggcg gcatcagcgc gccgcaggcg     47100
     agcaaggacc tgaccaacgc gctggcgtcg ctccgtcaca cctttaccgt gtgcgacccg     47160
     acgctcccgg actgccccat cgtctacgcg tcggacgggt tcctgaagat gaccggatac     47220
     cccgccgagg aggtcctcaa ccgcaactgc aggttcctcc agggggagga gacgaacatg     47280
     gacgacgtgc gcaagatatc cgaggcggtc aagaagggcg agaggatcac cgtccgcctg     47340
     ctcaattacc gcaaggatgg ccagaagttc tggaacctgc tcaccgtcgc gccggtcaag     47400
     ctgccggacg ggaccgtcgc caagttcatc ggcgtgcagg tggacgtcag cgacaggacc     47460
     gagggcaacg cggataactc cgcggcgatg aaggacacca aaggtctccc cctgctcgtc     47520
     aagtacgatc agcggttgaa ggatcagaac ttcaacaggg tggacgacgt ggagaaggcg     47580
     gtgctgacgg gcgagggcgt cgacctcgac gcgaacccgg tggcggcgaa cagaggaggc     47640
     ctcgacatgg ccaccaccct ggagcgcatc cagcagtcct tcgtcatcgc cgacccgtct     47700
     ttgcccgact gccccatcgt gttcgcgtct gacgggtttt tggacttcac cgggtacacc     47760
     cgcgaggaga tcttggggcg gaactgccgg ttcctgcaag gtccgcggac cgatcggagc     47820
     gcggtggcgg agattcgcaa ggcgatcgac gagggcagcg agtgcaccgt ccggctctta     47880
     aactacacca agcaggggaa gccgttttgg aacatgttca ccatggcgcc cgtgcgggac     47940
     gagcagggaa acgtccgttt cttcgcgggg gttcaggttg acgtcacggt gtacacccgc     48000
     gaggagggcg agaaggacgc cacgagcttg gacctcgtga aggagtacga caaggacagg     48060
     gacgagagct cgttcgatcg acagatgaag gagtactcga agcagacggc gagcgcggtt     48120
     gcgtcggggg ttgccgggct taaagacggg gatttgccct ggaagaacat ggtgggcatc     48180
     ctgcggacgc cgcagccgca ccagcggcac gatcccaact gggtggcgct caaggcgcga     48240
     gtggacaagc acgaggcgga gggcaaggtt ggaaggctgt cgccggatga tttcgtgccg     48300
     ctgaagcggc taggcaacgg cgacgtgggc agcgtccacc tggtccagct cgcggggacc     48360
     aatcggctgt tcgcgatgaa gatactggtc aagcaggaga tgcacgaaag gaacaagctg     48420
     cacagggtcc ggacggaggg tcagattttg gagacggtgg atcacccctt cgtcgcgacg     48480
     ctgtacgccg cgtttcagac tgacacgcac ctgtactttg tgctcgagta ctgcgaaggc     48540
     ggcgagctgt acgagacgct gcagaaggaa ccggagaagc gatttccgga gacgatcgcg     48600
     aagttctacg ccgcggaggt tctcgtcgcg ctgcagtacc tccacctcat gggattcatc     48660
     taccgcgacc tcaagccgga gaacatcctc cttcgcaggg acgggcacat catcgtgacc     48720
     gactttgacc tcagctattg cgcctcgtcc agagcgcacg tcatcatgaa ggaggggcga     48780
     gcgcccggcg cgagggcgag gaaccgcagg gtttcgcagc ggcggtcgtt cgcgggaggc     48840
     gggcgtccct ccgtcgccat cgatgttgga gggagcggga agccgcccgg cgaaaacgcg     48900
     tcaggtcggt cgccccgaca atcgcagatg tccatcgacg ccacacacaa cggcggcgtc     48960
     gccatacccg gcgcgtcgcc aaaatccgcc ggccccgggc tcgacatgat cgcgtgcggc     49020
     acgttcctgt ccccgaacgg cgccaacaag tcggggaagt ttccgcagat catcgccgag     49080
     cccttcgcgt acacaaactc tttcgtcggc acggaggagt acctggcgcc cgaggttctc     49140
     aactcgacgg gtcacacgag ctcgatcgac tggtgggagc tcggcatctt catccacgag     49200
     atggtgttcg ggacgacgcc gtttcgggcg aacaagcgcg agcagacctt ccacaacatc     49260
     gtccaccagc ccctggactt tccgtcgacg ccgccggtga gcggcgagct gaaggatctg     49320
     cttcggcagt tgctccagcg cgatcccagc gtcaggttgg ggacgcaggg cggcgcggag     49380
     gaggtcaagg cgcacccgtt ctttcggaac gtggactggg cgctgctgcg gtgggcgaag     49440
     gcgccgttgg cggagaagat cgcgaggagg atggcgaggg cgagcggggc ggaggcggcg     49500
     agcgcggcgg tggacgcagg gggcggcggc gacgacgacg aaatgtttca gatggacgtc     49560
     gagcagtgac gagttagctt cgattggacg attttgcttt cacgcgagcg aaaagacgaa     49620
     aagacgaacg aatcgcgacg cgtgccgcct ctgtttttta acactggctg gtaccttcgt     49680
     ggtgctacta actaccctca caagcaagcg agtgtgtcac aatcacgcgt cctcttcgcc     49740
     gcggagcagc ttgaccaact tgtggtcttt cagttccggc tcgatgacga caatctggtt     49800
     gatcaacacc ctgcacgcgt ccgggtcctt cctgcagtgg agcttcaggg tggcccagtt     49860
     gaacatggcg tccacgcacc tgtcgtcgat ctccacgcac ctgaggtagt acgcctcagc     49920
     ctcgtcgacg ctcttctcgt cgcccttagc ctgcagtatc atcgcgaggt tgttgcacga     49980
     atccagatgc ctcgggtcga ggtcgatcgc ccgcctgtag cattcctccg cctcgccgaa     50040
     cttctcgatc gtctggtaga agttccccat cctgtaccgc gcgtcggcgt cgtcgggctt     50100
     ggcctccacc gcgttcgcga agaacgcgcg gctctcctcg acgagcgcgt cgaacgccca     50160
     gttgatcttc ccgatcctct gctcggcgtc gccgtcgaaa cccggcgcgt tggcctgctc     50220
     cagcgccacc ctgcgcgccg ccttgagccc ctcgaacgac gttccacggc tcactcgaag     50280
     gatctgctcc ggggtgtcgt cgcccttggg cgtcatctcc atctgccgcc gcttggcatc     50340
     cttgttgagc gcctccgggc cgttgtcgcc agccgccgcg atgatgcgct gcgcgagcgc     50400
     tctggcgcgg acgttgccgc cgcggacgcc gcgcgcggcg aagcgcgtgg acatcgccgg     50460
     tgcggacgag agagccgggg gcattcgtcg cgtcgcgtgc ggtccctccc acgcgcgcgc     50520
     actccgatga cgcggggtct tatccagaga cggaaaagcg acctcaagtc gaaggaaact     50580
     cgcgtgtgac gaagaatcgc gaaccgggtc gtccttgcgc tgtctgcggt ccggggcact     50640
     tggacggggc gcggggtttg gatgccagcg atttggaacg tgagtgggcc gctcccggat     50700
     gtggacgtcg aggtcggggt gacggaggac gcgtcgagca aggggacgaa gcggaagaga     50760
     gcccctccca cgaaggggcc atgcgagcac ggggtgaagc cccggtcgaa gtgcaaggtg     50820
     tgcagcgctt gtccgcacgg gaagaggcgc tctgagtgca aggagtgtgg cgggtctcaa     50880
     atctgcgagc acggtcgtcg gcgcacacag tgcaaggagt gcggtgggtc tcaaatctgc     50940
     gagcacggtc gtgtacgctc tacgtgcaag gagtgcggtg ggtctggact ctgcgagcac     51000
     ggtcgtgagc gctctcggtg caaggagtgt ggtgggcctg gaatctgcga gcacggtcgt     51060
     gtacgctctc ggtgcaagga gtgcggtggg tctcaaatct gcgagcacgg tcgtcagcgc     51120
     tctaagtgca aggagtgtgg tgggggctca atctgcgagc acggtcgtat acgctctacg     51180
     tgcaaggagt gcggtgggtc tcaaatctgc gagcacggtc gtgagcgctc taagtgcaaa     51240
     gagtgcggtg ggggcgcaat ctgcgagcac ggtcgtatac gctctacgtg caaggagtgc     51300
     ggtgggggcg caatctgcga gcacggtcgt gagcgccata ggtgcaagga gtgcggtgga     51360
     tctggaatct gcgagcacgg tcgtcgccgc tctcagtgca aggagtgcgg tgggtctgca     51420
     atctgcgagc acggccgtca ccgccaatac tgcaaggagt gcggtggggg ctcaatctgc     51480
     gagcacggtc gtatacgctc tacgtgcaag gagtgcggtg ggggcgcaat ctgcgagcac     51540
     ggtcgtcagc gccataggtg caaggagtgc ggcggggcct cattctgcga gcacggtcgt     51600
     cagcgctctc gttgcaagga gtgcggtggg tctggaatct gcgagcacgg tcgtcgccgc     51660
     tctacgtgca aggagtgtcg cgccgcgaat taagagagtc gtgattaatg cccatccccc     51720
     agctcgccag cgtcgtccct cacttccctc ggtacctcgc caggaactcc tcctcccgcc     51780
     gtttccgttc ctcctcgccg tccaacctac ggctcctcag tccagctcct cgaactgatc     51840
     gtccgccttg tcgtcgtcgt cctccgccgc cgccgcccct ggtccgggac ccgcgtcgtc     51900
     ggcacccccg tccccgttcg cgtccccttc ctttttcgca gccttggccg ccctctggcg     51960
     ctccttcttc gcctttcgct tgtttcggtt cttggcggtt cgctcctccg cctcccgctc     52020
     gcgctcagcc tgcctcgcgt cgaactgcgc cttggctacg ttggcgttgt cctcgcgctc     52080
     catcgccgcg attcgcatct gctccctgcg ccgagcctgc ctgtacaggt ggaactctcc     52140
     ggatcccgcg ccggcggtgc tgccctgtat gttctggggg ttgatcggca cagcctcggt     52200
     gatgtagttg agcttcgcct caaggtcctt caccgggtca cccgtcttac cctgcgcgtc     52260
     ggggtttgga tgggtgtttg gatgcggcgc gtgagcgggg atgcgtcgat acggggcgcg     52320
     cggggcgagg tttgggcgac gcgtcgagcg gcgcgctctc ggctctcgtt agggatgggc     52380
     gggtccctcc ctcacctcgt tgggatcgct cgggttgtag acggcgacct gccgctgggt     52440
     gctctcgagc gtgacgacct tcgcgacgtt ggccgcgggg ccggcgtctc cgcgacgcga     52500
     catcgtgcgg cggtaggtcc ttttcacgcg ccctcggaag tgacgccgac gacttcgaca     52560
     tttgtcaatt gttttcggag ggggcaccgt cagcacgcga gtttacgtgc atgcagtcgc     52620
     gaggagcgcg cgcgagggcg cggggacggc gacgatggcg acgccgccgc cgcggctcca     52680
     cctcgtccac ttcagcgtcg acgccgccga cgaggaccgc gacgacgacg acgaacgaac     52740
     gacggagagg aaggggcccc acacgcagtg cgcgctcctc tggtgcgacg aggccaccgc     52800
     gcgagatcca ccgtccgggt gcgtgccggt cgaccccgtc gcgggtctgg cgtctttggg     52860
     accgggctac cgcggcgtgc gcggtgccga ggcggtggcg gcgctcgtgg gcgcgtgcgc     52920
     cagcgccgcg cacgtcgtcc cggacgcgac ccagcgctcg aagcccgacg aggagctgcg     52980
     catcatcacg ccaagcccat cgtcgtcgtc gtcggagccc ctcgcggtgt cgccgtcggc     53040
     gatgtcgctg tgcgttcgcg tcgcggcggc gctcggcgac gacgacggct ggcgaccgac     53100
     gagggtgtgc gagctcggct ccgggaccgg cgcggcgggc ctcctcgtcg cccgcatgct     53160
     cacctctaca cgcggcgcac gcgagctcgg cgcgcggccg ctcgtgttgc tgacggacag     53220
     ggacaccgcg gcgctggagg tgatcgcgtc gaacgtgcgt ttgaacgcgc gggggtgggc     53280
     gaggtgcgtg ccgcagcggt tgcagtggga caggcgcgac gagcgctcga gggcgacgcg     53340
     aagggcggcg gaagacgatc ggataccctt acacgatcag acgcactcga agcactcaga     53400
     tgcactcgga ggatcttcgt ccggagtgcc tccgccggcg ccgttcgacc tcgtgctcgc     53460
     gtcggacgtc ctccgcgggt cgcgagtcga cgacgtgcac cacctgctgg acaccgcgac     53520
     ggagctgctg agcggcgcgc ggcgcggcgc gaggctggtg ctctcgcacc cggtcgtaac     53580
     cgacgcggtg tcattcgaac acgcgaatcc gtcctcggcg cgagtcacga aaacggagct     53640
     gacgcatctc gacttcgtgg atgacgacga cgacttcgtg gacggcgagt acggcgacgt     53700
     cggggcggat gaagggcacg atgacgcgct ggacgccttc gtcgccgccg cgcgcgcccg     53760
     ggggttcgcc gttcgagagt ggtttccgga aaccgaaacc aaaagccaaa agccaaagcc     53820
     aaaaccattt ttggccaaaa accaaaaacc gaaacgggcg cgaacgttcg acgtgtacct     53880
     ccccggcgcg tgccccggtg cgcacctggc ggggtacgtc gacgtcgtcg cacagagggc     53940
     ggtggatatg cgacgggagg aggatcgcgg gctgagggca ctgatgcgcg agaggtacgc     54000
     gcgtggttgg acgccgccac cgtcgccgcc ggtgccgacg atggagccgc cggcgcggtc     54060
     gtcgtcgtcg atcgggacgg aggcggcggc gttggggaga gacggggacg gggacgggga     54120
     cggggacggg gggaagatga gcgccgggtc gaaacagtcg tcgcccggta agcggaagaa     54180
     gggcgggttc tgcgtcgtct cctgagtggc agccacgctt gagtcgagcg agtgaattta     54240
     gtctaacatt cgtaacactt gaaagattcg tcgtcgtcac gcgggcgccg gcgaggacgg     54300
     cccgtcggta ccctcctttt cgtccccctc cttcccgccg tcgcgctctt cgccgccgct     54360
     cggttcctcc cccttccgct tgaacagacc cgccgccttg tccgcgatgg cctggtccat     54420
     ctccgccctc gcgggctctc ctttgtcgat catcacctgc attaatttac tcggatccgc     54480
     cttgaagagc tgcgcgaaga agcacagaaa cacgggcacg tcgctgcccg tcgcgaggct     54540
     gatccccatg gcgacgacgc cgatcaccgt ccacgccttc cgcgccctcg cctcctccgc     54600
     ggaagcctca gggtcgggat tagggttcgc caatcttcgc cggggtttcg agtacccttc     54660
     cccgcgccac gccctggcga tggcgccggg taggagcgcc gcgggcgcga ggtaaaaaac     54720
     gtacaccaac gcgaacgtca agggcgccag gacgtacccg aggtatcccc cgccccgtag     54780
     ccctccgagc gcctgcgtga gcgtcccgga cgcggacatg agcagcgccg cgagcgccgc     54840
     cgcgccgccg acgactgcga accaccgtcg cggttgcgtg agaaatccaa tcttggcgca     54900
     caaataccgc atgagcatga aaaagggcgc gagcaggagc caccagctgg cgccctcgcc     54960
     cccggcggct cccgcggggg cgaggatggc gtacccgagg tgcaggtcga gccacgccgc     55020
     gcgttgctcg cggttaaact ccatacgcgg cggcggcggc ggttctcctc gctccgtcgc     55080
     tctcttcaat tctctcttcc cgatcgattc gtaccaaaac ttacgagcga acgagagcgc     55140
     cgcgcaggat gggaaaaaca cgaacagcat ccactgcagc gccaccgcgg gttgcccgga     55200
     acattccctc agcaccgcgc ccgtgtagta caccagcact ccggtgagcg ggttcaaacg     55260
     tccgaagagc gccgggatgg agtccaggcg tctcgggtac atccactcgg gcatcggcgc     55320
     gatcgtgtcc gggggcagtt cgacgcgttc gtccaccgcg ttcgcgaggt ccgccgcgtc     55380
     cgcctcgtcc ctggcgcgct gtttctcgag cgccagcgtc gggtccggcg gcacgtctcc     55440
     ggtcatggcg gcgatctcgt cggcgaacga cgacgaattc gcgtcggcgg acgacgacgg     55500
     gttcgagctc gagctcgacg acgaccgcgc gctcgtcttc tcgtcctcct ctttcgacgc     55560
     gcgggtttcg tcgtcgctag atgcgcccgc ggcgacgcgg cgactgtcgt aacggtcgta     55620
     acggtcaatg tgcacaggcc acgcccgcgt cgccgccgtc gcccggagga gggatttggc     55680
     ggcaattcgc ccctccccgc ggtgtcgttt ggcggtggct gtcctcgccg cgggcggcaa     55740
     cgcggcgcgt tgtctgcccg agcggagcgg gttcccgacc gtcaccagcg acgcactcat     55800
     cgccgcgact cccgacggcg ccggtgacgc catctctccc cctctcctcg gcacgctcgc     55860
     cggctccttt ggcgggttcg cacgacgcag tcgaaataat ctcgttgcca actcggcagc     55920
     ccgggcgcgc gaactcgtcg ctcgctcggc gctgtccttt cgacctgtgc caatcagatt     55980
     caccgagaaa tgacaactgg actgaccgtt acggaaggat tcgcccaacg cggtttgact     56040
     gcaactcgtt tttgaatcat caaaccctca ctttcagggg tgcgctaatc agactaattg     56100
     cccagtgcga actaaacaca ggctgggtaa tacgagagga agttccgagg tggagatccc     56160
     tccgcccatg tgttcgttcg tcgccgccga ggggcgaccg cggcgcgagc tgcttgaaga     56220
     tcgggcgatc gataccaccc gagagctcat cggccgactc gatccgcccg tttacgggtt     56280
     gggatcgtac tggtccgggt cgtagatgac gccgtccttg ccgcgggtca cgcgcgaggg     56340
     cttggcaccg acggaggcgt aggcagccgc gggggcgcgc atggcgccgc cggcgggctt     56400
     gtaggcgacc gcgttggagc ggacgttggc gtcggcgtcg aactgatcgg ggtcgtacac     56460
     gacgccgtcg gcgccgcgcg tgacgcgggt gggcttggcg gcgtaggaca cggaggcagc     56520
     cttggcggtg gggcgggcct gggtggcgac gaagccggag ccgcggccgg agttggcgtc     56580
     gtggtcgtac tggtcggggt cgtagaacgc ggagaccttg acggccttgc gggcggtgac     56640
     cttgacggcg gggcggatgg tgagcgcgga ggcgatggcg aacatggtgg tggtggtgtt     56700
     gttgtgcgtg cggaagtgat gcggtagatc cgggtggctt gtttttatct gcgccaccaa     56760
     attcaaaaaa atcgtgaaac gtgggccaat aggaacactg gaaaccatag gatttcgcga     56820
     acttgcgaac ggctatttat cgtttgtcat cgtttcggac cttttcttcg aaaccagaaa     56880
     aacgcatcat tacgacgaaa gcgccgaggt gaccgaagaa cgacgacgac gcgagcgaag     56940
     aaagaaggac caataactca atcgctcgtt acacacactc ctcgcgccgc cgccgccgct     57000
     cgcgccgtcg ctcactcata caccgcgcac cgctctctcc tcacgcgcgt tcactcgcgt     57060
     tagctgtgac gaacccctct ccgacgatgc gtcactcgat cactccgatg cgtcgctcac     57120
     ctcgatcgct ggttcgcgtc cgcgtcgaac tgatcgggat cgtacaccac gccgtcggcg     57180
     ccgcgggtga cgcgcttggg cgccgatgcg gaatacgaac cggcacctcc ggcgacgcct     57240
     ccggacgatc cgtatccgcc cccaaagtca aagttgggct cagacgcgtt ttgcgggaag     57300
     agctttgcga gggtcaccac cgcgccggcg ccgtcgccca ggcccacgtt gacgtccatc     57360
     accgccctgg ctccgtgcgc cctgaagtcc gggacgtcgg acgaagggca cggggtgatg     57420
     acgcacggca tgttcgcgcc catcgccgcg cggaggccca cgagcgaatc ctcgatgacg     57480
     acgcactttg acgacgggag gccgactttt tccctggcga ggttgtagat gaggggatcg     57540
     ggcttcttct tggtgacgtc gtcgcccgcc atgacgacgt cgagcctgga cagtcggtcg     57600
     ggtccgacga tagagttgac caccttcagg aatccctctt tggtcgccgc ggagcagatc     57660
     ccgacggcaa tgtcgggcgc cgcgatggcc tcgtcaatca accggagcac cccgggtctg     57720
     gcttgcgctt gcgactcgac gatgtccttg taaaactccg tcttcatgtc ctgtaacgag     57780
     tccaccatct tggtcttctc ctcgtccgtg gtcgggacct tgctgccgcc gaagaaggac     57840
     ggccagccgt tgttgtcgaa gtggtaccgc atcttgggct tcccgccgcc gacggtgttg     57900
     gcgaggacgt cgtagtactc cacgctccac tcaaccttgc ccttgcccgg gatgacgaga     57960
     ccgaagtgct tgaacgaggc gttgtacgcc ttgcggtgga gctcctccgt ctcgacgatg     58020
     acgccgtcgc agtcgaagag gagcgcgaac ctcgggttct tggtgttgct gccgacgccc     58080
     tgggcagcgg cgcccgcggg tcgcaccgcc acaccgcccg atcgctggtt cgcgtccgcg     58140
     tcgaactgat cggggtcgta caccacgccg tcggcgccgc gggtgacgcg cgtgggcctg     58200
     gcgccgccgg gagccttgga cgacggcaca tgcgcgcggg tggcgacgaa gccggacccg     58260
     cggccggagt tggcgtcgtg gtcgtactgg tccgggtcgt ggaacgcggc cgtcttgacg     58320
     gccttggggc cccgggcggc caccttgacg gccctgtttg acgcggggac gcgcgcgccg     58380
     acgatggaag gtgcgacgcg gaggctcgcg gcgctctgca tggtcgcggt tcggtgtttt     58440
     cgaagggtga agagtgcgct cgctcggagc cgctctgcgc acgcgccacc cgggaggata     58500
     gcacgaaaag cacatcctcc gcgcttcagt gctatccgct ccgagaactt gctccgagaa     58560
     cttgctcaca cgcgccgcgc gccgacagcg tccgaaacgg atttgacggc agagccccca     58620
     gtctaattcc cggttcgatt gccctgcttt ttcgtcacag agcagatcca cctgacatcc     58680
     gcgtggccaa tcaaatgccg ttttgtttcc agccattcgc atcggccgcg agcgcagtgg     58740
     ccaaatatcg ccccgtcgcg cgtgacgatg gtcatattcc gcacacagaa cccgctagtc     58800
     tctccgtccg gcaaccgaaa ccatggcgct cgctatcgct tccaacacca tcgtggccaa     58860
     gttcaccaag aaggcccccg ccaagaaggc tcccgccaag aaggccgcca agtcggtctc     58920
     ccgcggcgtc aagcgccagg gcaacgtggg tcccaaccgc accctgtgga acggatggga     58980
     ggccaacccg gaaccccccg cgtacctcga cggtaccctc cccggcgacg ctggcttcga     59040
     ccccttcggc ctctccgcgc ccaccgagta cctccagttc gagctcgact cgctcaacgg     59100
     ctccgccgcg gttaacaagt ccggcaacgt catcggcaag ctcaagaagg tggacaacaa     59160
     gcccaccgag cgcaccatcg tggtacgtat tttagcggga taaaatccga gatagcgccc     59220
     ggaccttctc tcgcgaggcg cggatggacg agcgcccgtt tcgcgtgcgc gacacctccc     59280
     gcgacgatta cgcgtgacgt gggatcagat tcgcgttcac gccgtcgagg atcgcggcgc     59340
     gcgggtggct aacgggcgcg tttccgccgc gggaatcacg atcggaattg tcacctttgc     59400
     ggatctcgga cccccgcgct gcgcggtttt ctttgctggt cgaactttca cccgccacct     59460
     cgcttcccgc taaccgcgcg cattcactga cgttccctcc cttccgtcca atcacagccc     59520
     ttcaacgagg ctttcgacat cgtccgcttc cgcgagtgcg agctccagca ctcccgctgg     59580
     gcgatgctcg gccttctcgg cgccgtcgtc gccgagggcc agaccggcat ctcctgggtc     59640
     gacgccggca aggtgctcaa cgagcagccc tcctacctcg gcttcgacat caacgtcccc     59700
     gtgaccaccc tcgtgtggat tgaggtgctc gccatgggct tcgccgaggt taagcgctcc     59760
     gccggtgcgt gcccgaaccg ccgctatcgc cccgctccgc ccgccggctc gcccttaaca     59820
     acgcagtttt tcacgaaagt tctcgcgtcg aagcaatatt tccacgatgg attatggatg     59880
     cccgattggt gacgcctctc gctgaccccc gcgcctcttc ccctcaacag agctcgactc     59940
     caacaagcgc tgctaccccg gcggctactt cgatcccctc ggcttcgcct cctccgcgtc     60000
     ccccgaggct ctcttcaagc tccagaccgc cgagctcaag cacggccgcc tggcgatgat     60060
     cggcatgctc ggcatctcca tccaggcgct caagaacggc ctctcccccc tcgaggccat     60120
     caacgccctc ggcaactaaa tgttcccgcg tcgtgcacgt gcgaaacgtt aggtgttagt     60180
     gaactttagg gcgcggcggc tcggctgggt cgcgcgttca atgttcgaat tagagggtta     60240
     acaaaatcgg ctgggacgct tcctggtggg agcgtggagg tcttgggaga agcttgtcac     60300
     atttgtaacg gcggatacgc tttcaaacgg attacacgaa cgacgagccg ccaacccggc     60360
     cgcgcgcgtc tccctcatcc ctcttcgcgg cgtaacgtcg tcacgcccta acctaaactc     60420
     acgttatgcc ccgtcgtcgt ctgagtgaac ctcctcgtcc atgtaaaact ccccgtcggc     60480
     gtcgtcgtcg gcgccgtgca ggtacccctc ctcctccgtc ggggacgtcg cctcgaaccc     60540
     gtcctcccgc ctcgaaccca aaccctttcg atccccgcct ttcgcccccg tggccccccc     60600
     gtcgatctcg gcgagcatgg tcgcctccag gtagggctcc gccgcgagcc ccgcggcttc     60660
     tcgcatctcc gccaccagcc ctcggcacct cttgagatcc ctcgcctggt accagtgctc     60720
     caccagcatc gcgtacacgt cgccgacgcg gatggtcacc tcgctctcgt cccgcgccct     60780
     cgggtccgcg atcatctgtt cgcacagccg tgtcgcctcg gcgacgtctc cggcggcgag     60840
     gagcgtccga gccctcacga acgtctcaac cagctccgtc ctcgcctcca gcgagcgcat     60900
     cagcgcgtcg tgcccgtccg ccttggactt ggcgaggtgc ttcgcggcgt ctcgcagggc     60960
     gtcggcagcc ttgtcgtagt cgcggtactc gtcgatctcg atctgcgcga cggattcgta     61020
     gaaaccagac agcgactcga cggcgcgcgc cttggtgtag aactggacga tgtgcttggt     61080
     gagctcggga tcgccgtgcc accgcagcgt ctgcaggtag ttggcgctca tgacgtaaat     61140
     ctcccgctgc ctggagacgc ccgcgaagaa gcagatcttc tcggtgtccc cgctcttcaa     61200
     cagcgccttc atcgccttca tcttgtcccc agcctgcgtg tactttttgc acgcgaggtg     61260
     gtacgaaccc tggttcttgc acacggcggc gattttcatc agcgtcgctt tcctggcctc     61320
     ctcggagatt cccccgtctt ctttggggtc cgcgctcttg gggggagtca acgcctcggc     61380
     gagtgcctcg tcgatcttca cgtcgtgctc cacgatgagc tccaaacccc gcgctacgtc     61440
     tccgcccttg acgagcaacc tcgccgcgtc gccgtaccga ccgttgtcca gaaagtacga     61500
     agcgcacttg gccacgagct ttgggtccgc gtctgtatcg tcggcgacgg cggcgacgat     61560
     cccggcgagt aggtcgaaga gatcgtgcgc gaagcacagc tccagcgcct tgcccgcgtt     61620
     tcccgccttg tggtacagcg tcgtcgcctt ttcgaactcg ccgcgttcct cgaggtacct     61680
     ggcgctgtcg agcatcatct ccggcggcga ttgcagcgcc aggtgcatga gctcgttgtc     61740
     catgccgcac cgacgcgcca gtcgagccgc gtggccgtgc ctccccgcgg cgccgaagaa     61800
     ccgaatggcg tcagcgtact cgtccatcgc ctcaaacgtc ctgtacgttg tttgggaaat     61860
     aaatacgtaa ataaacgtaa gtaaacgcgg tcggacgagg gtcggacaag tctgggtaag     61920
     gaaaggaacg ggacgaagaa acccatatgg ggacgaacct cgccaagtga aacgccgcgg     61980
     cggggtcgcc gctctcctcc acgagctgcg ccgcgatctc caggtcgccc tgcgcgcagt     62040
     aggtcctgac caagctgagg taatccccgg cggcttggta tccgtgcaga gccttctcgt     62100
     agtcccctga actctcgcag tatcgagccc accacctggt gagctcgttg gacccggcgt     62160
     tgatgacgta gcgctccagg gtgtccgtca tgccccgccc gtggagcatg cgcggcacgt     62220
     cgacgtcggc gcatccgctc ttttcgtacg cgcgaatcgc tccgggcacg tctccgacgc     62280
     tttccagatg ccgtccgtgg gcgtagtgcg tggatttcag gttgatgcgg tccttattgg     62340
     ttgcggtcct tatggcgtcg tcccaccgac ccatcgcctg gtacagcctg ttgagcaagt     62400
     cgtgtcgatg gcactgctcg tacagtgcta tagcgtcgtc gaccaagccg aggtgcaccg     62460
     cgacattccc gactctcgcg tcgagctcgg gttcgttggc gccgtcgcga accgcccttc     62520
     cgcccctgac gtgcccgagg ttcgcgaggc acgtctccgc gacgtccagc cgcttgttct     62580
     tgatgcacat gtgcgccatg gcctcccaaa ccgacggctc cgtcgtcgcc ttgaccatag     62640
     ccctggccct gtcaacgtcg cccacggcga ggtcgtagtt gaacgtcagc agtgccgcct     62700
     tggcgtgggc gtcgaggtgt tccatcccga cgaaatcccg catcgtcacc gcgaagcacg     62760
     cgccgccgcc gccttgcgcc gcggctttgt tgcacacgaa cagcgagggc gcatgcagcc     62820
     cgaggagcga ttcgaatccg tcgggaacgg gatgcgcctc ctggggaagc aaacccctcg     62880
     gcgaggcgaa gagagtaaac accactacgc cgcgaacgct cgcgtgccgc ctcatcgtcg     62940
     cggcgctccg cccgtgccca gtctcggagg cgtacgggtt agggtttatc cctaagtcac     63000
     ccgagtcgtc ttcgtttttg gagtcatcgt ctttggcggt ttcgtatatc gtctcttcgt     63060
     cggcgaaaaa gttttcgtca aacgcggttt gcgcggcgag gacgttcggc gccgccgcgt     63120
     cccacgcgtg cgactcgggc gccctcccgg tgatggcaaa gtcgaaggtt cgatacccgt     63180
     cggtgtccac gtcgtacacc gcgagcgtgg aaagcaccga gtggtgcccg cggtgggcga     63240
     acagcaccga agccttggtc ccgtcgcagt tgacgcggac cgagtcgatg gcaaacggaa     63300
     gtcgcccgga aaattccgga atgtctccgt cgtcgccgtc gggacccgac ccgggcgcgt     63360
     gcgctccccc gcatatgtcc gcggggatca tcgcgccgcc cttggggccg tgcgcctccg     63420
     cgcgcccgac gccgtccgcg ggcaaacgcc aaaaccgaag atgccccgaa gccgtcgacg     63480
     cgcacaaaaa atccccgttg caatccacaa actccgccgc gccctgcgcc tcctcgtacg     63540
     ccagcgcatc gacgacgtcg ccccccaggt cggtcacctc cacgaccgcg cgcccggggc     63600
     acgcgcgata gatccgctcg ccgtggatcg ccatcgcctg gctggacgaa gccggcgcgt     63660
     tcgattggcc gcgaccgccc aatcccgacc gttcccgacc aatcgatccg cgcccggacc     63720
     aatcaaacgc cgacgtccgc gcaaagccgg acccgcgagc ctcgtgcacc tccgcgcgag     63780
     ccgagttcca caccagcagg tgacgcgacg tggcgtccgc gccgaggatc tgcatgcccc     63840
     gttcggtggt gtttaaacgc gcgggcgccc tggatccgtc ggtggcttcc accacaaccg     63900
     aatcggctgc gacttgaacc acggaaatcc cgcctcgggt cttatcgttc agcttgaccc     63960
     gcacgcacag cctcgcgccg tcgcggcaca ccgcgacgag caacctggcg ccgcgcccgc     64020
     tcgcgaagtg cacgcgctcg agcgttccgc cggcgtcgag gctcgcgcac actcgccacg     64080
     cgtcttccgg cgccgagtcg tcttcgggcg gtgagtcacc gcccggtgag tcaccgcccg     64140
     gtgagtcacc gcccccgccg gtgccccccc ccgcccggcc gcccgcgcgt ccacggggcg     64200
     gggtgcggcg gaacatgacg acgcggccgt cgcgttgccc gcacgccagc gtcttcgcgt     64260
     cggcgtcgta gcacagacac gacagtcgcc tgcccgttgg atcaccgcca gctgtgtccc     64320
     tcccgtcgct ccctttgggc agcccctggg acttgcgcct cgcggggggc accaggacgt     64380
     agttatcgcc attgttcagg tcgaacattc gcacggcgca cgacgggtcc ctgtcgttga     64440
     ccaccgcgag cacccccggt tccgtccacg caagctccgc gtcgccctcc gtgggcagct     64500
     tcgtgctgct gacgacggtc cactttgatt gagtcccctc tgggccgccc cctccgatcg     64560
     agtccccttt gggcggggcg aagatggaga gcacggagtc ggtgccgagg gtcacgaggt     64620
     tgccgacgcc gtcgtggtac agcgccgcgt ggatggcggt tggcgagtcg aagatctttc     64680
     gactggcggt cgctttcgac tcggctttcg accctttcga ctcggctttc gactcgccag     64740
     ccccgcgatc gtcgccggcc gtgtccatcc cgacgcagac gtagccggag tcggcgaggc     64800
     cctcgttgac ggcgtagtag aagacgaacg gacgctcggg ttcggcgccc gtgtcctcat     64860
     ccacggctgt gtcgttcggg atgagaacgt gcgaagtcct cgcgcccggc gcgggtttcg     64920
     cgcatcggaa tcccgtcggt ttcggtcgga gcttctcgtc gacggtccac acctgcgtct     64980
     tgcccgcgtc gtcgccggtg acgacgcggt gaccggtggg ggaccacgcg atgcacgtga     65040
     tggatcgtcc cgcgtgcgtc gacgtttcct ccccaacgac gcggagttcg gtgccggacc     65100
     acgtcgcgac cttcccgtcg gtccatccga tggcgagcag gggcgatgag gggtgccagg     65160
     cgagcgcgca gggatacacg cccgggacgt cggatcgaac cgggcgcgac gcggtgacgt     65220
     cgtcaccctc ctcggtgtac actcccacgg agccggacga gtacgccacc gcgcacatcg     65280
     cgggcgcgcg cgcggaggtg gcggcatgtc cggaccacga cgtcgcggtg cacgcgccgg     65340
     gctgtcgggg gatcttgttg gcgaagtaga cagccatggc gcgaccgagt cggacgtcga     65400
     cgcgttggga tgcgtccggt cacggccgcg gtgccgatac gacggcgagg cgtgaagagg     65460
     ggtcctcccc tggggcctca ccctcccccc gcgccggtca aagtgagcga tgggaaaagc     65520
     ggcacccaac ggctcagaag acgcagtcgt tgccgtggct cttttgtttc caaacgggcg     65580
     tcgaccggtg gggcacttgg acggggcgcg gggtggatgc cagcgatctg gcggccgaac     65640
     gtgagtgggc cgctcccgga tgtggacgtc gaggttgggg tggcggaggg cgcgtcgagc     65700
     aaggggacga agcggaagag ggcccctccc acgaaggggc catgcgagca cggggtgaag     65760
     ccccggtgga agtgcaaggt gtgcagcgct tgtccccacg ggaagcggcg cactcagtgc     65820
     aaggagtgcg gtgggtctgg aatctgcgag cacggtcgtg agcggcctaa gtgcaaggag     65880
     tgtggtgggg gctcaatctg cgagcacgct cgtgagcgct ctaagtgcaa ggagtgcggt     65940
     ggagcatcaa tctgcgagca cggccgttta cgctatcggt gcaaggagtg cggtgggtct     66000
     caaatctgcg agcacggtcg taggcgctct cagtgcaagg aatgcggtgg gtctcaaatc     66060
     tgcgagcacg gtcgtgagcg ctctaagtgc aaggactgcg gtggtgcatc aatctgcgag     66120
     cacggtcgtc agcgctctac gtgcaaggag tgcggtgggg gctcaatctg cgagcacggt     66180
     cgttaccgct atcggtgcaa ggagtgtcgc gccgcgaatt aatgagagtc gtgatgagta     66240
     cccatcctcc agctcgccat cgccgtccct cacttcccgc ggtacctcgc caggaactcc     66300
     tcctcccgcc gtttccgttc ctcctcgctg tcgaacttct cgagcgccgc gcgccgcttc     66360
     tcctcccgct ccccctccct cgcgcgaaac ccctcctcca gcgcgtcacc cacgcactcc     66420
     gccacgatcc tcacgatctc cttatcttcg tccgagattc gccgcccgtc ggcgaacttc     66480
     tccccgacgg tgtccaccgc gatgtacccc cgcgtggcgc cccccctgaa cggacacgcg     66540
     aagtatccac ccggtcccgc cgcgacgggc ctccccgacc cagactcgtc cccggccgat     66600
     gacgccaggc tcaccgcccc gtgcgacgcg tcgagctccg gcacgtccac cgcgacgccg     66660
     acgccgccgt ttccgtttcc gtctgagccg tttgaaccgt ttgaatcgtt tgagccgttt     66720
     tcgtcgtcgt tcgcctttgg gtacccaacc gccggccacg acgctccctc gccccgtcgc     66780
     atcgtcgcgt tcaccgcgga cgcgcacgtc gacaccacga ccctcaacac ctgcgacctc     66840
     ggcgcgacgg ttcctatccg cgtctccgtc ccccgacgaa gctccacagc gtgaacgtcg     66900
     aacggaggtt tagggttagg gttagggtcg tatgtgtcgg aagcaccggt gccctcgtgt     66960
     gtgtcggaag gaccggtaat aacctcgtcg ccggatgtaa cgtgggatga tgtttcgccg     67020
     gaaaatctcg cgacgatgtc caccgcgtcc ctgtacagcg cgtacgcgtt gtcgctggtg     67080
     agcgcggata ggtacttggc gcactccgct cggagcctcg caatcttcaa cgctctgttc     67140
     gcgcgcgcca cctccgcggc gtcgcgcgcc ttttcagcct cgagagcctt ggcgcgacga     67200
     acgtcgtcgt cgcgtttcgc ggccgcgcgc cgctcggaag cgtcgagcgc ggctctcacc     67260
     ctcgcgcccc gctccatgtg cccgacgacg tcgcagaaga aatcaaccag ctcgccgtac     67320
     cgcaccaccc cgtcgccgtc gacgtccacg caccgcatgg acatggacat cgccgcgcgc     67380
     atcggcggcg tgatctctct tctccgcgcc aacgcgagca gcacgttttg aagctcgtcg     67440
     cggtcgagcg cgccggatcc gtcctcgtca gccgccgtga acgcctccga gagcagcgcc     67500
     ctgagcgtgg acctgtcgtg gtgccggagc tcggcaatca ccttggcgcc ctccgtcgcg     67560
     gcgaaggtgg cgacggcgac gtcgcgacgt tccgcctcgg ccgcgtcgag catgccccgc     67620
     aggcgatccg ccgcgacggg ggcgaacgcg cgccaatcca cggtaccgac ggaggacgca     67680
     acgcggcacg cctccgcgca cacgaccgcc gcgtggaggt tactcacggg gacgccgtaa     67740
     tccctcaggt tgacgagcat cgcgtcgcgg atggagccga cgtggggcgc gatgccggct     67800
     gttgtgatgc ccttgggggc ggcgccgacg acgggcactc gcgcctcgcc cccggacacg     67860
     gcgtcaaagg cggtcaacac gagcttgagg agctcgccgc cggtttcgta catcgacgcg     67920
     gcggcgtact cgccattcac gcggcgcgca agcacctcgc gggcgacggg ctcgaactcg     67980
     cggtacgcga tcgagccgtc gcgggtgttc gccgatgcct tctttgcgag cgcgtctatc     68040
     tcggttttcg ccaagcccgt ttgagcgaac cgcaaggttc gcgagaacgc gtctttcgtc     68100
     atgacgcatc tttcccctcc cgcgccgacg tcgtcggtac cggtcgcgtc gtgaaacacg     68160
     cgcgacaggg tgtactgcac gcccgtttcg ttcatcggtc gcgaacgtct ggaagtatcc     68220
     ggaagcgtgt cgaagtatcc ggaagacgtc gactcttctc gggtcgaatc ttcttcttcg     68280
     gcggctcgcg cggcgacggt gcacccgatg gttcgcatca gccgcatcgc cagcggctcg     68340
     aactcgtgcc agtcgatcag cccgtccgcg ttctcccacg tcttctggtc aacctccgcc     68400
     atgatctctc ggacgtcacg cgcgctgaac cccaagtcgg cgcctttgag aattttctta     68460
     aattcggcgc gattgagata gccgtcgaaa tcgtccgtgg cgcggatgaa aatctccgcg     68520
     caaaagtccc tcagctgctc gtccgacatc ctcgccaacc tcgccccggt tccctccacg     68580
     atcgtcaccc ccgtgggcga cggcggcacg tcggtgaggt acttttgaag caccgggtgc     68640
     gtcgccgctt ttgtcttttt ttgctccgcc ggatccgtcg acgtttgaat ccccacccgc     68700
     cttcgcatca gcgtctcgtg ccgcgccagc gcctccttgt tcaccggcgg acgtttgccg     68760
     cacagcgccg cgaggcgggt caggatcacg tgcctgtgat tgccgttcgc caccgcgaag     68820
     gtcgtacgca ggtcctcgtc ctcaatcgcc gcgaggagaa aaccgtccac gccgaaagac     68880
     agcatggcat ccgcgtaggg cttgaggtac gtcccgtgcg acaggagaaa cgcgtgtgcc     68940
     tcgtgtttgg tccactccag gaacggccga cgtcgccacg acccgccgtt cgcgtccatc     69000
     cacgccttga cgtccctctc gtccggcggc gctcgtttgg tcagagcggt taacgtggat     69060
     gcgtcgaaag ttttcgtcgc gggatcgaat cccgggtgcg ccgcgccgcc gaggcactcg     69120
     cgaagctgcg cgctgcgacc gcgtaaggac tccagcgcgc tcagcgcagc ctccgcggcg     69180
     accgtcgggt cgtattcgtg cggaacgacg atcggcggtg ggtcgccggc gccgagcaaa     69240
     ccctctggtg gcgccatcgc caccggatca gacgacgacg aggaattgag ggattgaggg     69300
     ccttctccgt cgcgatctcc gtcgtccctt tggatggacc ccacgaccga cgacacccgc     69360
     ggttgttgga ccacgatggc gacgacgggc acctcgtcac cttccccgcc gatgataccg     69420
     ctcgcgcgcc gtatacgcac cgcgtccctc tcgacggcgc attgctccga cccattatac     69480
     gcgggcgtga cgatggcgat caccccggcg cacgactcgc acgcctccag cctcgccagc     69540
     gcgcgctcgt ccgtggacgt cacgagcgtc ccgagctcgg acgcgtccag ccacgcgagt     69600
     cgaacgcgtt cgcccctcga ttctcccggc gggggtttcg tcctgacgtc gtcgttgagc     69660
     gtctccgcga tcttcttgca gtaggcgagc tccgcgaacg tggcgtccgg ggtgggcgcg     69720
     taggagacga atatcggctt gggcgtcgtg gaccacgtga cgccctttgc cctgcgcgcg     69780
     cgagactcgc gccacggcgc cgcgcgtcgc tccaggtttt cgcgaaggct tcggaccgcc     69840
     gcgacctcga tggctcgggc catctcccgc gcggcggctt cctgggcggc gagtgccttc     69900
     agctcggcgg tcgcggcggc ggcctcgacg cgcgccttct ccgccgccgc gcgctccagg     69960
     cggcggcgct ccatcttatc ccggaaccat cgctcgccct cgctcagctc ctggtgacgg     70020
     tcgttggtag ggacggggag acgcgaggtg ggtcagcgat tgtttgtgcc taatcggggc     70080
     gcccgaggaa ccggtcgggg ggcgcggggt tgggagacga cgagggcggg cgcggacggt     70140
     ggggcggggc gggcgagcgc gtacctcctc cgcgggggcg ccgccgccgc ccacgtcggg     70200
     ttcttccgac atgttcgccc gcggcggtcg accgacgacg ccggcgcgtg tgctcgagcg     70260
     aggctcttcg gaccttttcc ttcatcggac ctcgtcccaa aagtcaacaa ctggttcatc     70320
     tgttgacgtt ccaacgcgtc cgtcgcgaca gagccgcgcg cgcggagggt ttcaacggaa     70380
     ccgcgccatg acgaagacgg cgaagtcgtc gggaaagaag ccattcggcg cgaatgatct     70440
     gattttgcgg tcgaacgtga ggagggcgct cccggatgag gacgtcgagg tgggggtgac     70500
     ggaggacgca tcaagcgagg ggacgaagcg gaagagggcc ccttacacga aggggccatg     70560
     cgagcacgga gtgaagcccc ggtcgcagtg caaggtgtgc agcgcttgtc cgcacgggaa     70620
     gaggcgcaga tactgcaagg agtgcggtgg gtctcaaatc tgcgagcacg gtcgtatacg     70680
     cactctgtgc aaggagtgcg gtgggtctcg catctgcgag cacggtcgtg agcgccgcag     70740
     gtgcaaggag tgcggtgggg ggtcaatctg cgagcacggt cgtcagcgct cttactgcaa     70800
     ggagtgcggt gggtctggaa tctgcgagca cggtcgtcag cgccattatt gcaaggagtg     70860
     cggcgggggc tcaatctgcg agcacggtcg tcggcgctct gagtgcaagg agtgcggtgg     70920
     gggctcaatc tgcgagcaca gtcgtgtacg ctatacatgc aaggagtgcg gtgggtctca     70980
     aatctgcgcg cacggccgtc agcgctctac gtgcaaggag tgcggtgggt ctcaaatctg     71040
     tgagcacggt cgtatacgct ctacgtgcaa ggagtgcggt gggtctcaaa tctgcgagca     71100
     tgattgtata cgctctacgt gcaaggagtg cggtgggggc tcgatctgcg agcacggtcg     71160
     tcagcgcgat tattgcaaag agtgcggtgg gtctcgaatc tgcgcgcacg gtcgtgagcg     71220
     tcgttactgc aaggagtgcg gtgggtctgg aatctgcgag cacggtcgtc agcgcaaaca     71280
     gtgcaaggag tgcggtgggt ctgcaatctg cgagcacggt cgtcagcgcc atcaatgcaa     71340
     ggagtgccgc ggatcgtctg ttcccgtggg gagatgggtc ttgtgacacg acgacgtatg     71400
     tacacgcgat atcgtaacat acacaacaga aggtggactg actagctagt cctcagaggt     71460
     tatcgtccgc gccgcggcgg ttaccgtacg cgacgttgcc gcccggtccc tgaacgacgg     71520
     cgccgccaaa acctccggaa cctccagaac ctccggaacc tcccaccgcc ggcgccgcct     71580
     ttgccgtctt agccttgacc tcctcgtaaa tctcgtgcac ctccggcctc gagttcctct     71640
     gcctgtccag gtccatcacg taacacacga acacgcagtc caccacgtcg agcaacacgg     71700
     tgacgcagaa attgaccgcc accagcgcga gacaaaacga gacgaatcct aagatgaccg     71760
     attcgccgcc ggcgttttcg tgcccatccg cgccgttcca cgcgacgtac ccggcaacgc     71820
     ccacgcacgt cccgtacgcc gccgcgaaca cgaacgcggc ggcggagagg agcgtcccgg     71880
     ggagccacca caccgcgtac gcgtttaaga aattttccgt gagcatccga ctcaccgcgg     71940
     cggcggcgtc gcaaaaagcg gcgcccgtga cggcgcactg gatcgtcgcg tacttggtga     72000
     cgtgctgtat gaccgcgtag acgcagtcca tgcacgcggt gacgaggcac gcgaggattt     72060
     gcagggcgcc gccgccgttt tctcgcgcgt ttcgtcggac gttttggtta atctctcgcg     72120
     cgacgtgaac cgcggtgagc acgagcgaac cgagcgcgag ggacccaaac gacggtccca     72180
     acgcgttctt cattgtaccg atcgtggtgc ccgcgaatgc gcgaacgccc gggggcgcga     72240
     agtaccactg cgcggtgacg ccggcgacgg tgaacatccg aacctcgaac gcgagcatca     72300
     cggtccacag ccaaaacagc gaggtcatcg cgacgtacgc cgacgcccag tcgtccgtct     72360
     cccacacgca gcacggcgcc acgtcgccgt tctcgtccaa acacgtgtcc tttccggatt     72420
     ggagcaccgc gtccgggtcg cgaacgacgc ggccgttgcg gtacgccgcg gacacgaacg     72480
     caaacgtcgg aacggtgagc gtgagcagcg ccagcttgac gccgacgatg gccgtcacca     72540
     cgtgggggtt gtcctgcagc gacttggacg cgaccgcgag aagcctggcg acgaggtcga     72600
     tctcgcgtct ccacagccaa aacacgaacg cggtgaggca cccgagcagc gccaggaaca     72660
     cgcccgcgcc cggtgagtca ccgcctccgc ttgcgacgat taatgcaagc gcgaagatga     72720
     cggcgacctt gaagtagacc atcgcccaga cggtgccccg tgcgtgggtt cgaaaggcgg     72780
     cgaggaaggc gaggccgacg gcgacggcgc cgacggtgga gagcgccagc cacgtcgccg     72840
     cgtgtcgcag gaacatcgcg ccgtccacgt cgtcgtcctc ggcgagggat ctgcggtacg     72900
     cgttcagcgc gtcgggggat ctggacgcgt cgcagtgcga cgccgcccgc atcaggtccg     72960
     ggtccgcgag cttctcgtag tgcgactccg cgtggttcga ggcgacgcat ccgaggatga     73020
     agacggcggc ggcgacgacg gcgtagaccc ggccgtacgt cacgtcgcgc gcctctcgag     73080
     ggccgtggcg gtagacgccg tcggtgagat ccgcggcggc ggcggcgccg tcgtcgtcgg     73140
     cggcgcggtc gtcgccgacg agctgctggt acacgcccgg gtcgcgagtc atgggcgcga     73200
     tgttcgtgtc tcggacgggc gcgcggggag agcggggttt gtgtggcgtg aacctcgggg     73260
     tgtgtgcgaa ctgaagcgaa aagaatgttc caaaagacgc ggtgccacgt cggatgtcaa     73320
     ctttgtttca aacgggcgtc ggccggcggg gcacttggac ggggcgcggg gatgttcaag     73380
     ttgcctttgc ggccgaccgt gaggagggat ccccccgatg atggtgtcga ggtgggggtg     73440
     acggaggacg cgtcgagcaa ggggacgaag cggaagaggg cccctcgcac gaaggggcca     73500
     tgtgagcacg gagtgaagcc tcggtcgcag tgcaaggtgt gcagcgcttg tccgcacggg     73560
     aagaggcgct ctgtgtgcaa ggagtgcggt gggtctcaaa tctgccagca cggtcgtgta     73620
     cgcactctgt gcaaggagtg cggtgggtct caactctgcg agcacggtcg tcagcgctat     73680
     tggtgcaagg cgtgcggcgg gtctcaaatc tgcgagcacg gtcgtcagcg caaacagtgc     73740
     aaggagtgcg gtggtgcatc aatctgcgag cacggtcgtg tacgctctaa gtgcaaggag     73800
     tgcggtgggt ctggactctg cgagcacggt cgtctacgct ctcggtgcaa ggagtgcggt     73860
     gggggctcat tctgcgagca cggtcgtata cgctctcagt gcaaggagtg cggtggtggt     73920
     ggaatctgcg agcacggtcg tcagcgctct aagtgcaagg agtgcggtgg gggctcaatc     73980
     tgcgagcacg gtcgtgagcg ccacaggtgt aaggagtgcg gtgggggctc attgtgcgag     74040
     cacggtcgtc ggcgctatga gtgcaaggag tgcggtgggg gctcattctg cgagcacggt     74100
     cgtcggcgct atgagtgcaa ggagtgcggt gggtctggaa tctgcgagca cggtcgtcag     74160
     cgccacaagt gcacggagtg cggtggtgca tcaatctgcg agcacggtcg cgtacgctct     74220
     aagtgcaagg agtgcggtgg tggtggaatc tgcgagcacg gtcgtgagcg ttctaagtgc     74280
     aaggagtgcc acggatcgtc ggttcccgtg gggagatggg ttttgtgata ctgcaacgat     74340
     agtgcacgcg atctcgtagt agacacgaca gaaggtggac tagtagtctt cagaggttat     74400
     cgacgattgg acgtcgacga cgcgcgaaag ttaacccccg gctaaggaat cagcggctcc     74460
     ctctccttgt ccacgttccc gaccgtccgt cgcctcggcg acttatctcc gccgcctccc     74520
     cccttggacg accccgtcgc cttcgccccc cccggccgtc ccgtcttcaa ctttggcaga     74580
     cccaacaccg cggtcaccac gtgtccgctc gacgtgcgct gcaaactctt ggccgagctc     74640
     gacgagctca tggaaccgtc cccgccgccg acgacgacgc cgttcatggc cccgaccccg     74700
     accccgaggt cgacacccac cccggtcggg gcgacgccca cccccaacgt caccgtgttg     74760
     ccgccgacca agccgacccc cccctcgact atcccgccgc cgccgccgat gattccgctt     74820
     gagccgagac cctgcgccgc cgccgccgcc gccgccgccg ccttggcgcg ggcctcctgg     74880
     tacatcacga acccgtacgt cgcggcggtg tacccggcga cggcgcgcac cgtcaccgga     74940
     tccccgtacg ccaccaccgc gagcgcgatg accacgccgt tcttcaacag cgacagcgtc     75000
     gtgagcgtca cggctccgcc gtgttgcacc acgcccaggc ccgcgacgtt ggcgaggaac     75060
     ccgaaggttc cggtggcgag gagggagagc gggttgccga gcgcggcgcg gccgtggagc     75120
     tcggcggaca ggccgtccca ctcgaacgcg tagaccagga gccacaggga cgcgagcgag     75180
     attggggaaa agtaaaagag gccgtcgaag agcgtcatgc cttggttggt aggttggctg     75240
     gaccccgggt tggaggtggc cggatcgaac cccgtgttgc tgtttcccgt ggtggcgttg     75300
     ttcttgaccg tggatgacga ggagaggagg tactggacgc cgcagagccg aagcgcctct     75360
     gcgatttcgc acgccaccat gcatcccagc ccgatccacg cgtgcggctc gttccccgtc     75420
     gccgtcgctc cccacgcggc gacgacgcat ccccccacga tgacgcacac cgccctggcg     75480
     cacttgtcgt cgaaggcgcg gtcgaggcga agggtgacga gcgccgcggc ggtgaccgcg     75540
     ggggcgaacg ctttggccat ctgcgccagc gacagcgaca cgtacgtcag ggccaggttg     75600
     gcaaacgcca gtgcgaccgc ggcgaagacc ccggtgggca ggacgtacgt cacccactgc     75660
     gacgtcgtga gccgcgtctt gagctccacg cgcccgaacc ccacgagcgt ccacgcgacg     75720
     atcgttccga agagcgaacc gagcgacgcg atgaggatcg gggttcgggt gttgaccacg     75780
     aggtgcttgt tggcgagcac cagggatgcg gacagggcga cgtagaggga gccgtgcatc     75840
     gcggccagga tccacgccga cgttccctcg ccgcgtgatc caggcggctt cgcgacgagc     75900
     ggccggagcc gcggcgcgag tctccccagc gacggcatcg accctcacgc gcgcgcgctc     75960
     ccgctctgcc accgcgacct catctccacc gccgcgtctc aggaaataac aattctaggt     76020
     caaccgcgtg ggggcgccga gtgctcgtca caacgcatcg agcggcgcgt cacatccgcc     76080
     gaccgaacct tcgccgaccg cgagtgagcg tgtgatgcgc gcgagcgcgc cggggtgcac     76140
     atcgcgaggc gcgcgcgtcg ggccgggcgc gaacggcatc aaagcgaccg cccgcatcct     76200
     cgcctccggt gtccgtcggg gcgccaccgc caccgtcgcc cgcgcgtctc gtccatcgac     76260
     ggtcgtcgcc atgccgttcg cgcccgggcc gacgcgtcgc gcgattgccg cgctgacgat     76320
     gcgcgcgcgc ctcctcatcc acacgggacg cgccgatgcg tcgtcgtcgt cgacgcggcc     76380
     atcgcgcttc ctcgtcacga cgcgtcgctc caccgccgcc gccgccgccg acgccacgaa     76440
     cccgcggagg tcggacccgc catcctcccc atccccgtcc gtcgtcgacg ccaccgacga     76500
     cgcctccgtc gccttcgcga acctccgccc gaaactccac ccgaagctcc tcgccgccct     76560
     ccatcgcgcg gggttcgtgc acgcgacgcc gctgcagacc cgagcggtgc ccgcgacgtt     76620
     ggacgcgtca ccggatggag cgacccgaga cgtggtggtc gccgccgaga ccgggtcagg     76680
     caagacgctc gcgtacctcg tgccggtctt ctcaaacctc ctgttccacg ggcacggggg     76740
     cgacgggggc ggcgatgagc acggggcgat gagatcgaac ggtcggctcg gcgcgctcat     76800
     cctggctccc aactccacgc tgtgcgagca ggtgaagagg gtggcggact cgctggtggg     76860
     ggacgacggc gaaccgttac tcgtaacgcg cgcgctcacc ccggacacgt ccatgccctc     76920
     gccggtatcg tcgggatcgt cgggatacga agcgtcgtcg ggcacgaacc gagggttgcc     76980
     cgacgtcgtc gtcgccaccc ccgcgagagc cgccgaggac gtgctcgagt ttaccaaagg     77040
     cggttggcgt cggggtaact ttgcccccgc cgcgacgcac ataaggcacg tcgtcttcga     77100
     cgaggcggat cagctgctgt cgggcgggta cctgcggccc gtgcgcgggg cgttcgacgt     77160
     gctgtaccgg gaggagaagc tcgcggcgtt gggtctaacc gtcccgggat cgaatcccga     77220
     aggggggggc gactttaacg tctttaacag tttggaagga cccgaacagt ccgagtgggc     77280
     cggcgataag tcgaggccca aggacggggg cgacagggct tggtccgccg atcacgacga     77340
     catcaacgtc gtcgccaagc ggaagggcaa gtcgcggatg ggcaagggtg cggcgttggg     77400
     tggtaagggc gagatcggcg tcggcgaagg gagggatttc cgcaggcagt acgtattcgc     77460
     ggcggcgacg gtgatgagca acgggaaaaa gacgccgggg gcgatgattc ggcacggctt     77520
     tcccgacgcg cgatggatcg agggcaggcg tctgcacaag gcggtggcga cggtggacca     77580
     gacgtgggtc aaggtgacgg cctcgacgcg cgcggacgcg ctcggccgcg cgctcgccct     77640
     cggcgacgag aagagacaac gcgatcgaac gttggttttc gtcaactcca ccagagcgtg     77700
     cgaggaggtg acggcggagc tcatcaggca ggggctctcc gccgccgcct tccacgccga     77760
     ggtgggcacc cgcgagcgta gtagccggtt ggtgtcgttg gcgaacggag acgtcaccgt     77820
     gctcgtgtgc accgactcgg cggcgagggg cgtggacgta ccggaggttg tccacgtggt     77880
     gcaagctgaa tttgccgcaa acgcggtgga ttaccttcac aggatcggtc gaaccgcgcg     77940
     gtgcggcgcg agcgggcgag tgaccaactt ggtgtccaac gcggacgctg acctcgtgga     78000
     cgcggtgcgt gccgcggagg cggcgggcgc gccggtggag ggggcgttca gtcgcaagag     78060
     gagctttcgt aaaaagttca aaaagtacgg cccgtcgcgc acggcgccgc aaaacaggcg     78120
     atgatcatta gggtcgtttt atgatacatc ccttcttacg taccgaggta aaagttagac     78180
     tatcgtggtg ccatcgtaaa acccttgact tgctcgcggt ggtaacttat tagccagagg     78240
     atcaaatctc ggtggcgtag ttgccgatgg cgcttccctg gacgtatccc atgttcgata     78300
     gcttcttcat ctccgccgtc accttctccc tgtgcagcga catcgccgtc ttaccgtcca     78360
     cctcgcgcgt caggttcacg tccgcacccg ccgcgcgcag cgcgttcaga gcccccgcgt     78420
     gcccgttctc cgccgccatc atcgcggcgg ttgacccgcc cccattcgcg cccgatccga     78480
     aatcgctcct cgcgtcgacg tccgcgcccc tgtccaccag caccgcgatg cacgccacgt     78540
     ggccgaacct cgcggcggcc atcagcgccg tcatcccgtt cctcgggtcc ctgcactccg     78600
     tgctcacgcc gacggtctcg gacagcagca cgtccaacac ctcggcggcg ccccgccccg     78660
     cgcactcgat gcccatcgtg catcgtaagc gcccgtccgg atcatcggac cctacgtctt     78720
     cgaagagccc gagggatgcg ccgcggtcca ggagcaggcg cagggacttg gcgctgcccg     78780
     cgcgggtcgc ggcgagcgcg gcggcgcgaa cctgcgcgtc gcggatcttc gcggtcgacg     78840
     cgtccggcgc ggggaggtac acggaatcca tcaactctcg cgtctttttc cagtcgtcgg     78900
     cttcggcggc tgccatgagg tgcgggtact gcgcgaagag ggcgtcgacg tagtcgcgct     78960
     ggtccttctt gttcgcggcg gaatgcgcga cgccgaggtt ccagctgccg ggggtgccgc     79020
     cgcctcgaga cgacgacgcc gaggcggcgg cggcgacgcg cgagcgacgg tgagcgagtc     79080
     tcaccgaaga atcatcgccc cctcgcgccg actgcgttgg gacgcgcggg gcgacgcgag     79140
     tccacgcgcg atgtcggcat cgccgtcgtt catcctccct cccggcgtga gcgcaccgcg     79200
     atgccgcggc ggacggcgcg ggcgcggtcg tcgcgcggaa catcccgcga cgagtggtgc     79260
     tactgccagt ggggcgcccc ggcgtcgacc gccagacacg actcttgacg cttcatcaat     79320
     cgggagacgg agaatcgtcg ggtcgatgcc agctggcgtt cccgctcaat tcgcgagacg     79380
     cgcgagccag ccggataggg gcgggaggat ggggttgcgc cgagccttag ccgcgcccct     79440
     ccaggcgtcc ccgttcatcc tcgcctccct ctacgccatc gtccgcgctc tgctcaagga     79500
     gcgcccttgg tccacccagg cgcgcgcgca gaaggagctc acggactcga tcccgcgcgt     79560
     atcccccggc acccgcgtct gcgtctacgg actcagcgcc aatcccccca cgggcgaggg     79620
     cggacacgcc acgatcgtcg cgcaccttcg ccgcatgttc gacgaggtgt gggtcctccc     79680
     ggtgtacagg cacgcgttcg agagcaagag caacctcgcg ccctacgacc atcgcgtgcg     79740
     gatgtgcgaa ctcgcgttcg ggctggggaa catgaccgag caacaacgac ggacggagaa     79800
     ggtgaaggtc ttggacgtcg agcgagcggt ggtccgcgcg gcgtgggaca ggcacagggt     79860
     cgcggaggaa gaagccaaac gcgtccgcgc ggacgcccac gcgcggcggg gcggcggagg     79920
     gggcgacgcg tcgtcctcat catcatctcg cggaggcgac ggacctaatt ccaccccagg     79980
     cgcccaatcg accgcctcgg agtcgtccgc ggcgccctcg ccgaaggcgc gaaagacccc     80040
     gccgatgagc ccgtccgcgt ccaccgcgtc cgacgcgcta catatatccc cgttcaagtc     80100
     cccgacgacg atcggcgcgg aacccagcgc ggggcccggt gcgacgaacg ttcgagcgca     80160
     tcattccgaa cgtcatccgc acagctgtgt tccgccgccc aaggtgggat ccttcgacgt     80220
     catcaccgcg attcgcgagg cgaacccgtt cgcgtcgttc tcgtggtgcc tcggcgccga     80280
     tacattcgcc gatctgaggc gtgggagatg gcgaaacggc gcggaattcg ccgcgctgtg     80340
     cacgcagctg tacgtggtcc cgagggtggg aggcgcgggc gccgcgtggg aggagatcga     80400
     gatggggacg acgtacgggg acgagcacgg ggacggggac ggggacgacg agcacgagat     80460
     cgacgccctg ctctcgggga tgggaggcga cggggggttg ggaggggacg gtgccgaggg     80520
     gggtgccgag gggggtgccg agggctcagg agcattcggg gacgccggac tcgtccgcgt     80580
     cgacaacgcc agcgtgatgg acatcccggg gatgagcgct gacgtgtcga gcaccgcggt     80640
     gagggacgca ctgcgacggc ggcgaaggag gttacacgag cgggatcggg cgaatgggaa     80700
     ggcgttcact ccggagagtt cggacgggat ggagatgggc gggcgcgggg cggacttgct     80760
     gctggacgag gccacgctgg cgacagcggt gagcgaggac gtgttgcggt acgccgtcga     80820
     gcacgggctg tacgcgtgat tcgattcgaa ggggtcggcg gcgagtgcgt tgggagacga     80880
     tatttttttt aacactcggt tgttgttgtt ttcaattgcg cgtcggcgtg ttcccgtcgt     80940
     gtcgtatcgc atcgcatcgt tccgttcaca acaccgcccc ggctgccttc aagatgtcgc     81000
     gaatctccca aaagtctggg tcagcctcct cgggttggcc gcccggatat gaggccaggg     81060
     ccaaaggggt tatgttcgcg tccttctggt tgacgtcagc tccaacctcg atcaacagac     81120
     gcaccatgtt cgcatcgcag tgcatgatgg cgttaaagag cggattcata acgtttttgc     81180
     tcaggtcaga ggcgacgttg atgttggcgc ctcgctcgac gaggagtcgt atcatcgcaa     81240
     aatcttcgaa attgacgagc ccaatgtggc ccaccgcggc gtccatcacg tcggcgctca     81300
     cttttcccgt gtcaatcaag gctgcgacca tgcctcggtg gccgacctta caagcgtcgg     81360
     ggaaaacgaa atcgacctca agtccggcgt caatcagagc gcgggcgatg gcgatgtgat     81420
     cttcgcacgg cggctgatct tccctccact tgtgccaatc aattatatgg ggctctaagt     81480
     ttgaacagtc attggtagtc ttataaccac gggccactgg cgagttgcaa aggacggcaa     81540
     atttcaatga atgaggatcg ggctttacgc cgatggccaa aagaccgcgc acagcctgaa     81600
     cgtcctgttt atgcatcacc gcaaactgca tgagcgtgac atttcctccc aagcgttcgc     81660
     cgttgaaaca gtaatccgcg acgctgtcga ggtcgtcctt gtccgcgacc agtccggtgg     81720
     ccatggctct catcctctgc tcggggctgt ccaggctcca ctgcttgcag acgagcatcg     81780
     cgcacgcgag atcgtccggg ttgttcaggt ggcggtacac gcgctcgaga atgtgaagcg     81840
     gcagggacgc ccagatgggc gttgtgtcct cctccatgct catgtccgcg agtccaaggg     81900
     tcggcgacgc gaggtgccgc gcgggataag tcaaactgcc caaaccaaac tgccgcgcga     81960
     aggcctcttc aggtgtgagc cactgcatct cgcacctctt cttcgtgaac ttcacgccca     82020
     cgcacacgta ccctatctca cacccacgaa ctaccttgcg tgtttctccg tgaagctcga     82080
     tgtatttgga cagagataac gagacgtcaa gttcaccctt gatgaggggc ttgatgcggg     82140
     tttgcccctc cgccggctcg gcccatgagg cgcagtacca cttgcacgca tcctcgggga     82200
     cgaagtgttt cttggcgtaa aatgtcacca acttcctcaa ggcgcccttg aactgcgaag     82260
     gcttgaatgc gtaccttcct cgtagtcccg atggcgagca cacgatgatt attttcttgc     82320
     catcctttct cacttccgcg tcgtcactcg cgccctgctc cgtcatgggc gcgcgcgatg     82380
     gagtgtggct cagatctcgg gcgacgtttg gtcttccgag aaaattctgt tctgtttctg     82440
     ttggcgccca gcgcgtcagc ccagtttgaa ctcgaggtgt gccaaccgcg ccactgaccc     82500
     cgcgcgcggc atgcccaaga gggtctgggc cgcgcccccg tggcccgcgc actgccctct     82560
     cccgtccgac gatgacgaca ccgcgcgcgt cgtcgccgcc gcggggggcg ccaggggcgt     82620
     cacgcacgcg ctcgtctccc tgggcgacga gcgcgtcatc gaggcgacgt tgacgaggct     82680
     ccacgccgaa cgcgcggcgc gcacggcgag gctgacgaag gcgctcgacg cgggggtcgc     82740
     cgcgagcgac gtcgcgcttc gagcggagtg ggacgcgctc atcgcgcgcg tcaccgcgcc     82800
     gcccgacggc gccgataccc ccgcgcccgt cgccgtcccc cgcgatctcc acgccacgac     82860
     gacgacgacg acgacgacga agccgacgcc gcgttccgct tccatcgccg ccgtcgacga     82920
     cgccaccccg cggcatcgtc gcgcgcgtcg atcccaaacc ctcactcccg cgacgaacac     82980
     gcacggcgcc ggcggcgacg aggtcgtcgc ggccaccccg gacgccgaac tcgccgccgc     83040
     gccgtcgtca ttttccgcgg gtgccaacaa aaatcgcgcg acgcggtcga gatcccgctc     83100
     gtcccccgcg cccatcctcg ccgacacgcc gacgataccg gacgccgacg ccgccgacga     83160
     cgccgccgac gatgccgccg ccgccgacga cgacgcgctc gatcacccgg ggtcctacaa     83220
     acccctcgcg tcgtcgcaac tggcgggccg atactccatc tcggccactg ccgagtacag     83280
     agcggcggcg gcgttggcgt ttgcgaagac gccgacggcg acgcttcgat cgtcgctcga     83340
     gacgacggac gacggcgtcg tcctcgacgg caccctcgac ggcaccctcg acggcaccct     83400
     ccgcgacggc gcctccttcc cgctggacac tgccctcccc cgacgcgttc ccgaggatgg     83460
     cgacacgctg atggtggagg agacgccgag gtcggagatg gacagacgcg cgggaggagg     83520
     aagcgggagc gggaacgggg ctagcgaaaa caccaacgcg aaagggaacg cgaacggcga     83580
     cgggagcgga aacgggagcg gcagcggaaa cggcggcggg agtgggaacg ggtttggagc     83640
     gatcggccgc cgccgcggcg tcgccgggca caggctcagg ttcagcgtcg gcgggtcgct     83700
     cgtcgccgac gcgggtgccg aggcgggtgc cgaggcgggt gccgacgagg atacaccgcc     83760
     ggatccggtc gccgagagga tcttctccgc gacgcacgcg tccggctccg tcgtcctcgg     83820
     cgtgatggct ccgccgcccg tcgcgccggg cgccgaccgc gtcttcgccg tcgtgaccga     83880
     gtcgagcgag gggtccgagg acgtcaccgt gatggtctgg cgggtacgat gtcacagcga     83940
     cggggacgtg cgcgacggcg gcggcggcgg ctggaatcga tcccgggacg tgaactctca     84000
     tcgcggtttt gggaccacca cgtgcgaact cgcggggtcg gcgaggcttc gcaagcggga     84060
     ctggaccggc gcggggggta aggagaacgc gtccccgcgg agggttaaca tcgcgtcgct     84120
     gatgccgcca gtcccgggga ccgttacgga ccgttacggc gcgtcgaggt cagcccggga     84180
     cagcctcgac ccggcgacgc gcggcaagag acagagcggc gcgcagctgt gcggcgccgt     84240
     cgcgctctcc ccgtgcggcg aatttctcgc aatcgccgag tcgcagttta tcgttcgagc     84300
     cgacggggac gacgacgcga ctgggacgaa ccggggcgga cgcggcgcgt gcgtggttcg     84360
     cgtcgagtcg cgacgggacg agcgaggcac aaacagcgcg tggatcgacg atcgcgacgt     84420
     ggtgctcgcg ttggactgcc cgctacgggt cacgcgtttg gcgatgcgtt gggacccagc     84480
     cggcgacggc acagctggcg acgcggctgg cgacgcggct ggcgacggtt caaccgaacg     84540
     gtccgcgcgc gtcgtcgtcg tcgccggcgc cccgctgggt aagatgcacg cgtggaggtt     84600
     tgacgcgtcc gacctcgacc cgaagaagag tcggtcgaag aagacgccgg gggagcgaat     84660
     gccggatctg cggtacctgg accaaacccc gatgtccgac ccgctcgacg tcctggcgtt     84720
     cgcgtcgacg ggcgacgacg tcgtcgccgt gacccacgac gggctcgtcg tcggaaacta     84780
     ccgcaggacg ccgcgaaacg gttgggagac gcgcggggtg cactacacgc agcggcaccg     84840
     cgttcgagcg atggcgccgc tgcaccccgc cgcggtcgcg gttacgtccg cggttacgtc     84900
     cgcctcgtcc gcgcaatcct tcgtcccgtt cctcgcgctc gtggagagga aagccgagcc     84960
     gcgcgacggc gtcctgcgcc tccacgcggg cgccgtgggc gtcggcgtgg acgtatgcgc     85020
     ggcgatgccg ttggacggcg tctgcgctct cgccgcgggt ccaaccacgg gcgcgttcgc     85080
     cgcggtggga acgaacacag gggacgtgct cgcgttcgac gtgctcacgg gggtgacgat     85140
     cgcgaggctg ggggacctgc gcggggagga cgggggcgtg gtgggggtgg cgacagcgcc     85200
     gtgggaggcg gcgggggacg tttgcgctgg gaacgtttgc gccgggaacg gaaggtcgtc     85260
     ggcggcgctg ctcgtagccg cctccaaaac gcgcatggcg gcgtacgtgg tgcacgcgtc     85320
     gtgagtcagc gcgaggtgtt tcgtcagtgt gatgagctat tacaacgatg aatggataca     85380
     cgagatttta gttaaactac agagcgtctc gacggacgtc gcgcgatgac gacgagctgg     85440
     attgatgaat accgcagacg cctttgaagc aaggagcatc aacggaaatt actacgtgcc     85500
     atgaacctgg aggctcatta cacgaagccg gaggattgca tcaaaggcgt ctgcggtcga     85560
     catagtcgtc gttcatcaat cgagcgcgtc acgtcgtcgc ccctggaaca agacacgcgt     85620
     ctgatgcggc gtgaaaggaa tccaactcgc tgaatatctt tcaacgccac gacaacgtct     85680
     cccaaccaac gttgaggacg tcgtcccttg cattcagcga gttggctcct tggacgtcct     85740
     taagaagaac cggaatcaga cgcgtggtga gaaacaaggc tgttccaggg ccgacgacat     85800
     cgcggcgtcg tccgtcgggc gctcgccccc aagccggacc cgcccgcgcc caaaaaaatc     85860
     accaattctg cgcgcgtccc ggcgcgttca ccagcatggg ctccaggctg aatttgtact     85920
     gctcggcggg gaggaggagg agggggaggg cagggcatcg gtcaggctcg gggtctcggg     85980
     ggggaaaggg cgctcgagcg agtcgcgtcg tcggaacatc gtccgcgagg gcgcgcgcgt     86040
     cgcctcgggc gaacccgcgg acgcgatcga gggggcgaac cgccccttcg tgggtcgtgg     86100
     cttttcctcg gtcggatacg ctaaatctgg gttgggggca ctcacggtca gctggttgcg     86160
     gtccttggtc caccacctgt gggtcttcgt gggttgctcc cagttcttct tactgcgcgc     86220
     gtgaagggtg aggcgggaac gtcagggccg atgcgtcgac gggcgcggga cgggccggtc     86280
     ggaaggcgtc gaggaaaccc taggcgttgg gcgatacgag gatgattata tcggacaaag     86340
     ccggggggac gggcggggcc ggcaactcac atctcctcgc acttcgccat cgtcgtcgtc     86400
     atgtgcttct cgaaatccgc ctgacgcttc gccgggtctt ccatcttccc ggcgagccat     86460
     cgcgtgagga aacccatcgc gcgtcgagcc gcgcccgaac cgcgctccgt gctgtgaagg     86520
     aaaccatctc ctccgcgaaa cacaagagtc gttggatttc tccgcggcct gaacctgaaa     86580
     attcggcgtc atcctctgta tgaatacatg tggcgtcaag taaatatttt cctatgggta     86640
     atatgggtct ataacagcaa atacgatttg ggccaaaacc gaggcgacca ttttagcgaa     86700
     agcgaagggg cgacccggct gggcgtcagg gcgaggcgcg cgggcgcaac gaacgcggcg     86760
     ttcgatcgaa ctcgacggcg gaaacgtttc gaggaggcca cgggtaatcg ttcgggggct     86820
     ccagaccggt tcagcgggga tcgtggcggg catcgagccc gtgattccgg aagggtgccg     86880
     tgtccttgcc attttttggg ctcgtgagga ttgccgaggg ggctttcggt tccgcactcc     86940
     gcgcgtccga gacccggcga gggtgcggca tcgtcgatgt cggcgcccat cgcgtcgacc     87000
     gcggcgggtg acgtcaacgg cggcgcgatg gacgcgtccg ggcccgcgcg ggtgcatcca     87060
     accaccgccg acggcgaact cgcgcaatcg caatcgcacc gaaaacccga gtcgctcggg     87120
     ggcgcgcgcg gcgacgatgc cggtaactcg cctcgggacg cctcgtcgga gccggaagac     87180
     ccggtcgagc gattcgcggt gatgagggcg ctcgagacgc tgagggacga gcacgcggaa     87240
     ccccacgagc ggacgtcggc gtgcgagcgc ctccgagact ttgcccgcgc aaccccgacg     87300
     gtcctcgccg gacgtcgtcg acagattcga ggacttctcg gcacgtgcct cccgatcctc     87360
     gcgcgggtgt ttcacccgtt cccgagggcg gcgagcgacg gcccgccgag ggacgacgcc     87420
     gacgttcgag ccgccgcgct ccgggcgtac atcgcggcgg cgtacgggca acgggagacg     87480
     gacgacgacg acgacgacgc acagctggcg gctgattggc ggaaaaacgt aagcgccgtc     87540
     gaggcgttgg cggcgacggc gacgtcctcc cgcgccgccg tcgccccgcg cgtgtccgcg     87600
     ctggacgtca tcgggcgatg cgccggggag gtccgcggga tcttcgccga ccgagcgcga     87660
     cagaccgtgg gcggcgactc gtactcgcgt ggcggcgtcg acgtcgattc tttcgacgaa     87720
     agattcgacg aaagattccg cgcgacggtc gaggctgtcg tccgtgcggc cacgtcgacg     87780
     ccgaacgagc acaccgacga ggaatgggcc gcggtgatgg agtgcgcgtg ccgactctgt     87840
     ccccactacc acccgccccg ggacgggagt agcacgttgg gcgccgagtt ggtccgttcg     87900
     ctcgggtcgg cgaacgatcg cgtcgcggga tccgcggcga gaatcgccgg taagctcgcg     87960
     tggcccgacg tcatcgatga gcgacgcagc gacgtcgtcg acgcgctcgt cgcgctcacc     88020
     gcgtccgagg gccgcgcggc gtgggtgcgt cacgccgcgg cgctcgccgt gggccgcgtg     88080
     ggcgccgcgc gggatggatg gcggagatcg gcgggatcga cggcgccctc gacggcgccc     88140
     tcgacggtac cctcgacggc accctcgacg gcaccctcga cagcacccgt cgcgaacgaa     88200
     acttcgaacg ccggcgaaga ccccccgagg tcgcccgacg acgccgcatt cgtcgacgcg     88260
     gcggctcgcg tggattcgct cgtcgtcgat tccgcgcggg atcgagcccc cgaccttcac     88320
     gttccctcca tcgggaacgc accgcaccac cacggaccgc accaccagca gcagcgacgg     88380
     accccacgcg acgcgctcgc ggcggcgctg acggacccgt gcggctttgt tcgcgtcgcc     88440
     gcgacgcaca gctgtgcgcg cgcgagtaaa gccgattgcg tcggcgcgat gcatcttttg     88500
     ctgccgaacc tgagagcccg cgacgcgtac ctgcgggagg cgacgtgcag ggcgctgacg     88560
     gcgctgtgga cggaggaaca cgtacctgcg atgggtgcca tccccgcggg agagggcgcc     88620
     gcggcggggg cggagacggc ggcggagggg gatgtcaaga cggatgtcaa agcagaggtc     88680
     aaagcggagg tcaaagcgga ggtcaaagcg gaggtcaaag cggaggtcaa agcggaggtc     88740
     aaagcggagg tcaaagcgga ggctgaagcg gcggaggcga aaacggaggc gcctccttcc     88800
     gatggcttgc cccacccacc cgcgttgaag acgaagaccc ccggggaact cgcgcggctc     88860
     aagctgatgg cggccaccgc ggccaacgtg gcgccgctcc tcgacgacgc cgacggcgga     88920
     gtccgtgaag ccgccgccga gtgcatgggc cacctgaagg aatccgccac ggcgcacctc     88980
     gacgcgttgc gcgctctgat gaaggacgac cgcgaggagg cggtgcggga cgcggcggtg     89040
     gacgcgatga cgcgactcgg gttttataac ccgctgactg ggagcgtgaa gcagcggggt     89100
     ttctacagga cgtggcggcc gaggagggac ggcgaaggaa gcggcgggag gcggccggct     89160
     tcttcgttgt cgaggactcg agcgtgcgag gttggcgcca ccgtccgggt gtggtggcca     89220
     gacgatgcgc agttctacga agcccggatc aaggcgtggg accgcgagcg ggacgtgcac     89280
     acgctgctgt acatcctcga cggcgtcgag gaggagctgg atctgaaaaa ggagagggtc     89340
     gagttgcgat acaagccgca caagcgcggc gccaaggagt cctggctgcc catacgggag     89400
     aagaaggaga agaaggagaa gaagcccaag aaggagccgc gggagaggaa accacgggcg     89460
     cccaggccgc cgaaggaccc acgcgagaag ggggtcaagc gcgcggaggt gacggtggag     89520
     aaggttggta agggtcgcgc ggtgcccgtc ggcgcgcggg ttcgcgtgtt ttggcctttg     89580
     gacgacgcgt ggtacggcgg cgaaatcgtc ggacacaacg ataaggagtc ggtcaacaag     89640
     cagggcgagc tcaaggtgac caagctccac accgttctct accacgacgg cgtccgggag     89700
     gacctaaact tcgacaagga aaaggtccag ttggtatccg taggcgccgg cgacggaatc     89760
     ccgccgctgg acggccagcc gccgcttcgc gtcccgatcg tgggcgggaa ccagccgggg     89820
     tggatcttac ccaacgcgag acggggcgcg gagcgcgtcg cggtgtgcgg cgagggcggc     89880
     gtcgtcgttc gcgagatgtc cctcttggac tttcacgacg agtacgtggt atccgcatct     89940
     ggaaacaatt ccggggacac aaacaaagaa tcctccggaa acgtgggaca gaagcgatgg     90000
     cggcgaacgc tgtcgttcga cccggcgcgg tgtggcgagc gcctcagacg ccggggcggg     90060
     tgcgccaagg ctgtgagcat cggtcggtgg ctggcgaatc agggcgcggc gtggggcgac     90120
     gccgtcgtgg ggcgtccggt gaaggtgagg ccgagcgggt ggtcgtacgg ggagcgcgac     90180
     tacgcggagg cggagcggtc ggacgctccc acgcgtggaa cggaggtttc cggatcgaac     90240
     cccgccgagg ctgcgtgcgt cggggagaaa cggaaggcgc ccgagccagg cgcgaacgcg     90300
     gacgaaagcg ccgaacgtcg gacccccatc ctcggtatcg acggtggacg taaaaagtct     90360
     ttgaaggaca tatacgagga ggatcctcgt tcatcctccc agccggagaa ggacgaggag     90420
     gcggcggctg gggatggcga aaccgccgcc gtcgaaccgg cggacgacga cggtctgggt     90480
     ggtgactcac cgggtggtga ctcaccgggt ggtgactcac cgggcgacga aacagacgac     90540
     gagacggagt ggcgatccgc gtccattgtc gggttcaacg cgcagaccgg cgaccaccag     90600
     atgttgtact cggacggaac gcgcgagtgg ctgccgctca tcttgcacga gaccaagccg     90660
     gcgagcgact gaaaaaaata tcgacgcgag tcgtacttta cacctcgcta agagcagctc     90720
     atcgcgttcg ccgcgatgaa aaaaaagaat aggtttggcg tttcgctgcg agtccagtct     90780
     tcaccctcgc gccggcgcct tttgcgccgc cccgttcgcc cgccgaagct cccacgcgtc     90840
     tcgctcgtcc agctttttcc gaaacaagtc ccgcagccgc cacaccgcct ccctcgtcgc     90900
     ccccgagtct ggcccgattt gctcgcccac cggtcgatcg atctgcggaa acggctcgtt     90960
     cgggtagtcc acgccgattt cgaacttgac cgcgtcgtcg tacacctccg actcgggcgt     91020
     ctcgttgagc gcgttcgagt gagcgaagaa cttggcgtac gcgtcggggt ccctgtcgat     91080
     ggcgacgacg tagtcggcga tgacgtccca atcggactcg gtggggggcg aaccgggaac     91140
     ttcgggatcg cccgggacgt gacccttgag cctccaaatc tcgaggacgt cgacgaaggt     91200
     gccccgtttg aaaacctttc gcgcggcgcg agagtcgccg tagtacaccg gcacggcgcc     91260
     cgacgccatc gcgttgacca gcttctcggt gacgtatccc ggctcagccg agttctccaa     91320
     cgccaacacc catcggtaat ccttgtacag ctcccacggt ttcgtcccgc gcggggggta     91380
     ctcgtcggcg gaggaccaac gaacgttgtg ctcgcacgcg ccgagcgcgt gcacggcgcc     91440
     gtccctgccc aactcgtcca cccgtccctc tcgccatccc cggttactcg cgcgctgcaa     91500
     cgctcggaag atctgcgcgc ggtggtcctg gcagttcccg ctcgcccatc ccaccatgtg     91560
     tcttcttaag tccggcgggt tgtctttaaa cgcgtttagc cggtcggcga ggtgatcgcg     91620
     catgagccac gcgtgcgtca tcgcgtacgg cgaccaaacg tacgtcgtct tcttcgggtc     91680
     gtacaccaaa ttctggttgt agtgcgccag ccccgtttcc agacgcatca ccggatcgct     91740
     ctcgtgcctg caccactccc acgcgttgaa gaacatcgag ggttccgcgg tggtctggac     91800
     ccacggctta tccccccacg agcaccggga accttcgtcg cggcccgcct ggaagatgtc     91860
     ggggccctcg acgacgatgt cgggctcgac gctcgggtcg gacgtcgcgt cgaccctcag     91920
     gtctctcatc gccgagcgcg aaccgtccgc ctgtgcgtcg taacggtcat gacggccgtt     91980
     atgacggctc gatgacgtcg tcaggtccgc gaggttcacc gcgctccagt cgtacgtcgg     92040
     gtcggcgagg gttatcttca ccccggggag cgcggcttcg agcagccgca cgacggggag     92100
     ccagtaaaag tcgccgctgg attcgaatcc caccgtgacg ctcggcctgc cgtcgtcttc     92160
     gatggcggta tgttgggcgg gttcgtgtgc gggcccggcg ggttcgtgcg tgggctcggc     92220
     gagggcgagg cccggcaggg gcgtgcggac ggcggcggcg gcggacgacg acgacgacga     92280
     cgacgacgac gacggggacg acgatctgaa gctgccgacc ccatctcggg gcgcggcgag     92340
     caggcgacgg aggtcgccgc cggcgccggt agacgcgacg agcgccagcg cgagcgcgac     92400
     gcccgcgagg aacgcacatc ccaccgcgca cgccacggtc caacccctgt accgaccgcc     92460
     ccactcgagc tcccgcggcg cgctccccgc gtccagcgcc agcctccgcc tcgcaccgcg     92520
     cccggtaaca cccatcgtca tccagcgcgc acgacgcgaa ccccccgcgc gcggcggcgc     92580
     gttcgcgttg gccggcgcgc cgtcgtcgga ctccagggtg aggtggacgt ccccgccgtg     92640
     atccgtcgcg ccgtagtcca tcgcgcgccc gtccatggct ttcacggtcc gagcgcggct     92700
     ccttctgagc gcatggctat cgtgaggtct cggaggcgcc gactggaaaa acaaccggag     92760
     ctgcgccgcg cgccgcgcct ttttggcgac ggaaaacctc ggaaaagcgc gacgcgagcg     92820
     cggtcgtcgc cgcacgacga cgggagcggc ggagcttccc gagggcctca acgcgcgacg     92880
     gtgtctcccc ggtcgcgggt tcgatacctc gcggcgtcgg cgatggcgtc gctgccgcag     92940
     tgggccgccc accaggccgc ggcgagccat cgtgctccgc gtcatccccg tcgcgcctgg     93000
     cgatggaacg aacgaacggc ggcggcgtcg tggtcgtcga cgcggtcgcg gtcgtcgccg     93060
     gtgcgaacga gcgccaagcc ggagcgaaac gacgcgcggc gggaccgacg cgcggagtcc     93120
     gcggactgga ccgtgccgga cggcgtgtcg cacggcgacg tcgcgcggca acccgcgggg     93180
     gatcacgtcc acccctccca cctcatcccg ccaaaccttc gacgcccgga cgtcccggag     93240
     acgtacaaga agaaacccgt cgcgctgctg atgggctacg tcggcgcggg atacagcggc     93300
     aacaccacga acgcgtcgct gcccaggggg agcaccgtcg acgacgtcct cgaggatgcc     93360
     ctcttcgacg cgggttgcat cttactctcc aactaccgat cgaggtcgct gtcccggctc     93420
     aagtggagcc ggagcagtcg aacggacaag ggcgtgtcgt cgctcgccac cgtggtgagc     93480
     gccaggctgg aggtggacgt gggggtgtgg gaaaacgacc cggaggggac acgaatcgcc     93540
     gcggatatca accgacacct cccgaaccac gtcagagtct ttggcgcgta ctcgacgccc     93600
     aagtctttcc aggcgaggag ggcgtgcgtt cgacgcacgt acgattacct cttacccgcg     93660
     acgtgcctcg ggttgaacgt gaacggcgag agggacgcgg cgctcgcgtg gccgggcgcg     93720
     ccggagttgg cggacgccac gggggaggag gtgatggcgc ggttcaggcg ggcgctacga     93780
     atgttcgagg ggtcgcacta cttccacaac tacacgagac ggtcggcgta cgcgccagcg     93840
     cccgacggag gccggcgccg cgcacgggcc cggggcgccg gcgacgacga agacgacgag     93900
     acggaaggca gcgaaccgat ggacgaggcg gaggacggag aggcggagga cggggccggt     93960
     gactcaccgc ctgaacatgt cggctgcagg cgccgcgggt gctactggct caaggcgcgt     94020
     gacgacgccg acctcgtcgg ggtgaagcac gcgaggaagg tcaactcgtt catcgccgcc     94080
     gaccccgccg tcgccgccgg gcacaaagac gcgccgccct tcgttcgcgt caccgtcaac     94140
     ggcgacagct tcatgctgta ccagattcga aagatgatcg ccaccgccgt cgccgccgcg     94200
     atcggccact tccccctcga gctcataccc gcgtctttga cccgaccggc gaggatcgcc     94260
     acacccatcg cgccagcgtc gacgctgtac ctcgtcgacg cggagttcat gagcttcagg     94320
     ccgcgcaaag aagcgaaagt aagtggcccg gagatgcccg gagacgccga gaacatcgcc     94380
     gagaacatcg ccaaacgtcg ccaaacgtcg ccaaacgaac agtgcgtggt tcccaacagg     94440
     ctcgacgcgc tcgtacccgg cgcggaggtg cgcgcgtcca tcgcggagtt tcagaggttc     94500
     gtcctcgacc cggcgttggc ccccgccgtg gcggacgccg agtggggcgt cttcgtgggg     94560
     aaccttcgca agcttcgaat caacgtcgac gactttgacg gggatgacgg gaaaggggac     94620
     gcggtgaggg agtgcctggc ggcgcacgcc gagtacgtcg cgatgcggga ggagaggcgg     94680
     gcggagcggg aggagcgcga gcgcgacgcg gccggcgcgc tcgcgtaggc gtagtcgagc     94740
     gtccgtcaat cgatcaattg agtcgccgat gaacgacaag tgttctaact aaacagcagg     94800
     cgtcactgga ggcgatcgtc tagggcggtg acgtcgaaga gcaccgcgta caccgccgcc     94860
     agcgtgaacg ccagcgtgat ggcgtcgagc caccgcggaa cctcctggtt cagcgcccac     94920
     gacaccacct tgtacgccac cagcggcgac gccaggtcca ccgcgagatc cttggtggtg     94980
     tagtcgtagt cgtccgatct gtcctcgtac ccgaacgcgg gttcgcctcc gcccgcgacg     95040
     ccgccgccgc cgccgccgac gaaccccccg tccgctcggg gccccatctg cacgtcgttg     95100
     taccatcccg cggcgtgcgc cgtctccggg gcgatcagcg cgtggattcc gagcggcacc     95160
     acgagggctc cgatcgcctg cccgtacgtc cgtcttgtac ggttgttgct tcccgcgcgg     95220
     gcgtcacgcg atgggttatc ctcgcgcggc gggtagaggg cggccttggg gagggtgacc     95280
     gcccgtcgac gacgcgcggg tgacgagctc ggcgcgggcg cgaggcgcgc cggggcgggc     95340
     gaggcgatcg cgggcatccc tccacgccgg agtccgaatg acgcggccga tcggctcctc     95400
     cgcaggcgac gtcgtctctc tgtcaaagct cgacttctac aagtacaact actctaacta     95460
     ctacaacgac ttgtagaaat gccccgagtc aaatcaaacg cgctgactcg tcggcacttc     95520
     ggtgggcgcg ggggaggatg ccgacggttt cggagcccga cctcgacgag ctgcgcgcca     95580
     gcgtcgccga gatggaggga cgggcgagcg aagaggagga ggacgcgtcg aagcagggga     95640
     cgaagcggaa tagggcccct cacacaaagg ggccatgcga gcacggagtg aagccccggt     95700
     cgcagtgcaa ggtgtgcagc gcttgtccgc acgggaagca gcgctctaag tgcaaggagt     95760
     gcggtggggg ctcaatctgc gagcacggtc gtcagcgcca taggtgcaag gagtgtggag     95820
     gttctggaat ctgcgagcac ggtcgtcagc gccataggtg caaggagtgc ggtggggctg     95880
     gaatctgcga gcacggtcgt cagcgctctt attgcaagga gtgcggtggg tctggaatct     95940
     gcgagcacgg tcgtcggcgc tctgggtgca aggagtgcgg tgggtctcaa atctgcgagc     96000
     acgatcgtgt acgctctaca tgcaaggagt gcggtgggtc tcaaatctgc gagcacggtc     96060
     gtcagcgctc taagtgcaag gagtgcgttg aatctcgaat atgcaagcac ggtcgacagc     96120
     gctctacgtg caaggagtgc ggtgggtctc aaatttgcga gcatggtcgt cggcgctctc     96180
     agtgcaagga gtgcggtggg gggggaatct gcgcgcacgg tcgtcggcgc tctcagtgca     96240
     aggagtgcgg tgaatctcaa atctgcgagc acggtcgtca gcgctattgg tgcaaggagt     96300
     gcggcgggcg gggaatctgc gagcacggcc aggagctctt taagtgcagc aactgcgaag     96360
     ggggtggact ctgtgagcac ggtcgtcggc tctccgtgtg cgaggagtgc ggcgggggct     96420
     ctacgtaggt gggcggtttg ctcttctgga ccagtttggg acccaagaat ggtgggcaac     96480
     ggacaaccaa aaatctcacg cccccgtcgt cgacgtcgtc gccgttccaa acgcgcgcga     96540
     cgcgcactga aacacgcacc tccaaacgcg tcacagcctt cccctcgtcc gcacgtccgc     96600
     gttcaacctc gcgtccctct ccagctcgta ctccctcagc tcggcgcgct tgaggaaatc     96660
     ctgctcctcg aggtacgtct tgcccctctt gtgtttctcc agatcctcct ccatctcggc     96720
     gtcgccctct ttgacgtcct tccagtccat cttgctcttg tccaggacgt tgagcttcct     96780
     cgtcttctcc atctgcagca ggacgccgtc gaggccgccg gatttggccg cggcgtcgcg     96840
     cttcgccgcc tgcttggctt ccttggagcc ctccgcgtac gttttggtca cctccatctc     96900
     tttgcccgcg aagttgcgcg tctccttgac ggtcatgacg ccgtcggtgc gctccacggc     96960
     ccgcatgcgg acgccgccgc cagccttcgc gagggcctcc ttgacggcct ccgcggaaac     97020
     cttcgcgcgc gcgggtctgt tcgcgtcgcc gtcgaggccg agagccttgc gccagtcgga     97080
     gtcgttgggc gccttcttgc gcgacgatcc gcgatcgccc ccctttgtcg ctcccttctt     97140
     cgccacgccg ccgccggcga cgcggttgag gcgcgcgagg acgcccagcg cggccttgcc     97200
     cttactcggt cccgcggcgc cgtcgccgtc gccgtcgttc gcgggcgcgg cggctttctt     97260
     gccgccgcgc ccccgcgcct tcgccgcggc gggcgccctc gccgacgcat cgggggcccc     97320
     tccgccgccg ttgagcttcg cccacagcgc gtccacctcc gcgcgcctct tggccgacat     97380
     gtccgtggcg tcgtcagcct ccgcgtcggt cctgtccccg gcgcccatgg tgggtcggat     97440
     gtgcgaaccg atcgggtgcc ccggtgttgt gccggtcggg gcgacctgaa tgacgatgat     97500
     tacttgtatg cggtgacgag gaaacttggt tcgggttcga aatgtctcgc cgggcacttc     97560
     ggtggacgcg ggggtggatg ccgtcgatct ggcggccgaa cgttgggagg gtgctcccgg     97620
     atgtggacgt caagatcgag gtgacggagg tggacgcgtc gaacaagggg acgaagcgga     97680
     agagagcccc tcccacaaag gggccgtgcg agcacggggt gaagcagagg tcgaaatgca     97740
     aggtgtgcag cgcttgtccg cacgggaaga ggcccagtgt gtgcaaggag tgcggtgggg     97800
     gctcaatctg cgagcacggt cgtcggcgca cacagtgcaa ggagtgcggt gggtctggaa     97860
     tctgcgagca cggttgtcag cgccctcggt gcaaggagtg cggtgggggc tcaatctgcg     97920
     agcacggtcg tcaccgctat agctgcaagg agtgcggtgg gggtgcattc tgcgagcacg     97980
     gtcgtcagcg cagatactgc aaggagtgcg gtgggtctca aatctgcgag cacggtcgtg     98040
     agcggcctgt gtgcaaggag tgcggtgggt ctcaaatctg cgagcacggt cgtgtacgct     98100
     ctacatgcaa ggagtgcggt gggggctcaa tctgcgagca cggtcgtcag cgcaaacagt     98160
     gcaaggagtg cggtgggtct caaatctgcg agcacggtcg tcgtcgctct cagtgcaagg     98220
     agtgtggcgg gtctcaaatc tgcgtgcacg ctcgtgagcg ctctaagtgc aaggagtgcg     98280
     gtgggtctca aatctgcgag cacggtcgtg tacgctctac atgcaaggag tgcggtgggt     98340
     ctcaaatatg tgggcacggt cgtcgacgct ctatgtgcaa ggagtgcaaa aagatgtgat     98400
     tcatcgtccg tgtagactaa gcaagcgaca gcctcgggtt ccgtctcaga tgagcccctg     98460
     tcggcgaaga tcttcgtacg tcttcttgtt gtacacgttg ccgtcggcat cctcgcactc     98520
     ctcgtccgtc tcgcgcttcc actggccaac cttgcgcgcg tccagcgcct tttgcagcgc     98580
     gagcgcatcc gcaatcgtcg tcacctgcgc gaaaggagcg ggcgggcgac gggatgattc     98640
     gaatcgaaag tcagtcgaaa gtcagtcgcg cgtcgactct gggctcgaaa aaccaaaacc     98700
     aaaaaaaaag tttggcgcgg tttgagtgcg gcggcgggca aacgcggcgg tcgatcgccg     98760
     gcgggtcagg ttgcgggttt tctaggccct aatgcgtgtg cttcacggga atcagtgccc     98820
     agtgcagtgt gtccatcaac cccgtcacga agatgctcga gcgccgcgtc gccaaaaagc     98880
     cgccgagcca aaaaaccaaa aaaaccaaaa atcgccaaac gaacaaggaa aacgtgcgca     98940
     cctcggcgaa agccttcgtg ttgggtatgt tcaggcaccg catcccgtgc tgatgcctga     99000
     actccttgaa gtggcgctcg tacgcccgtc gtccccagta ggagtagttg ccgcagatct     99060
     cgcacgtgaa ctcgaggttc aggccgtgca gcttgtacag ccagtacggg atcggtttcc     99120
     cgtcccaacc catcggcagc ttgagtgggt tgtaaatctc ctcctcctcg tcctccgctt     99180
     cctcctccac ccagtcgtcg tcctcctcag cctccgcctc cagctccgcc aaggacagcg     99240
     tcgccttctt ctcgacgttt cctttcgtcg cctccagctg ctgccgtaaa tgctccagaa     99300
     gcgtttgcgc cagactttcc gccctggcga cgcccttggc gcgttcctcc ttcttcttcg     99360
     cgtccgcgtc gtcggcgccc gtcaccgcgc ccttggcgaa gagcttcttg tcaatctccc     99420
     ctacggactt gccccgcgtg ctccacagcc ggtcgcgcct ctgtgtcggg gttccgccct     99480
     gcttcagacc catggacgcg agcgcctcct tgatcttatc catccccacc gccgtctcca     99540
     tctcaaccgc cgagtcgaaa gcttcgaggt cgacgacgtt ggacttcacc gcgaccaaac     99600
     ccttgtcttc ccaccccggt atcgacccgg acgcccatcg cgtctcgaac tcctcctccg     99660
     ccttgcgcgt cacggtgtcc aggaagacga ggggcttgac ccgcgcgtgg aagccccgta     99720
     agtacccgac gagaccggag aggtactcct cgtacgcttt cgtgaatttc ttttctcgcg     99780
     ggatggggtc gaaatcgccg acgacggaga ggtacgcgat gtactcgcag tctttggacc     99840
     cgaacgaagc gttctggaac gcgcgatggt gcgcgtgcag gtccaggtac cgcccgctcg     99900
     cctcttcgcc gctaaactcc ggcggtttac cgtcgcggta ctgtcgcaga aactcatcgg     99960
     agagcggggc gtggtagccc gcgaattgct tgtggtaatc gcgcgtctcc ttgaggcgat    100020
     cgtagaaggc ggagaagacg ttggagccgc cgccgagggc ttcgatctcc tccttgcgca    100080
     cgccgtcggc gtcctcgtac acggcccgct gtcgcgtcgt cggggatgag ggggggggta    100140
     aggggtcagc gggcgagatc acgcgcacgt gcccgggtcg gcgccgatgg gtcggtcgga    100200
     tctgttcggt ccgtcgccgt gggtcagggg gcggagacgc gagacgcgcg cggagggcgc    100260
     gcgcgacgtc gcggcgtcgc gatcggggtt tcgccgcggg gattcgtctg ggaggtgcgc    100320
     accagccgct tggacttgtt cgccatgtcg tcgagcatcg atcggaccct gtgattctgc    100380
     gccaggcgct ccttgtgcgt caccgcctcg ttcctgaagt cggcgcatat cgcgcgctcc    100440
     aaccgctcga tctcctcgtg ggactcgcgc gtgcgctcga gcagcgtgga cgccatggca    100500
     cgcgcgcggg tttaagctgc ggtccgcggg ggggcgagtg cgccgcgctg gggccaatga    100560
     cctagaataa tgtgcggccg cctcactgcg tgcagtctgc tcaaggagcc aagaggcttc    100620
     tttctgttgc gcgagattcc accgtcacaa ctcgtcggca cttcggttgg cgcgcggggg    100680
     aggatgacga cggtttggga gcccgacctc gacgagctgc tcgccatcgt cgccgagacg    100740
     gagggatgtg cgagcgaaga ggaggaggac gcgtcgaaca aggggacgaa gcggaagaga    100800
     gcccctccca cgaaggggcc atgcgagcac ggggtgaagc cccggtcgca gtgcaaggtg    100860
     tgcagcgctt gtccgcacgg gaagcggcgc agacattgca aggagtgcgg tgggtctcaa    100920
     atctgcgagc acggtcgtgt acgctctcag tgcaaggagt gcggtggtgc atcaatctgc    100980
     gagcacggtc gtcagcgcca taggtgcaag gagtgcggcg gtgctggaat ctgcgagcac    101040
     ggtcgtcagc gctctgtatg caaggagtgc ggtgggtcct caatctgcga gcacggtcgt    101100
     atacgctcta cgtgcaagga gtgcggtggg tctcaaatct gcgagcacgg tcgtcagcgc    101160
     cataggtgca aggagtgcgg tggtggtgga atctgcgagc acggtcgtca gcgctctgta    101220
     tgcaaggagt gcggtgggtc tcaaatctgc gagcacggtc gtgtgcgctc tacgtgcaag    101280
     gagtgcggtg gggctggaat ctgcgagcac ggtcgtcagc gccataggtg caaggagtgc    101340
     ggcggggcct caatctgcga gcacggtcgt cagcgtcgtt actgcaagga gtgcggtggg    101400
     tctggaatct gcgtgcacgg tcgtcagcgc catagctgca aggagtgcgg tggtggtgga    101460
     atctgcgagc acgatcgtca gcgccatagg tgcaaggagt gcggtgggtc tcaaatctgc    101520
     gagcacggtc gtgtgcgctc tacgtgcaag gagtgcggtg ggggctcaat ctgcgagcac    101580
     ggtcgtcggc gctctgggtg caaggagtgc ggtggtggtg gaatctgcga gcacggtcgt    101640
     caacgctctc ggtgcaagga gtgcggtggg ggctcaatct gcgagcacgg tcgtcggcgc    101700
     tgtgagtgca aggagtgcgg cgggtctcaa atctgcgagc acggtcgtcg gcgctctcag    101760
     tgcaaggagt gcggtggtgc atcaatctgc gagcacggtc gtcaccgcca tcaatgcaag    101820
     gagtgtcgcg cggcgaaggc caaacagagt cggtagcatc tcaatcaaac gcagatctgt    101880
     tcgcttcgcc tcaccgcacc gccgcggacc tcggcctacc cccgcccccg ccccccgcgc    101940
     ggagcatcgc ctggctcctc ctgaacgcgg cgagctccgc cgccgccgtc ctcgccgcga    102000
     cgtcgacctc cctctctgga aacttggaaa ggtccggagc cgttccggcg actttcgagc    102060
     cctcgtcgcc gtccccgtcc cgcggcggcg ggaacattcg agacgtgacg tcgcgccacg    102120
     cccgcagggg ctcaccaccc ccctcggcac ccttcgggac gccgatggaa gacagcctgt    102180
     cgccgccgac gggacacgtc accggccgga ggtgatcgag cctggcggcg atcctccccg    102240
     gaaactttcg atccgcgccc gcgaacatca ggtggttgag gtacgcgcga aactggttaa    102300
     actgcgatcg catctcgccg gggtattcgt ccgcgtcgtc tgcgtcgttc agagacgaac    102360
     ggtccgcgcg cgagtcaccg tccgccgcgc cgaaacctcc caggaagaac aggccggcgg    102420
     cgtttgcgtg cgccaaaaac ctgagtgctc ggaccaacac cttcatgcgc tccgggtccg    102480
     ttcgccgcca cgcgtcgtgc ttcgtcgcca cgatgagcac cgtcacgccg gagtgccgca    102540
     cgagcggcga gtgcgcgtcc tcgtgcgcgc cgccggccgc gccgcctccg ccgccgccag    102600
     ccgcgaagac cctctcgctt ctacgaacga gctgctccgg cagcctgctc cccctcgcgg    102660
     ctaacttctc gaacgtcttg gcgcaccgcg cgtgaacgcg gccgagccag tactccgccg    102720
     tgcgcatcgc ctcgtggggt ttggcgaggt cgacgcagat ggcgacgacc gcggtggtga    102780
     cgtgtcgggg accgagaaac acgttgtcct gctcggtgac ttcgtcggcg aagtgtcgcg    102840
     agcccgcgat ctcccacacg tgcgcgacgt ccttgcggtc gacgccgccg ccgccgccgc    102900
     ccgccccgct cgaggccctg cgcgcgtagt tgtactccat cccctcggtg ggtttcggga    102960
     cctcggtctt gtccgggtag agcaggcggt tgaccagcgt ggtcttgccg catccgcgcg    103020
     atcccaccac gaagagcacg ccgtcgggcc tgcccgagtc cccgcgttgc ttcgcgacgg    103080
     acttgttgtg gtcgatgacg tcggtccaca cgttcttctg cccggcgtcg aacggcgtgg    103140
     acggcgcgcg ggaggcggag gaggaggcgg acctcgccga cgggggcctg ggcacctgcg    103200
     acgacgacat gatgaatgac tttttttttg aaacttgaaa cgcccggcgc gggggatggg    103260
     gtgaggccag tcgcagccgc cgcgcgagct atcggtcgtc cgggtccgct tcgatgcgtc    103320
     gcgagattgt ccggagaggc gctcgctcgt cccgtcgcgc gcgcggttgc gatgccaccg    103380
     cggcgcgggt cgatctgacg aatgtgccaa acgagatttg actttccatc atccgcccgt    103440
     tgcgtgttga caacgtctcg tccgatggtt gtctcgcctc gcataacgag tagcgcgcgc    103500
     gcacgcgagg aggagggcgt cgatcggacc ctcgcgcccc ccgcgtcgat agacacacgg    103560
     gtaggctggc gtccacgtcg cagctgcacg gccgaggccg aggccgaggg tcgccgcaaa    103620
     ccggaggcgc catggcgagc agcctgccct cccccacggg gcgcggaggc gcggtcgtga    103680
     tcgcgtccga gggtggttct tcgtcgtccg gcgtcggcgg cggcggcagg cgaggcacgc    103740
     ccgatcgcgg cggcgcgcac ggcggatcgc tgaaccactc gtcgcacgcg ctgacgcaga    103800
     cggtccagaa gaggcggagc gcgatgacga ggtgcatgac catcttcgcg gcgtccctca    103860
     tcgtgttcga gctgctcagg cacctggtgt tcgtcggggg taaattctgc ggcgagctcc    103920
     cgcgcggggc gcccgtcgcc gtgctcctcg cgggaagcgc gcacgcgttc aaccggacgc    103980
     actgcggcct cgccaaccgc gttatcgcgc cgttcaccag gctcgggcac cccgtcgtcg    104040
     tcttcgccgc ggacgagaac ggcgacgacg acgccatggt ccccgcgctc gagcgcatcc    104100
     ggaaagatta cccgaacgtc gactttgtcg tcgcgccccc ggcggcggcg tcgcaaaaag    104160
     acctgcacga tcggtgcgtc gagagcgtgg aacgcaggtt caggcgcatg ggcgtcgggc    104220
     cgggcagcat ctacgccgag tcgcaccaga cccacgcggt ggcgcgcgcg agatgggaag    104280
     agagaaacct ggacgattcg cgtttggacg acgatggctc ggatcgatcg tcaacgtcgg    104340
     gtcgaggcgc gagaccgagg ctccccggcc gagacgcgcg cgccgacgag gacgacgccc    104400
     tcggcgcgca tcgcaggcgc atcgtgcact acatgcgcag gctcgcggcg cgtaagcgcg    104460
     cggacgacgc gcgcttacgg tgggagagcg gcgacggtag ttttaattcc ggggggaaaa    104520
     ccggttccgg cgtcggccag gggactggga cggggatgga tcgcggatcg ccgttcgcgt    104580
     ggatcgtggt cgcccggccc gacgtcgcgt tcgccgacga gatccccgcg gaccgcgcct    104640
     gcgtcccccc gggcggaagg agggtgcacg tcccgtggtt ccacagccgc ggcggcgcca    104700
     acgatcgatt cgcgatggct ccaccggagg gcgccgcgga gtacctcggc ctctacgact    104760
     ccctctgcga caaccacgcg ttggcggctg gggaggatta cgcgggaatg atcccgcgtg    104820
     gcgtggactc gtccgagaag gtgctgcgtt ggcacctgcg caggagacac gtcgcgacgg    104880
     atccgtggtt actgttcaat ttcgtgtttt atcgcgttcg aagcgaatcg aatttcgacg    104940
     actgggatcg atctcccgac accaggctcg ccgggtcgcc gttcaacccc agccgcgggc    105000
     ggtggtccga cgcgagcgcc gagctcgggc ggtgcccggc gatatacgag cggtccacgc    105060
     gggggcacag gaggagcgga ggcaagacga cgcaggaggg atcggagctg gcgagacgcg    105120
     ggggggacga acgcgaggtt ggaggttcga atcccgctcg gggcgcgggc gggcggaagg    105180
     gagggaggtt tgggtcggtc ggtggcaccg gctgggtcgg taagatcgtc gagcccggga    105240
     tggaggacgc tgacgcggac gccgacgcgg acgacgagcc gctcggaccg gaggacctcg    105300
     ggatgacggg cgccgcgaag ggcaagtcca aggctgggca ccacgtcacg tggctcatcg    105360
     cgagcacgag cacggaggcg cagacgctca tcccggagtg ggtgctgggt ttttgtctgg    105420
     tgtttttcgg gctggcgttt acgctcatcg catccgggat cgtcgcggag gggttccggc    105480
     actacagggc gttttacgca aacaggcgag aggaacgcga gcgaaagcgg ggcgacggcg    105540
     acgaggtatg aacgagcccg tggatggcac cgcgtagaac gcgcgtagac ggggacgaag    105600
     gggaacgagc gtgaatttaa acatcgtgat gaatagcgca taataaggtt aacacttact    105660
     tttaccttcg aaggtatttc gcacacaagg cagaggcgat ggcgtaggtc cgtcgaccct    105720
     ggagggcggc ggtcacagcg cgcgcctgcg ggcgagccgc gacgccaagg gactgctccc    105780
     ttcctgcctc cgcttccctc cgcgtcgcct gcgccggacc ctgcgaatca ccagcgcggc    105840
     gaacgcggcg aagagcgcga gcgccaccca cgcgagcccg gcgcctgcgg agcggtcggc    105900
     gtcccgggag tcaatcgacg gcgtcgcggg atcgaatccg tcgtggcgcg tacccacccg    105960
     cgacggcgtc ctcttcttcg cgtcgtcgaa gggcccggcg tcggcgtcgt aatcgtcgtc    106020
     gttcgggcgc gtgttggcgc gcggcgtcgt aaattggtgg tgcgacccgc cgtcggcgtc    106080
     ggagaacgaa tcgtcgtccc tcacgaccga cgccggactc gaaccctcga cgttaacgag    106140
     cgactcgcgg cgccgcagca ccgcgtccag ccgccgcttc gcctcgcgca tcgcgctctc    106200
     cgcgcgcgtc tcggaccatc cgatgaccgt cttggcgtcg gggtgaccgc cgctttgttc    106260
     aacgtcttcg cctgcgccgg aactttgcca aaactccggt ggcgagttgg gaccgcaccg    106320
     gttcaacccc tcgttccccg gcgttccccc cctggtggtg gacagcgcgt cgaagtcgac    106380
     gtccgtccgc cgcgtcggca actcttcgcc gttgtcgtac ggttcgggcg cgaggttctt    106440
     gtccgacgtg agcccggtgt ccaaagcgtt ctccgtcaaa aattccaaga cgttgcccat    106500
     aaacggaaaa cacggagcgg acgtgtgact gctgtccagg cagttggaat cgccgtatat    106560
     cgccaacctg cccgcgggtg aaccgaccga ggtgtcgtca tctgaaccgt cgtttggatg    106620
     cgaaccgtcg ccgccctgtt ccccgggaac ctgaaagaac gccgcgacga cgtgctcctt    106680
     gttcccgccg ccgccgctca ccgccgcctt tcccccgccc gccccggtcc cgcccttcgg    106740
     agccttgtcc gcgacgaacg ctttatgaac gaacgccccc gcgggtactc gcgcgatgtt    106800
     cgcccccgac gcgatcgcca ccgcctggcc gttcaacgtc gccgcgccgt gtaagatggc    106860
     gtcgccaaac gcgaaaccga agggtttcaa caagtcgttc aacgccggga cgttcgcgcc    106920
     gcccgtcacc ggcgtccagt gcgagtgcgt gttatcgtcg aagaaacgca tgctctccat    106980
     ctgcttgacg ttgtaccagt ccccgacgac gaagacgccc aggcctttgc gcaccacgtc    107040
     gtttcttaat ttcttaatct cttcatcgga gtactcctcc tcggcgtcga ccagcatcag    107100
     cgcgccgtac cggctggcgt cgaagcacgt caacggcgaa ccgagaatct cgagaaagta    107160
     acccttatcc cgcagcgcgt cgtacatggc gtggtagttg gtgtgcgggt ggtccccgtg    107220
     ccagtccagg atgtcgttct tggcgtcgag gttatcccgc ggcacgtacc cgggcgggta    107280
     tcgaacgctg tggtactggc tccacagcac tcttttcgcc ctcggcgggg ttggtacgac    107340
     ttggaacttg accgggacgc gcaccgtgga gcgacgcagc gtcgtctcgt ccggccctgg    107400
     cggggataac accgtgaacg ttatgacccc cgaggcgacg ccctcggatg tagacgcgga    107460
     cttcttcacc cgggcgtaaa aggcgaggta gccgctgtac ggccacagca cgtccgaaaa    107520
     ctcgaaacga acgtccaggt gcttcccgag gtcgtcggat cgatccccgt cgtcgccatc    107580
     gccgccgtcc cccccggtgg gggtccagac gggcgcggct tccaaccaac cggtcagtcc    107640
     catcccgttc accacggtgg cgttgaacat gaacggcatc gcgccgtggt acaacgcctg    107700
     cctgcagtgc ggccacatgt acggacacgc cgtgaagtcg agcctccccg gcaccaaact    107760
     cgcgcgcggt tcgtagtcgc gcagaatctc cctcgacgcg tgcaggttca gcttacccgc    107820
     gccctgctcg tagatcatcg ggccgccggc gatgacgtcc gcgccctcga cgagcgcctg    107880
     cttcatcacc ccgggattta agattttcca ccgcttctca accggcacga cggacgcgag    107940
     cagcgtaacc gcgcccgcca ccacgggcga cgccacggac gttccgctca ggctcctgca    108000
     cccgcccgcg atcttcgacc ccatgacgtc gcggccgtac gcgacgacgt cgggcttgac    108060
     gcggccgtag ccgtgcggga gctcgtgcgt ggacatgcct ctggacgaaa acgacgcgat    108120
     tttgtcgcgg tagtccacgc cgccgacgcc gatgacgtcg agctgatccg cggggttgtt    108180
     cagggtgccg tagagcgggc cgtcgttgcc gatggccgag accatgatga tgccgttggc    108240
     gacgatctcg tcgatcttct ccacgaacgg gaggtcgagg tagtccggac cgccgatgga    108300
     gaggttgatg acgttgacct cggtggcgat ggcgtagttg aacgcgtcga gaaaccagga    108360
     agtgtacgac acctggtcgt tggtgaacac ccgaaaggtg tgaatctccg cgtcgggggc    108420
     gaaacccggg cactcgccgt cctggctcgc caccaccccc gcgacgaacg tgccgtggcc    108480
     caagccgtcg ttcagcgttc gctcgtgcgt ccagttggtt cgctctttta ttttgcgaaa    108540
     gtggggatgg tccgcccgaa cgccggtgtc gaagacgccc gtcttgacgc ccttgccgct    108600
     gaatccctcg cgccacagcg cggcggcgtc gaacgcgtcg acgacgtgcc tcgccgcggc    108660
     gagggatcga ccgcccgcgt tcgcgcgtgg tttcgtgtcg ccatcgacct cgtcgcgttc    108720
     ttcgcgatcc ccctcgcgtg tcgaaccccc aaacgatggt tcgacgtcgt cgtggtacaa    108780
     gccgccggcg tcgagatctg gggcgtaccc cgggggttcc atgccgatcg tggggcgcgt    108840
     gcgtagcctg ccgggcgagg gcccgccgcc gccgccgtgc ctcgagacgt gggcaccctg    108900
     gtgcgcgccc gaacctcctc gtctctcgcg gcggcgtcgc tcggctcggt tcggcgcgcc    108960
     tcccacgtcc tctcccgcgt ctccccatcg aagcccgccc gcgacgggat ccacgccggg    109020
     tccgacgcgg gcacccgtgg gcaccccatc ggcacccgag tcggcacccg agtcggcacc    109080
     cgagtcggca cccgagtggg cacccgagtc ggcgcccccg tcgtcgttgt cgggcgcgtc    109140
     ggctcgttcc cacgcgagcg accggagaag tcgctgctcc cttcgcacgt cccgcacccc    109200
     gtcgacggcg ccgacgacga ggagcgcctc ggcgcgtgcg tcgtccgtcg agggtgccgt    109260
     cgggggtgcc gtctggggtg ccttcgtcgt cggcgcgatc gtgacgggcg ccatgaactc    109320
     atcatcatcg gcgtcgacgg cgatgacggc gaaatcggtg ggaaacttgc gcgtcgcggg    109380
     gttgtctcgg accacccact gccacctgac cgaacgctcg cttcgcggcg cgtcgtcgtc    109440
     acgtgggatc cgtacgaacc ctcggtcaac gcggtgctcg atcctcgtcg cgctctcccc    109500
     ggcgtgtgtc ggggcgtcgt cggtcgacgg cttgcccatg gcgccctctt cggcgttcaa    109560
     cggcgggccg agcgcggcga cgagcgcgtc gtaatgcgcc tcgatggggc ggtaatcgtc    109620
     gaagcggacg acgtagcgat cgcgaaggaa ctccgcggtg gtgctgaccc cggtcaggcg    109680
     gccatcgccc gcgtcagtcg cgccggcgtc cgtcgcgtcg cagctcatca cggggcggtc    109740
     ggtgccgtcg atcggtgcgt cgcagcggtc gcgttgggtc ggatcagcga ccgcggcgac    109800
     gcaccgcgcg cacgcgagga gcgcgaacgc gaggccgaag ccgacgcgtg cgcatcgcgc    109860
     cgtgtgtcgt cgaaccgcga tcgcgccgcg cggggaagtc gagccgcgtc gtcccgcgcc    109920
     ccgcggcacc gtcatagcga aatgggatca cttaatcaat caatcgtgcg gtcgtctcgg    109980
     agaccgcacc gctccccgcg ggtcgcctcg atccgcgcgc tggttccgcc gctgggacga    110040
     gtttatggtt agcggacggc gaaatgtaga gatgtcacca cggctgcgta cgtcgcgttt    110100
     cccgaagtag ccgaaggatt cgaaatcgac ggcgcgaatc gaacctcgcg gctgtgggga    110160
     cattcagaat ctgtattccc cgagaaatag acccggctgg gtgtttgccc actgagaggc    110220
     tgtaacgaat ggctcgcgtc ggttaaaaca gaggagacga cgggagctgc tcctgtgagc    110280
     cacccacgtc ggtcgggacg gtccactcct cgcgccgccg gtgccgccgc ccgacgcgcg    110340
     tcgagcccga gtccatccga ccctcccctc gcgtcgtcgt cacgggaatc caggtacgcg    110400
     ccgccccgct tccggtcgcg cccgatgaac tcgcgcgcgc gtcgcgtcat cgccgcggcg    110460
     ttcaacaaga cgacgccgcg ggaacatacg ccgtgcgcca gtgcgaacac gtgatttcac    110520
     gatcgatcga cgcgatgcgt ctccgccgac ctctcgatcg tcccttctcg tgaccgcgcg    110580
     cgacgccgcg gcgcccccgc gcgcgactcg cgtccatcgc gtccgcgtct ccgcgctcat    110640
     tcgcgcgtcc ctcctccgtc cgaccccacg acgcctctga cccgtacccc ccgcgatcaa    110700
     aacgaaaaac aggattcgtc ccaacggaga gtttaggcga ccgttccgcc cgcccgacct    110760
     cccctgaatc ccgccatgcc agccgtcgcg cgctccgcgg caaagcccgc caaggcatcc    110820
     gccgccgccg ccggcgcgac gatgaacccg aagcgcaccg cgcacatgaa cgcgcccgcg    110880
     atgaagtccg acggctactc cgccgaggac gtcgcgcgtc actgcgccaa ggatgacgcg    110940
     tgggtcatcg tcggcgacgg cgtgtacgac atcacggagt ggatcccgcg tcaccccggc    111000
     gggtccatcc cgctggtgca gtacgcggga agggacatga cggacgcctt ccgcgcgtac    111060
     cactcgccaa ccggcaaggc ggcgaagact ctcaacgcgt acaggatcgg agagtacgtc    111120
     gggcgcgccg gctcgagggc gtccgattcg gagtgcgagt cccccaagga ccacctcgcg    111180
     accgcgtcgg gggattccgt cgggtccgcg gcatcctccg acgccgccgc gccgccccac    111240
     gtcgccgcgt tccgcgccct cgtcgccgga ctcgagggtg agtttcgcac ggattaccgc    111300
     cactacttta aactcttcgc gtgcctcacc gcgctcttcg ccactgccgt gtggtgcgtg    111360
     gtgggcgcgg ggcacggcgt ttggacgcac atgctcggcg ccgtgctgct gggcatgttc    111420
     tggcagcaga cgatgttcat cgggcacgac gccgggcacg gcgccatcac gcacaatcac    111480
     gccaaggatt ttttcatcgg gctgatcgtc ggtaacctgt gcaacggcgt cggcatcacg    111540
     tggtggacga cgacgcacaa cgtgcaccac tgcgcgtgca actcgcttga gtgcgacccg    111600
     gacattcagc acatgcccgt gctcgcggtg acgccaaagt acttcgacag cgtgtggtcc    111660
     ttgtaccatc agaggcgcat gacgtttgac cgagcggcga ggtttttggt gtcggtgcag    111720
     cactactcct tctaccccat catggccgtc gcgcggttca acctgtacgc gcagagtctc    111780
     atcctcctgt tgacgagcaa ggagatcaag aacaagaggc gcgcgctgga gatttgcgtc    111840
     atgggcctct atttcacctg gctcggcgct ctggtgtctg cgctgccggc gaacgagcga    111900
     ctcggttttc tcctcctctc ccacgccgtc ggcggcatca tccacgtgca gatctgcctt    111960
     tcgcacttca gccgcaagat cttcgacggc aggccggaga acgacaagtg ggtgacgatg    112020
     cagctggacg ggacgatgga catcgactgc ccgccgtggc tcgactggtt ccacgggggg    112080
     ctccagtttc aaacggagca tcacctggtg ccgaggatgc cgcggcacaa gctcaggcgc    112140
     ttccgcgaag aggtggtgaa gccgttttgc gacgagcacg gcctgaagca cgactgcccg    112200
     agcttctggg aggccaacgt ggaggtttgg aggacgctca aggcgagcgc caaggctgcg    112260
     aaactgtcac ccgcgttcgt gcacgccgtc aacctcgagg gttgatgcgc gtcgcctcgg    112320
     catgtttctt attttcggtt atttcgccgt gttctgtttg ataccttatt tgcttttgct    112380
     cgcgcacatg acggtgtgag gggggacgcg cgcgcgcggg cggccccctt tgcgcgattc    112440
     tgactcattc tttccggcgc gccgccgccg aggtttactg ttctttgtat caccaccgac    112500
     gagttgcagt ttcaaataac aaatcgaatt tctcagagtt attcaatgtt accttcgtac    112560
     atcgatcgac taaccccgcg ccgcgtccac cagcctctcc cgccccagcg tcacccgaac    112620
     caacttgccc gtggccacgt cgtaccgccg cgacgccacc gcgcgttcga acgcgccggc    112680
     gcctgtgccc gccctcggat cgtacccgca ctcgacgacg atcgtacccg cattcggagc    112740
     ggaggggtcg gcgccgcagt acgcccacgc acccccggga aggcggagga gctggccgac    112800
     gccgttcgcc gcggggtttc ccgccaccgc gacggcaccc ccgacggcac cctcggcacc    112860
     cccgacggca ccctccttcg cgaaggcgcc ctcctcgact cgaaacgtcg acccgccgtc    112920
     cttcgcgtcc gggcccggat cgacgacggg ccactcaagg cgccacgtgg caaccgacgt    112980
     ggcatcagac gtggcaccga cccacgcctt gccgttcggc gcgatcgtgt ccacccgggg    113040
     ctcgccgctg aacccgcgcg ggcacgactt ggcgcggtgc tccacccaca cgtcgcacga    113100
     gatcattcga tgttcgcgca cagctgtgtc caacgcgacg cgctgaacga ttcggacccg    113160
     tcggttcggg tcgctcgggt ccgccagaca ctggtgcacg accgtgacgc agccgtgcgc    113220
     gtcgtcgtcg tttcccgcgc acggctgcgt cgggagcgtc ctggcgcccg ccgagaatga    113280
     gccgtccggt aagatcgtct tatcttcgcc cgcgcctcgc aagatgcgaa gggtctcgtc    113340
     cgcgatcagg agctcggcgc cgtcgttcca ctccgcggcg ccgcacgagc tgatggcgtc    113400
     ctcgttgcca atctccggca tcgcgcgcga cgcgtcgatg cgcacgccgt cgtccgtgga    113460
     cacgcactcg caccgcgtga cccagtcgaa atcttcatcc gcgaagggca tgtttgcgcg    113520
     gggcacgcgc ccgacgccgt gcacgtaccg tatcgggatg tcgcgcgcga cgccgcgcgc    113580
     gtcgaactcg acggatcgcc cgcgccaccc gccggcgaag gcgagggtga actcgcgcca    113640
     tcgcggcgtg ccgtgagcgg tggacgccac agacgacgac ggggcgtcgt tgtcggcatc    113700
     ctgagggacg gtgcccacgg tgccgccctc cgcggaggcg gcggcgccgc ggccgggagg    113760
     cggcgcgcgg aggcgcgagg tggaggcggc gccgcggtcg cggcggcgcg cggggagggg    113820
     cgcgcggcgc gcggtcgccg cgagcgtcgg ggcgacggcg cgcatggagg ctgccgcgga    113880
     agcgcgtgct ctggttcagt cggcctcggc tgcaaactct gctgccaggc tggacagccc    113940
     aagtcgagcg cagctttgaa aatctcactt ccgggcgcgg gcgctccgag gggcgcgcgg    114000
     gggaggatga cgacggtttg ggagcccgac ctcgacgagc tgctcgccat cgtcgccgag    114060
     acggagggac gggcgagcga agaggaggag gacgcgtcga acaaggggac gaagcggaag    114120
     agggcccctt acacgaaggg gccgtgcgag cacggcgtga agtatcggtc gaaatgcaag    114180
     gtgtgcagcg cttgtccgca cggtcgtgag cgcagatact gcaaggattg cggtgggtct    114240
     aaaatctgcg agcacggtcg tcagcgcgat tattgcaagg agtgcggtgg gggtgcaatc    114300
     tgcgagcacg gtcgtgagcg ccacaggtgc aaggagtgcg gtgggtctgg aatctgcgag    114360
     cacggtcgtc ggcgctctcg gtgcaaggag tgcggtgggt ctggaatctg cgagcacggt    114420
     cgtgtacgct ctcggtgcaa ggagtgcggt gggggctcaa tctgcgagca cggtcgtgag    114480
     cgctctcgat gcaaggagtg tagtgggtct ggagtctgcg agcacggccg tgagcgctct    114540
     aagtgcaagg agtgcggtgg tgcatcaatc tgcgagcacg gtcgtcagcg ctctcactgc    114600
     aaggagtgcg gtgggggctc aacctgcgag cacggtcgtg agcgcagata ctgcaaggag    114660
     tgcggtgggt ctggaatctg cgagcacggt cgtatacgct ctcagtgcaa ggagtgcggt    114720
     gggtctggaa tctgcgagca cggtcgtcgg cgctctgatt gcaaggagtg cggtgggtct    114780
     caaatctgcg agcacggtcg tatacgctct acatgcaagg agtgtggtgg gtctcaaatc    114840
     tgcgagcacg gtcgtcagcg ctcttactgc aaggaatgcg gtgggggctc aatctgcgag    114900
     cacggtcgtc gccgctctag gtgcaaggag tgcggtgggt ctcaaatctg cgagcacggc    114960
     cgtgagcgct ctaagtgcaa ggagtgcggt ggtgcatcaa tctgcgagca cggtcgtcag    115020
     cgctctcagt gcaaagagtg cggtgggtct ggagtctgcg agcacggtcg tcagcgtacc    115080
     agatgcaagg agtgcggtgg ggcctcaatc tgcgagcacg gtcgtgtgcg gtctcagtgt    115140
     aaggagtgcg gtggtggtgg aatctgcgag cacggtcgtc agcgctccaa atgcaaggag    115200
     tgtcgcgcgg caaaggctgg aacgcactcg tagactagta gctcgtggat cctccgtcac    115260
     ggttcaaccc gtcccgccct tcccccccct tcccccaccc cctcggcggc cgcagctcgt    115320
     gcacgcgcat ctcccgcctg tccaaacccc tcacgtcctc gaacagcccg gtcgctccga    115380
     tcgcgcgaaa cacctccgcg gtcacgtccc gcggctcgaa cccacgctcg gcggcgacgc    115440
     gttcgaacag cgccagcgtc tccggctgcc gaagcgtcgt gacgaaaatc gcgctcgggc    115500
     gactcatcgc gtcctcgtgc cacggccggg gtgcccactc tccgtccccg gggattgtcc    115560
     ccgggggtgc cgactctccg tccccgtccc gatccccgag gatgcgctcg cacgcgttca    115620
     gcagcggcgt cacgttgagc ggatcgtaca acacgtcgga cgcgacgacg aggtcgactc    115680
     taggtcgaga cccgcctcct ccgaagtaat cgccggcttc caaatcttcc cagttgagcc    115740
     tcgcggtacg cacggaacag gcgcgaacgt cgtcgtcgtc gtcgtttgac agctcgttcg    115800
     actcgtcgtc gttcgattcg tcgttggatt cgtatcgttc gactcgaacg tcgtttgcgg    115860
     cgaggtttct ctcgaggttc gcgagcgctc cggcgtcggc gtcggtgagg accagccgac    115920
     tgggcgcccc gactgggccc gacccaccgc gcaccccgca tgccgctccc cccctcgcca    115980
     tcaccgtcgc ggcgaccccg catccggacc cgagctccac cacgcgcctg tgttcgaaca    116040
     gcttcggatg cgtcagcgcg agctcggcga ggtatattgc cgcgtgccac tcgtggcatc    116100
     ccgtcccacc ctcgaacagg ttccggtgca tccggaacga gaccgagggc gcgtcgcgaa    116160
     tgtcgtcgtc gtcgtcgtcg tcgtcgtcgt taacgttaac attaacgtta acgtcgtcgc    116220
     gatcgggccg ccgctcggcg tcggacgtcg gatgcctgta cacgtacgtc ttgtggcacc    116280
     accccgcctc ctcgtccgcg ccgtcgcatc gggtgaatgt tcgcgtcacc aggtcgccga    116340
     cgcgatcgga gagctcgcgc cccgagcgct ccgcctcgag cgtcgcgagc ttcagcagcc    116400
     gggcgacgta ttccctgtcc ggcgggtgcg acgtcgcgat ggggtgggtg acgcatcgat    116460
     gcagcgcgtc ctgcgcggcg tcgccgaacg gggatgggga ggttgactcg gcacctccgt    116520
     ccgtctcggc gcccccgtcc tcgcagcggc gacacgcgtc gatgacctcg gcggcgggcg    116580
     ccatctgcag gtaggcgacg agcgccgcgc ggcgacgcgc cctacctctc ggcgacgacc    116640
     ccatcccgtc gccgttggga tcccatcgac gtgcctcacg cactgacgcc gccggcggtc    116700
     gcgacttcca agacgaaacc ttcgtttaac ccgcccgtct cttcgaatgc gatcattcta    116760
     gggattggca ccgctggtca tcacaggagg gcagaacatg ggccggaaga agaggcgcgc    116820
     ggagctgccg tggtgtttct actgcgaccg cgagttcgac gacgagaaga tcctgcagca    116880
     acaccagcgc gccaagcact tcaagtgcac gcacgaccgc tgcaacaagc gactgatgac    116940
     cgcgccgggc atggccatcc acatgctcac ggtgcacaag atcaaggtgg agaaggtgcc    117000
     gaacgccatc gaaggccgcg ataaccccga gtggctcatc gagggcatga acggcatccc    117060
     ggaggggttc gatttcgaga ataacagggc gctcgtggac ccaaaagcgg agaacgtcgt    117120
     cgtcaccggg aagcgcccaa atctgggcga acacgcgccc ccgggagcga tcggaggctg    117180
     gggcgccccg ccggcggtcg ggatggggat gcggccgatg atgcgaccgc cgggcgcgat    117240
     gggcatgccg ggcatgcccc cgccggggtt ccctccgccg atgatgccgc cgccgcccta    117300
     cgggatgatg ccggggatgc cggggatgat gccgccgccg gggatgatgc cggggtcgat    117360
     gccggggatg atgcccccgc cgggagtggc gcccgcgccc caaccccaac ccgtcgcgcc    117420
     gcgacccgag caggcgccca tcacggagac ggtcatggtc tgggacgacg agtccgaatc    117480
     catcgaggaa aagcgggcgt cgctgtccaa gtattccggc gtcgaaggga gagccgcggc    117540
     ggatggcgag ggagaaacga aggatccgtc cgcggagggc gaggaggacg gcggcgacgc    117600
     gcggtgaaga gacgcgcggg gatagagaga gagagagaga ggaacacggg gtttaaagag    117660
     acgaagatgg gattcgaacc cgggacgtcc acgcccccac cgactcgatc agagctcgtc    117720
     cgagtcgagg tcgacgattt tcggcgccga ccgcctcgaa gccggcgcgc cagctgtgcc    117780
     gccccccgcc gctttaaccg cctttgcgtc gccgctcacg tccaccacgc tccccccgaa    117840
     cacgctcgcg cccaccttcg gcatcctcgc gccgccgccg ccgccgccgc cgccccaccc    117900
     gcccacgccg ccgaggtttc ccgaagccgg ccccgcgacg attgcgccgt ccagcctgtc    117960
     gagtcgcttg gacagactcg tcatcgccga accgttggcg tacaccgcga cgagcagaaa    118020
     cccgaagacg acgaccgccg cggtgaagtg cagcgccgcg gtgagcatgc cgaggtagtt    118080
     caccgcgtcc tccagctgcg ggggttgttc ggactcttcg aaggtgttcc ccggtgtggt    118140
     attcgccgac gatcggggcg ggtgaaactc gaaggctccg gtggcgaagt cgtaatcgtc    118200
     ccttcggtac gacccgcgca aaccgccagc cgcggaggag agccggacgc gcggcgtgcg    118260
     gtcgcgcacg ccaaactccc gcgcgcgcgt cgcgcccatg gacggcgacg gcggcgccga    118320
     tctgcccccg cgcggcatcg aaccaacgag ggaagaacgg cgaaacgaat cctcacccgc    118380
     cactccgtcg taacccccgc cgcgatcgaa ccccccgtac atacccgcgt ggctgcggct    118440
     gacgaaccct cgggacgacc gcgcggaccc gcgcgagctc gacctcgacc cgggctgcga    118500
     gtacccgccc acgccggcgt acccgccgtc accaaacgga cggacgtcgt cgtgggaact    118560
     ccggtaggac ccgtatcgca ccgggggcgg accccttagg gtatgggtcg acctcggata    118620
     cgggtcgaca cccgcgtcgc cgtactcgtc cccgtgctgc gaccgccggg ttccgttacg    118680
     cgagtcgcgc gacgagtagt atccccgcga ttggccgtta tagccgttat gacgcacgcg    118740
     cgacgacgat cgtgggacgg gatcgggcga cgccgccgac gggttcggtc ggttgttggg    118800
     cgcgggatac ccccggacgt cctcccagtc gagtatctcg gcatcctcgg cgacggggtg    118860
     ggcgcgaagc gaacctcggt cctcttcgtc gctcagcaca ccggcggtga ctcttccggc    118920
     ggtggcgccg cttcgcgtgg acccccgctc gctgtcggag ttgactgctg attcggtgac    118980
     ggatgccgat tctcgcatcg acgccgcggt gcttccctcg tcggagcgtt ccgtcagcgt    119040
     gaccagccgc ggggacctcg ccatgggctc gagcgcgcgg ggcccggggg cgggaccgcc    119100
     ccggccgctc gggctcgccg cggccgcggc tccgacgccg accccgtctc cgactccgac    119160
     tccctccgac tccgcgctcg cccacggctg cgcgtcgtac tggaacctgg cgttgagccc    119220
     ccgcttcgcg gcgggtgagg cgttgcggtc gaacccggat gttcccggtt cgaatcccgg    119280
     cgagggcgcc gcggacgtcg gcccggcggc gtgcgacatc gcgggcgacg acgacgcgga    119340
     cgagtacacg cgtcggcggt accggctgct cggcggaccg gcgacggacc gttccttccg    119400
     ccgggccctc ctctccgtgt gctcggcgtc ctcggcaccc tcggcaccct cggcaccccc    119460
     gaatccctcc tcctcctcgt cgtcgtcgaa atcgtcgtcg aaatcgtcgt ggtctcgtcg    119520
     atttccccga cctctgttga cgtacggcga ctcgtcgaac agcgtccgcc gcgttcccgc    119580
     gtcctcgaac tcgtgcgagt accgcctgga cacgcggttg agcctggact cgccgccgct    119640
     gttcgggcgt gctccgttgg cgcgcggcgc gtgttggacg tgagggccgt tggcgccgag    119700
     gaggcttcgc gacggaaacg gaatcgaatt cgcgtcgggc gacatcggcc gcgtcgcgct    119760
     ccgggcgccc tgggcgccgc cgtcggcgcc ccgcttcggc acccccctcg gcaccccgcc    119820
     tccccctcct ccctccgcct cgtcctcgaa gggattcggg gacgcaaagt tgatcgcggg    119880
     cgactccggc accacctccg cgctgcccgg cgcccttcgc accgcgcgag gggtctctgt    119940
     ttgagtgtta tgaccctctg tttgagcgtc tcgaggtgcc gggttagtat ccggcacgtc    120000
     gccgtacatc gggttcgtaa gccacacgtc cgcctcgtcc acgctgtcgt ccaaaccgtc    120060
     gtcgaccggc ggcgtttttc gtgtcttcgt ggactcgggc gagtcgccgc cgtcctcggg    120120
     cccgtccact actggcgttt ggccaccgtt tttggcaatc tttggcgatc ccttttcgcc    120180
     aaactccgag gaggtttctc cgtcggaggt tccggtctcg tcgtcgccgt cgcgtcgccc    120240
     cgcgcggctg cgccccccgc cgcgcgtcgg gggcggggat tgcgccgcgc ggagcagcga    120300
     cgccgccccc gcggccagcc cgcccggcgc gcgcgcgtcg cccaccggat ccacccgacg    120360
     gaacacctcg tcgacaatcg cgaattgttc ctgttggtcg ttgaagtcgc cgaggttctc    120420
     atcatccccg gcgtcggccg tgtccccgcg aggacgccgg ccccgctcga gcacgaaggt    120480
     gtgcatgaac tgcacgtccc cgttaacgtc gtcgtcggtc ggaccctggg cggtggcgtg    120540
     caggttgccg agcaccaccg ccatcacccg ctcgcgatga gacgatgagc cctctccgtg    120600
     cacagctgtg ttttcggagt ccccccccga cggcaccggc ctgacgtcca cgctgaccac    120660
     ggagacgcgc ctgttccgga acatgcgccg ctgccgctga actatcgcgt cgacgccctc    120720
     cgcggtggga tccgagtggg tgagcgcgcg catgggcgac cgcgacgtcc cgggttcgat    120780
     gccgtcgaag aagtcgacga tctcgatgta ttcgccgggg gtggtggacc cgggggtggt    120840
     ttttacgttc gattgggatt gacgcgtgtc gcgaccgcgg cctgggcgct cggcgccggc    120900
     gaccggcgtg gtcgcgcgcg gcgtgctcgc gtcctcgata gtcagcaccg aatcctcctg    120960
     atgggcggcg aacgggggac ggatcgggcg gtcagtcggc ggtgtgtcgg gcgcattttc    121020
     gacgaagggg ctgggcgggg gcgggggcgc ggtttgaatg agcaatcaat cggcgcgggc    121080
     gacgcaccgt gtagtgcctc gcgacgcgct cgggagcgtc gttgatgtcc ctgtagtacg    121140
     aaccgaggaa acgcttggcg acgtgtcgca tgcgccgcgc gttttccccg tgggacccgg    121200
     gggacccgtc gtcttccccg gcggtggagg acccgctcga gcccgacgcc tcggcagcgg    121260
     cagcgtcgcc cgagcccgag cccccgcgcc gccgcccccc gggccgggac cgcggcttgc    121320
     cctgcgacgt cagcggcgcg tcctcggggc tgagcgaaga catggcgcca gtcgaccagg    121380
     acgcccgtcg accgaacgct gcgcacggcc gcgcgactcc gcgcgcacct cgactgaatt    121440
     gggggagtgt tagcccgcct ctggtgcgac gagcgagtcg agagccggga ttggatttgg    121500
     ggatttttaa tccgcacgtg tggaatacag ttagacattt ttgtttcaaa aactgtcctg    121560
     cacacgtaat cagttaaaag tcttaccata aatagtgcca ctccaatccg aaacgcctcg    121620
     tcacggtcct gccacgcaag tccacgcaag ccgagagata tttttctccg cgctggctct    121680
     ggccccattc ccacagccac gaggggccgc gacgtgaccg tccgcgcccg aaacaggtga    121740
     gcccgtcccc atcgccctcc tcgacgccca agcgcctctt cgatgcccga tacgcgacgc    121800
     gaaggaggtc ccaaacaagg gagagaagcg tcctgaacgc gccgatgcgc tttttctccc    121860
     gacgcttcgc tttttctatt tctatccgca tcgggccccg ctgcggcgtc ggttccgcgg    121920
     cgagacgcgc gtcgtcgggg atctcgtcgc ccccggaacg gtctcgacga ttccgcgcgc    121980
     gccgtctcgc gacggatccg cggcggaacc cccgattcac aacgctgacc ccgagcccac    122040
     caccgcccaa accccctcgc agaattgaac acgaccgcac ccgccccggg cgacaccaaa    122100
     taaatcacag acgcgaaatg gcgacccagg ctgagcgcaa cctcgcgctg tgcaaggagg    122160
     ttttcgatat ccaatccgag ctcgcgctcg acatcgtcga ccaggccgcg ttcgtcgcgg    122220
     tcgcgtccaa gcttcccgac ttcttcgcgc cctctttcgc cctcaccatg ggccccggcc    122280
     tcggcgacgc cgaagccgtg aactttcgcg ccatgaccca aatcactcac cccatctttc    122340
     acaacgtcaa gaacacgaag gtggagcacg catgcacggt gctgaacaac gacaagatcc    122400
     gcgcgctgga gcaccgcacc gccgtctttc tcgacgcgtg gggccgcgag gttccgggca    122460
     cgaacaagat gtacacgttc gagcacgtcg tggcattcga cgcggccacc gggaagataa    122520
     ccgaatggcg ccaaacctgg gatctcgtcg agtggcatct ctcgtgcgcc aaacgcgacg    122580
     ccgtgaacga cgcgcagatc ttcgaccgga acaggcagct gtactacgac atcatgggcg    122640
     cgtggggcgc cggcgagttt gacagctgtg cgtcaaactc gccggctggc gaatcgagtc    122700
     gcgaaacgtt agcaaagaaa ctcttcgcgg atgacttcac cctggaccca cggtacccgt    122760
     ccacgtacag gcgcgacgcg tgcgacgtgc tgtacgatgg ccccggtggg tacctccgtt    122820
     ggtgcgactt ttttgcgaaa accttcgcca cgccggacta caccgttcgc gacgcgtacc    122880
     ccggcgaaag cggcgaagtt tgggccgtcg gtcactacac ccccacggac gtcacgtcga    122940
     accgcgcgtt gccgttcaag gtggagtttg tgcaccgcgt cggcttcgac gtgaagggta    123000
     agtgcgttta ttttaaggtg tacaacggcc cgcaggcgat ccacctcgac gcgttgggcg    123060
     cgccgacgga ggacgcggtt ccgccgatga tcccgacgcc gcctcgaccg actttggacg    123120
     tcgagaagga tttccagaag gctctcgcgc tcttcgagct caaccagcgg cagtgggcgt    123180
     ccgggacgta cgccgcgagg gacagggacg aggcgctcgc ggccatcgcg gaggtttggg    123240
     acccggagtg cgtcgttgac gtccggtgag tttattttaa tctttgtccc gcctgtatgg    123300
     gcagttcgac tgacgtggtt tttttatcct tcgtaacagg tatccgtcgc gatgtgcgac    123360
     gaacctgaac gcggtgctga gggggcacga gggcgttcgt cgctggtgcg cggtgctctc    123420
     cgggtacgac tgtcccggct ttcgcgtgtg caggacggcg aggggccccg acggggacgt    123480
     gatcgccagg ctcgagttca acgcgagcgt caaggcgacg aaggcttcga tggacgagcg    123540
     ccaggactgc ttcatgcgcg tcgtcgccag ccgacgcacg ggaaggctga cgcactgcgt    123600
     ggtgcactgg ggcccgggtc gggtcgcgga ggacgccgcg ttggttcccg acgcgtcctc    123660
     gcccggaagg tttttcgccg tcgttcaccg ccccgtcggg aaggcttccg agtggtggcg    123720
     ggcgacagcc gccgcgttcg acgatccggc ctcgctccgt gagacgttcg agagacagta    123780
     cgagctcggc tactacaacc actacttcct cccggagaag gctggggacc cgaacgcgcc    123840
     cgtcctgtgc ctgtgggaga gcgccaagtc cgtcaccgtc gaggagttcc gttcgttcat    123900
     cgacggcgcc gacggaccgt tcccaaacgg cgagttcgca aacgacgtgt acgccatcgc    123960
     gcctaccggg gcgacgggcg ggctgccggc gactgggttc atcgcgcccg cggacccgtg    124020
     gcacgcgcgg ccgatgccga cggccacgcg cgggtcgcgc ttctgggtgc gtcacaggtg    124080
     agtttatttt actctttgga ccttcgatgg tattatacca ggtatgggca attcgactga    124140
     cgtggttttt ttttaacagg ttcaagagcg aagacgaccg cgccgcgttt tggaacgcgg    124200
     ttaaagcgtt taccgccgcc gactggaagg aattcgccat cgcgaaccac gccgccgggt    124260
     accacaaccc actcttcgcc ccggcgatgg acgacggcga cgtcttctgc gtgtgggagt    124320
     gcgtggatcc gacgacgact gtggaacagt tcgcggaata cgtcgacggg ccgtcgcgac    124380
     agacgaggct cctgaagcac ttcgtcaacg agtgccacgc gtgcgacgcg gtcgtcgggg    124440
     tgtggccgga cgcgaaattc gcgaaaccga cgggaggagc gatgctgacc atcaagcaga    124500
     cgccgcaggc ggcgatggcg gcggcgacgt cccgagccac cgcggcgtga tcgatcgcca    124560
     aaaaaatcgc caaaaaaatc gcgaaaagaa tccgaaaacg aacgcagagg cggcgagctt    124620
     tcgcggcagc ctctcctcat cgccgcgcgc ggcccgcgga cttttaaaaa catacatact    124680
     atgatgttaa cacagcgggg tcatcgcgcc gcgtcagctc acgcgcgcgg atttagcgtc    124740
     cgccccggcc gccgtggtaa ccgtcgccgt cgtcgcgcct ttcctcgcgc tcgcctcccg    124800
     agcttccccg ctccaatcga ggtccccgac gcgatgctcg cgctcgtccg gcagcgtctc    124860
     gctcaggaag cccagcgccg cgcacgcggc ggaccgttcg acgccccgtc gcaccgcctc    124920
     tcgcgagatg agcgcgtctt tatgcgccag gcgaacgacg taagagattc tcggcgcgcc    124980
     agcggtgact ttgtgcagac gcatgttgtc gaaggagttg cctgcgccga cggcgttggg    125040
     tgcgtgggac gcgaacgccg cgaggaacgg accggcgatg cgggtcagca gtctgtgcgc    125100
     tgtcgagtat atgccgaacg cgacgatgca ccgatacgtg agccaatcca accacatcgg    125160
     cgccctttcg cacgtcacga gggcaccccc gtccttcgtc aggttgaagt gcacggacac    125220
     gaagtgtcgg tcgcgcatgg cgacgagggc gtcgcgaacg acgaacggac cgaggctctc    125280
     gtagtcggtg tgccacgccg tctcgttgcc gcgcgattcg aacacgatgt cgaaggccac    125340
     gacgtggcgc gggtgcgctc gcgtgatggc ccgcttcacg tcggccatct ccggcgcgtc    125400
     gatgaagaac ggcgcgtaga gccgtcggct ccacgtcgac gagtgcgcct gcggagtggc    125460
     gtcgtgcgcg tcgaacctcg cgcgcagcga gcgcacctgc gcgtcggtca gcgcgatcgc    125520
     cattcgcgga gggagcgagt ggcgaggcga cgccgggacg cgtcgttgtt agtctaccgt    125580
     atccgaggaa aaccgcggga gatgtgccag cgtggcaccc gtgatccggg ccacacagat    125640
     cgggtctctg cctcgagaag tgcaccaccg ggcgctcgcc cccattctga tcggtgccct    125700
     tcggctcgcc actcccccgc gcgcgcgcac cgcaccaccc cgcacacgca tcgcgccgtc    125760
     gaccatgggc ctcatcgtca aatccgagat caacaacacc ctctacctca tcctctcctt    125820
     catcgccgtc ttctccatcc cggtgatctc cttcgtcaag aagcagatgg cgcagctcgg    125880
     caacggaccc aaggttgtgg tgggcacggg ctacggcggc aaggacgggt cctacaccgc    125940
     ggcggacgtg gcgaagcaca aggcccagga cgacctgtgg ctcatcatcg acgggaacgt    126000
     gtacgacgtc accgagtacg tggacgagca cccgggcggg gtcgcggcca tcatgaaaaa    126060
     cgcgggggga gacgccacga agggtttcca cgggccgcaa cacccgagcc gcgtgatgga    126120
     catcgtggac gagtacaaga tcggcacgct ggtgacggag ggcacgtcca aggacgagtg    126180
     agcgagcgac gagcgcccgg aggatgggac ggggacgggg acgagaacgc ggatcagggc    126240
     gcgatcgacc cggccggcga gggagggatg gagtgcctcg ggtcacccca tcgcgcgccg    126300
     ggggacacga tcggcgcggg gacgggcgac gcaccggcga ggaagacgac gacgaggcgc    126360
     gacgaaggtc gtttcttaaa taaatgaagt agcatttcaa agtcaaagca caacacgcga    126420
     gcgaggtcat cgtaataaac aaatcaacac ggggagccaa ccgcgcgggc gagcaaatat    126480
     cataataggg tcgactcctc aaacgtcgag taaagttata agggattttc taattcacaa    126540
     ctctaattcg cctcgtgcgt gtttgctccg tggccgcgaa agtgccccgc agaacaccgc    126600
     aaaactcacc tcgcgggctc gggcgtggca aaacccccgc gcgccgccca gttttcctcc    126660
     tccgtctccg tcatccccgt cacccccgac ccgaccgcgt tcttctcctc cggcgaccct    126720
     aggaatcgaa ccccggacct cacgacgctc cccggcggct cccccaaccg ctccaccaac    126780
     tctcgcagac tcgcgttttc gtcccgcagc gcgcacaact ccgcgtcctt ccccgcgcac    126840
     tcgtccctgt gaatcgccat cacacccgac atcacctcga gctgcctctc cctcgcggtc    126900
     gccagcgcgg tggcttcggc gagtcgcgac gcgagggctt ccatggcgtc ggcggcggcg    126960
     tctctttgca tccgagccgc gtcgagctcc gtctggcatt cgtcgagcat tcgtttgcac    127020
     tcgtcgagtg ccctcgcgag caccgcggcg tcgctcgcgc cgtcgtcggc gtaggcgagg    127080
     acgacgcgga cgtcgcgttg gccggggacg gctgcgcgcg gcgcgatccc ggcgacgccc    127140
     gcgccccgag ccgccgccgg tcgaccggga tcgggatttt ttggatttcg cgacgtcgag    127200
     ccggatccgc cgccgccggt cgagtagagc cccttgaagc tgcggccgag gcccttcatg    127260
     tagctggcgt acgacgacga cgaagatgcg ccggtcgcgc ggccgcgtcg tttgggtgac    127320
     gccgcggcgg cggcggcggc ggcggcgtcg gcgagcggcg gcggctgcgg cgagacgatc    127380
     acgcattgac ccgcgccgtc gccaacgatc tgcggcgctc gagcgatgcg cgagcgcacc    127440
     gcgaaccaat cgtccaccac cgccaagcct cccccaccct cggcaccccc gtcggcaccc    127500
     ccgtcggcac ccccgcgacc ggcaccctcg tcctccgagt cggtgtcgtc caattcggca    127560
     cccgcccatc cctcctgcat cggcgtcggc gggaagtgcc gcggacgctc gccccctgca    127620
     gcgcgactta aatccccaac cgaccccccc ccgaccgtcg ccagctgcga cgtcggcgcc    127680
     gcgctcacgc tcgcgctcaa gttgcgtcgc ccgttcatcg tcccgtcaac cccagccacc    127740
     gtgagctccg cgtggtggga cgcatacaga gacataatct ccgtccacgt cacatccgcg    127800
     tgagcaccgc acgtggcgac gatgagaagc tctgttaaag aaaaaccacg tcattcaaat    127860
     tgcccatgca aagattaaaa taaactcacc tgatccgtcg aactgcgccg gggcgatttg    127920
     cacggcgcac tccatcagcc ggtcgcaccg cccaccctcc acgatgcgct tggcgttgac    127980
     gtcgatgagc gcgagcgcgg tttggaacag cacccttcgc gtgcgctcga acaggagcac    128040
     gtcccacact cgcaacgcca cttcccacgg gaggtgattg acgtacagcg tgaggaacca    128100
     cgaaccggcg acggcggcga ggggcacgcc ggcgtcgtcc agcgcggcgc ccacgcgcgg    128160
     gaacctcgaa tccacgaacg tcctcagcac cgcctggtcc accgcggacg ccagcatcgt    128220
     gttcccgtag tacccgggca ggacgtcctc gacgagcgcg cccaggcacc aaaacgcggg    128280
     ttcctcctgt taaaaaaaac aacgtcagca taattgccca taagaagatt aaaataaaac    128340
     gcacctccat caacagtaag agcagcgcgg cgagaaagtt catgccttgg cagtacccca    128400
     ccgcggggtt gtgaagggcg taggcgcaca gaacccggcg gagggcgtcg cgcccgatgc    128460
     cgtccaggag cggatgcccc gggaaggttc gcgggagatc cttgtcgatt tgtttccgga    128520
     cgcgacgaaa cgaagtatcc ggcgacacag ctgtgcacgg cgtcgaatcc gacgcatcgt    128580
     cgcgcacagc tgtgcgcgaa ccgtcatccg gcacagctgt gcacgtcgcg tcgaccaagg    128640
     aggccagcac gcgctccacg gcgtcctcct cgtccccgtt ctcgtccccg tcctccttcc    128700
     gatccttcgt ttccaaaact tccgccgatg ccgactcccc cgcggcgacg aggagctcgc    128760
     gaaatacgcc gtcgcgtcgc cgctccttga ctcgcgcgaa gatctgccag catcgtcccc    128820
     ggagcgccat gggcacaccc cccgcgacga gcgcgcgcag ctcgcgttcc tcgtcgctct    128880
     cttccgacgc gtcgtcgccg cttccccggg cggccctggc gtcgaggacg cggacgagcg    128940
     cgtcgagggt gcgcgcccca tctcgggcgt cgtcgtcgtc gtcgttgccg ttgtcgtccc    129000
     tcttctgcgc gaggaacgcg tcccatcgcg tcgcgcgctc ggcttcctcg tcgacgtaca    129060
     tcggcgcgtt acgcctgtac gcctccacat gttccggttt gacctgcgcg aacggtggcg    129120
     ggcgcggagg gagggtgagg cggaggcggg gacgggagac gcggtcgggg tgcccagtgg    129180
     agatgagatt ccacgaatgt cagcggcggg gccgagagcg cggtggggcg agaacgaacg    129240
     ggcggccgac gcctcgaagg gacgcaccac gaagccgtaa gcatcgcgcg tcacgggctc    129300
     ctgattcggt ttcttcttcg cgccggacgc gcgtcggtag agggcctcca tccgccggcc    129360
     acggcgtcac gcgcgccccg tctctgcaca gctctccaac gggctctctt ggaagaatct    129420
     cccagcggag cgggcgagga aaatgcatga aaattcgccg tgtcctgaat aaaattctct    129480
     ccatcgccta tggcgcccag ttcggatctc ttcgcgaatt attggagccg cgcgaaccgt    129540
     tatttagacc gccgttaccc gggagcgcac ctgcttttcc cccgaaaaag cagagacgac    129600
     cacgtataaa gcgagaaaaa acgtcgaggt cgacgccctc tacgaccggc gccgtcgcac    129660
     gcgcgctgcg cccgtcgccg agggccgcgc ggcgaaagct tcaccacttc ccagtgcggg    129720
     gtgcactctc cgaggtagac gcgcctcgga ccccgcggcc gccgcggccg aacccgcgcg    129780
     tcgcgagagc ccgcgcaatc ccacttcgga taaggcgccc atcgtggttc ggacggacgt    129840
     tgaagccctc gtggttcgtc gcgtgaactc cgcgcgtctc cgcacgttcc cggaagcgaa    129900
     gagaggcgcc gacatggcgt gctgcggcac gcggtcgcgg gtcgacggcc cggaggcgtg    129960
     cacggtctgc ctcgaaccgc tcccgctgcc cggcccaggc ggcgactgcg tcctcgtgct    130020
     gcacgcgtgc ggtcacgcct ttcatcgcga ctgcgcgcag gacttcctcc tcgacgcgct    130080
     gcgtcgcagg aggacgccca ggtgcccgaa ctgccgcgcg acgctgcaca cggcgccgtt    130140
     cggtaagctg ctcggccagc gcaagttacc gcgcagcagg cggatgaaga acatgcggca    130200
     gctcatcacc gtctcggagg tgcgtcgctt tttttaccta cccccttttt ccaaccaccg    130260
     ccctctgcgc tttttctccc tcgccccatg acgttgcccc gtcacgatgc ccgtcgtcgc    130320
     gacttcgcgc tgacgacacc gttccgccgc cgttattaac gacaggaata catgaagcac    130380
     aagaactgga gggtgccgag gcgtaacccc acgggcacca gcgagcagca acgcgcgctc    130440
     gccggcctga tcatccagtc ccgcaaggag ttcaaggagg agttcggcga ggagccgtaa    130500
     gattggcgag ccgcgccgag tcgtcccact tggtcgttaa actaaacacc gagacgaaag    130560
     cgtcgcggcg tttacacacg acgggaccct gtctgcacat ctcgtttgaa gtcttttccg    130620
     acgtcttcac cgcacgcgca cggggctggg cgcgcggcga cgacgcgatc gtcagtcgcc    130680
     cgcagccacc cgagatcgcg tcgatcgagc gacgtcaatc gcatcagcgc cgcgccgtca    130740
     tccgcctcga aggaggagga gacggagggg cggtgggagc agtcgtaatc tgtacgcaaa    130800
     gccgcgagga ctgccgcggc gtatacgcca catgtacaca ggatagagag ggtagagagg    130860
     ggagggtgga aatcactcaa ggtgggagtt ggtgagaggg ggcggggatt tagcattggg    130920
     cgacgacacg atttggggtc cgtttgacgc ggtgattgta acacgaaatc gagtcgcccc    130980
     gaaccgtgtt tgccgtcgag atcagcacac tgaaaccttc catttccaag aaatagccaa    131040
     ttctctgact acccaccgct ggcgtttgcg aaagagtgac gtggccgaat gagaagacgc    131100
     cgtggagcgc cagcagcgcc gctcacccac tgcttttttt atccaactcg ctccaagcgc    131160
     cgtcccgcgc tcgcactcgt ctctcgcgag cgatacgaca ccgcaccgcg cgcaaaccga    131220
     catcgtcatg tcgaccgttg ccgccgcgag gctcgccgtc gccggcatcg ccgcgcgcgc    131280
     gtccggcgat gcgcgcccga gggccgcccg tcgcacccga cgcgtcgagc gcgaaaaggc    131340
     tgccaccgcg gtcccgatgg gacgacgcgc gacgctcgcg gtgacccgcg ccaccgacga    131400
     gaaggacgcg aagacctcga tcgacgacga gaccgtctcc gagacggtcc gccgcaggcg    131460
     cgaggccgcc aagcagggca aggacaactc ccccacgctc aacccgctgg atctcggacg    131520
     acgcgccagg cagctcaccg acggcttctt caagggcatc acggggttga cgcagctcgc    131580
     gcggtcgccg tccatcgacg aggccaagta cgacgccgtc tactccgccg atctcctcgc    131640
     cggcgacgac ctcacggagt acgagacccc gaacgcgcga ttcaccaccg tcctcgtcgt    131700
     cggcgccgcc ggtcgcgtcg gccgagtcct cgtccgcaag ctcctcctgc gcggctacac    131760
     cgtcaaggct ttggtgcgaa aggaaagcga ccgcgagatc ttaccggaca aggtgcaggc    131820
     gtacgtcggg gacgtctccg acgcaaagac gttggagctc gccatgtccg gcgtcaacaa    131880
     ggtggtgtac tgcgccaggg cgaagacgtt catggcgtcc gagctggcaa acgtcgactc    131940
     ggaaggcgtc cgcgtcgcgg ccaaggcgct ccaggattac aacaactcgt tagcgtccag    132000
     gcgcgcgggt cgtagccaaa agtccaagca gatgctctac agcttcgcca agttccgcga    132060
     cgtcttcgaa gactggaccg tggacgagac gaggctggtg aaccccgagg atgggcgctg    132120
     gcaagccgcc gccgaggtgg cgcagcgcgt tttcttcgac aaagaagaaa aggatgcgtc    132180
     cgactccacc gacggaaggt ctccttaccc gacgttcagc gggtacgtgt tcgccaagac    132240
     gggcgtggcg cagatttcgt gcgcgtgcga cgccctcgga agcggcgacg ccgccggcgc    132300
     cgtcgtcctc cgcgaccacg agggcgtctt acttcgcctc cgcggcgacg gcaagcggta    132360
     ctccgtcgtc ctctcggagg gcggcgtgga gggacggacg ttcatcgcgc cgttcgccac    132420
     gacggggaag tggcagatcg tgcgcatacc gttcgcgcag ttcaggcccg aggtgttcaa    132480
     ccgcgcgtac aacagcggag gggacgcgga ggtggacgcc gtcgcgcccg tcgacctcaa    132540
     cgccatcgat cggatcgggt tgcgctttga ggcgaggaac cagagccgct ctggaagctc    132600
     cggaagcaac ggcgcggggg ccccggagtg gatgtcggag ctcgacgccc cgtccaacaa    132660
     cagcttcgag ctcgagctgg agtacgtcaa ggcgctgccc aagggcgagg agacggattt    132720
     cgtcctggtg tcctgcggcg gcgcgggatt gccagacggc gaggaccgcg ataagctcgt    132780
     gagggccaag cgcgacggcg agcgaacgct tcgcaactcc ggcctggggt acaccatcgt    132840
     caggcccggt cagctgctgg aggagcccgg cgggaacaag gcgctggtgt tcgaccaggg    132900
     taaccgcatc tccaactaca tctcctgcgc cgacgtcgcg gacgtgtgcg tcaaggcgct    132960
     gcacgagacg gaggctagga acaagtcctt cgacgtgtgc ttcgaggctg aggttggagg    133020
     cgcgtacgag aaggtggcga tggtggcggg caagagcaac aactacctcg ccccggcgct    133080
     ggcggtcctc gagaagaaca cgtgagattt gtgtgagtga gcgcgagaag gaaggagggg    133140
     acgtcgcggt cggcggcggc ggggacggcg gtccaccgcg atgttttggc ggggaattaa    133200
     ttgaaaggcg aattgaaagg cgcgatggat tgaaaggcgc gcgacgttta agcagtcgcg    133260
     cggggcttat taagacgtat taacgagaag gcgatcgtgc gtgtgtttcg tcgcgtcgtg    133320
     cgtaacgtta gggaacctct cgtgtgttcc tctcgtgtgt tcctctcgtt tgttcctctt    133380
     ttaggcccga ctccgtcgtc gcgtcgcttc atcggcggct tacctcacat gcgctccaag    133440
     tcgcgcacga gctcgtcgaa gtcgtgcgag tcgcgcacgg gcaacctggc cgccaccgac    133500
     gcgagcgctc ccaactttcc agacgactct ccagacgact ttccagaccc gtccgcggct    133560
     gacgaggacg agggcgaggg ctcctttccc ggcggcgtct cgacgggaaa ggaaccgaag    133620
     gcgccgaacg acgcacagct gtgcggctcc acctggcgac tcgcgattgg cgcgtgcgac    133680
     gtctcgtgat ccgcgcgtgt gaaatccccc gccctatcgg gcctgaacgc cgacgtcaac    133740
     gaggcgtcgg aaccgaagct tccgtcgaac acgagacctt tctcgccggt gctcgcgccg    133800
     gtggagatgg ctcgggagga gcgcccgtca gtcgtcgtaa cggtcgtcgt aacggtcgtc    133860
     ggggtcgggg tcggcggcgt taacgtcgtc gtcggcgtct cgaaggtttc ccacccggcg    133920
     gtcaggtttt tgcgatcgtc gtcgatcggt gtggtcacgt cgaacccgtc gaacccgtcg    133980
     aacccggggg cgcacagctg tggttcaaat ccgaggaggt ccggcggcgg cggcgttttg    134040
     ggcggattcg cgtcggctcg aacgacggtg gtctcgccgt acaggacgta ctcggtcgtc    134100
     gcgtcgtcat catcgagtcc cagctggcga ctcgcgattg gcccgaccac gttcgccgcc    134160
     gcgcagtcgg ggccccggac gcgaagggac tccaggaggc actccaccgt cggcgacatg    134220
     agccgcgcgg ggcacctggc gaagatctgc ccaatcacgc gacgccagct ggagacgtcc    134280
     acggcgtcgt gcgacacgaa cgcgggcacg gcgcgcgacg cgatggatcc gagccacccc    134340
     gacgaagacg acgacgacga cgatgccgac gccgacgacc tcctcgacga cgacgacgca    134400
     gtcgtcgccg agtgagaaaa cccgtttgtc gcgccgcccg ccgccgccgt cgtcgtcgtc    134460
     gccctcgacg cctcgtgcgc gtcctcctcg cgcgcgaacg cgtgacaccg acgcaacgcg    134520
     cacgctctca gcgccggcgc gtcccgccac gtctccccgc acacgcagag gaagagccgc    134580
     aggcgaagcg ctcggtctat cgtttcgaag ggaccagccg tgagcctgga ggcgagggtg    134640
     acgcatactc ggtgaacgcc gtcgaagagc gcgaagaggg actcgacgtc tgccggcagc    134700
     gccgactcat ctaacgacgg cgcgcggtcg cggtcgcgtc ggtgtcggtg ttcgtcgtag    134760
     cgtcgcagta tctcatcgcg caacacgcgg agtggcacct tgagcagcac cgggtcgtcg    134820
     gagcacttgc ggagaaggtc gacgagggtg tcggcggcgg cggcgcggtt ggcgtcgtcg    134880
     gcggcgacgg cggcgccgcc gtcgtcgttc gttcgagcgg cggcgcgcgc gaagtcaccc    134940
     tgcggcgagg aacgagcgcg gggcgcggga gaggggcgtc ggtgtcagcg aggaggacgg    135000
     gagaggcgcg gggcgcggga aggggcgtcg gtccgccctc ggcgaggagg acgggagagg    135060
     cgcggggcgc ggggcggcgc gcgcggggcg cggggcgggg cggcgcgcgc gcgctcacct    135120
     tcaggtactt gcggacgaac cggatcgcgt actcctcgac cgtcgggtcc ctcgtcgcca    135180
     tctcgagcgg ggcggcgcgc ggtctgcggc gagttcgcct cgtccccacg aaccagcgcc    135240
     cgcggggcgg cacagctggc cacgaacacg gcgagacgaa caccggcttc agagttttct    135300
     cggagcgccc cactgcgttc gtccgccgcg ccgacgatga ggttcccgcg gcacatcgcg    135360
     cgcctcgcgt gcgtcgcgct gatcgcgtgc gcgctcctcg cgcccgcgtc gcccgtcgac    135420
     gccgcgcgac ccctcggcgc caaacgcgcc ctccgccaga gcgacgacga ggccatcgcc    135480
     gcgttcgcgg tgaactcgtg ggggttaccg gtgaacacgt ggaaggcggc gtccaccaag    135540
     tcgtcctcgc acgtcctccc gcggatgcag gagcaccaca cgacgctgca tcgaaccgcc    135600
     cacggctgga tcgaggggta cgtgccgaag gagtacgccc ctctgaccgc cgcgatcgtc    135660
     tcgtatgttt tattagtctt gccattctgc gcggcgtacg cggtgtttaa agcgatggac    135720
     gcgctgctca gcatccagaa gctcctgctc gccatcaacg tctacaacgc gtgctactgc    135780
     gccttactcg tcgtcatcaa cctctggacg ggcaacgagc cgatggcgtc gctccaggag    135840
     tccaacgagg cggattacct catcctccaa ttcttcaagg tgcgtttatt ttatttcatc    135900
     tttgtatggg aaattacctg tagactgacg tgtttctttt ttaatcattc aagtgcgcgg    135960
     cgtacggcgc tttcatcgtc attcaggtgg tgcacgtgtg catgctgtgg agcaccaggg    136020
     cggagaacat gaaggtcgcg gcggtgggca acctcgcgtt gagcctgtgc atcgggttcc    136080
     actacttcat ccgggtgtgg tcgcccgcga tggaggggca cccgccaaag acgtcggcga    136140
     cgtcgtacac cctggtgagt ttattttaat cttttttgta tgggcaattg tactgacgtg    136200
     gttttttatt tatcccgtac agtacacgac gatgttcgcc gccatggcgt ttagtcatta    136260
     cgtcaagccg gacaagggcg aacgggcgat ggcggcgcag gccaacgcgg cgatggcggg    136320
     caacgacgag aacaagcagt tttaagcgtg ccttggcgag tgagttcgta agtctgtacg    136380
     tcgaaattga cgagctactg ttgctcgagt tgattgtatt acacggtacc atcctctgtc    136440
     tcattcgcgt cagtcaccga agctcggaca tgaagaacga gagcgactgc gacgcgagga    136500
     tcttccgcgc cgccaccacc ccagccacca cctgcgcgac gacgtacacc accgcgaaca    136560
     ggttcagagc cttgtcgaac gcgacgacgc ccatctgccc ggcgagaaag taaaagtgca    136620
     ggggaagcgc gacgcaaaag ctgagggcga cgaacccgat gagcatcgga acttgctcct    136680
     gcaggttacc cgcgaatccc gcgtagagcc gcgcgggttc gaacacggcg tacatgcaga    136740
     tcatcaccgg ccgaatctcg tcgaagtcct ccctcgcgcc gttggtcttg acgaacgtcg    136800
     ccaccaccgt cgcgacccag aagcagacgg agaagtaaac gttgaacgat atcagcatct    136860
     gcagggtcac gtcggaggcg acggctctgt gcgccatgcg aggagcgccg ccgcgcgccg    136920
     tcgtgtccga cgcgtcgggt gccacggatg tcatctcgac gccgcggttg tcggcgaacg    136980
     agaacaccgg cttatcgccc ccgtaccccc ccctctgcct cgccatcgtc gccatttgtg    137040
     ttcgcccctt tcaccgcagc cgagggcgag atttcgagtc ggcctctctt ggtgcctctc    137100
     acgcgaacga gcggttccgc gagagcgcgc gtcgaccggt ggacgcgacc ttgttccgcg    137160
     cggatgaccc ggggaacgtg cgcgatgcgg atagagacgc gcgagtggtg tgtggcgacg    137220
     tggccgggtc ggttttgacg tcggttgttg ccccagcttt tttggcaccg cgcgttcaaa    137280
     cggctcccag tcctgacccg cgaatgaagc ctcccgacct gctgacccgc gaaaacaccg    137340
     tgaaagtctt cgccgatcgg ggaagtccac ttgcgaaggc gcgcggcgtc atcgacaccg    137400
     gcgcggcgtc atgaattccg cgaacaagac cacgcttcga gagctcgacg acgaggaggt    137460
     gcgagagaga gagagagagc cgttcgcgtc caccccgccc aacgcacgcg cgggcaccca    137520
     gatcccatcc cgacgacccg ccgatcgcgt accctaaaat ccacgacccc cgatcccgcg    137580
     cttccacgct gcaggagtac ctcgtgtcca agggattcga gaaggtcgac ctcgcgtcgt    137640
     gcatcaagta cctccgcatg atcgacgagc acaagctccg gcgccccgat cccgtctacc    137700
     gcgccgcctc cctcgtcgtc aacaatcaga agcgcgccaa gctccagaag caagacctct    137760
     acgcgttcat ggaacaactc gcggtcgccg cgctcgacgt gaacgacgtg gacacgtgcg    137820
     atcgcacgat agacgtcctc cgcgagacgt ttccatcctc ttcgcgcgtg aaacggctcg    137880
     aggggatgtc gctggaggcg aaaggtcgcg tcgacgacgc ggtggccgtc tacggcaagg    137940
     tgctcgagga atttccctcc gatcaacgag ccatgaagcg ccgcgtcgcc gcgctcgcat    138000
     ccgccgggcg ggacaaggag gcgatcgagg cgctcgccaa gtacctcgac accttcatgg    138060
     cggacacgcg cgcgtgggag cggctcgcgg ggatgtatca ggagcggggc gcctaccggc    138120
     aagcggtatt ctgctgggaa gaagtcgtcg ccgccgagcc gtctgtgcac taccatcacc    138180
     ggcgactggc ggagtgcctg tacacgctgg gaacggagga ggacctgcgc gcggcgagga    138240
     agtactacgc cgcggcggtg gacatgagca acgcaagcga cgtgagggcg ctgtacggtt    138300
     tggcgctgac ggacaatagg ctcacgcgta aaggcaaggt gaaggggaat ccggaccaac    138360
     cggtggatgg ggacgggcag gttcccgtta cggagctcgg gcaacacgcg gcggggttgc    138420
     tccggaagat gtacgcggcg ggggagaaga tcggggcgtc gaagccggga ctctgcgcga    138480
     tcgtggaggg gcagctcaag accttgttag acgcgtagtc tctaagtgat tcttcgacac    138540
     gacaccttgg tctcccagtc acgaagcaat gtgcaagctg cccaagtcca cagccagaca    138600
     gcgggaccac agcgggtgca tccgagtcac gcccgtttgg tggagccact ttgagtcgcg    138660
     ggtcagtggc gtcatgcttc gacacgcggg catcgccgcg ggcgacgccc tggcgaggaa    138720
     cgccgccagg gccaccggcg cgcgttccgt ctccatgctg tgcgtgcccg atccccgatc    138780
     gcgcacgacc cggggctgcg gcccgccctc ccggttggag ttttttcgtc ccttagctca    138840
     cccgcgacgg gcgaggaagg cgccccaacc tagcccggcc accgcgcgtc tcgctcgccc    138900
     cgaccgctga cccgaaccgt ccgcctccat cctcacgacc gcaggacgca aattctcgac    138960
     ggcagcgtat ggtgcgcgcg cgtttacccc gccacccgcc ccgacccccg cgcgccagaa    139020
     ccctaaaatt ccatcccggc gactccgcaa gaccatccat ccatcttcgc cgatcgtccc    139080
     gacacgcgaa ccgacgaact gacccataag ccgcctcctc gcgccccgct ttcgtctccc    139140
     taacaggcag ctcaagtccc gcaagggcaa gctcgtcggc gaggacgagt tcggcaacaa    139200
     gtacttcgag aacacgagct accagtccgg tcgtcatcga tgggtagaat acgcagacct    139260
     ggacaactac aacgcgtcca ccgtgccctc cgagtggcac ggctggctgt ctcacgtgga    139320
     cgacgagccc gggctggcga cgcgcacggc gccgaagtac caggcgaaat tcatcgcggg    139380
     cgggctcacc accggcgttc agggggagat gtaccagccc aaggggagct tctacaacaa    139440
     gcgggggatg cgcaactgga agaggtacac cccgtggtcc ccgccctgag ctcttctcgc    139500
     gtgttctttt actctcgttc gacacttcgt aattgacctg taattcatat atacacataa    139560
     atcgattcca atcgattcca cggccggtgg cgcagcctca cgcgacgctt atccatcctc    139620
     ggctcggcgg cggagcgctc gactcgtttt ttctttttct tcaaaaaccg gcaaaggctg    139680
     cttcctgctc cttctcccgt ttcttcgacc tggacgtcgc gttcttcctg tcgaactcct    139740
     ctcccgggtg cggcgtccgt gggtcgtact cgtcgaagca cgagtgatcg tcgtcgcccc    139800
     tcagcggggg aacgaagggc ggtttcccct cgcgacgcgt catagcgatc caatcggtgg    139860
     atttgaacca cgggtgaagc ttgacgtctt tgacgccgcc cttgagagag ccgagcctgt    139920
     ggacggcgtt gacggagagg aaccttcgga cgacgtcctt gaacgcgggc gacacgccct    139980
     cggggaacga gtacttggcg gcgaggatgc ggcgcatctg gtcggtgctg tcggcatttg    140040
     gcgaataaaa cggcggagcg cccgcgacca tctcgtagat taacacgccg agcgcccacc    140100
     agtcgaccgc cttgttgtga ccggactggc ggtacagctc cggggacatg tactccgggg    140160
     tgccgcacag cgtgtacgtc ttctcgccgg ggaggagccg cttggcgaat ccgaaatccg    140220
     ccactttaac gtaccctttt ccgtcgatga gcaagttttc gggcttgagg tcgcggtaga    140280
     tgtagtgctt gttctggagg tactggaacg ccaggacgac gcacgcggcg tagaaacgtg    140340
     cgtcgcgctc ggggatcgat cccccgacgc gggagaggtg gttgaagagt tcgccgccca    140400
     tgacggtctc catgcacatg tacagcatgc gggggtcctg gaacgtcgcg accagccgga    140460
     ccaggtacgg cgagtcgcag tccttcatca cgtccctctc ctgtcggacg tggtgctgca    140520
     gctgcgcggc gatgatctgc gccttgctca gctgcttcac cgcgaagacg ccggcgctgc    140580
     tcggatgcct gcacagcaga accttgccga acgcgccgac gccaagcacg gctttgactt    140640
     taaagtccgt catcgccttg gccgccaacg atcgagccgg gtcgttcgcc accttgtcgt    140700
     cgtacacggc gacgccgtac tcgtccttgg cctgctggct gagctctttg gcgagcgatc    140760
     ccatgtgcgt gtcgaagtcc tccttcgtga gcgacaggat gaaagcgccg cccctctcga    140820
     cggtggccgt cgcggctcgc gagttggtgg agagcagcgc cagctcgccg aagtactcgc    140880
     cgcgcgtgac gagtttcaac acctcgtgct tggtacgcgt ctcgttggtg gcggaggtgg    140940
     actcgctctc gcggtgtatg gcgacgttcc cggtttcgac gatgtaaaac ttatccccgg    141000
     ggtcgccctg gcgaaagacc acctcccctt ccgcgtactg cctgggctgc aggtacgaca    141060
     ccagcgtcgt tcgttgctcg tcggagagcg acttgagcaa cgcgacgtgc tgcaaacacc    141120
     gcagcctcga ctgcgtcgtc accgcggtga gaccctctcc gagcaggttc tcgaggtcgc    141180
     ggcggttgag acgaagtaac ttggcgtcgg gcgcggacgt cgcgcacaac ccgccgttcg    141240
     ccacctccgc ccgcatcgcg cgcctctcgc tgcccattag cgatcgctcg ccgaagaacc    141300
     cgccgtcggt gacgacgtcg acgcgcttgc cgtcggcgtc ggtgattaaa aattcgcccc    141360
     tctccgcgac gtacatgcaa tcgccggcgt cgcccacgtc gtacaccaac tcgccgggcc    141420
     tcaggctcaa ctcgtcgagg tgcgacacaa gctcggtgat ctctgcgtcg gacacggagg    141480
     agagcacggg tactctgcgg agcgagagcc aacgccagat ctctccgtac gagccgagta    141540
     aggcgttgaa ccgcgctcga tcgaggtgga agagctcgca tcggtcggag acgaccttga    141600
     cggaagcgcc gcggacgtcg tcgttgatga gcgccttctc cccgaagctc gcgccggccg    141660
     tgagccgcgt gagctccctg tgggacttgg cggtggaata cgaatcggcg ccgcccacgt    141720
     acacggagac ctcgccggag ctcaccacgt aaaacttatc gccggtttcg ccctcggaga    141780
     cgacgacatc gtccttttcg aaaacctcgc acttgagcgc gtccgcgatc gtcgccttgt    141840
     gttcggggct caaaccctgg aacaagttca ccgactccac gaggtcccgc acgcgttcgg    141900
     cgagcgcctc ctggaacctt cgcttgatcg cgacgtagtg cgctcgatca agcgaccaga    141960
     gcttacagtc tttcgaagct cgaatcgtcg cggcgcgcgg cgcgccgtag agcagcgcga    142020
     gctccccgaa cgagtcccct ggaccgtacg tcgccacggt acgctccggg tcggtcatca    142080
     ccggcttgcc gtcggccggg tcccgtcgtc gaaccttcac ttggcacgcg cccgactcca    142140
     acacgaaaaa atgcctcgcg tcgtcgcccg tggcgccctg aacgatgacg tcggcgcccg    142200
     cggcgacgcg cgtctcggtc atgacgtcgc agagcgcgca tcgcgtggcg agatcgaggc    142260
     cctcgaagag ggtgttggac tcggtggcgc cgaggatgag ctcgcggacg cgttcgtcct    142320
     tggagacgac gtcgatgtcg tcgactgatg cgacgttctc gacggcgatg gcgacgcgtt    142380
     tcttcttggc gttgccgccg ccagcgacgc cccccgcgcc gccgttggac gcgcgcatcg    142440
     ccggtgtcgg cgacgtcacc ggcggcgttt gggacgtcac atccgggtcg agcgtggcgc    142500
     gcgacggcgc gatcgggacg cgcgacgggg acgcgtcggg agccgccggg gcggacgaat    142560
     gctcgtcggg tggtcgcttg gaggaagacg ggcgggcggt ggtgcgggtc acgatcacct    142620
     ccgacgtcgc cgcggtgtgc ttgggttgct cgcccggcgc cgcgaagctg ccccgcgggt    142680
     tctttgcgtt ggaacacacg gcgcccatgg tggtctacca ggagatctta gccggagcgc    142740
     gcgggttcgt tgtgtgcgac ggcgcggggc gcggaacgcc aaaagcgggc gcgaggaaaa    142800
     aagagcggaa gacgaagcgt ctcggggtcc gaggaaaatc tcgcgactgg gaagccgaaa    142860
     gggcgagcgg atcgtatgag cgttcagtta ggattcgcgg acgatattgg ggttacgatg    142920
     cagtcatcaa atcaaccaaa tcgaaaatca accagtcaac gcacgctgcc aatcaccgaa    142980
     ttcggccgaa atcggagatc gccgcccagc agattccttt ccagctttcc gcgttgggtg    143040
     ttggcttttt ggagcttttc ttccccatca gggatcgagc atcgggcacc tccccgcgcg    143100
     cgctggagcc gccgaacggc ctcgcgagtc acatccgcga gcgcgctctc gatcaagttg    143160
     acgcgcacga cgcgaagatg ccgtcgggcg gcaacggcgg caaacccccg agggcgacgg    143220
     agggagtagg cccgtcgtcg caggggtcca ccccccaatc gtccgtgccg ccgtcggcgg    143280
     ggcactcgcg tcaggcgtcc tggagcatcg cggaggatcc cggcacgtac cgccggagca    143340
     cgagcagcgt ggacttcacg gacctcgcgg gcgcgggcgc gatgccgccg ccgcccgcgc    143400
     gtccgccctc gcgcggagcc ccggcgtccg cggggggcgc cgtccccatc aattcctcaa    143460
     atcccccgtc gcggccaatc tcgcgcagcg ggaccgagtc cgagcagctc agcgccatgg    143520
     tgcacgtccc gaagggctcg ctcgaggtgg gcaacgtcat cgtcgcgcac gacaagctcg    143580
     tgagctccgg cgcgctcggc ctcatccccg gcggcgccgc ctcggcgaaa ccgaggccgc    143640
     tgggacccaa ggcgtggctc aagatggacg aagagggcgc ttgcaccgcg gtgtccatcg    143700
     agaagcacag gctggcgagc atgctccggg tccccatgcg cgacttgcgc atgctggagc    143760
     ccaacttcag caactcgtac agcgcggcga tcctgtgtcg cgagcggtgc atcgtcctgc    143820
     acctcgagca ggtccgtttg ctcatcaccg ccgaggaggt gtacctgcaa gacggccgaa    143880
     acagcagcgt gaccaagtac ctgcccgagc tgcagcggcg gctgctgatg cgcaagctca    143940
     agctcatgga ctcgcacggc gtgccgaact tcgacacccc gcccgaaagg tcgcgggcgt    144000
     acgagtccga caccgagccg tccgagccgc cgtcggagaa ggaatcgccc gagagggtga    144060
     cgaagcgggc cgggtcgacg gattcgccgc aatccctcga aagtcaaaag ccggacccgc    144120
     tgctcaagac gaagaaaccg gacccgacgg acaccgacga ggacgtctcc gtccgcgcgg    144180
     gacgaacgag gctggaggcg gtcggcatgc gcaggagcgc cagctccgag gagctcgggc    144240
     gcatcgcggc gaccaagacg gaagccgtgg gcaagtctgg caagtcaccg ctcggaccgg    144300
     gcgtcggctc gggctcgtcc aaggatgatc gatcgaacgc cccgtcgagc cctcgcaagc    144360
     cccggtcgcc gaagaaccac cactccgggg tcatccacga ggaaggctcg cttcgaaggg    144420
     cgctcagcat ccaacgcggc ggggatgcgc cgcggcagga ggagctcccc tttgagctca    144480
     tcgcgctgga ggttgctctc gagatcgtat gcaactcgct ggaggcggag cagagggaga    144540
     cggtgacgga agccaaagcc ggcctggagg gtttgcgcaa gaaggtgaac acgaacaacc    144600
     tcgagcgcgt tcgcagggtc aagtcgcgag tcacccgcct caccggtcgg gtcgccaagg    144660
     tgagggagga gatcaagcga tacctagacg acgactctga catgagggac atgtatctca    144720
     ccaggcgcct gctcgccgag ctcttcggag gcgccgaggc gcggggcggc gggatgggcg    144780
     ggatgggcgg cgagcaccag cagaccccgg gaggcggcat cgtgaagggg catcaccacg    144840
     actccccgag gttctcggtg acacacgcgc gagccatgcg ccggtccagc gtcaacctcg    144900
     agtccaagct ggactcggcg cgactgaacc ggggcggcga acgaccgggt ctgggcgata    144960
     aagacccggg cggcgttaag gacgggttcg agatgggcgg ggtcgtgttc gacgacgccc    145020
     ccgcggcggg agggtactac gaggaggaag aggagtgggt ggaccccaag gatgaggaca    145080
     aggacctcca ggaggttgag gatctcctcg agacgtactt cacgcacatc gacagcacct    145140
     tcgccgagtt gcaagcgttg gacgagtaca tcgacgacac cgaagatttc gtcaacatcg    145200
     agctcgactc gcagcggaac cagctcatca agctcgagct ggtgctcacc accgcgacgc    145260
     tgttcatgac catgtacgga gtggtggcgt cggtgttcgg catgaacgtt cgcaatggag    145320
     cggaggattc gaaggcttcg ttcgtcgtca tcaatgtggt gtgttccgtg tgcaccgtgc    145380
     tcgcgttcgt gctcgcggtg acgtacatca ggtacaagcg gatcatgtga tgggcgttcg    145440
     cgttgatgtc ttgatgttcc tcgcggatgt gctttagaga ggaggaggag gaggagggtg    145500
     cgggcgcgaa gtcgataact tatgtaactg actttattcg ccgctggcgt catcacttcg    145560
     ttggggtcgg tcgcgcgtcg aagggttcgg gacatgccgg tggacatgaa ggcgctcctg    145620
     gcgcgggagc gcgagcgccg tcgcgcggcc gcctcgggag acccggcggg ggcggcgacg    145680
     gcttcgtctt cggccgcggc gacggcgccc gtcgtcatgg ctccgcgcgc gaagatctcg    145740
     ctgcgcgact tcgacgtcgg cgagcgcgcg ggcgtccgcg gactgcacta cgtccccgac    145800
     ttcatctcgc cggacgagga gcgcgccgtt ctcgcgggaa tccacgcgcc gggcaccgag    145860
     tcccgttggg tgcgcagcgg ccgacgccgc gtcgcaaact acgggggcgt cccatcctcg    145920
     tcggaggtga ccgaacccct tccgcagttc gcgacgtccc tcctcgaagc catcgcgtcc    145980
     gccggcatcg tgaacgagcg caccgcgccg aaccacgtgc tcgtcaacga gtacgtcgcc    146040
     cctgcgggca tctcaccgca caacgacggc gacgtgtacg ccccgcacgt cgccatcgtc    146100
     accctgggag gcgccgcgct catggacttt tggccaaacg acggatccgt caccgccgac    146160
     gacgaccgac gcgactgcga cgaacgcgaa ccgacgccca tcgcgcaggt gctgctgcga    146220
     ccgaggagct tgctgctgta cacgggggac gcgtacgggt tgaggcacgg gatacggcat    146280
     cgcgacgtcg acgtcgcgac cgatcgatgc gtcaacgccg cagtcgcggg tgtcgagatc    146340
     ggcgacgagg tcgagcgggg gcgggtcagg tactcggtgg tgttcgttcg caaagggcac    146400
     ggctagggtc gtcgcgggtt agggtcatag ctactaggtt cattcactcg cacgagggat    146460
     ggcgtcaaga cggttagcgt cacaaagtca tagctactag gttcattcac cggtaatgtt    146520
     atgtactttt acgaattcga ggagagtcga ccgatcacgc ctctcccatg tcgacgttac    146580
     cgtcgttgtc ccgcgcggga acgtgcgcga acttgcacgt gtccccgtac ttgcacgatc    146640
     cctgctggaa gaaaacgcac ggcgtggagg acatgtccgc ggcggcttct tccctaaccc    146700
     acgtcttgcc gccctttgcc actccggatt cgggtttggg ctcggaggtt cccatgtcgg    146760
     gggtccagac gttggatcct ctgccgccgc cggcgcccct gccgccgcga ccacccctgc    146820
     cgccgcgacc gccgcggccg ccgccggcct gcatgtgctg cgccatggcc atcatctgca    146880
     tctgcatcat ctgcatctgc tgcatcatca tcttggggct cggtccgtag ggatctccgc    146940
     gccggccgcg gcctccgcgg cctccgcggt ccggcccgcc gccgccctgc gcgtccttaa    147000
     gcgacgtgtt gcagtcgaga cacacgggcg ggttaccgcc cttcaccggg cggaacggca    147060
     cctcagtgtc cacgccgcac ccctcgcact tgcccgcgaa gaaattcttc cccgtgcgcg    147120
     cgtctacgcg atcggacacg gtccagccgt cgagggtctc cgcctggggg cgatcgcggt    147180
     cgccgccgtc gtagtcgtcg cgcctgcctc gaccgccggc ccttccgcgc ccgccgccgc    147240
     gcctgtcgtc gtggcgatcg tgctcccacc tgtcgccgcc cccgcgcctg ccgccgtggt    147300
     aatcgtcgct gccgcgcagt ctgctcctga gatcgtcccc accgccgccg ccgccgcggc    147360
     cgccgcgggc ggggcgcttg acgacgacgc ggcgcgcctt cttctcctcc ttgtcggcct    147420
     ccgcctcggt gatcatcgcg tcgagatcca tccccgcgtc tcggctcggt ggtatcgtcg    147480
     cggctcggtc gctcgcgatt atgacctagc tagccggtgt ggcagccccg ggtctcaacg    147540
     ggactcttgg cttggactgg ctcggctgct ggcggggcgg cgagacgacg aattgaaact    147600
     cgatgtgacg cgcgtcgttt gccgttttcg tgggcgccgc cggggaacta tcgtcgcatc    147660
     gcctcgtctc tccgctcacc cgctcgcatc gtcgcggcgc ttccgtcctc atcctcgtcg    147720
     tcgtcctcgt cctcctcgtc gtcgtcgtcg tcctcgtcgt cgtcctcatc gtcgtcgtcg    147780
     tcgtcctcgt cctcgtcgcg ccggccccta ctcctcctcc tcctcctcct cctcccccgc    147840
     cgccgtcagc gacaggcgaa ccctgtgctg caccacgacc ccggcggccg ccatcgccgc    147900
     gcgaaagtcc ccgacgctca cgtcgaccgc ctccgccgtc gccctcggac gcgccgcctg    147960
     ggactttcgc gcgacggcga cgccatcctc gccgccggct gaccatcgcc agcccggtcc    148020
     ctccgcgggc accagcgtct gaccgccgcg cagctgtgcg ggtcgtcccg cgcgggacag    148080
     caccccgagc aggccgtcgc tcagccgccg agcgatcccg ccgagcaccg agcggcggga    148140
     acgcgcgcgg cggcgggtcc cgtgcgacga cgacgacgaa gacttcgccg cccgaccgtc    148200
     tttgtcgtct tcgtcgtttg cgacggcggc ggcgtcgcag agagcctgcg ctcgctcgcg    148260
     cgccgccgct cgcgtcgggg ggctgaacga gggcgcgagg atgaggctgc cgcggcgtcg    148320
     gcgcggtgag gcgagccgcg gggtcgttcc ggcggagacg gacgacacgg gagacgcgtc    148380
     gccgactcga ccggcggcgg agtcggaggc gttttcgtcg tccagtgctc gtttcttcgg    148440
     gggcagccgc ttttgcaccg aggctttcgc ggcgaggagt gcggcgtcgg cgaggttgcg    148500
     catgcgcgcg gagtcgcgcg gggtccgcgc ggcggcgcgc gcgggcgacg cgacgacgat    148560
     cgcggtcgtc gcggccgtct ccgcggacga gcggcggcgg cggcggcgcg gcggcggcgg    148620
     cgcggcgctc gcgctcgccg gctttttccg cttttcccct tttttcgcgc gcggagcggc    148680
     tcgggcgggt gccgcggtcg ccgcgcgcgc cgccgcggag ggtttcggcg cgcgcgcgct    148740
     cttcgccccg gcgctcttcg cggcggcgcc ggcggcgtcg cgcgcggcgg ccgaaacccc    148800
     gctctcgcgc gccctgtacg cagccttcgc ctccgcgagc gcggcgaacg tgcccaaggt    148860
     gacggtgcgc cgagtcgtcg ggtcgtagtg ccggacgttc caccgcgtct tgccgtcctt    148920
     ggtgacgcac cgcctgatgt acgagtcggg gatggggtcc tgccgcgggg ccatggcgtc    148980
     ggtcgaggcg gcgtcggtga agcagccggc gccgacgcgt aagtcgccga cgcttaagtc    149040
     ccctctcgtg tcgagcgagc ctcgtggtaa atcttgctcg atttgatgag atttcccgcc    149100
     tcccgtctcg aagttcgatg atatttcgcc tcgagggtgc cacgcgggcg aggcgcacag    149160
     tgcactacgc gcgccccgtc cacgcacgac gatgcgcgtc gcgacgtgct cccggaccgg    149220
     gcgatgcccg tcgcccgcgc acgcccgctg gcgcgcgctc gggccccgtc gatgccctcc    149280
     gaccgctccg cctctcttcg tcggggcgcg atctgatgac gaggcttctt cgacgaggcg    149340
     atatctgacg atcctctcgt cgtcgcgcgc cttcgagggc ggcgccgatc cgttcgacat    149400
     gtccggcctc tcggacgccg agcgcgccgc catgcgtcac gagtggtcgc tcgaatgccg    149460
     ccgcgcgggc ctcgaccacc tcgcggagtc gttcaagaaa cccagcgtgc tcaacccccg    149520
     cgacgacgac gtcctaccct tcacggaccc gagcctccat cgaaacccaa tcgaggccgt    149580
     cgtcgcgtcc gtcgcgcgtg aagatctcac gagcaacctc gacgcgaagc tcgcgttcct    149640
     caacggcgag ggcgtcgcgg gggtggcgca cacgggcaac ggaaaattcg acgcgcacct    149700
     cgtgggagtc gcgtcggtgc tcagggcgtg ggggtgcgac gattccgtcg tggacgcggg    149760
     cctgtttcac tcaatctacg gcaccgaggg ctttcagggc ttcagcctgc cgtacgaacg    149820
     cagggacgac gtccgcgcgc tcataggcga ccgggccgaa cgtttggtgc acactttctg    149880
     cgtcgtggac cgtctctcgg tggataacga cctcgactcg cgacctgaaa gtcacgggtt    149940
     caagacccgc cccgagctct cttcgctgtt cttcgacgac ggagccaacg aggtcgccgc    150000
     gatcgacctc gacgaggcgc tctggttcga tttcgtcacc ctgacgctcg cggactggct    150060
     ggagcaggtg gagggcgcgt cacgaggcac gaacgaggtc ttccagtggt tcgagagggg    150120
     tgacgcgtgg gggtaccgcc ggggcgcgta ccgacgaatg tctgagattg tcggcgagaa    150180
     gatcccggcg gcgagggcgt tgtgggaggc ggtgtacgcc agggagcacc cggggacgcg    150240
     gcacaagtcg cagccggtga cgccgccgat gtcggacgcg gcgaggatcg cgcgcgcggg    150300
     gatcgagcag ccccagcctc gatacccgtg acttaaataa ttcgaacctc ttcgcaattc    150360
     agctcaaaag tcgcgacgtt cgtgtaccga ctcgtcgtct caactcgacg cttaacccgt    150420
     attaacaagt cgctcacctt aataacaact acccgatcag agcaccacgg agaggatcat    150480
     gcacacgaac ccggtgagcg ccacgaaccc gatcatcccc ttctcttttc ccgccgcggg    150540
     cgtcccgcag agctccttcg acttgtacag gatgatgggc ggcataaaca ccgacatggc    150600
     gcagcagcac acgccgccca cgaggcccaa caccgcgcca aagttgggga cgttgcacgc    150660
     gaggtacgcc gccagggaga cgaagccggt gcgcacggcg agggacaccg ggaggggcgc    150720
     ctccttattc gggctcacca cgttttcgca gatgaggagc gacgatcgcg ccatgagcgg    150780
     aaacgtggac cagaggttga gcgcgaggag tcccttgacg acgaggcccg cgacgccggt    150840
     gagcatggtg acgacgacgg agctcacgcc ccggccgtac ccgaccgcgc ccacgagacc    150900
     aaacaccagc gagatggcca tcgagatgag gaacgccttg ttcgccgcgc tgaggaaata    150960
     cttcttctcc ggcatcccct cctgcaccga gaagagggtg aagtggatga agaacaggaa    151020
     ggcgacggta ccgaagaagc cggaaaactg ggagacgtcc gccagcggga tcgccgcgag    151080
     ctgcagcggg ttgcgcaggg cgctgatcat cacccagatc atcgagagcg ccacggtggt    151140
     ggtgccgaaa agcgagatga ggttaacgcc cgcgatggag cgctgccacg ccatgaacag    151200
     ccacaccggg aggttgtacg tgagcatctt ggcggtggtg tacgtcgccg cctgtgccgc    151260
     ggggagcatg gagatgcacg tgtccgcgac gaagatcatg taaccgacgg tgatgccgaa    151320
     gcaggtgatt acgttgagga cgcggcagat gacgtccccc gcgggaccga tggctttctg    151380
     cgttaagccg gcgtaggtct ggacctccgc ctgggtagcc ttgcccgcgg cgatgagggt    151440
     ctcctgggac tggacgagca tctcgagcgc cttgatggcg aaccagtagg acgacaggag    151500
     gcacgcggtg acgaggacgg tgccgccctg cgcgaaggcc cacggcaacg cgaatccgcc    151560
     ggcaccgaag atggccttga tgacgttgac gatggcggcg gtctcgccgg tgtcgcccgc    151620
     gctcgcgggg gcggcggatg acgccgccga catcgcagcg cgctcgccgc gcggcgcggc    151680
     cgcgcgctcg gcgagcaccc tccggaccga gcgcggcgcg ggagccgacg cgatgatcga    151740
     gacaaccgcg cgcctgccgc cgacgacggg cacgcgcgtc gcgtcgcgag cggcgcgacc    151800
     gcggaggggc gcgggggcgc tcgccgggcg cgacagcgcc accgcgcgcg tcatcgccat    151860
     cgcgggcatc gtgcgttcga gacgcgggcc ggtgcggcgc aggaaggcgt cgcgagacct    151920
     cgccaaccgc ggggggtttt ggctgcggcg agtccaagga tgattggttg gctggattgc    151980
     gatcgcgcgg cgcgacgcgc tttctgattc ctcggctggg ccgtcgttgt acagtgtctc    152040
     ccccacctta acgacgcccc tcttcgtcac acgcgatgcc gcgcgcgttc cccgcgaccg    152100
     caccacccgc gccgcgcctc atgccccgcg tcccgtcgcc gccggcgtcg ccccccgccg    152160
     cgcgcctcgc gccctcgccc accgcggcgc cgagaaacgc cgcgcccaac gcttttctcg    152220
     gaggaggcga gcttttcccc ggcgctacgg caggtgagct ctactacgag ttccacgccc    152280
     aagatggaac ccccgagacc gccgcgagcg ccgccgcgcg tcattcccgc gccgctgccg    152340
     cctccgcctc cgccgccgcc gccgccgccg ccgcgcgcgc cgcgatgaca cgcgcggaga    152400
     ggcgcgcggc gcagctcgag cgctgccgag gcagaaccgc ggagcagttt ggcagtttgg    152460
     caagcagagg cttcatagca gcgctcgacc agtccggcgg gagcaccccg cgcgcgctcg    152520
     cgctctacgg cgtgagcgac atccgcgccg gggacaagtc ggagatgttc gacgcggcgc    152580
     acgccatgcg gacgcgcatc gtcacctccg aagccttcga cggcgaaaag gtgttcgggg    152640
     cgatactctt cgccgacacc gcgttcgcga ggctggtccg aggaaaaccc accgcttctt    152700
     atctttggga agataaaggg atagtcccgt tcctgaagat cgacgtcggg ctccagccgg    152760
     aggcgaacgg cgtgcagctc atgagggaca tcgacgactt gggcgtcacg ctgagccgat    152820
     gcggacgacg cgacccgaag ctcgacgacg acgacgcctc ctccgaagat acaggatatc    152880
     ctaaaccccc taaaccccta aacccagggg atggggaccc cggtttgtgt atcttcggga    152940
     ccaaagccag gagcgtgatc cgttccaacg atccgaacgg catcgacgcg ctcgtcgcgc    153000
     agcagttcga gtcatggatc acgggctggt gcccatcgtc gagcccgagg tggacatcga    153060
     ctgcaaagac aaggcgcgtt cgtctatccg cttcgttctc gtatcacgcg ttgaccgaag    153120
     cgccgttcct ttccctcgct caggctggcg ccgagaccac gctcaaggcg gcactggtcc    153180
     gccacctcga cattctcgag accctcgccg acgcagacga cgccggtgac cagccgccga    153240
     cggtcatctt caagctcacc ctccccgagg acccggccct gtacgactcc ctcgtggcgg    153300
     acccccgagt gctccgcgtg gtcgccctgt ccggcggcta cgaccgcgag gagtccacgc    153360
     ggaggctgcg aacgtgccgc ggggtgagcg caagcttcag tcgagcgctg acggagggtc    153420
     tgcgggtgga catgacggat gaagagtttg acgcggcgtt gggagcgtcg attggggcga    153480
     tttacgaggc ggcgtgcacg tgagggaggg aggaaaaacg acgcgacgcg atgcgagcga    153540
     gccattgatc ctggtgcaac cgttcgatca caatcgtacc taatcgcagc cgcagaccgt    153600
     ggaaagcacg gcagcctgtc ctttccgtcc tcaatcttca gcacgtcggc tgtgatgttc    153660
     ctcgtgctga agatagacat cgagtgtctc ctactgcaaa ggacaagctg cccctttaaa    153720
     agtgccacgg tccgcggccg cgaagaggac aaacgacccg ctcacacgtc gcgctcgcgc    153780
     ctcgatacca accccgaggc tcgcccggtt acgacgttac gaaatttcat cacatcacgc    153840
     tcgactttga cctacgaccc tatcataatc accagtccct cgtccccgcg cgtcccttcg    153900
     tcttccgaac catccgctcg ttgatcagcc cgtactcgac gacgggcctg agatcctccg    153960
     cgccgcgacg cccgccccgc gcgccgccgc cgccgccgcc tccgaagagc gacccgaaga    154020
     atccgacgga tttgcgcttc acggtgacgc cctttcgaag cggatccgat ccgccgtggt    154080
     gcccgacgtg gtgctcgcgg gacacgtcca cgatctccac ctccttgtgg aagggtaaca    154140
     tgccagcgtc cacctggaga ctgcgccaca gccccgcggt gccggacgcg gcggtggatc    154200
     ctgaggcggc gtccgaggag gacgagtcgg cgccagctgg cgaatcgtca tccgccacgt    154260
     cagcgtcgtc ggcaccgaaa ccgtcctctc cgtcgtcaac ctcccgggag aacgacgact    154320
     ccgccttctt accgcccccg aacgaactcg cccgcgcacg aacgacgaac ggcgcatcgc    154380
     caggcacgta ccttacctcc aggagcagct gcttcacgcg ttcctttagc gctctagacg    154440
     cgccgggcgt cgtcagcgcg tccagctcgc acccgtcgca cgcgatgcgg acgacgtcga    154500
     cgagcgcgtg gtggccgcca ctggttccgt ccttgctcct gctcgccgac ccgcgcgtcg    154560
     cgacgtcgat catctccggc agggtcatgg agtaggtcgt ctccggcgag gcgtttgcgt    154620
     cggtcaacgg gcgggagtcg ccgccggaga ggaaggccga atgcgtcgtc tgcttgcgag    154680
     ggcgcatgtc gtcggcgtcc cacgaggcgt cgcgggagtt cgagcggcgc ttggcggcgg    154740
     cgtcgtcgtc gtcgcccgat tcgccgcgga actcctcgtc ctcttcttcg tcctcatcgt    154800
     cgtcgtcgtc gagcggcgcg tcgcgacggc gcttgccggt ttgtaacggc tttgtaacgg    154860
     ctgtcggggc ggttgacgtc gacgcgaggg acacccccgc ggtgaacgtc atcgacccgc    154920
     ccgccgccgc ccgcggtttc ttctccgcgc cgcctcctcc gacaccgtcg tcgtcgtcgt    154980
     cgaaggcgtc ggcgtccgcc gtgtccggcg gcgtcgcccc ggccatcgcg tcgaacacgt    155040
     gcacctcgca gccgtacagc gcgcgcatgt ccctctcgaa cgcgaacccg ccgcggctgt    155100
     tcgcgatgtc cacgcccacg gtgagcacga cgcacccaac cttctccccg atgtgcgaag    155160
     cgccgtcacc cttcgacgat tccccgtcat tcgaagaacc gcctcctcca aacccgagcg    155220
     agtggagcca gccgtgcgcg ccgcgcgccg ccctgcgctc ctgctccacc ctcgccttga    155280
     actccgcgtc cgactcgggg gtggcgatca tccgttcggg atcgcacacc caccggccgc    155340
     ccagcgattc cgcatccgcc gagtcaattg gagaatctga atctgaatca acctggtccg    155400
     aaccgctcgc gacgccgtct cccgcggaca cgggctcgcc tccgatctgt tcctcgtccg    155460
     cgcaagacac gcacggctcc cagaaccgcc tgaaccacct cgcggcgtcc gcgggtgacg    155520
     cgtcgacgtg cggtgcgtcg ttcgcggtcg ccgcggccat ggcggcttgg gagacgccgc    155580
     agtcgcgatg gcgtattctg gattcgatga ggggttgcga ttcccacccg ccgccgtggg    155640
     agacgagcgg gcggtgcgag aagtcgacgg cgcggtggac gtcgtcgtcg atgccgaggt    155700
     atatcggatg gtcggtcgtg cgaaggccgc cgccgcgcga tggttcgtgg cggcgatggt    155760
     cgcgcatcat ctcgacgcct cgatcggccg cggcgccgac ggtgagcgag ttcatcgagt    155820
     ccatcgcgcg gctcgctcgc gtcgccgcgc tcgcggcgtc ggcgtcgctc ccgaagcgat    155880
     gcagccgcac gtcgccgcgg atctcatctc gcgatcctcc gccgaagcgt gcgccatgcg    155940
     tcgcgaagtc gtcgaagcga tcgtcgatcg cggaaggcga cgatccgccc gacgccgtgc    156000
     gcgcggtcat gaccaccgtg agggtgaggc cgaggatgac gacggcgccg acgaggcgac    156060
     ggcgcttatc gcccctgcgt ccgcgctttg ccatcagggg cgcgtgaccc tcgtatatcc    156120
     agccggatga cttgcccatg gtggggtcgc aacgctgcca aatctggcgc accgcagtct    156180
     tatctccccg cttgacgagc gagcagcggc gaaaggagtc accgacgggc gagtcaccga    156240
     cgggcggatt tcataaacgt tggtcgcggg agcccacggc tcggcgccgg ggtcggggag    156300
     tcgcccggtc ggcgctggag gccgcgcgcg cgtcgcccgc cgggagaagg cgcgagcgcg    156360
     gcggggtggg cgggacacgc ggtcgcgcgc gtccggggta tcgaccctcg tcacccggcc    156420
     gaggggggcg catcgacgtg aaacgccccg cccgactcgg cacctccgct cgcggttggc    156480
     gacgatgaac gacgccctgc gtgacgccaa gaatgcgtcc ttggccgcgg tccgcgacgt    156540
     cgtcaggtcc atcgacgcca acgtcgcctc cgacgccgcg cgatacaacg agcggctcgc    156600
     ggcagcgcac gccgccagag ccgacgccgt cctggacgcc cacgaggctt ccaagcgaac    156660
     ggacctaggt ttcgtggaaa aagccaacag ggcgcgactc gagaagctga tgggctacat    156720
     gttcctggac gcccccggcg gccccgaccc atccccaacc gacgtccaga ccctaacgct    156780
     ggacggcgag acgatcgtcg tggacgcgca cgacccgtgg cgtccatcct acgaccgcgg    156840
     gggcaggctg gagcgcccgc ccgacctcgg agcggtcaaa ggagacgtca aagaaccgcg    156900
     aacgctggtg gtggagatac tcgcggcgag gaacctggag gccaccgacc tgctgggcac    156960
     cagcgacccg tacgcggtgg tgacgttggg cgcgcagcga cgtaagacca aagtcaagca    157020
     tcgcacgtta cgtccggttt gggccgagcg cttcgccgac gtcgtcgccg ccaaagagct    157080
     cgaagacgac gaggtggacg tcgccctgta cgaccacgac gcggtgggcg cgcacgattt    157140
     cctcggcagg atcggcatcc cggtcacgtc catcgaggaa ggacacggca cgtcgggtca    157200
     aaccgggtca aacgtgaggg cgcattgggt caaactcgag cacgccaagc cgccgccgga    157260
     gccgtttctc ggcacgctgg tatccgccgc ttaccacgac gcggatgttc cgggaaggct    157320
     ccacgtccac gtcgtcggcg cgagggacgt gcccgcggcg gacgtcggcg gcggcgcgga    157380
     cccgtacgtg agggtatcgc tgctgcgggg ggagcgggat gacgacgacg gcggcggcgg    157440
     cggcggcggc ggcggcggcg ggagggggaa gaagatcgcg aagaaaaaca agaaaaagga    157500
     cgactcgcgg aggacgaggg tgagggccaa gacacgcgaa cccgtctggg cggaggcttt    157560
     cgcgttcgaa cacgtcgacg acagggtaga cgacgcgcgt aacaccgacg ctttgctcct    157620
     ggaattgtac gataaagacc tcgtgggctc ggacgacgcg ctggcgcagc tggtgctgcc    157680
     gcttaattcg ctgcccaagg ctcgcgaggg cgaccgcgcc gcgtcgcccg tcgaacacga    157740
     gtggcgcgtg cactccaaga acaggcgcgt cgctggcgag ttgaacctga tgtgcttctg    157800
     ggaggacagg tgagtttatt ttcattttcg tatgggcaaa tcgattgacg tggttttttt    157860
     aaacaggcgc aagacgaagc tgtgcgtgcg ggtgatgcga gcgaaaaacg tcaaggcggc    157920
     ggacgtgggg ggcacgagcg acccgtacgt ggtcggcacc ctccgcgcgg ggacggggac    157980
     ggcaaagggg gtcaaacgcg gggacggccg cgaggatcag acgtaccgaa caaagacggt    158040
     tcgcgcgacg ctcaaccccg agtggaacca caactttcac tttcgagtgt acccgtcgac    158100
     cgaggcgcag gtgagggatt cgcagcggtc gaggcgcggg ttcttgggca cgatcgtcaa    158160
     cgctgtggtc ggtgatcccg cggtccgagc cgcgcgacgc gccgaagcca gggaaaaggc    158220
     gcgaaaggca aaggcggata aggccgccga cgccgaacgg aaaaaacggt tgggggtgaa    158280
     aaggaccggg ctcttcgcgc gcgcgttcaa cggcgacgac gggttccgaa cggacgtcaa    158340
     ggaacgcgcg ctggcgcgcg agcggacgat agaccacgag cggatgatgg tgagcacgct    158400
     gggcggcgac ccgcacaagg cgagcggttt caacgaggag gaggaggagg agggggagga    158460
     attggacggc ggcggcggcg agggcgtaaa ctccggggtc aacgacgtcc gcggtcaggt    158520
     tctcgaactc gacctgtacg acgccgacga cgacgagggg atcttctcgc gaaagaagga    158580
     cgatttcctg gggcgcatcc tggtgcccct cgagcgcgtc gcgaccgtcg cggagggggg    158640
     tgacaaaaaa tcgctgtgga tgccgtggag ggagaagaga gacagacccg tcaagggaga    158700
     ggtttgcgta cgatgctact tcccgagttc cagcccggtg gaccccgagg cggtccctga    158760
     cgatctcgcc gcgaggctcc aagagaagcg cgaggcgcgc gaggcgctga agctccagcg    158820
     cgtcagggat caggcgtggg cgttgtacca ggagctcgag gggcagcttc gcatgcagct    158880
     gctgtgccaa aaatggcccg cggagatcgc cgtcaagtac gcgcgcgcct acgccaggca    158940
     cggtcacgag cacaggctca tcccgccccc gcccgacggg tgcaccgtcc cggcgtcgtt    159000
     ccaccacatg ttcgagacgg cggagaaggc ggcgagggcg tttaatccac ccgccgcacc    159060
     ggagtttccc atggcgggcg cgaaggaggc ttcggcgggc gctcaagatc tcgggtatcc    159120
     ggcacccccc tcggcacccc cctcggcacc cccctcggca cccccctcgg cgcccgaccc    159180
     ggtggagcgc gccaggatcc accccccggt tcccacgtac tcggcggcgc aaaaagaggt    159240
     ggaacgggcg gattacgagc aaacgcttac ggactttccg gaactcgccg acgccgagta    159300
     cgtggctcgg gaacgcgcgg aatacgaaaa aacgcgtctt cgaggagccg cgcggcgagg    159360
     gtgggcggtg gcgaggcgcg tgatggacga gaagagacgg gagctcgcgc gaaaggacgc    159420
     gctcgcggac gacctgctcg ggatggtggc gatggctcgg gagaacgagg cgatggcggc    159480
     ggagattgct cgaatcaagg cgcagatggc ggttttcgag tctctcagga acacggatcg    159540
     cggcgcgtac gaggggccgg gccgattgac gagcacggcg gtggcgccgt acaggcgcca    159600
     agggtacgag cgcagggcgg cgctcgcgga ggaacgaaga aaagaggcgc tgaacgcggc    159660
     ggcggcgaaa aaggcgaaag agtcgcgtca atctgaccgg gagctggagc gaacgaggcg    159720
     acgggcgccg tggtcctgcg cggcggacgc cgggcccgcg gcgcgctaca tggccgcggg    159780
     gggtgccgac aggggtgccg acaggggtgc cgacgggggt gccgacgggg gtgccgacga    159840
     cccgaaccta cccgcgggcg ccgcgaaact cgcggagaag ctcgccgggt ccacgtggag    159900
     cggattttac cgacgtcacg agcgcgccat cgtcgaagcg gtcgcgggct cgaatcccgc    159960
     tcggggcgtc ggcgcgtccg ccgcgacgca cgccaaggcg cgcgccgccg ttctcgacgt    160020
     gggcgccgcg ggcgggacgc cgacgcacgt tttccgcgga cccccgccgc ctccgagacc    160080
     cgccgccgcc gtcgccggcg ccatgttcaa gaccgacgtg tcatccgacg tggcatccga    160140
     cgtggcaccg acatgggagc gcgaggacga cgacgacggg cgcgtcgggc accgcgaaga    160200
     cgagccgccc ccgctgccgc ccgagcgcga ggcgcagatc gcgcgcctcc tgaacgacgc    160260
     ggggggaaaa gaaaaagagc ccagtctgtc caagttcggc ccgaggcacc cggcgcgggg    160320
     gcgaaaagtc ggcacccttc ccgtccccgt cccggcgcgc gacgatcccc ggacgcgcgc    160380
     cccgctcgtc ccggcgctgg acctcaacgt gatcgacggg cgctcttcgc ggggcggtac    160440
     ctctcccgac gacggggggg atgccggttt ggaccgagaa acgtcatcgc cgggaaatat    160500
     tacgcgcacg aggataccgg tcgcggacgt cgacgacgag ggatttgacg acgacggacc    160560
     ggtgccgagg ctggacctgc gcgggctgac aaaaacggcc ggaagaaacg gccgggcgcg    160620
     cgaggaccga aaccaaaacc aaaacgaaaa cgcggcgcgg ccgagccgac tgcggcgaac    160680
     gaccacggtg cgcgcgagga tcgccgccga ctgggacacc gacgacctcg acgcgtgatg    160740
     acgcgcggga cggtacaaag gcgggcgtcg tccgaacgtg tcgtccgatg gagacgccgt    160800
     gttacttaag ttttgtctct aactcggtgt taccgtcgtc agtcgactcg atacccgcgt    160860
     cacgcttttt tgcgcttgag ctcctgcgca gcctcgggta tcttctccag cgtcaccagc    160920
     gacaagatcg tgttccacgc caaacccatc gccgacacgt agagtatgtg atacgagctc    160980
     ggcaccagcg cgaactgcac gccctgcgcg ggaatccaaa acgcccaatt ctgcgccagc    161040
     agcttcaact tgtacttttt cttcatctcc tccatcgact cgtcccacgt gcggccccgt    161100
     acgaacccgg tccacgcgaa gaagaacggg tagtacccca cgcacaccat cccgagctgg    161160
     ttcacgagca gcggcgccag gacgtccttg cgtaggaacc tggccttgag gcccacctgc    161220
     ctggggaaga cagtctgcag gtatctgaac cagtgcatct gaaagtatcc ggtgtagatg    161280
     gcgccgaagg atgcgaacgc ggcgagtctg cgccagtcca tccggaacgc cggcgcggcg    161340
     ccgtccttgg aggtcttggc ggcggagcgg tgctgaatgc gctgcgccat ggtgtcgccg    161400
     aagaggagga taaccacgga ggtgccaacc ttggtcgtcg tcgggtgggc ttcgttgagg    161460
     gcgttgtact tggcgagcgc gcccctgatg ccgcccgacg tctgctgcgc cgatgttccc    161520
     tcgttggacg cggaggagaa tcggcgttgg gaggagaacc gccggtgcgc gtggcgcatc    161580
     cacggcggga ggccggcgcc tccgccgcgc aaccccagcg cgaacgggag gcgacccgcc    161640
     atcgtcaaat gcgccgagcc ttatcggttc ggtcgtgaca cactgaacgc tatttcgtcg    161700
     ctgacgcgac tccgtccgag gggcggtccg gtcctcctca caccggacgc gagcggagtc    161760
     gcgattcgcg gagggtccct cgcgggtcga ccttcgcgcc gcgtccgcgg gaggtggcgt    161820
     cggcgtcggt cgcgatgaag agacagcggc ggaacccgcc gtgcccgcag acggatgaag    161880
     cgggggcgcg cgacgtcgaa caacaacaac aacagcaaca acaacatgcg gacgactcgc    161940
     ccgtggccgc gccgagctcc cgcgtccccg agatcccgca ccaggtgctc cacgagatct    162000
     tccgccgcgt gcttcgcgcg gacgacggcg gcgtacccgc gctcctcgcc gccggcgcgg    162060
     tgtgccgcgg atggagagcc gccgcgaacg accccgcgct ctggtcgcac gtcgcgcgga    162120
     ccagattcgg gttgtacgat ttccccctga acgaccgagg caaccgagag gcggtgcgac    162180
     ggatggcgtg cgagagatcg ttcgcgttct cgtacgctcg cgcgcggtgg tggcgcgcgg    162240
     tgagcggcgt ggtgtcctac cgcgtcaccc tgcatccgcc gcggtctcac gcggagatcg    162300
     tcgacgcgcg ggggggcggt ggcttccagt cggcgtgcat cttagacgac gggctgccca    162360
     cgccgatgac ctactacgga gaggttgccg acgactacgg gtacgtcgac ggcagcgaca    162420
     gcgaggcgga gccggaaccg gacgagaacg gcggtcggga cggcgaacat cgacgcccgc    162480
     tctgttcaat cgtcggctac gaccaaaacc aaaaccaaaa ccaaaaccaa aaccaaaacc    162540
     aaaaccaaaa ccaaaacgcc gacggccaaa accaaaacga tgacgacgac gccagcgacg    162600
     acgactacgt ctgggtgtgg accccggccc ccgacgggag ccttcaaccc accgaacgca    162660
     cgtgcgaacg acgacgcacg ccgcatccgt cgaggcgccg gctgctcaga gacgccgacg    162720
     cgtccggccg acgggggacg tggacctgcg tgatagacgt ccggaagact ccagaagacg    162780
     tccgcgtcac cgaccacgcg ctgatcctgc ggctcccgcc ccacctctcc gcgcgtcgtc    162840
     tggagaatta ctgcgtcgtg cggggaggcg gcgacgggga cggggacggg gacgggttcc    162900
     gatacctgcg cgtctccgtg cacgttcgcg gcgtcgggga cgaaaagtcg gcacccgggg    162960
     ttgggcaccc ggggacggaa agtcggcacc cgcgcgcgct gtgccacgcg tggttgaggg    163020
     tggacggcgg cgacgtcgtc gtggcttccg cggacggcgg gtacggggac gggggaaacg    163080
     cgtcgagcca aaccccgggt gcccactttt catccccgaa aaaacgcgtg gcgctcgtca    163140
     tcgacgggtt cacgcacctc gcgcacaggg ctcggcccgg gcggtgcttc gaggcgttcg    163200
     gggtgccgag gcccccgggt tcgaacaggc gatggctctc tcacggtgcc gagtggggtg    163260
     ccgagtgggg tgccgagtgg gaggacgacg tcatccacgc ccatcaccgc aacaaggcga    163320
     cgcaccttcg cgcgaggtac agggctcggc gggggttccg aggcgagaac aacggcgcgc    163380
     actcgcccgg ggcgcacttc ggcgtcaact acggcgcgcg cgggtgtccg tacgcgctcg    163440
     tcggtagggt aggggcctcc gcgtccgccg ccgggggggg cgcgacgggt ctgatccaag    163500
     cgctcgccga gacgcccatc gcgaaccttt tccaaccgag gctcacgccg gacctcctcg    163560
     acgacgtcgc cgacgggttc atcgcgtcca tgcacttcac gcacgcgcgg gagattgcga    163620
     gtggcggcgg atttggggga tccgtcggcg tccaaagtat cggcggttcg tcatccgccg    163680
     gtttcaatcg gaggtttgat tcaatcacgg attcccccgc cgtcgtcgtc gacaggctcc    163740
     cccgaccccg ccacgtcgac cccgacgtgc tcgtgttcaa ggtgacgggc ggcgcggcgt    163800
     cgcgcgcgat gtcgatcctc gagcgcctcg acgagcgcga cgtgcttccc cggcccgggt    163860
     tcgacgggga cgaccagtgg ggctcggttc gttgccattt ggtgtttacg cacaggacgg    163920
     ggcgcgcgtt cgtctccgcg ccggcgctcg cggcggcgtc gtatgtcgga aaaggtgtcg    163980
     gacaaggtgt cggacacgcg ccggcgcggg gcagccgagc gggccactac ggcgtgacgt    164040
     tcgccggagc ccccgccggc ggatgcacgt accaggtgct gcctcggagg tcgcacacgt    164100
     ggggcgcggg tggtttcggc gagtacgacc cgggcgatac cgtcgcgcgt ccgattcgag    164160
     tcgtcctgtt cgactgcgtc gtggctgttg gtcacagcgt tttggtgacg gtgccggcgc    164220
     gggcgctggt ggacgcgcac gaggctgcgg aacgtagcgt gcggcacgag ctgaaagagt    164280
     tcctcgcgga gaaggagggt aagcggctcg tcgaggaggc aacgcgtgct aggttagatc    164340
     cgtacgagta agagtaagag acgcgcgagt agaagcggcg cgcggcgctg gagaggttgg    164400
     aacgcgagga ggaacggaaa cggcgggagg aggagttcct ggcgaggtac cgcgggaagt    164460
     gagggacggc gatggcgagc tggaggatgg gcattaatca cgactctcat taattcacgg    164520
     cgcgacactc cttgcactga gagcgtacac gaccgtgctc gcagattgag cccccgccgc    164580
     attccttgca cgtagagcgc cgacgaccgt gctcgcagat tccagaccca ccgcagtcct    164640
     tgcacctgtg gcgctcacga ccgtgctcgc agattgagga cccgccgcac tccttgcact    164700
     tacggcgctg acgaccgtgc tcgcagattc cagacccacc gcactccttg caccgagagc    164760
     gtagacgacc gtgctcgcag atttgagacc caccgcactc cttgcacaga gtgcgtacac    164820
     gaccgtgctg gcagattgac gcaccaccgc agtccttgca cctgtggcgc cgacgaccgt    164880
     gctcgcagat ttgagacccg ccgcactcct tgcactgaga gcgctgacga ccgtgctcgc    164940
     agattccacc accaccgcac tccttgcacc tgtggcgctc acgaccgtgc tcgcagattg    165000
     agcccccacc gcactccttg cacttacggc gctcacggcc gtgctcgcag atttgagacc    165060
     cgccgcactc cttgcatgta gagcgtatac gaccgtgctc gcagatttga gacccaccgc    165120
     actccttgca gtaacagcgc tgacgaccgt gcggacaagc gctgcacacc ttgcagttcg    165180
     accggtactt caccccgtgc tcgcatggcc ccttcgtggg agggcccctc ttccgcttcg    165240
     cgcccttgct cgacgcgtcc accttcttca cccccacctc gacgtccaca tctgggagcg    165300
     gcccactcac gttcggccgc cagatcgctg gcatccaccc ccgcgccccg tccaagtgcc    165360
     cacccggtcg actcccgttt gaagctacgg gataaaacat caccttcatg agctaaccat    165420
     ccagtcacga acatgcgcgc ggtgacctcg atgccgtcgg cgtcgtcggc ggtcccccgg    165480
     tggaccccgc ggcgcgcgcc gtcctcgagg aggcgcgtct cctccgaccg aacccccgcg    165540
     cgcgccctcg gctcctcctc cccgacggcg ggcggtcccg gccccatccg tgtcacgtgg    165600
     accggcgggg gcgccgcgga ggtttcgggc gccggcgcga cgttgggcgc gggcgcgggc    165660
     gccgacgcgc gcgtgacgct gccgggcgtc gccgacgcgc acgtcaagct cgaggtcaag    165720
     cagggccggg ttttcgtcac cgcgctcaag gggggcggga gggtcaccct gggggacagc    165780
     tcgctcttcc cgggagtggc gtacgcggtg aaggagggcg cgacgatcgg tctgggcgag    165840
     gaggggagcg aggtgacggt ggagcaggtg gacggaggcg cgggaaccgc ggggatcgac    165900
     atgatgtcga agatgatgca gatgcagttc gaggcgacgc tcaagcccga gatcaagaag    165960
     gcgctcgagt gaagatgggg agcgacgacg cgagcatcga atcgcacgcg ccggtacccg    166020
     ttgtacgttg agaagactac gaaccttcat gcgtctactt taaaacccgc gtccgtggcc    166080
     gcactaggac ctcgcgaggt gaagcctggc gctcgcctgc atcttcgcga ccgccgccgc    166140
     ctccccatcc gacaccgccg ccgccgccgt cgccgccgcg tcgtcgtccg ccttcgacag    166200
     caaatctctc gcgctcgcct gcatcttcgc aaccgccgcg agctccgccg cgtcgagctc    166260
     cgtcgcgtcc aaacccaccc catcatcctc ctcaccaccc tcgtcctcgt cgaagaaaac    166320
     cccctcgccg gtcgtcctcc cgacggagga tggcagcgat cccgtgagcg aaagcgtcaa    166380
     cgcatccgcg gctctcgcga ttgtatcatc cgccgagaga tgcgacgacc cgccgctcgc    166440
     gcccgcgcga tccacccccc tcaccgcgtc cacgacggac ctctgcagcg cctcgatcga    166500
     cccgccgccg ggtcgcgtga gcatcgccgc ggccaccgcg gcggcggcgg cttcttcgtc    166560
     caccccgtcg ccgccgccgc cgggggatcc gtcctcgccg tcgtacactc gaacttcctc    166620
     catctccctc gccgcgagcg cgaggcgacg cgcccggagt tcgcggtcca tccggcatcg    166680
     gaccaggtgc ccgcgcgcat tcgcctggat cctggccgcc gcgcggtgtt cctcctccag    166740
     acgaagcgcc ttgcttcgcg gcgacggagc ccccgggtcc gaatgttccg tcccgccgtc    166800
     cacttcgtct ggatacatcc gaggcgtgcc atcgatcgca cccgtaagat tacccgagtt    166860
     gaaccgaaca tcgtgctcgt ccgggaagga atcgtcgggg gagtcgtacc cggatccggc    166920
     acccgcgccc aatcgcgcgg cgtcctccac gtcggataac gtcgggagtc tcatccggcg    166980
     caccacgtcc gggctggctc gaccagtcac cgccgcccga ccagtcgccg cttccccggc    167040
     tctccccccc atacccccta aaccgccctc ccggcccccg atttgtcctt ccgacggcgt    167100
     caaccccggc gtgctctccg cgcttcccat ccctccgaac gccgccggag acgtgacgtg    167160
     cagacccaaa ggccggccga tgtatcgagc cgccgcgctc ggagccgggc tgggaaagtc    167220
     tccgggcgag tcgacgtcgg cggggtctaa taaagggtcg ttcgcggacg gcgtcatcaa    167280
     tgacgggccc ggggtgttgt taagattagg gtgtttgccc ctcccggttc gtccgtgtcc    167340
     cgtcggcgtc gcctcggcgc tgctggggtg gctaccgtcg gacccgaccg acgacggcgg    167400
     ctgagccaac ggcgcgggcc tacgcgcgtc caataatcgg ttaccgtcca gcgccgagtt    167460
     gttggttttc acgcccttga tcgagcttcg gttggacaag ggcgggcgcg cgagcttggc    167520
     ggtgccgaag cccgccaccc tcggcgggga cacgcgcggg atcgacccca agtccgcgga    167580
     gccgtcgcgt tcgagcatcc cgtcgagccc ctgcgcgagc atcgcggacg actcgggcgt    167640
     gcacgcgcgt atgcccgcct cgaccgcgat tgccgccgcg cgcttgacct cggcgcccac    167700
     gcccagcgtc accgacgacg cctccctcgg cgccgcgtgg tacgacccat cggatgagag    167760
     tttaccccct ccagagagcg aacccacgcc gtactttcgt tccatcgcct cgcgctgctt    167820
     gcgcgccttg ttctcgaggt aggcgcgcat cttttccgac gcctcgaggg ccttggcgcc    167880
     gttgatcttg ccgtggatct tcgccttctc cgcgtcggac aggccgtggc tctcgcccgt    167940
     cccgcccccg ttgttgttgt tactcgcggt tggcgcggct gcggacggcg ggagctttct    168000
     cgcggacggc ggaaaggacg cgcgcttctt gcgccccgag gggttgaccc cgccgatcac    168060
     gagcgcgggc tgcgacgccc cgagcttcga cgcgtcgcct ttgtcgccca tcgcgcgcgc    168120
     tgacacggaa gactcgcctg agggttcggt tcggttcgcg cagatttaga ttctcgattc    168180
     ccttgatccc tcggggcagc cggcaccttc caggtcgtcg aagttcgcgc gcggcgtcgg    168240
     cgtcgcgtcg agcggcttcg gcgtcgccgg tcagccgcgt gcgaacgtac ggggcgcgac    168300
     gtctccgcgc tgccggcgta gtggggagcg cgctcccttc gatcgacgaa ggtcgcccct    168360
     gccaggtcag cggcttgaaa taatcactcg cgcgagcacg agaggagcgt gctgccaaat    168420
     gcggggttga ctttttgaca ctttccgacg cctctgcgcc ggacctaccg gctacgccgc    168480
     cccgacttcc gcggccacct gcctctcgag cctctcaaac tccgcgagct cgtcctcctc    168540
     ctccggtgtg agctcctcga cgaacgactc gtcctcctcg ttcgaagcga cggccctgag    168600
     agcgcgcccg tcccggcctc cttccccctc gtcctcgtcc tcgtcctcct cgtcgctgcg    168660
     gctactcctc cactcctcct cctcgcgcgc cctcgcctcg cgctcctcgc gctcgcgcag    168720
     gacgccaacg tccctctccc gcaccaaagc gcggtatcgc gccaaaaaat caccaacccc    168780
     cgacccgcgc gcctcgtccg tcgagtcgtc gcccgactcg tcaaaaatcg caaccggtga    168840
     ctcaccaccc tccgccgtcg cccgatccct ccctcctttc cgcgccccga cgggatcgat    168900
     ggcacccttc tccttaagcg cgaggcgctt cgcctcccgc gccagctccc gcgtcgcgat    168960
     cttcaccgcg gcggccctcg cgcggtccag aagccgacca cccggatcgc cccacctcgg    169020
     atcgttcaac ctcggatcgt cctccgtctc tttgccgtcg tcgcccttcg tgaggtcgcc    169080
     ggatcgaatc ccaccgccgc cgccgccgcc tcccgtccta tctcgccgga tcaccgtccc    169140
     gccctgccac cggggtagcg acggttgcgt cggtcgaacg gcgtcttcgc gggtgcctgg    169200
     cctcgcctcg ccgttttggt tttggttttg gttttccaac ctttgtttgg ttttggcgtc    169260
     cctcgcggcg gctcgcgcgg cttcccgtct cgcggcggct tcctcccgcc tgatctgccc    169320
     cggcgccttt cgcagcgcga tgggggcgca cgcgggacgg aagagcgagc cgtcgtcggc    169380
     cgacggcgcc gtcccttccg ccgacgccgc gtctatggtc gaatcaaagg acgcggttga    169440
     cgaggatgcg gaggatggtg acgcgtcgtc gtcgtcgtcg tcgtctcggt atcggatcgt    169500
     ctcagcctcg tgcggcgaag acccccggat gggacgcgcg gccggctcgt cgggaacctc    169560
     cgacccgtac ctcggcgcga cgggacgccg cggcggcgcg acggtttcta acgctttgtc    169620
     gtcttcgccc ttttcgtggc tcttttcttc gtcgaagcct ccggcgcttg gacgcgttcc    169680
     cggctgctgc tgccgcggct cgcgcgtcgg ggagcgcgtc ggggacgtcc acccgatgat    169740
     gccgtcgcgc ctcgcgcgct cctccttctc cgcgcgcagc ctctgcgcga gcgaggttct    169800
     cgacgtcgcg tggagtcgcc ccatggacga ggacgaactc ggggaggaga aggaggtgga    169860
     cgcgcgcacg gtgtccagcc ggcgcatgag ctgttcccct tcgcggagga ggtcgcgctg    169920
     ggcgtgggtc agcgcgccgg cgacgtcgtt cccgcgccgg accccggacg ggtggccgcg    169980
     cgttgggccg ccgcgcgcgc ccgtcacccc gccgtcgcga tgatgttcct cctcgacggg    170040
     cgcgttcgat gcgtcgcgct tgcgatgcca caccttgtgc gataccagcg agctcgcgtc    170100
     cgcgaacgtc tctccgcacc tcgcgcatcg aaaccgcgct cgctcctcca cccgcacgat    170160
     gcgcgcggcg cccgccggcg gtacccccgc cgccgcggtc atcaccggtc cctccccgag    170220
     ggcgaccctg gaagtgccgg tcctctcggg cgctcggcgg gaacgacaac gacgcagtcg    170280
     tcacgaatgc cacgggacgc gccaaaagtt ttggcgccac gcaccatggt tgcggtcctc    170340
     gccgcggcgc gggccgcgat ggccgcgcgc gccgccgccg tcgccggcgg caagcgcgac    170400
     gcctccagcg aggacaagtc cggcctcgac gcctccgacg gcgggttcct ccacatgcga    170460
     cgcgtggggc gcgtgaggag catcgccacg tacccgctca agggcgcgcg gggccagatg    170520
     ctggatcgcg caaaggtgtc gctcgggtcc tccacgccgc gcgacaggga gttcgcgctg    170580
     ctgaggcacg agaacatcga gcagttctgg gcgaacggcg acggcggcga cgacgacgag    170640
     gcgcgcgccg gcaggatact cgccacgggc gaagggaagg acccgggcca tcacagcaac    170700
     aaggtgccgc gaaaaaacca aagcgcgcgc gcgttgtcaa ctttcccctc ctcgcccccc    170760
     tcgccccccg cgcgcccgcg ctgacctccc ccatcccccc ctcccttccc ttcccctccc    170820
     ccgatcgcca gcacctgttc caccagctca tcacggatcc gagcatggtg cggtacgcgg    170880
     taaagatgct cggcgaccgc ggcatcgcgg tcgtcgacgc ggcgacgggt cagacgctcg    170940
     tctccgccga ggacgtttcc gacgcgacgc agcgatcggt cgtcgaggcg ttctttggtg    171000
     aggttctcga gacgtcgtcg gcggcgaaac ccccgagttt ggtgcgcgcg cgcgggcact    171060
     cgttcgccaa cgtcggggga cgacccaacg agcacgtgct tcacctcaac gccgcgccca    171120
     ccgtcgagcg gtgctggcgg gagctcgtag cagcggacgc ggaaaattcc gacgggggga    171180
     aagcgccgga atcgctcgaa gcgttcgcgt tgcgttttcg gcccaacctc gtcgtcgagg    171240
     acgctgggga cgggagcctc aagccgtggt cggagctcgg atggtgcggc agggacgtgc    171300
     gcgtcggccc tgaggttgtg ctgcgcataa acgagccgac gatacgatgc ccgagcacca    171360
     gggtgcgtta cgacacagct ggcgacgagg tgctcgtgga cgaagctcag ctcaagatgc    171420
     cggacgtggc gctgcagcgc gcgtttccga gcctgagcgc cgggatcttc gggagggaga    171480
     cgacgctggc ggagaagggg agctacctgg ggctctacgc gacggtgatc cagggtggga    171540
     cgatgtctcc gggggacgac atcgtgctca tcgggtgacg gggagcgcgt caccatcgaa    171600
     ggtacgtttt tacgagtgcg acgcgtgtaa aagatagcgg cgtttgacaa tgagcgagaa    171660
     agtttgagcg cgccgcggtc tcgtcacctc gttccagcct ttgcggcgcg acactccttg    171720
     cacttagagc gtacacgacc gtgctcgcag attccagacc caccgcactc cttgcactgt    171780
     ttgcgctgac gacctgctcg cagattgatg caccaccgca ctccttgcac ttagagcgcc    171840
     cacgaccgtg ctcgcagatt tgagagccac cgcaatcttt gcactgtttg cgctcacgac    171900
     cgtgctcgca gattccagac ccactgcaat ccttgcaata atagcgctga cgaccgtgct    171960
     cgcagatcga tgccccgccg cactccttgc actgagagcg ctgacgaccg tgctcgcaga    172020
     tcgaggcccc accgcactcc ttgcactgat agcgtatacg accgtgctcg cagatttgag    172080
     acccaccgca ctccttacat gtagagcgta cacgaccaag ttcgcagatt tgagacccac    172140
     cgcactcctt gcactcagag cgccgacgac cgtgctcgca gattgatgca ccaccgcact    172200
     cgttgcacct agagcggcga cgaccgtgct cgcagattga gcccccaccg cactccttgc    172260
     acctgtggcg ctcacgaccg tgctcacaga ttgagccccc accgcactcc ttgcacttag    172320
     agcgtacacg accgtgctcg catggcccct ttgtgggagg ggccctcttc cgcttcgcgc    172380
     ccttgctcga cgcatcgtcc tccgtcaccc tcaactcgac accgtcatcg gggggatccc    172440
     tcctcacggt cggccgcaaa atcaacttga acatccccgc gcccctcgcg cgcgccgcag    172500
     agtaaagaca aacggtttgt tttccgagcg agccggctcg cgttgagaca caggacgaaa    172560
     aagcgactca gatggatagt gctggtgctg aagagggcgt gaacgtggcg tccgccactc    172620
     caacggacgc aaggttcgtt aagcgcgcgt ccatcgttac gttccgaaca caatgagcgc    172680
     gttcaccgcg tccgcggtcg ccgcgccgtg cgccgccaag ctgctcgcgt cccgcagatc    172740
     cgtcgcggcg aggacacccg cgatggctgc gaagcgcgtc gccaacaagg ccaacaagcg    172800
     cgcgcccctc tccgtcgccg ccaaggctgg tccctccggc gaggtcaaga aggtgcgcga    172860
     ccgcgccatc cggaactcgt tcgcgcggcc cgatgcgcgg ggagacggcg ccgagcgacc    172920
     tcaccccggc tcggcgccac cgccgcgcaa cgaatcaacc ctcaaaccct gtagccctcg    172980
     tttcgtggtt ccatccgtcc catcgccgtc acgcgaaacc gccgccgctt cgtcgtcgcc    173040
     ggacctgacc cgcccgttcc gccccgcgct ccaccccgaa acaggtcgtg ctcgcgtact    173100
     ccggcggcct cgacacctcc atcatcctca agtggctcca agatacctac ggctgcgagg    173160
     tgatcacctt caccgccgac ctcggccagg gcgaggagct cgagcccgcg cgagccaagg    173220
     ctgagcagat gggcgtcaag caggtactgt ttacccacac gtccactaga tatcgtatac    173280
     cgttacaatt gcgtatttcg catttcacga gtatttcaca atttctgacc gacgtccccg    173340
     tgcgtgtccg catcgcagat ttacatcgac gaccttcgcg aggagtttgt ccgggactac    173400
     gtcttcccga tgttccgagc caacgcgata tacgagggca cctacctcct cggcacctcc    173460
     atcgcccgcc cgctcatctc caagcgccag atcgagatcg ccaaggaggt gggcgccgac    173520
     gcggtgtgcc acggcgccac cggcaagggc aacgaccagg tgcgcttcga gctcgggtac    173580
     tacggcctta aaccagacat caaagtcatc gcgccgtggc gcgagtggga cctcaactcc    173640
     cgcaccaagc tcctcgacta cgccgagaag aacggcatcc ccatcgcaaa gaacaagcgc    173700
     caggaggcgc cctactccat ggacgccaac ctcctccaca tctcctacga gggtttggcg    173760
     ctggaagatc catgggtgga atacaccgag gacatgttca ccaggtccgt cgcgccggaa    173820
     aacgccccgg acacccccac gtacctagag atcgagttcg agaagggcga ccccgtcgcg    173880
     atcaacggcg agcgcatgtc cccggccgcc atgctcaccg ccctcaacaa gtacggcggc    173940
     gacaacggca tcggtcgcct cgacatcgtc gagtcccgat ttgtgggcat gaagtctcgc    174000
     ggggtgtacg aaaccccggg tggcaccctg ctgctccacg ccaggcgcgg catcgagtcc    174060
     atctgcctcg accgcggcga gtcccacctc aaggatgagc tcatgccgcg ttacgctgag    174120
     ctcatctaca acgggttctg gttctccccc gagcgcgaaa tgttgcaggc ggccatcgac    174180
     aggtgcgccg agaacgtcaa cggcaccgtt cgagttaagc tctacaaggg taacgtggac    174240
     gtcgtcggaa ggaagagcgc gcagtcgctg tacaacgcga acatcgcgtc gttcgaggac    174300
     gacggcggcg cgtacgatca gaaggacgcc gccggcttca tcaagctcaa cgcccttcga    174360
     ctccggacgc tgggcaccca gcgcggggtt ccgaagtgat gacgacgagt gaggttatgt    174420
     tttaaggtaa tgttattaac gctcgacggg acgcgagtga cgacgcggga cgaggcgagg    174480
     ggcgggcgga gttcgttcgg accgcggatg agttttggtt attaggggtg cgggcgcgtt    174540
     gttatgatac gacgacacgt agtgatctta ttttcggtgc cgcgcgtgac gtcgtcccgt    174600
     cgccgggggc gccggtgatg tatggttttc gaccgcggac attcgcggcc aaccgttcac    174660
     ggcgacgagt ggctgagaga agctcgacct aggccacttc gacgcacgcg ccggtggatg    174720
     acgatgacgc gcgcgccgcc gctcgccgcc ctcgtcgcgc tcctcctcct cgcggtgcac    174780
     cggtgcgacg gcgcgatcca cccgtaccgc gccgccaggt tcaccccaac cgacggcgcg    174840
     cacgtcctcc gcgcgggtcg cgagggcctg tacgcctcgg tcggatcgga ccatcggagg    174900
     cacgacgtca aaggggactt cgcgttgagc gacggcggcc gcgggcacga gaaggcgtac    174960
     gtgcgcttcg aggacgtgga gttccggcgg tcgcggtcgc acgcgtcgcg gttcaccggc    175020
     gccgacagcg agggcaagga cactggcgcg gtccacgccg tgctcttcga gctcaaggat    175080
     cactttcgga tagggtggac cgacccgcgc gcgggcacgc gccacctctg ctgcgattcc    175140
     cccgacctcg tcgccgacac cgggtgcgtc atgaacgacg tcctcatcgc cccgccggac    175200
     gacggcaggg aaccagagcc cgggtggccg tgggtccgcc gcgtcgagtt tgtcggcgat    175260
     cacgccgtgc gctcaatgag cgccgagcaa gtcaccgtca cgcgcgacgg catgtactac    175320
     ctatggttcg tgacgtgcga cgcgtcgttg ggtgagtcac tcaccgtcac cggtcgcacg    175380
     acgtggcgca acccgcacgg ctacctcccg ggcatgatgc gtcacacgcg tcccttcttc    175440
     gggacgctgg cgctggcgta cgggggactc gttttttggt ggacagcgaa ggttgccaaa    175500
     gtacacgtca aacgccccga cgtcgtcacg cagctgcacc actgcgtcac cgcggtcgtc    175560
     gccgcgtcct tcaccgaggc gttcctgtgg tacgccgact acgagtactt caacgcggtg    175620
     ggcgtaaggc ccgtcgcgct caccttactc gccgtatttt tctccgcggc gagagagagc    175680
     gcatcgcgaa cgctcgtgtt ggtcgtctcc accggatacg gcgtggtgcg tccgacgctg    175740
     ggtgggctga gcacgaaagt ggtggggctt ggtaccgcgt actttgtcgc cgcggtggcg    175800
     ctggacgtgg cgacgcacgt gggaaacgtg gacgacttaa cgcagaccac gcgggtgctc    175860
     ctcgtcgtcc cggttgcgct gatggacgcg acgtacatcc tctggatatt ttcgtcgctg    175920
     tcgcggacgc tgacgcagct ccgcgcgcga cgacagctgg cgaagctggc gctgtacgcg    175980
     cggttcacca acgtcctcgc cgtctccgtc gtgggcagcg tgatgtggat tttatacgag    176040
     acgtggtttc gcgccaccga cgctttgaac caaaagtggc aggtggactg ggtcgtcggc    176100
     gcgttttggc acgtcctgtc gtttctcctc ctcggcgcga tttgcgtgct gtgggcgccg    176160
     agcgacgacg cggcgacgca gttcgcgtac ggcgaggtat cggggaagga cgacgcgacc    176220
     ggggcgatgt tcgacggctt cgaggggtgg gatttcgggg acggagacgc gagtggcggc    176280
     gggtactcgg atgaggagga tggacgcgaa cgggagatgc gaaaggttcc ggccgggcac    176340
     atgggagggg gtaagggcat gggcgtgggt cagaccccgc tgaagggcgg cgacgtgttc    176400
     ctgatggact cggacgacga gcgggaggcg cggctggcga gggataagat gcgatgacgc    176460
     gaatcggatg atatatttta tgatgcccgc cgccgctacg agtgcgttgt atctcacccc    176520
     gttcgagcct ttgccgcgcg acactccttg cactgagagc ggcgacgacc gtgctcgcag    176580
     atttgagacc catcgcactc cttgcagtat ctgcgctgac gaccatgctc gcagattgat    176640
     gcaccaccgc actccttgca ctgagagcgt acacgaccgt gctcgcagat ttgagaccca    176700
     ccgcactcct tgcacctgtg gcgctgacga ccgtgctcgc agattccaga cccaccgcac    176760
     tccttgcagc tatagcgctc acgaccgtgc tcggagatgc gagacccgcc gcactccttg    176820
     cactgagagc gctgacgacc gtgctcgcag attccagacc caccgcactc cttgcacctg    176880
     tggcgctgac gaccgtgctc gcagatttga gacccaccgc actccttgca cctgtggcgc    176940
     tcacgaccgt gctcacagat tgagccccca ccgcactcct tgcacttaga gcgtacacga    177000
     ccgtgctcgc agattccaga cccaccgcac tccttgcagc tatagcggcg acgaccgtgc    177060
     tcgcagatgc gagacccgcc gcactccttg caccgagagc ggcgacgacc gtgctcgcag    177120
     attccagacc caccgcactc cttgcactgt atgcgccgac gaccgtgctc gcagatttga    177180
     gacccaccgc actccctgca ccaatagcgc tcacgaccgt gctcgcagat tgcgccccca    177240
     ccgcactcct tgcacgtaga gcgtatacga ccgtgctcgc agattgagcc cccaccgcac    177300
     tccttgcact tagagcgtac acgaccgtgc tcgcagattc cagacccacc gcactccttg    177360
     cagctatagc ggcgacgacc gtgctcgcag atttcagacc caccgcactc cttgcactgt    177420
     gtgcgcagac gaccgtgcgg acaagcgctg cacaccttgc acttcgaccg atacttcacc    177480
     ccgtgctcgc atggcccctt cgtgggaggg gctctcttcc gcttcgcccc cttgctcgac    177540
     gcatcgtcct ccgtcaccct cacctcgaca ccatcatcgg ggggatccct cctcacggcc    177600
     ggccgcaaag tcaacttgaa catccccgcg cccctcgcgc gcgcggcaga gtaaagacaa    177660
     acggtttttt ttcccgacga cgacgcagag gcgcagccga gccgcgaccg ttcagtcatc    177720
     aagtcaccca tcgtcgcggg ccgcccgtca gtgctcgagg cgcgcccggc cgccatggct    177780
     ccgcgcgtca acgggttccg cgacgcggac gggcgcctca gcatgaacgc gcaccagtgg    177840
     ctcggcatcg gcgcgtacgc ctcgctggtg ctcgggttct acctgctgca ggcgcccgcg    177900
     gttggggact cgacgacgag gctcgcgctc gagatctgct acggcgccgt cgcgctcgtc    177960
     gccgcctgcg cgttcgtcaa ggcggcggcg gtggacccgg cggacgacga cgacgacgat    178020
     gacgacgagg ccgggctgtt ctgccagctg tgcgatcgta acgtgcacgc cgggagcaag    178080
     cactgccgcg cgtgcgacaa gtgcgtcgcg cactttgacc accactgcaa gtggctgaac    178140
     aactgcgtcg gcgcgaggaa ctaccacagc ttcttcgccc tcgtcgcgac ggtgctgtgg    178200
     caggtgttgg gacagctgtg cgcgggggct tggctcctcg cgtgggtgag ccgaaacccc    178260
     gcgcgcgcgg acgccctgct cgacgacgac gcccgatttc cgtcgcacct gacgcgactc    178320
     gagtttcaag ccgcgctcgc cgcgtatctg ctcctttgcg tctgcctcgg ctacctcgtc    178380
     ggggacctct tcgcctttca cgtcttactc atccgacgcg gcatgaccac gtacgagtac    178440
     atcgtgtccc gcagggaggc ggacgacgac gacgggcgag gggggggacg cgacggggct    178500
     ggtggagcga ggcgagccga ttggaaagtc gccaaggggg gcgacgtgct tcgatgcggg    178560
     tggtgcgccg ggaacagggt cggcgtcggc gacgaagacg acggggacgc gacgggaggg    178620
     gggacgcgac ggaagaggaa gagggtcgcg gtgtcgtgcg tcggtcttct cttcgcgcgc    178680
     ggcgtcggcg tcggcggcgt cggcgtcggc gcgaatgatg cgccgggtcg ccagggtcgt    178740
     cgccggggcg gatcctttga cggccctcgg ggcgtcacgg aatcgtcgtc gtcggcgggt    178800
     aagccgtcgc gagcttcggg ggacgcggac ggcgcgcagg gcgacgtcgc ctccggcacc    178860
     gggcgacgcg ggagggagga ggggtaccgg gtgagcgggc tgggcggcgc catggaggat    178920
     gatgacgcga tggacgacga cgacgatttc ggcccgcatg ggcttcgagg gttgcggccg    178980
     ccgtcggaga gcctcgggtc gttgcgtgcg ccgggggcgg tgggaggcgg gagcgcgagg    179040
     ggggggacgg ggatcgggcg atcgggctcg ggcgtgaggc cggtgtcggc gcgcgagtag    179100
     tgagcgtttg tagccgtagc gggcgtttgg agcggagctg tgtcagtcat caggctctct    179160
     ggcgcggaac gagatccgca tcgcgcttta tcgttcctca atttacccta gccagcctca    179220
     tcgttcctcg cgcgcgccga gcgcacgtga tcatcggggc gtgccgagtc tcggcggcat    179280
     cctcgcgtcg ctaccgcgcg cgcgtgcgcg aaggctgcga cgggcggccg cggcgcggag    179340
     cgctcgcgtc gaggcgccac tcagtcgagg cgtcgcggat tggtaatttc gtcctcgggg    179400
     tgaacgtgca cgagggggcg ccatgcagag ccgtggcgcg gactacggcg aggacgagta    179460
     cgtctcggtg attccatcga gcgacatcga ggcgcaggtg cgggtgacgt gtccggataa    179520
     gaccggcctg ggttccgaca tcacccgcac gatattcgac ttcggcttcg tcgtcctcaa    179580
     gggcgacttc gccacggacg gcaagtgggc gttcgtgctc gtgacggtgc gcaggcaggg    179640
     cggaggcgcc gagacgagcg cgccggtgaa ctgggacctg ctgcgcatcc gcctcgagaa    179700
     cctctgcccg agcaaggcgt ccatctcgac gctgtcgtcc ctgaacctgc gctccgtggg    179760
     cgaggttcga gatcccctcg agccaccaaa gggaaccatg tacatcctgc aggtggaggt    179820
     ggaggaccgg gtgggcttac tccacgacgt cacgcaggag ctctgggcgt ccgagctgac    179880
     ggtgcaccgc gcacacatct caacctcccc agcggacacg gccgtggacc tattctacgt    179940
     caccgacgaa cggaacgagc tgcccgcgga ggcgcgggtg gcggagattt ctcgaaacgt    180000
     gcagcgcacc gccgtgcgac aaacgttcgg agaatcgggc ggcggcgcgc tggcgatggg    180060
     cggtcggcac tgccgcgtca ccgtcacgcc ggcgcccaag ttcgtcacca agacgagcag    180120
     cgcggggcgg ctcgtggagg ccaactccat cgggaagatc gagacggcga gcgcgacgca    180180
     gtactcggaa gccaccgtca ccgtggacaa tctcatgtcg cagaagcaca cggtgtttca    180240
     gatgcgcact cgggaccgca agggcttgct ctacgacgtg ttacgcgcgt ccaaggacct    180300
     gaaggtgcac atctcgtacg ccaaggtgga gctgaagagc ggcgggctgt gcgaggtgga    180360
     cctcttcgtg gcgaggtgca cgaacttgca ggagcagcgg tacctgtgcc agaggtacaa    180420
     ggaaaacatc gagaggccgg tgagcgtcca gatcatgacc atgggtctgg acgagatcac    180480
     cacggagctc cgcgtcatcg cgcccctgga catcagcggc ttcacccggc cgcgagtgct    180540
     cctggacgtc acggaggcgc tgcggcagct caaggtgatg gtgttcaagg ctgacatcat    180600
     cataatgaac ccggatggcg gacgcggctt ggacgcgtca ggggggggta tcgggggatc    180660
     ggcgcactcg tcgccgtcgc actcgagcgc cgcggtggga ccgccggggg cgacgaggca    180720
     ggaggtgcac aggttcttgc tgacggacgc caggggacag ccgatcagca gcgtgcggga    180780
     taggaaggtg atatgtaacc gggtgctcgg ggtgctgttg cagtgagcga gcgggggacg    180840
     tgtacgaaca agttgatgat gtaaaacgtc gcatcgtatt tttttttgaa tttttgttta    180900
     ctcccgtctc tctcaaatct cttcattgga tcgccaatcg agctcagcct ctacctcttc    180960
     ccgcagcctc ttttttgcgt tagcggcacg catcctcaca ttcattaacg caacctcatc    181020
     attgtgaaga gagaacgggt acgcggaaag cacggcatca ctgccctctt cgatctttct    181080
     cctttccatg tacgctatct gatgcggagt tggctcaacg acattgccgg atcgatatgc    181140
     gatgtatgct tcctgggaga cgacgacgtc ggtgggagtg accttggccg ggaggcggcg    181200
     agcagccctc tcggcttcgg tgagttttct cgtggcggcc ttgtcgcgtc gcaaggcaaa    181260
     gcagcccggc cacatgctca catacgcagt aaacagcttc cccgcgtcgg tggtaaggtg    181320
     gaagtcaatc agcggatgaa acgcgctcat gtttatgcaa tagtcatata tcagatggtg    181380
     agaggttcgc tcagacttgg gcaaggtttt gagttctctt tgactgggag ttgaagttac    181440
     gtaaaggctg aacccttcac tgtcccctac gacagcctcg tagcgaggtc ggatgtgcgg    181500
     cttaagcagc tcaacgaggg ggcgcgagta ctcagcgttt gcgaggtact ggtcgaacgc    181560
     atctttggct ctctgcagtt ccgcttcagc ctttttaccg agcttgggcg ctcgagcgta    181620
     aaaaccccgt tgggtcggtg ccacgagctt tgcgggaacg aggatgggtt tcttcatgtt    181680
     ctcacggtcc gcggcggtcc aaaagccggt atccacgtcg ccagaatcat cgtcgtgcgc    181740
     gttcgcgtga gcgccgtcca tctcctcggt cggcggcgcg agtcgaagtg gcagagggag    181800
     tttgaaaact caagcaacga ccacttgttg ccgatgcgac aggactcttt atttttcgac    181860
     cccccgaagc tggtcgcctc tccctttgcg cgcacacccc cgcgcgctcg ccgccgggtt    181920
     cgcccaaaat ccgaatggat cccgccgcac atctcccctc gcgcccgctc gagcccctcc    181980
     tcaggctcgt caaccggctt caggcgcgtc gcacgaagcc cccctagcta ggcaccctcg    182040
     gcaacccgaa cccgcaagac gttgacgctg acgcgccccg cgccccacca ccacccgcga    182100
     aaccccacca ggaggcgtgc gcgctcgccg gcgacggcgt cgacgcgccg cgccgccagg    182160
     atctcccgtc cctgtggcag tgcctgcccc agatcgtcgt cgtcggcggg cagtccagcg    182220
     gcaagtcctc cgtcctcgag gctatcgtcg gccgagactt tctcccgagg ggcgcgggga    182280
     tatgcacgcg ccgcccgctc atcctgcagc tgcactgcgt cgacgacgcg gagaaggaca    182340
     ccgcgaggtt cctgcacaag cccgacgagg tgcgaaacgc gccgatacgc ggtcgggtcg    182400
     ctcaactcgc ctccatcatc tccactcgtt tacgcctccc acccctgaac gtcaccccaa    182460
     aactaacgcg ccccgaccga ctgccccgca ggtgttcgac gactttcgca aggtccgcgc    182520
     ggagatcgaa gccgaaaccg accgactcct cggcgcaaac accaagtccg tcagcgccga    182580
     gcccatcgtc ctctccgtcc gaagcaaaga cgtcccaaac ctcaccttgg tggacgtccc    182640
     cggactgacc aaagttccaa ccgccgatca acccgcgtcg atagtgcgag acatcgagtc    182700
     catggtgaag aaattcgtca ccccgccgga cgtcatcgtc gtcgccgtgt ccccggcgaa    182760
     cgccgacatc gccacgtccg acggcgtgcg catcgcgagg gaggtggacc cgggattggt    182820
     tcgaaccgtt ggagtgctca ccaagctgga tctcatggat cgcggcaccg acgcttcgga    182880
     ggtgctcgcc ggtcgagccg tgcggctgcg gctcgggtgg tgcgcggtgg tcaaccgatc    182940
     gcagttcgac atcaacgcca acgtggacat ggcgaccgcg cgagccaacg agcggtcgtt    183000
     cttcgacgag caccgcgcca agtattccaa cgtcaactgc ggcacgggcg tgttgacgga    183060
     gatgttgacg gcaattttgg gcgactcgat ccggcggcgg gtcccgagga tacgagagac    183120
     gatcgacggt gccgcggcgg cgctggagct cgagctcatg accctgggct cccccgtgcc    183180
     gagcgacaga ggagcgttga tgcacgaggt gctgctgtcg tgcggcggtt tcgaaaagga    183240
     gttcgtcaaa tcgctcgacg gcggccgcgg gggcggcgag actatccgcg tcatcttcga    183300
     ggataagctc gtcaactcgc ttcgttcgct gaacctgcgc gagttttacg gcgccgagtt    183360
     cgtcaagtcc gtcgtggacg cgacggacgg gtaccagccg cacctcgtcg cgccggagct    183420
     gggcatcagg cggctgatcg agctcggttt ggcgaggctc cgcgacccga cggcgcagtg    183480
     cgtcagagcc gtggacaggg tgctccgttc catggtggag cgctcggtgg aggacggcgt    183540
     gggcgcgggt ttggggacgt taggaacggc gccttcgtcg gcttcgtccg gcggtgggcg    183600
     gggctcttcg tcgtctctcg acggcaccct cgacggcacc ctcgacggca ccctcgacgg    183660
     cggcggcggc cgcgataggc ttcggaggtt cccggcgctg cgagccgcgg tggcgtcggc    183720
     ggcgtacagc gctctcgacg cccgtcgcga cgagtcggaa aagatggtcg ccgcactcgt    183780
     ggacatggag gcgtcctact tcgacgccga cttcttccgg aggttcaccc gcgaggagca    183840
     ccttcggagg tataataacg ccgcgtccga gcccgacgaa tcgagtcccc cgactttgga    183900
     cgaagcgtcc gacggtcgtc ccacgaaacg gtccgacgaa acgctcgact gggacgacag    183960
     ggtcggtctc attcgagcgt ctgtgtacgc gtacgtcgac gccgtgcgaa cgagaatcgc    184020
     caaatccgta ccaaaagcgg cggtgcactg ccaggtggtg cccgcgaggt ccgggttact    184080
     cgccgacttt tacgccaact tggggggtaa gacccaggag gaactggcgt cgctgatggc    184140
     ggaggacgac ggcgtgggcg agcggaggga ggcgtgcaag acgcggctcg gtctgttgaa    184200
     tcgcgccagg gcggagatcg ccgccgtcgt gggttgaggt gaggttctct tatacaacac    184260
     cctacgctaa tagaagcaca ccgtgtagat gggccgccgc cccacctcgg cggcgaactt    184320
     gtccatgatc tcgtcgcact cgcactccca atcgtcgctc gcgtcgatca tctcgcacag    184380
     cttgagcgcg tgcggccccg cgttgagcgc ctcctcgtgc gagtcgatga cgtccaggtt    184440
     gatcaccagg agcggctccc ccgaaccccc cacgcgtccc ttcaggtcgg acaccacgtt    184500
     gtcgaacacc ctctcctcga agcacacgac gacgtcgacg tcgacctcgc tgtcctgcca    184560
     ccgctgcggc gcgggtttga tcgtcatgtt gcgctccagc atgtccttca gtccgtttcg    184620
     cgtgtagagc ttctcgtcct cggccatgag cttgtcgtag atgtccttgt acgtcacgct    184680
     gccgaactcg aagacgttgg ggttatcgcg gctcgcgccc gggagcttga ccctgttccc    184740
     cgcgccgtag gacttgacgt ccaaaccggc gttgagggcc accttgtgcg cctccatgct    184800
     gcggttcatg ttcgccgcgc acaccatcgc gaaccgcttc gcctcggcca tgatcgacga    184860
     cggatgggca cctcgattgg aggctgcgcg ttcgagcgat gccctcgcgt cgagtcgagg    184920
     gatcggcgcc tcgtccgaga cggcgcggcg cgcgcgcgag ctgcgtgtgc cggagtgttc    184980
     ggccggtcgg gtcacgaccc cgcgctcgcg actttgcggg agcggggggt gcggcggcga    185040
     ccgtgaaaca attcgggacc gggggcccat aacctggcca gttggaacca accgcacgac    185100
     gcacacccat cgctcgtctt gacgtttgaa tgcctcggtg cgcgcacacg ccccaggcgc    185160
     ggtcggcaca cccacccggt agcgacgcct caagaagcga gttcacgcga cccgcgaacg    185220
     aacgcaccgc cggaatcgaa tccgatccaa acgcgtcgtc gcccgcctcg ctccagtcgc    185280
     gacgcgccag atcgtaccgc gcttcgccca acgcgacgta cttagggttg ccacgagatc    185340
     tcgggcggtc gtcgcggagt ccgcgcggag ggtgaggacg agagtttacg ctcggtgcaa    185400
     acgcacgaga cgcgcgcgcg atggacgtca tcttcggctt cgtgggcgat aagttcgccg    185460
     tggtcgtcag cgacaccatg gcggtccagc agatcatcat caacaaagac gacgaggaca    185520
     agacgctgga gctcgactcg cacaagctca tggccatgtc gggacccaag ggcgactgcg    185580
     tctacttcgg cgagtacatc caggccaaca tgaagctcta cgagctgcgc aacggcatga    185640
     agctctccac gcacgccgcg agctcgtaca ccaggaacca actcgccgaa tccctgcgca    185700
     agggaccgta ccaggtgaac ttactgctcg cggggtacga cgccgacgtc gatgaggcca    185760
     gcctgtattt catggattac ctcgcgagct gtccatgatc tcgtcgcact cgcactccca    185820
     atcgtcgctc gcgtcgatca tctcgcacag cttgagcgcg tgcggccccg cgttgagcgc    185880
     ctcctcgtgc gagtcgatga cgtccaggtt gatcaccagg agcggctccc ccgaaccccc    185940
     cacgcgtccc ttcaggtcgg acaccacgtt gtcgaacacc ctctcctcga agcacacgac    186000
     gacgtcgacg tcgacctcgc tgtcctgcca ccgctgcggc gcgggtttga tcgtcatgtt    186060
     gcgctccagc atgtccttca gtccgtttcg cgtgtagagc ttctcgtcct cggccatgag    186120
     cttgtcgtag atgtccttgt acgtcacgct gccgaactcg aagacgttgg ggttatcgcg    186180
     gctcgcgccc gggagcttga ccctgttccc cgcgccgtag gacttgacgt ccaaaccggc    186240
     gttgagggcc accttgtgcg cctccatgct gcggttcatg ttcgccgcgc acaccatcgc    186300
     gaaccgcttc gcctcggcca tgatcgacga cggatgggca cctcgattgg aggctgcgcg    186360
     ttcgagcgat gccctcgcgt cgagtcgagg gatcggcgcc tcgtccgaga cggcgcggcg    186420
     cgcgcgcgag ctgcgtgtgc cggagtgttc ggccggtcgg gtcacgaccc cgcgctcgcg    186480
     actttgcggg agcggggggt gcggcggcga ccgtgaaaca attcgggacc gggggcccat    186540
     aacctggcca gttggaacca accgcacgac gcacacccat cgctcgtctt gacgtttgaa    186600
     tgcctcggtg cgcgcacacg ccccaggcgc ggtcggcaca cccacccggt agcgacgcct    186660
     caagaagcga gttcacgcga cccgcgaacg aacgcaccgc cggaatcgaa tccgatccaa    186720
     acgcgtcgtc gcccgcctcg ctccagtcgc gacgcgccag atcgtaccgc gcttcgccca    186780
     acgcgacgta cttagggttg ccacgagatc tcgggcggtc gtcgcggagt ccgcgcggag    186840
     ggtgaggacg agagtttacg ctcggtgcaa acgcacgaga cgcgcgcgcg atggacgtca    186900
     tcttcggctt cgtgggcgat aagttcgccg tggtcgtcag cgacaccatg gcggtccagc    186960
     agatcatcat caacaaagac gacgaggaca agacgctgga gctcgactcg cacaagctca    187020
     tggccatgtc gggacccaag ggcgactgcg tctacttcgg cgagtacatc caggccaaca    187080
     tgaagctcta cgagctgcgc aacggcatga agctctccac gcacgccgcg agctcgtaca    187140
     ccaggaacca actcgccgaa tccctgcgca agggaccgta ccaggtgaac ttactgctcg    187200
     cggggtacga cgccgacgtc gatgaggcca gcctgtattt catggattac ctcgcgagct    187260
     gccagaaggt gaacagcggc gggcacgggt acggcggcat gttctgcctc tcgctgttcg    187320
     acaagcactg gaaaccccgg atgacacgcg aggaggcggg cgacttggtg gacaagtgca    187380
     tcgcggaggt gcgcacgcgg ctggtcacgg cgccgaccaa gtaccacgtc aagatcgtcg    187440
     acaaggacgg gacgcacacg acgctgtacg actgcgtgga gaaggcggcg cagaaggcgc    187500
     gggacgaggg taagtgacgg tgttaagtct gtctaggcga ttcgaatatg atgatgttgc    187560
     gagtaaaaca gacaaggtgt gtcgatccga gtcgtcgaca agacgtggaa actgtcaccc    187620
     tcgatcgccc ttaatcgacg cgtcgaccgc cgccctcgcc cgcgcgagcg cctcgagacg    187680
     cgcggccgcg accgcgggta tccccgtcgc ccgcagcccg acgtgcgccc ccgcggctgc    187740
     gaacctcgcg agttgttccc gcgccccgga cgaggacgac gccgccagct gtgtgtgcgt    187800
     cttttcgcca gctgtgtctt tcccgccggt tgccaccgcg agcgtcaccg ccgcggcgtc    187860
     ggtcgcggtc gggggcagcc tcgtcggggg tgcgacgcct aggctcgcga aagacacggt    187920
     cggcggcgtt ctcgacgccg cgagccgcga tgccggcgcc cgcgaacgct cgcccgactt    187980
     ggctcgagtc gccgaccgcg tctttcgagc gcccccgtcg tcgtcctcgt cctcgtcctc    188040
     gtcgggtccg cctcgtcgtc gtctgcggga gagcctcggt tcctccgccg ccagctgcgt    188100
     ctttcgcgtc gtctcgaccg aagcgggcgc cgccgacctc gcggcggcgg cggcgcgaac    188160
     ccgacgcgac gcgtcctcct ctcccgtgct tttgcttttc gctttttgct cccgccctcc    188220
     gcttttgctc tcgcgggagc aggcgtgcgc gcgcgggctg cggcggacgc ccgcggcgcc    188280
     gcggtcgcgc cgttcgcgcg gctgaatccc gcgcggctcc tcgcgcgcgt cctcgaccgc    188340
     gctcgcgggg acctcgcggc tcggcgcgtc gcgcggcggc gacgtcgtcg tcgctcggtc    188400
     gtcgttgttg ggacgacgaa aaacaacgac ggcctcctcg ggggcttcgt gcgtgccccc    188460
     cgcgcgcgcg cggttgccgt gggaaagcac caccgccttg atggcgtcga acgatgccga    188520
     gcgcatgccg tcttcgtcgg gtcgaccgcg tcgtgtgggc gcgagaggcg aaagaggcgc    188580
     gtgtcgaacc tcgacgggcg cgggatacgt ccgagggaaa cgcggcaccg gcagctgaca    188640
     gaaacagaca ggaactagaa acagaagcac atttacaaac ttggacatat tgaaatactg    188700
     tggtctacgc gcgcgactga gatgcgacca tctccacctc accgccgcga gctggctagc    188760
     cggaacgaga acacggtcac gcgcgcgagt accacggcgc cggggacgtc gcgcggcgct    188820
     tcgcctcacc ggcttcagac acggctggcg gcgaaaagac acagctgtcg acgacgatgc    188880
     acgcgaagag gtacgccgtg tcctcgcgct cgaacccgct tggaactccc gcgcttctca    188940
     ctgcttagac atcgtcatct ccagcttgga cagccgggcc tccgtcgcgg cgcactgcgg    189000
     tcgggggatg ggacggcggg gcagtcagcg gtcggcgtcg ggcgagcgga gagaaggacg    189060
     cgagtggaga gaactcgatc tgatgatctt ccgttggtcg gggcgtccgt cgggtcgggg    189120
     cgaggcggcg gcgccggcgg tcgggatccg cgcgggtcag agggcgcacc tggtcggcga    189180
     gtatcttgtg gctgctccag atctcctcct tgagcttgta catggagatg ccgctggcgc    189240
     acgcgaagcc gaaagcgaag gacgtgatcc gggtgcccaa catcctcgtt ccgaccctct    189300
     ctcgggggtg ttttctcctc ccgctctcct cgaacgcgcg cgcgttctcc gctgccgtcg    189360
     agtgcttcgc cgggttcgtc gacgcgcggc tcgggcgcgt gaccgtgtgg tcgtcggagc    189420
     gcgggcgtcg agggttgggc ccctttcgcg ctcgggaatg atttttaggt ttgcgaggag    189480
     ggagtccaat aaaacaagat cacaccgaag cgcgcccggg cggacacgtc gtgctcgatg    189540
     cgcgccgcgg cctcgacgat gacgacggcg tcgctatccc agtgccgccg cctcgcgcac    189600
     cacgcgcgct ggcgaacccc ggatccgcgt tcgtaccgtc gcggagcctc ctcccgtcgc    189660
     agccttaatc gcgtcgtcgt cgtcgccgcg gacgggaggt tccgcgacga ggccgagcga    189720
     cgcgcggcga tcgaccgcct gtccccgccg tccacgtccc gaagcaccga cgacggcggg    189780
     gacgcgcgcg acgacgacgc ccgcgacccc gcgaaggcgc cgcgcgtccc gccgccgaag    189840
     atcacgcgcg acgcggacag gacccgcccg aggcgcttca aggatgcgct cgacgccgac    189900
     cgcaggcgca aggggggcgc cgtcggaagg accgcgcgga tgcccgcgaa cgacgaggat    189960
     ccgcccgccg acgtcgaccg cgaggcgctc gcgcgggagc tccgcgagcg tcgacgcgag    190020
     cgacgcgtcg cggcggtaga gtcggaagcc gccgatagac tcgcgtccat cgttcagatc    190080
     gttcgcgccg agctcggaga cccgcgcgtt ctcatctcga gctcgatgga cggcgaggcg    190140
     cggaacaagc gcttcgcggc gctgtacgag cgcctcgaag gcgtcgggac ggtggagatc    190200
     gcgttcgcgc tggtcaagta ctactggacg tattgggacg aggcggaggc gggggaaacc    190260
     tcggagaagg cggcgttcgc ggcggaattg ggggattcga aatcgacgtc ggaggaggag    190320
     aacgatacat cgacatcgtc gtcggagaat aaggagaatg aggatgatga ggaggatagg    190380
     tcgacgtacg acgaagccgt ggacgaaaag acccggcgcg cgttgcttcg tgcggcgcag    190440
     ctccgcgcga cgcagagggg cgacgaggta cgaacgagct cgtcgtacta ctcgggcgac    190500
     gaggacttcg gggatgaaaa gtcggcaccc ggggacggca ataaaggggc cgacgacgac    190560
     gagtacgggc tgatggacgc cgtcgccgac atggtacgat cgtacttctc cgtcgacgtg    190620
     gtcaaggacg aggacgggaa cgaggagatg gtggtgatga cgtcgcccga gtttctcggc    190680
     tttctcatcg tcgccgtcat cgtctcgtcc agactgggtc gatacctcgt ggacacctac    190740
     ctggcgacgc ccgtcgaccc gctgttgcga tgagcgtaac gtcgcccgac tcgagtttga    190800
     gtaatctcgg atttaagtgt ttttactgac accgaacttc gtagactccc gtcttggtat    190860
     cgcgcccgct gttgcacagg taccgcaccc acttcgtgct ctggtacccg ctcttctccc    190920
     aaaccttcag gaacctcacc cgcagcccgc tcgccgtgaa catcggcacg tgaaagtcca    190980
     tcgatatcgg cggcttgtgc cacggttttc gctccgtcgt cgtgctcacc agctcaacct    191040
     cggcgctcag cgtcagctcc gtcattccct gaaacttctt gatcttccac accagcgcct    191100
     cctccgcgga cttgtacttg gccgtcccgc ccgtcagctt gcacgtcgcg ccgctcgtgt    191160
     acttgggcac gggtatgcga atcttcacgt tcgtcgcgaa ctgcttatcg ctgaagcacg    191220
     accgcacctt gacgtcaacc tggatgcgag tccgccccag ctccttcacc agcggcatga    191280
     gcttgaacgg cagggagatg ccctcggtga cgcggtactt catcaggtcg aacttgccgt    191340
     cggggggcac gaacgatatc gtcttctcgc tcgcgaactt cgacaggttg acgcactgat    191400
     ggaactgcag atcggcgagg tcgatgctct tcttgtggtt acccccgtgc gtcgcctgcg    191460
     cgttggcctg agcctcctcg ccaaccttat cgttcaggcc gatggtgagc tcgggcatgc    191520
     ccgagaggag cgtcttcatc tcgatgaccc cggtggcgga cgccttgagc accacccctt    191580
     tcggcgacat gagcagcgac acggactcga cgatgtcgag gtacacctcg ttcttcttgt    191640
     acgtcaggtt cggcgagcgc cactgcacgg ctccggtgac ttgcatcgac acctccttcg    191700
     ccttgcgctg gttttcgtac gtcgcggttg ggtcatccgc ggcgcgatcc gctcgttgag    191760
     tgatgaaaga cttcagaacc tccggggagg tgatctgcgg gtagccgtgg tcgcagacct    191820
     cgtcgaggag ctcgtagata atgacaaagt tggacttgag caccttctcg ttgaacttgt    191880
     taaagtacga cttgaagagc gagatgagct gatgcatgaa ctgcgcgagt catcgattcg    191940
     ggacgagctc ggtcagcgac gaaggaggcg agggcgcggg aagagaggcg ggaagagagg    192000
     cgggaagaga ggcgggatct aatctaatta attgttaccg tgaaggcgag catggcgttg    192060
     gcgttggcgc gcgtcaccgc caccacgtac acgttctcct ccctggtgta catgaaggag    192120
     cacatgccga ggttcaccac cgggtttccg cctcggtcct tgccgttgat gatctccgtc    192180
     ttgaaagcgg tggccatgtt gcggctgatg agagcgggga acggcgtcag cgtcgttttc    192240
     gaggggacgg ggctgggcgg gaagattggg gggcgcgcgg gtttgcgtcg ggcggagacg    192300
     ccgcgacgca tcgtgggtta gggtgactca ctcgacgtcg tcgcggtatt ggcgctccaa    192360
     gataacgtcg ccgcggaggt tgaggaagta cagggcgctc agcgcgacgg gcggattacg    192420
     cgccatcccc tgccatccac cgcctccgct cgccatcttc gccggatctc ccaagcaagt    192480
     ctccggacgt gttcccgtcc cgcgcctccc gtgcgagaga gatccggggg ctccgtcccg    192540
     cggttcgaag cccggcgcct cgcaaagtgc gcggtgccct gacgagcccg aggcggggtc    192600
     acgcgtcggg cgtgcagtag tccctggcta ctactagtga cgcgtgcggg tctggatctg    192660
     gctgcggaaa gcctccaagt ccctccaacg ggcgctgcgc aaaattgagt cgcgaattgg    192720
     cgtctcgatt cgcactggtg accggcgcgg gcgggtatgg cgccgacgat agcgtcccgg    192780
     gtcgagcggc gatggcgctc cagcccgggg gttgtcaaag cgttcatcga gcagcgcgac    192840
     gtccgagcgg tcgacaacgc ggcggccgcg cgggcgcccg tcggcgcctc cgcattcgag    192900
     ggaaatgtcg tgggaactcg gcgcgagagg ctcgacgacg aggacgtcga gatactggcg    192960
     cgcagagcga cggaggtcgt cccggacatc tccgcgctcg tgagcgtcac gacggtggtc    193020
     aaagtcaagg agtgcgtccg gcgatggcgc gccagggttc ggtcctcgct tcccaccccg    193080
     gagcgcaaga cggtcacgcg catggcccga acgcgcgagg acgacgccac ggtgacgctg    193140
     tgcgaagaga cggtggcgcg cgcgatgaag gatcccgccg cggtgcgatg cccgcacctg    193200
     ctcgccgccg acgacgacac cggcgggttc tggcgttccg acgacgacgg cgcgcggttc    193260
     gtcaagccgc gctcggtacg aaccgtccgc gtcaacgccc cgggcacgcc attcctcgcc    193320
     aagcacgtcc agtgcgacag gtgccacgcg gcgatgcagg cgctggcggt gcgaagcgtc    193380
     gcggtgtgtc ccgcgtgcga cgcgtcggtc ccgcgccacg tcatggcgag gtacgcgcac    193440
     gactgggacg gagacccgtc gaaattaaca cagctgtgcc tcttttgcga caagctcaac    193500
     cagcgagtcg cgcgggaagc ggaggaacgg ttccgtcccg gcgatcgcgc ccgcgccgcg    193560
     tccagggcgt gcatcgaacc gtcgtgcggg tacctcgccg tggacgacgt cccgttcatc    193620
     gagacgatcc tgcacaggaa cgtcgcgagt cggtgggatc cgatcacaaa cgaaaacgta    193680
     tccgtcgaaa aggagaggcg cactcgcgtg ggcgtctaca ccgtgcgtaa atcatccaag    193740
     ccggacgaag gcgtgagcga ttccccgtta attaacgacg tcgtcgcgca cgagtgggag    193800
     tttacgcggc aggggtacgc gcacggtttg aggggcgacg cgccggagac cgaacgcggc    193860
     ttcctcgcca tcggcgatcc gcctccgatc gtcgacgaaa cgtttccccg aatcggccaa    193920
     acgcgcctga cgcccaacct gatgaaaaag acgtacgcgg ggcgcaggaa agaggttcgg    193980
     ccgccccgaa tcgtggtgca atagatgacg ggcgcgtcgg tgcaccggcg gcgtggtggt    194040
     tagtcttatt agcgtgtagt cttagttata gtgtacaagt aagtcttggt gaaagaatga    194100
     tgtgagcgtc gtcgccgcga gaactttgga cgagcgcgga ttcgggtcgg tgtttgtatc    194160
     ggtcgcggca cccccgctcg agcgggttga gcgcgccgcg tcgtcattta accgtcccga    194220
     atccctcccg cccccggagc cgtctcgtct cggttgatga tgagtcggcc ctcgagggcg    194280
     caaagtgaaa gcgcggttgt ccgccgtctt ttttctcgcc gcgagcgtac gcatgtaaag    194340
     tgcgagtctc gaccccgagg cgtttggtgt ttcgccgcgg agccttacgc gcctcagcac    194400
     ttcttgagct cgctcatgtt cgtcgtgtgg accgggtgcc cgttgaccac gatcttggcg    194460
     acgttcgtca cgtcccctcc gccctggttg tcgtcgacga agatgctgac gactcttacg    194520
     ttttgaaact gggtaaagtc gagctcgatc ttctcatccc ccgtcgcctg cgccgcggtg    194580
     aggacgagcg actcggcggc ttttttaccg cagttgtcga acgagaggtt gggcttgttc    194640
     acgaacacct tgaccgtcct cggcgcggtc ccgtccgcgg ggccgcggat gatgagggac    194700
     gtgaggttga cgagctgctt gaaggggatc gtgacgatca gctgctcgtc gtcgtcggac    194760
     tggcagagca gcccggcgtc ttctctgtac ccgggcttga cggcgttgcc ccattccttg    194820
     cccgtcgcct gaggagagtg gcggtgggtc ggatgcgagc gcgagcgagg tgagcgttag    194880
     tcctggaacg cgcggcggct cgcgaaggtg cggcggggag atctctctcg aggggaagcg    194940
     cgggaggcgg tgaccgtgac cggtcggggc ggcgagactg cggacgcacc atgttgaggc    195000
     actcgacgga cgagaggtcc atctcctcga tgagatccgt ctcggggatc cccatcgctt    195060
     atcccgactc tttggacgat tcgcgcgagc gcgcgacggc ctgaagtgac ccgcgcgcga    195120
     gtgaaaactc gcgacttgtg tggtgagggg aaacccagcg tcgagcgagg agcggcgctg    195180
     acgagggcga ctcggttcga attttcggcg tcatttcgcc gggcgcttcc atggacgcgg    195240
     gggatgaaga cggcggcgat gtgggggtaa cgagagagga cgcggcaatc ctgatgacgc    195300
     tgaagcacgg gacgaagcgg aagcgacgac gcgcgggctc aacatgcgag cacggtcgtc    195360
     agcgccacag gtgcaaggag tgcggtggat ctcaaatctg cgagcacggt cgtcgccgct    195420
     ctaggtgcaa ggagtgcggt gggtctgaaa tctgcgagca cggccgtcag cgctctcagt    195480
     gcaaggagtg cggtggtggt ggaatctgcg agcacggtcg tcagcgcaca cagtgcaagg    195540
     agtgcggtgg ggtctcaatc tgcgagcacg gtcgtcggcg cacacagtgc aaggagtgcg    195600
     gtgggggctc aatctgcgag caccgtcgtc ggcgctctga gtgcaaggag tgcggtgggt    195660
     ctggaatctg cgagcacggt cgtcgacgct ctacatgcaa agaatgcggc gggtctcaaa    195720
     tctgcgagca cgctcgtcag cgtcgtcatt gcaaggagtg cggtggtgca tcaatctgca    195780
     agcacggtcg tgagcggtca aagtgcaagg agtgcggtgg gtctcaaatc tgcgagcacg    195840
     gtcgtcggcg ctctcggtgc aaggagtgcg gcgggtctgg aatctgcgag cacggtcgtc    195900
     gacgcgacgg gtgcagagag tgtctcgcgg caaaggctct aacggggtga gatacgacac    195960
     actcgtagcg ctacgtcgag agttgaacgt caccgatagt tgaacgtcac cgataccttc    196020
     atcactgctg cgcgctgatg gacgtgcgcc tcgacggcga ctgcgagagc agcggcgacc    196080
     tcggcctcga cccccccgac gcgctcgccg ccgcctcctc cgcgtctaac cgttccttgc    196140
     tcctcaccct cgccgtcgcc atcgtgtgcc ggccgcccgc gcacacggac gtcacgcgcc    196200
     acgccccgcc ccccggcgcg ggcgggaagt gcaccggcgc gggatcgccg ctccacttcc    196260
     cgcttaccgc ccgaccgagc cgcccgagcg agttcctccc gaacgagtac acccggccgg    196320
     attcgtcgag gagacacgag tgcgtcccgc cgagcgccgc ttcgacgatc ctcggaacgg    196380
     atcccccgcg cccgcctcct tcgcgattgt cgccccccca agaccccagc gtcagctcca    196440
     ccggccgctg cttgtccgcg cagtcgccgt cgcccagacc cagccgcccg tactcgcccc    196500
     gtccccacac gtaacacacc ccacccgcgg tgacagcggc gctgtgccaa ccgcccgccg    196560
     cgactgacct gacgcccgcg cgggacagcg cctcaacctc cgtcggcgtg tcctcgttac    196620
     ccggcctgcc caggcccagt tggccgtagt cgccgttgcc ccaggaaaac acgcggccgt    196680
     cctcctggag cgccagcgcg tgaaacatcc ccgcggctaa ggtggtcacg cccttgattc    196740
     ccggcactcg caccggcgac ctcgcgggtt ccttctccga accgaccgtc tgtccccacg    196800
     tgtacacctc cccggtcctt cccaccaccg cgaacgagca catccccccg cacgccacct    196860
     gggtgatctg cagtctgttc gcgttgaggc cgtcgggcgc tggaaagggc acgagttcgg    196920
     gaactgacag gtggagcgac acgtgaacgc cttggcccgc ggtgccggtg tcgacgccgg    196980
     cttggccgta ctcgttgccg ccccaggcga agagtcggcc gtcgttgtcc gcggcgcaga    197040
     cgtgccatcc gccgagggag gcgcacgcca cgtcggacgg gtccagctgc gtcgggacag    197100
     ccgcgtcgtt ggacgcggcg ttggaggttt gggatcttga ggattgggat ctcgcgccgt    197160
     cgtcgttcgc cgcgcgtcgg ctggcggcct gcaccgccgc gaccgccctc gggcgcggga    197220
     tccactcgtc gtcgacgtcg tgaccgaggg tatcgtgcga gttccaaccc caggtgtaca    197280
     gcgcgccgga ggaggcgagc gccgcgctgt tgcgcgaccc ggcgaggatg gccttggtcg    197340
     gggcgtaccg cggtcgggaa cggacggtgt cgccgtcggg aagggcgagg atcgtgggcg    197400
     cgggcacgtg ccagtcgagc gcgcaccggt tgtgcgagac gggagcttcg ggaaggccga    197460
     gctggccgtc ctcgccgcag ccccactgcg gagttggacg aagggaggtt ggtcaggagg    197520
     acgtcgaggt tcggcgcggg cgtcggtttg aatcgagcgt gcgtgagtcg gtgagaacgc    197580
     gcgagggttc gagtgtcggg gtgtgggatc cggaggcgcg acgcaccacg aacagtgtct    197640
     ccgtctcgtc gtcgtcgtcc gccatggaaa gtccttcgag ttcagcgggg gagaacagtg    197700
     cgctcgggag gagcgcccgt cgtggaaaac ttagagctct cgcgaagacg ttaaccgtaa    197760
     acgcgccgtc tcgtgtgagt ggcgagcagt caggaattgc gccggattcc gtcccgacct    197820
     gccgaccaat gagatccgtc tcgtttggat atgataaaag ttaccccgcg atccggcgtc    197880
     gggaccactg cgcgtcgtcg cccaccggtc gccgcccgca acgctcagcc tcgcgatgcc    197940
     aaccgcgacg ctctccgcgt ccgcatccct cggcgcaccc acccgcgccg cgtgcgcccg    198000
     cgccggtaga accgcgcgcc gcgtcgcgct tcgatccccg ggctcgatcg cgtcgtcgtc    198060
     gtcgtcgcgt cgcgtcgtcg tcatggccgc cgccgcctcg gacgccgtcc ccgcggacgc    198120
     cgtcgagtac ttctccccgt ccaaggtcaa cctcttcctc agggtcgttc gcaggcgcga    198180
     ggacgggtac cacgacctcg cgtcgctctt ccacgtcatc gacttgggcg acgacatgaa    198240
     gttcgccaag tcgaccggat cgcgcgacgt cctcgtgtgc tccgacgaaa ccataccgct    198300
     ggactcgtcc aacctcgtca tcaaggcgct cgacctgtgg cgacaaagga ccggctccac    198360
     gcaacacttc tgggtcgagc tcgtcaagaa cgtcccgcac ggcgccggct tgggcggggg    198420
     ctcgggtaac gccgccacag ccatgtgggc ggcgaatgag ctctgcggcc aaccggcgtc    198480
     ggaggctgag ctcctcgagt ggagcggcga catcggcagc gacatcagcg tgttcttctc    198540
     ggagggcgcg gcgtactgca cggggcgcgg ggagatcgtc gaggacgtgg agccgcccat    198600
     cccgctggac acgccgatgc tgctcgtcaa gcccgacatc gggctgtcaa cgcccgccat    198660
     cttcaaggcg ctcgacttgg acggccggag caccgaggat ccgctcgatc tgctggagcg    198720
     catcaagtcg gaggggtgca aggacgacat atgcgtcaac gatctggagg tccccgcgtt    198780
     cggcaagctg cccgagctgt tgaaactgaa ggagaggctg cggggcgcgg gcacgaaggg    198840
     cgtcagctcg gtgtttatga gcggcagcgg gagcaccatc gtgcaggttg gcagcgacga    198900
     cgtgccggaa ttcgtccggg aggacgccgc gctgttcagg tcgcccgcga ggctgatcac    198960
     gcggaagcga ggagagtggt acaagccctc ggggctgtgg aagaagtgat cgttagccgg    199020
     gcgtcgattg acgtcgtcgt tatgataata tatacccttt gcgaaaatgc ctaataactc    199080
     actcgtccgc gtccgctagg atccacgtcg ttcgtccgat gggatcagaa cagcgggaac    199140
     gacaggttgg actggtccac gtcgaagggc ttgaacgagt ccttgatcac cccgtaccgc    199200
     gcgcgccact ccgcctcgtc gacgtccaga gcggaggtct gaaaccgaag ctcgtacagc    199260
     cggttgttcg cgacgcccaa cgttgacgaa agcgtccggt cccactccaa aaactgcggc    199320
     ctgtccgcct ccgtcaggcc gtactggttc ttagccgcgt acgacttgat ccgcagctcc    199380
     acgtcgtaga agagcatcgg ctcgccgtcc acgtccgttc cttcccgttc cctggcgctc    199440
     acgacggagc tctcgcggcg gacgccgagc ctcgacgaca tgaactcgtt gaggtactgc    199500
     gcgaggatct tttgggccgc ctcgtcgggg gtgccgagat ccctcggcga cgcgaacttg    199560
     gtggatgacg gggacgagat ggacacgaac atgttctcct ccaccgacga cgggttccgg    199620
     aagaacacgt cgttgcccga tcccttgact tcgatccaat cctccggccg gaagagcttg    199680
     tacccgtcga tggtgtcgtt gaacgggcgg taccccgggg gcgggcgagt gaacgcgcgc    199740
     gcggggggta ctaacgccgt ggactccagg agggtggacg cgacgagcgc cgcccccgcg    199800
     ccgagcgcgc gacgcccgaa caacccgggc gaacgctgct gccgatgctg ctgcgatcgc    199860
     ggctgctgat cctgcgacga cgacgacgcc ccatcgacgg ccgccccgcg ggtgacgatc    199920
     gcggggcggg cgacgcggcg cggcggcgcg cggggtgccg cgcgcgcggt gaggccggtg    199980
     cctcggtggc agacgaccga catcggatcg atcgggcggt ctcggcgtcc gagaggcaac    200040
     gggcgcggcc gtcagtgagg cttatccaag aaaaggacag gctctcggga ccacctgcca    200100
     ggctgccagg cgtgtgacag ccagcgtgct gtgtcctgac tggcgggaga gaggctcgga    200160
     gccgttggga gcgtttctag cgaagggaaa acgaaagggc gaggagcgcg ccactccgct    200220
     tcgagcgccg cgtcggccgc cgcgatggag cctcacccgg ccatggaatg gaccgcctcg    200280
     aagccgccgc tcgacggcgt gtccatcgag cccctgagcg acgccaccct cgagggcgcg    200340
     cgcgccgtct ggaacgattt cgtgcggcgc agcaacaagc ggttcctctt cgggtgctgc    200400
     cccgcgtgtg acgagtccgc gcggcagttc gcgagaccgt tcgaggcgga cccgagcagg    200460
     ctgcgcaccg ccgcggtggc cgtgcgccgc gccgacggca atgtgatcgg cgccgtcgtg    200520
     tgcacgacgc acgggcagat gcgcacggag gaggaacgct ccgtggcgcc cgacccaaaa    200580
     ccgggggcgt cccacgtcga gtggatcgcg gtgctgccgg aggcgcgagg cggtgggatc    200640
     ggcgccgcgc tgctgacgca cgcgttcagc gcggtgaagc aagatccgtg gaacgcgagg    200700
     tcgatcgacc tcggggtggt tggggggaac agggccaaac gtctgtacga acgactgggg    200760
     ttcgagcggg tcgggccgaa cgacccaatc gagaaatgca tcgccgggtg cgtgatatgc    200820
     ttcttcatgg gatgcccgaa ccgcgacccg tgcgccgggt tcacgtacag cgacatggtg    200880
     aaggcgctgt gagtggcgac gatcggtgtt tcgggtcgtc tcgaagtcga cgatgcgacg    200940
     cgcgtgtcac ttgtatcaaa acgttcgcct ccgctccggc ccgactcaaa cctcgagcgc    201000
     agcctcgggg tcgacgaacc cgacccctcc cggcgtgtac ctctccatcg ccctcgccag    201060
     tatgcgcttc ctgttcaccc tgaacgacaa cgcggagagc agacgccgca aaaacgtggc    201120
     gtcgtttccg tcctcgccgt cgccgccgca tctctcgacg tcgcccgaat ccagggaaca    201180
     ctcggcgacc acctcgccgt acacgccctc gacggcgtgc aagttgacca ggtcctcgtc    201240
     gtacgccgcg agaccgccca tctccgtgag ctcgcgttcg cacgctagcg ccaggctcgc    201300
     ctccgccgcc agctgagccc cggacccgac ctcctcgatg ccggagaatt cgcggcgcaa    201360
     gccgtggacg ccgcccagcg cttcgtactc gtcgtcgctc gcgagaagaa ccctgagcgc    201420
     ccacaggaga tcgggggatg cctcgccgtc gtgcgtgagg tgggcgtcct tcaccgcggc    201480
     gtgcaacccc tccgccttca tgtccgcctc gcgcagggaa cccggcatga gccactcgag    201540
     ctcgtccatg caccccggca gcgcgatctt ctcatcctcg ctcccctcca cgcaaaaacc    201600
     gaatcgaagc aagagctcgt cgttggcgtg agcgccgtag gagatggtcg cctccgtccc    201660
     cggcgtcatc gcgcgcgtcg ccacgagctg gaacgcgccg tccgtgaacg tcagcttcgt    201720
     cgcgccaccc gaggcgtcgc ccgtttgaga gccgtcggat gagctcggcg aatgattaaa    201780
     cgcgtccaga aagggaacga cgaacacggc gggctgcgcc gccgaccgac ggctgacgtc    201840
     gctcggggta cagctggcca cggcgacgcc ggcgggatcg tcggggtcga ggccgcactc    201900
     ggcgctagcc gcgtgccgcg ccgcctcggc ggcgcgcctc gcgtcctcct ccgccgccgc    201960
     aagctgtgac gctttttgtt cttcccgagc gtcgcactcg gcgagcgtcg tcgccgcatc    202020
     cgtcccagcc gcgtacgggg gcatcatcac gctcaccgag gtcgggtact tgcccaggaa    202080
     cgacctcgat cgaaccgtgt tgagccccca gtgcacctcg gcaggggtca agccgagtgc    202140
     gtcgcaaacc gccgacgccg ccgcggaatt ttcgcctcgc tggcgcttgg cgtcgtccac    202200
     gagtttcggc gcgtggagtt cgtccaactg cgcgtctgtc cacatgccga gcaggtcgta    202260
     ctcgtcggga atttgcgata cgtacgcgtg ccacggcgag gcggtacccg cgcgtcgctc    202320
     cctgatgagc gcgagggcca tgcggagctc ctgcgccggg cgccccgggg cgacgcccgg    202380
     gggatcgttc cagagatcgt cggggcagaa atcggggaac gggttggggg gcgacggggg    202440
     aagcgcgaag acgatggacg cggggcatcg cgcgatgact tggcctgcgc gtgcgattcg    202500
     ggtggaggcg cgtgagcggc gcgtctttcg ggtcggaggg atcggtcgag tcggcgcagg    202560
     gacggggcgg ggcgcgcgaa cgacgacgtg gcgaagaaaa agtcggggcg ctttttgaag    202620
     ggcgcgaaac ctaccggcgt cgatgggggc ggtgacgagg catccgcgct ccgtctccgc    202680
     tccgtccggg agggatgacg tgaggtagtg gatggatacg ttcggcgcgt cgactccgcg    202740
     ctccttgcac cactccgcgt aggaatgctg cgccgcgcgc ggcaccaccg cggaggcgcg    202800
     cttgggcgat attttggtca tggccggtgg agctcgggag aggagggcgc ctccccgcgg    202860
     gttgggttgt atgttgttct tgcccgagag gcgtctgtcc atgttcttct ggacgaggaa    202920
     gtggcggtag ggcttgatgg gcatcgggcg gcccgtcccc gtgcgcgtgc gcatcggggg    202980
     aaggtgcgcc gtagtcgcga cggcggtcat ggcgccaaca aagtgtcttt cttgcccgcc    203040
     ggttcgttcg aaacttcttc acaaaggtct ctccaagttc gaggcgcgcc gatcaaacac    203100
     caagcgtgac ggtctgcgac tcgagaaagg cgtccggttg caaccacccg cgcaaatctc    203160
     ggccggcgcg ccaaaaaaaa atccgatttg ctgactggac tacccggaaa aagcgagaat    203220
     gagagtccac tcttagccac gccgggcgaa ccacggcgct tccttcggga ggaacgaggc    203280
     gaagatgcat tgacacgccg ctccgccggt tcgacgtacg gcggagcgtg ggggggaggg    203340
     gttagaaagg ctggcgagca caggcgagat gcgaacagag gcgaaggggg cttttttgat    203400
     catgtttcac cccttcaccg cgtttttgcg gtggtgagtc agcggccttt ctccgtgggc    203460
     gtgacggggt ggtgtgccgc cgcgcgggcg gaaacttatg aagcgtgtgt tcataggtct    203520
     tgtcattcca cgatgcctaa tatgtactcg aatacgaatc aaacgcacgt cggccgcgtc    203580
     gagcgcgcgc gaaagcatcc tcgttccgcg cgatgtcgtc gtgccacgtg gaattccccg    203640
     ccacccacgg ggaaaatccc tcgccccgac ccaaccgtct cagcccccgt catccccgtc    203700
     ctttccgtca tccgcggctc gtggcgctcg ccgccacgct gctccggaca gtctcgatga    203760
     gacgctcgct gtacgcggcg agcgcgcgct ccatcgtcgc gtttatcgcg cgttccagcg    203820
     acgggggcac ttcgaacgaa tccgccagcc ccttgggcat cgctggcgtc tcatcagatg    203880
     ccgacggatg acccgcgtcg tcgtcgtcga cgacgcgcgc gcgcgattcg ccgtcagccc    203940
     cgaacgacga cccccggacc gctccatcgt cgacgtccgt ctggacgtga acctcggcgc    204000
     gcggcgcgga cgcctcggcg gagcttcggt cgtccagccg catcgtcgac gcgagcgacg    204060
     ccagcctggc gacaaccgcc gcgcgctcgt gcgcgccggc gtccttcacc gacgcgcgca    204120
     ccgccgcgag tgacgcgcgc accgccgcat cgagcgcgtc catcgcggcg agcgcgtcca    204180
     tcgcgacggg ctcgggggac gcgacgggct cgggggagga tcgagccgcg tcggcggcgg    204240
     cctccggctc ccgctccttc ccgccgaccc gcgcgtcgtc cttcgttcgc gcggttcgcg    204300
     cggcgatcgc ggcgatgatt cgcctcgccc gacccctccg cttcttcagc gacgcgcgca    204360
     agccgccgcc ggcggaccgc gacgatcggc gcgcggcggc cggctcgatc gacggaagcg    204420
     gctccgcgac gggttcaggc tcggcctcgg gcgtcggtgc gtcggagtcg tggatgaccc    204480
     ccgcgtttcc ttcggccgtt acagccgtta cagccgtcac gtcctcctcc tcggcgtcga    204540
     cggcgtaagc cacggcgtcc gcgatgctcc gtcgcaccgc gtcgtcgtca tcttcgtctt    204600
     cgtcggatgg agctgtcgcg tcgtcgtcgt cgtcgtcgtc gtcgtcgtcg tcatcgtcgt    204660
     cgtcggatgg agcgtcctcg ggtagcggcg gccatgtcgc ttcgggctcg aacgcgacct    204720
     ctacctcctt ctcctccttc acctccttct tctcctcctt cacctcctcc ttctcctcct    204780
     cctccttctt cttctccgcg gatgtcctga ttcggggcag ggacgcgcga agctcctcga    204840
     cgctcttgcg aaccgcgtct tcgcccccct tcgcgtcgtt cgtcgctcgt tcccgggcga    204900
     attctgcggc ggcggcgcga cgcgacgcgt cctctcgctc caccgcgtca atcgccgtcg    204960
     cgacgtcaac cgcgtcaatc gcgaccggcg cgtcaccgcc gccgatgagc tcgtgcaccg    205020
     gaagcggctc cctcttcgcg cgtcgcctcc accgcccgga gaagctctcc cgcaacgccc    205080
     ccgcgtgcgt gcgcgtcggt tcaatcgcgg gacccgcgcg cgtcgggtct tccgtgtcgt    205140
     cctcctcatc cgccgagtcg aaacgcagcg cgagcggcac agcgggttca tcctccgacg    205200
     attcgtcctc cgacgatccg aattcctccg aatccgtcgc cacctcgtcg gcgtcgtccg    205260
     agtccgcgac gcgcggtacc tcgaacctgt tcccgccgag ggtcggggat tccgacctcg    205320
     gcggctccga gcacggcgtc tgcagcggtt tttccgcctc gacgggtcgc tccttcttgc    205380
     cgaggtggct cggaggtttc ttccccccac cgcccgcaag catcgcggcg acgcgcgcga    205440
     aaaccccctt gggccggtcc ttgtccttgg gccggtcctc cgagagttcc tcagccttcg    205500
     catcgtgcgc cggcgtggtc gcctcgatcc catcgtgtac gactgtttca tccgtcgcga    205560
     cgacgtccga tccttccctc ctcggcgacg tcgtgacaac cccgaacgcc gctccgggcg    205620
     ccgccgaatg ctccgccaac gctccgccgg gttcgctctc ggcgtagtac agcgcgtcgt    205680
     cgtcgtcgtc gaggggcttg aggctcacca cggacggcgc gcggcggggg gagcgggtgg    205740
     gctcgttttc cttgtcggga cggtcttcgt cttcgtcgat acggacgtcc acgtcgccgt    205800
     ggtcaatcac cgacgcggac aagccctcga gcttcggcgc gtacccgccc ggcgcgttgg    205860
     cggcccactt ggacccagcc gcaaccttgg ccaggttggc gagcttctcc gtctctcgct    205920
     cagcgcgttc gcgctcgtgt tgttgaacgc ccgccgccgc ccaccgcggg agttcttcaa    205980
     acggagcgag cgacgggacg gaggatgacc ccgaggcgtt cagctcgtcc gctcgtgtcg    206040
     cgtcatcctc cacggcgtgc gtggcctcct tcgccgagac cgcggtcgcg cggtcctccg    206100
     tcgcgcctcc gtcggacacg tccagacaca gacctgggcg cgttccggaa ggagtcttcc    206160
     ataccggcgc cccgtaccgg tcgtttacgt cgacggggcg aagcttaagc gcgccggcgt    206220
     ccgtccccac gagcaccgcc ctctgttttg cggccgcggg tgggtgcgcc cgattcgcgt    206280
     acgccgccgg cagccgccac acgcaaatcg tcccatccgc cccgccggtg acgagcgcgc    206340
     cgccggcggg ggaccaaccg ccggcggtga acgccacgca cgtcgcggcg tcgccgtgcc    206400
     ccgcgcaccg gcccacgagc gcgccagtcc tcgcgtcgta cactcgaacc accttatcga    206460
     cgtgggacac cgccgcgagc gtacccgcat cgtccacggc gacgcaaaca gcctccccgg    206520
     cgccctcgtc ggcgcaagga aacgcgcgag tcgactttcc ggagcccacg gaccacaccc    206580
     gaagccggcc gtcggcgccc gccgtcgcgc acgtgcgacc gcccgcgtcg acgtccacgc    206640
     cgtgaaccgt tccacgcggc atcgtctccg tcgagaaagc tttcgtgggt ctgttgacgt    206700
     gtgggttgtt gtgtgggttg ttgttggttt tcgagcggac ccgcttcaaa ggcgcgagtc    206760
     gccggaaaat caccttgcgg tcggcgccgc acgtgacgag cgtcgcgtcg gaccctaggc    206820
     cggcgatgcg cgcgcccgtg accgcggcgt cgtggtcgtc gatcgtctcc tccagcaggt    206880
     acgtccccgg ggacccgtcg ggcgccaggg acgcgtcgta ggtgtgaacg agcctgtcgc    206940
     ggccgcagga cacgaggcga agctcgggag cctccgcttc ggcgacaaag ggaaaccccg    207000
     cgctgtcggg cgacgacgcg gacgttcgga cgacgttccc gccgcctttg gacttgtccg    207060
     cggacgacgg tccgtacgcc acgcacagca cctcggcgtc gtgcgccgcc agtcgcaggc    207120
     gctcggtcct cgacgcgaga tcaaacaccc ggacgtttcc ggctgcgtct ccaacggcga    207180
     gctcaacgcc gtcgggcctc gtcgcgacgc atcggagcgc gtgaccgcca gccgccgcga    207240
     ccgccgcctc gtcagcccca ccgtccgcct gtttctccac ctgcttgagc gcggcagctt    207300
     cccgcgacgg gtcgggagtc gcgtacatca ccgccgtctg cgagtacgtc ccggaaccct    207360
     gatcggaacc caccggatga ggctccggat gttcccagtc gccgccgccg gttcggtcgt    207420
     cgcgctctcc gagatgccac agccggacgc tgccgtcggc ggcgcacgtg gcgaacgtcc    207480
     cgcgcggcgc gatcccgcgc tcggacgccg cgggcgggag cggcgcgacc ccccagacgg    207540
     cggcggagtg cgcgaaaaag cgccgaacgg ggagtgcggc gccgtcgatc gatgagcgga    207600
     cgtcccaacg aaacacgctc cggtccgagt acgcgacggt gagcacgacg ccgcgcgtgt    207660
     cgaacgcgca cgcgacggcg tcggggaagg cgacgccggg agggggctcg aacgacgtcg    207720
     cgggagccgc cgggtgacgc gtcgagcccg gcgacgcgtc gagctcggct cgatcgggcc    207780
     ggggaagcgt gccccggtag gcgagcgttc ccctttggaa gatgcgcacg acgccgtcgc    207840
     ccgcggccac ggcgacgttg ggtccgccga cggccacgga cccgccccga cggaccctcg    207900
     cgtcgaccca acgctcgacg cgttcgcccc tccgaagcat gcacaggacc ccttcctcgg    207960
     agagggcata caacgcgtcg tcgtcggaaa acgcattcgc cgattcgttc gtcgccgaat    208020
     cgtcgccggg cgcggtctca cggcgctccc ggtgcgtgct cgtcgtgctc ggcgcgcaca    208080
     cggcgaccca cgtgtgcgac gcgtgacccc ccacgtccgc attcttggac ccgcactcga    208140
     ccaacccgaa gactcgcttg ttgttcgcgc cgccccccgc cagcttgcgg tacttggcgt    208200
     gaaacttgga gccatcgtcg tgcgcgtctc ccttggtgcc cacggtccac accttgaggt    208260
     gtcgcgcccc cgccgtcacg aacgcggtgc cggtcgcgtc gaacgatacc gcgcgaaggt    208320
     ggccggacgc gtcgtgcgcg caaaagtgcc tcgccaggca cgttccctcg cgccagtccc    208380
     agagcgcgac gtgcccgtcg ttgtccgctc cgagcgtcag aaccttggcg tcgtcgctcg    208440
     ggcagaaggc gacggactcg acgccgtacc tgtgccctcg aagcacggcg agcgcgcggc    208500
     cggattcggc gctccagacg acggcggcgg gctgatggcc gcgctcgcca gccgcgacga    208560
     aggatccgac gattgttttg tcacctttgc tcgtgccgga gaatgcgacg cacgcgaacg    208620
     gcttgccgcc gccggacgac gcgcccgcga accccaaccc taaacctccg cgggtggtgg    208680
     cgctgggtcg aatcgcgcgc gtttctttca ccccggagtt ggcgcgcggc gctcggagga    208740
     accgaacctg cgcgtcgcgc gcgggcgagt agacgaccac gaccgctccc gcgggatgcg    208800
     cgacgtcgcc ggtcgccggg gagcacgcga gcccgccgcc gcggcattgg gacatgccga    208860
     tgacgcgcgc cagctccatg tcgagaccgc tgtcggcggc ggcggatgta gcggcgcggc    208920
     gcgacgagga cgacgtcgtc ttgcgcttga cgggcgcggc caccatcgcg tcgacgggta    208980
     tcgggacgat gtgcgtttcg ttggaggcgc ggaggaaggt ggcgcgggtg gaaccttcga    209040
     accaggcgcc ggtcgtccgc gcgtcgaaag acgatgagat cgaagcgtgc gtgcgtccgc    209100
     gcgagcttgc tcggtgcgaa cgatgcggaa ggtgcgcgtc ctgctttgat cgacgcctcg    209160
     ggaaagtcaa caaaaactgc ctgctggcac caaaaaaaac gccattctgg ctaatttggt    209220
     cggacaggtg atcaacgggc cgtctcgcct gtttgtgact ggccaaatat attgcaaccg    209280
     accaaaacaa ctctcgtgtc ctctcggccg cagaaacgac gtgccgagcg agaaatgaag    209340
     tcagagcgca cggcaccgac gacgaacgat gcaggccaag gactcggcgc aggacctgtc    209400
     gaagctgtcc atcgaggaca acttcggcca caggtttttc atcgcgccgc acaggcacac    209460
     caagacgctg tacctcgtgc ggcacggcga ggggtaccac aacctgcacg gcgagcccag    209520
     cctcggcgga gatcgggcca actacaagtc ggagaggtac ttcgacgcgc acttgacgcc    209580
     caagggatgg gcgcagtgcc gcgcgctgaa gaagcacctc gacgaggcgg tcacgcacga    209640
     cgggtgcgag cacgtcatgg acaggatcga gctcgtcgtg gtgtcccctc tgatgcgcgc    209700
     gctcgaaacg gcggtgggcg cgctgggcgg cgacgacaag tcgtgcgacc cgcccgcctc    209760
     gaggctcgac tccgcgctga tgctctcgcg aacggcgatc gagggcgttc gacccgcgca    209820
     cgccgccatc ggcacgcgca acgaggggat tcacgagcag cccgggcgga aggggctcaa    209880
     gtttctcgcg tgcgagctgt gccgggaaca cgtcggcgag aacccgtgcg atcggagacg    209940
     gccaatccgc gagtacgccg ccgcgttccc aggggtggac ttcagcgaga tcaccgacga    210000
     ggaggacacg gcgtggggaa cgatgatcga gacgaacgac gcgatgtgcg aacgcgcgca    210060
     caggttcatg gagtgggtca tgcgcaggcc ggagactcac atcgcggttg tcacgcacag    210120
     cgcgttcatg gcggcgatgt tgagggagtt tggcgccacc gatcagctcg gatgccacga    210180
     gagcgtcaag caggagacgc accggtggcc ggacaactgc gagatgcggc ccgtcgtggt    210240
     gatcgacccg agcggcggcg gggggctgga tcccatgttc ttcccgggtg gcagaaccgg    210300
     gttggaaaac ttcgacgatg ccgacaacgt ctaattcgaa tatttcgatc ctttcccctg    210360
     actgtttgcg tgtgctgttg ccggtacttg taaatctcat cgctctatgc gccgtttctt    210420
     catcagatgt tttcgccggg acacaggcag aacaagcttg gagaaaggtt cggatccaaa    210480
     agaccaactc ggggacgctt cgtcagcaac gagaaacttt cccgccgatc tttcggttgg    210540
     gaagcgtgcc tcgcggggca ccatttgggc gcggcgcgac ccacctcgtc gcgccgagct    210600
     gacgacacca acggcgcgtg cgcgcgcgct tctccccgga cgcagagtct gcgacgggtg    210660
     acgggggtga cgcgcccccg agagctcccg cagaatcgca catgggaatt ttcctgagat    210720
     gctcgcttgt cgccctccta ctcctcgcgc tggccacctg ggcccgaggg tcggagatat    210780
     ctgtgggcca aatagctgtg ggtggaggac acgcgtgcgc cctgctgatg cctggcggca    210840
     cgatcaagtg ctgggggcac aacgatcatg gctcgctcgg ggacgggacc accactacaa    210900
     gcctcacccc cgtcgacgtg tttgggatcg aaaatgcgac gagcatcgct ctcggccggc    210960
     acacctcata cgccctgatg ccgggcggca agatcaaggc gtggggctac aaccatgccg    211020
     gccagctcgg tgacgggacc ttaaacacgc gcaccacccc cgtcgacgtg gtgggaatcg    211080
     tcaacgcgac aaaaatctcc gctgactccg cccacgcgtg cgccctgctg aatcccggcg    211140
     gcacgatcaa gtgctggggc tggaacggcg acggccgggt cggggacggg tcatacaccc    211200
     ggcgcaccac cccgtccccg gtggcgatca cgaacgcgat agacgtgtcc gcgggatgcg    211260
     gaaccacgtg cgccgtgctg ctgggcggcg ggatcaagtg ctggggtacg aactcccgct    211320
     gggacgacgg gagcatcgcg ggccagctcg gggacgggac cgtcacggta caacgcaaca    211380
     cccccgtcga cgttgtcggc atcgcgaccg cgacgagcgt tgccttgggc tactggcacg    211440
     cgtgcgccct gctgaacggc ggcgcggtca agtgctgggg cgccaacgac cacggccagc    211500
     tcggtgacgg aaccaacaca agcagcaacg tcccggtcga cgtcgtcgac atcgagacgg    211560
     cgacgagcat ctcggtgggc atctcgaact cggggtgcac gctacccgac ggctcggtca    211620
     agacatgggg caacgcttac ctcggcgacg ggacgagcga cggtggcaat gttccagtgg    211680
     acgtgccggg aataatcaac gcgatcagcc tcgtcctcgg gaaaggcgaa aactcgtgcg    211740
     tcctgctgcc cggccacgac gcgatcaagt gctggggctc gaacggttcc ggacggctcg    211800
     gggacgggac cgaagtgacg cgcctcgtgc ccgtcagcgt gcggggcccc ccgtgcgacg    211860
     cgtctgccgc tcccgtcaac ggcgccgtcg gtgactgcac gaactcgtta gcgagcgggt    211920
     cgacgtgcca gcccacgtgc gagaaggggt acgcggtgtc cgggtggagc tcgtgccaca    211980
     ccttcggctt tctgacggcg gcgacgtgct ctccgagtcc gtgcgacgcg tctgctgctc    212040
     ccgccaacgg cggcgtcggt gactgcacga actcgttagc gagcgggtcg acgtgtcagc    212100
     cgacgtgtga taccgggtac acggtatcgg ggacatcgtc gtgcagcttt ggggtagtga    212160
     caacggcgat gtgcgaacca aatccgtgca cttcctccac ggactcgagc aaggatggga    212220
     gcgacgggga gttttactgc gtcaacggtg gcagtgtcgg aggcaccacg gggtcgtgca    212280
     cgtgcacatc ttgtgctagg agatacggcg gcaggaactg ccacatcggc ccttgtgaaa    212340
     tggagaaggc ctgcttcgac ttcaacgtgc gatacgggtt tgccacgccg gataaatgtg    212400
     tgtggatgat ggatgtcact ggatgtgggg catagcttca tctttaaaac tgtcctccga    212460
     cgaaagccgc gttcacgtca cgagtctctt cgcagcgccg cgcgccgttc ctgcaccgcc    212520
     cgcgaaacct cccgcacctt ctccatcacc cgcgtcccgt ccgcttcgtc gacgcgatcg    212580
     ccgtacgtcg cgagaaactc atccgggtca aacctagacg cgagccgatc cagccgagct    212640
     cgctcgacac tcgccgggag ccgatgattg gagatatcgt cgagctcgtt cggccacggt    212700
     attcgtccgt acgcgatcac gccgccgttc gcgtcgagct cgtcccacgc ctcgtcctcg    212760
     tcggcggccg cggcgagacg atcggcgatg gcgtcgatct catccgcgtc atcgtcgtcg    212820
     ttctcgtcgg cggcgccacc ccctttgccc tcgtcgggcg tcgcatcccc gctatcgctc    212880
     ccgcgcgcgt cgccctcgtc gaaccgcgtc tccggtcccc tctcgacgac tcccggcgcg    212940
     tcgtcgtcgg cggcggcgtc ggcggcggcg tcggcggcgg ttgtcgtcgt cgccgcgtgc    213000
     agcacctcct cgagggtcac cgtctccacc gcgtcgtcgt cgtcgccgtt cccgccgagc    213060
     gccgagccgt tcgggccgag caccgcgctc ggcggcggga cgaacgacgg tgcgtacatc    213120
     gcctccgcca tcgcccgcct cgctgacgcc tccgcctctt tccttcgaag cacgtcctcg    213180
     gcggtgacgg cgcgttccgc cgctcgccgc cgttcgtaag cctccagctc gtaccggcgc    213240
     ctgcgttcga gtcgctcgcg ttccatccac gtcgtctcgg ccgggatgac gggcgacgtc    213300
     gcggccgcgg cggtgggcgg cggcggcgcg tcgtctttcc ctcgcgtcgc cttcttcgcg    213360
     agcgcctcga gcctgaagtt ctcggctcgt ctcatgcgct cggcgttcat cgccgcgagg    213420
     gactccgggg acgacagctc ggcgaccgcg accgccttct cgcggcgctt gaggtccgcc    213480
     tcgcgcaggt agagctcctg cacgcgcacg cgctcctcct ccatccgcgc gaggtcctcc    213540
     gtactgaacg cggggggagt cggatcgtcg tcacctccgc cggaggttcc cccgataaca    213600
     acggcgtcgg tcgatgcgac gcgcgcgacc ggcgtcgtcg gtggatcggt cgtcgccacc    213660
     gcgggggcgt tctcgacggc ctcccccgcg ccgtcgctca tgtcgatatc cgagcgtcgg    213720
     cggacgcgct tcctcagtga cggcggcgac tcggccggtg ccctcctcgc agacgtggac    213780
     gttcacggct tttctcaagt gaaaacgaac tcgccggtcg cgagactccc ggacgcagac    213840
     tgggtgaggg ccatggacgc accggacagg cacgacacca tggtggaggc cacggagctg    213900
     gcccaaaaca acgagtacaa gtcgtatcac tccggcgtgg tgatcgcgag ctactgcgtc    213960
     gtcgcggtcg tggcggtgct cgccgcgcgc gacgtgcaga aacagcgcgc ggctcggccg    214020
     ggtggcgtga gcgccgatct ggtgggcgcg gctgcgggaa aggacggagt gagcaggtgc    214080
     gagcgcgcgt acacgcccgc gcattcgctc gacgcgcatc gcgatgagtc gacgggagcg    214140
     tttgaacgcc tcgcggaagt tcctcgcggt cgcccgatgt gcccaccgcg cgccccgtcg    214200
     atcccgtcat cgcgcgtctc atctcggtaa cacccacgat gaaatcgcga tttcctgacc    214260
     acccggaccg ccgccctccg atgcacgcag gttcgcgctg ggcctcggac gcttgttctg    214320
     gctcctcttc ggcgtcttct tcgtcgggta ccacctgtgc tacgagaaca tcctgcacca    214380
     caccgacggc atggagtacc tcagcgactg gaccatagtc ttgctctgtt tcgtcatggg    214440
     attactgtcg tggcactctc tggtgaagga ccccgaaggc tccgtgcccg ggtgggtcac    214500
     ggaactcgcc gtcatcgctt acgccgtggc gtggagcagc aacatcatgt ccaccgtggg    214560
     cgcgtggtac agcttcttct tctaccccat atgcgagacg ctcgaagggg tgaacaactg    214620
     gccgtggtgc tacctggagt ggtacaggct gaccgagcac gggctgaaca tgctggttct    214680
     gctcggggac tggaggtggg ggtgcgttcc gctgcgacga aaagacttag ggtggagcgt    214740
     gttgtttctg gaggtgtacg cgctgtgggc gtggtatctg atgttcaaaa cgggccgatg    214800
     tccgtacgac atgtttgact ttgccaccgg gtggggcgag ctgccgtggt tgatggccgc    214860
     gttgggcggg atcgcgatct gtcacgcgct ggcgaggtgg gcgcacgttc gtagggacga    214920
     cgcggcgggg cgggatccgg agggcgaagg gggcgggacg ctgccgacgc gtgcacgtca    214980
     agggggcggg tacaaatccc tggacggatc cgggtagcga gtcgtgttga cttcaacgga    215040
     cattgaatga aggactgagg ttacaaacga acagaatgca ttgaacgcac gcgttcggcg    215100
     ctcttatttt ggccgcggac acggagcgag agaatcgtcg cgcgatccgt gaccgcagtt    215160
     gcggatcgaa aagaaagagc tttgtcggcg aaagtttgct cgagatcaca tcatgagcgc    215220
     aagcacggcc gcgaagatgg cggggacgat ggtcacgaaa gagacggcgc cggagaccgc    215280
     ggctgccttg gcggcttcgg cgttgagctc gatcgccttc ttcccgccgt tgtccacgcc    215340
     aaccgcggcc gttcccggaa ccttgatggg tccgaggtag ccgacggtgc cggcgccgcc    215400
     gtaggtggaa gcctcgtcgg ggtgctgaac ttggttcatg atgtaggacc agccgttgat    215460
     gttctcgtgg taccagacgc cggtggtctc ggcctcctgg acgacggtgc tgatgcgggt    215520
     gaggccgtgg gtctccatgt ggtaggccca gacggcgttg ttcttgtgct ttgaggtgtc    215580
     ctcgccgatg aggagaatgt cgtggccgtt catgaacgcg acgttgtcgg ggttggcgat    215640
     gttgtggatg tcgcaatcgt cgtcgccgtc cgtgtgtccc agcttgtcct cggtgttgaa    215700
     ggacttgtcc ttggggacgc cgcagatgag gggagagatg gacttgatgc ggttgttggc    215760
     gtcaaggggc gcgcggtaaa cgcagccgca ggtgttcttc tcgatgccga tgtgatcacc    215820
     ttccgcatgg tcgcccttgc tgtcaagctt gtgctccatg gaagcttcgt tggaagagat    215880
     ggcgaagtac atctccttgc ggttctctga ccaggtgatg ccctcgagct tgcgccactg    215940
     ggagcttgcg ccaacgtagg cggcgtagat gcgggtctcg aatcgggagg cggcgatctc    216000
     catgccggtc ttgagcttga ggcacatcgc gccgccgtcg acgacggtgg ccttgaagcc    216060
     ggaagcgcaa gtgaagtcgt aatcgccgtt ggggccggcg gtcttggtgc cgatttcaaa    216120
     catgtcggtg aacttgatgt agctgccatc ggctttggtc atgagggcct tgacctgcgc    216180
     gttcgaggct ttgccgaggg agacccactc gacgtcgaac ttgccagcgc cgacgccctt    216240
     ggcggatgtc tgcgtgacct tcatggcgaa aagctcgcca gaggagaggt cgttggcctt    216300
     gtcagggaca aacatcgcgg cgacgccggt gttggagtcg tcggtgatgt agcacacctg    216360
     gggagtagca tcgacgcagt acgggagctc gatggagtag cggcccatgg agtagtgctt    216420
     ggtggcagtg atgacgggct catcggcgga cttggaatcg tcgatggaga cctcgttgac    216480
     ccagcggtgc atgtacggag tccaggattt cttaatcttg gcgaggtcat cgtcgtggag    216540
     actgagatgg cgcagcgaca gaacgtctcc gcccagatcc gaagtcttcg tgtaggcacc    216600
     ggtgacggcg ctgtcccact tgagggagct cgggacgccc cactcctcgc ctccaaggtg    216660
     ggtgttccac ggggaaacgg aaccagcgca ggtggcgatg aggccgctgt cggcggagaa    216720
     atcggcgtgg aagatcttgt caggggtgag gatgcccgtg ccggggttct gcttgagacg    216780
     aaggacctgg atgttcgcgg ggcgatcctc gaggtgcacg gcggcccaga gagtgtttgg    216840
     cgtggccttg ttgcgggtct tgaggatgga tacgaaatcc tccatgttgg agatcttggt    216900
     cttgctggcc ttgccgattg cggcgtcgta tgcgagggtg gacttgccgc tgtcactcat    216960
     gccggtgatt gtggccacgc tcccgagttc cgaggagtgc ggcatggtct tgccgctatc    217020
     gtcgaggagc tcggcgaagg tgacaccgcc gaccttctga ccggatcgga tgatctcggt    217080
     gtactgcagc ttctggaaga ggcccttgta cacgatccaa ggggaggcca tgttcgactg    217140
     ttgcgcagcg gaggtctccg ggtaggggga ttctccgaag aacgtgccgg ttgctccggt    217200
     gatggcgacg ggctgggtgg gttcggcctc gacacccgga accttgatgg gtccgaggta    217260
     gccgacggtg ccggcgccgc cgtaggtgga ggcctcgtcg gggtgctgaa cttggttcat    217320
     gatgtaggac cagccgttga tgttctcgtg gtaccagacg ccggtggtct cggcctcctg    217380
     gacgacggtg ttgatgcggg tgagggcgtg ggtctccatg tggtaggccc agacggcgtt    217440
     gttcttgtgc ttggaggtgt cctcgccgat gaggagaatg tcgtggccgt tcatgaacgc    217500
     gacgttgtcg gggttggcga tgttgtggat gtcgcatttg tcgtcgccgt ccgtgtgtcc    217560
     aagcttgtcc tcggtgttga aggacgtggg gacgccgcag acgaggggag agatggactt    217620
     gatgcggttg ttggcgtcga ggggcgcgcg gtaaacgcag ccgcaggtgt tcttctcgat    217680
     gccgatgtga tcaccttccg catggtcgcc cttgctgtca agcttgtgct ccatggaagc    217740
     ttcgttggaa gagatggcga agtacatctc cttgcggttc tttgaccagg tgatgccctc    217800
     gagcttgcgc cactgggcgc tcgcgccaac gtaggcagcg tagatgcggg tctcgaatcg    217860
     ggaggcggcg atctccatgc cggtcttgag cttgaggcac atcgcgccgc cgtcgacgac    217920
     ggtggccttg aagccggaag cgcaagtgaa gtcgtaatcg ccgttggggc cggcggtctt    217980
     ggtgccgatt tcaaacatgt cggtgaactt gatgtagctg ccggccgtcc ccatgagggt    218040
     cttgacttgc gagtccgagg ctttgccgag ggagacccac tcgacgtcga acttgccggc    218100
     gccgacgccc ttggtggatg tctgcgtgac cttcatggcg aaaagctcgc cggaggagag    218160
     gtcgttggcc ttgtcaggga caaacatcgc ggcgacgccg gtgttggagt cgtcggtgat    218220
     gtagcacacc tggggaaagt cgccgacgca gtacgggagc tcgatggagt agcggcccat    218280
     ggagtagtgc ttggtggcag tgatggtcgg gcttgacacg ctggaggaat cgtcgatgga    218340
     gacctcgttg acccagcggt gcatgtacgg agtccaagag tttttaatcg tggcgaggtc    218400
     atcgtcgtgg aggccgagat ggcgcagcga cagaacgtct ccgcccagat ccgaagtcga    218460
     cgtgtaggca ccggtgacgg cgctgtccca cttgagggag ctcgggacgc cccactcctc    218520
     gcctccaagg tgggtgttcc acggggaaac ggaaccagcg caggtggcga tgaggccgcc    218580
     gtcggcggag aagtcagcct tgtgaatttt cttgacggtg aggataccgg tggctgcagc    218640
     ctgctcgagc tcgaggacct ggatgttcgc ggggcgatcc tcgagatgca caacggccca    218700
     gacagtattc ggactggcgg tgttgcgggt cttgaggaga gacacgaaat cctccatgtt    218760
     ggaaaccttg gtgttgctgt gtgcagcttc tttgccgatc gcggcgtcgt atgcgagggt    218820
     ggcggacttg ctgtcggcac tcatgccggt gattgtggcc acgctcgtga gagtcgacga    218880
     gtgagggata gtcgcgccgg ctgtggtctt gatctgggcg aaggtgacac cgccgacctt    218940
     ttcgccggag cggatgagtt cggtgtactt gaggggttgc atgctgccct tgtagattat    219000
     gtaatcggag gccaagttct tctgctgatt cgccgatgtc tccggatacg gagactccgt    219060
     gaaagccgtg tacgtggaag gcatgacctt ctgctgtgca gcggccaggc ctacgaacag    219120
     cgccaggaag gcgatgatct tgtatcggag catattatct ctttctgcga cgatcgggcg    219180
     atcgcgtttt tggggcagat ggttggtcag ggtcttcgcg cgaggagaac gccaagagga    219240
     gcgggaaatt gggcgtcgcg tgcgtgaagg acggaaatga ttcgactcga gaacgatgtt    219300
     tgcggggggg cacggggttc ggacctctcg atgaggcgcg cgcgtggggc gcgggacgag    219360
     gaagtgagtc gctttcgagc gtgttcgggc gttttcctgt tgttagttcg gcgaattttc    219420
     gggtcaagat gcctttcaag gaatttttcc ggcagatatt ttttgaaggc accccgccct    219480
     tttctaggtt cgaaaccctt cgatggagtt tggatccttc ggaaacgtcg tcaaacgctt    219540
     cgacgaatat tcccagttgc ccgattccaa atttacgcgg tttcgtgcca attgtaactg    219600
     aaaccccata cccggccgag aggaaataat cggaatattc ccgcgccgat tcgggtcgaa    219660
     gagacgcgga ggttgcccac ctcactcggc cgtcgtaagc gaccgcgcct cgcctcgact    219720
     cgttcgtgtc agccaacgcg cgcgcgcccg cgcccgcccg tccctggatc gagcctcggc    219780
     gcatgagcgg cgcgaatacc cccgccgccg cctctgatgc ccccgcggcg gttcgcactt    219840
     tttcgcgcgg cgggaaagat gagcccgacg ctcgcgacga cgattgcgat tcgcgcgcgt    219900
     cttcctccgg ggaccgcccc gacgaccagc tcgagaggca gtgcggggaa tggtgcgtgc    219960
     ccctcgacga cctcgacgac aacgacacgt ccgcgtcgga cgccgagtac ttcagcacgg    220020
     tcgtgtggac cgcggcgatg ggaacagccg tcgacgcggt cctcgccgtc gtaaagttcg    220080
     ccgcggggtt cgcattcgca tcctccgcgc tcgtcgccga cgccgtgcac tccgcatcgg    220140
     acgtcgtctc ggatctcgtc gtcatcgccg cggccaggta cgccagcgcg cccccggacg    220200
     cgaggtatcc gtacggccgc gggcgctggg aggcggtcgc caccctcttc gtctccgtcg    220260
     cgctcgcgtg ggcggcgtct acgctcatcg tggagtttgc cgagaggctc gcagcggcgt    220320
     acgacggtcc cctcggtcgg cacttgggca accccggggc cccaccgcgt tcgttgctcc    220380
     cgagcaccag gaacgcgctg ctcgaggtcc tcccggcgaa cagcggcggc gcatcgtcga    220440
     cgtcgatcct cgacgacgtc gcggcggcga tgcggacgga ggaccccacc gacgcttcgc    220500
     acttccgacc ctcgacgaag gaggcggatc ctaatgaggg aaaaaccgtc ggtaccgcca    220560
     tggactccgc cgcggtgctc gtcgcgctcc tgtccgtcgt cgccaaggag gcggcgttcc    220620
     aggtgacgaa ccgcgtcgcg aaccgcatcg ggtccaaggt gctcgcggcg aacgcgtggc    220680
     accaccgctc cgacgccgtc tccgccttcg ccgcgctcgt gggcgtcgcc ggcgccgcag    220740
     ccgggttcgc gtggctggac gcagccgcgg gggtcgccgt gtccgcgctg gtgctcaaag    220800
     ccgggtggga gatcggcaag ggcgcgacga tggcgctcgt cgacgagaac gccgcggacg    220860
     gggaggtgga ggaggcggtc ggggccgccg cgtcggaggc gctagggacg ggggcgaaga    220920
     gcccgaccgt cgcgggtctt cgcgcgaggc gcgtcgggcg aagaacgcac gtggactgct    220980
     gggtggagct ggacccggcg tcgcagacca gcgtcgggga cgcgttgcgt cgaacggagg    221040
     agctccgggc cggcgtgcgg cggagactgg gtaacgaagc gggggacgtg acggtgcagc    221100
     ttcggtggaa ggaggaggcg tacaccggcg gggcgttcat gtacgcctac ctgtgaatac    221160
     gatagtctac gacgacatca tctaatgtga atacgatata gtctacgacg acatcatctc    221220
     cgagggcccc gtcttcccag ttcaaccgag tcgacgctcg catcagatca gagccatcag    221280
     ctcctggacc ttagcctgcg actgccgctt gtgctgcgcc acctcctgca gcagcgcgcg    221340
     catctccgcc tcgacgcgtc gcaccttctc cgtcgcggcg cgctctcgct cgtcgatgct    221400
     ggcgacccgc gcctcagccg ccgccgccgc ctcagccgcg tcagccctcg cggcggcggc    221460
     gtcttccctc gccgccctcg cctcagcctt gagctcgtcg tccgcgtcgt cgcgctcggc    221520
     gagccgcgcc agcgcgtcgt cgcgttcgcg cctcaggccg tcctcgcgtt gcgcgaacat    221580
     cgacttgacc gactcgacct cgctggacac gtacgcgagc atctggtccc tctccgcaat    221640
     ctccctccgg gcatccgccg ccgcgtcctc cgccgcgtcc ctccgcgcgg tcacctcctc    221700
     cagagccttt tccagacgct cgatggcggc gtccgcgccc gcgagatcct tcttgagccg    221760
     gtgcaggtcg ttttcggtgg atttggctcg cgacgaagcc gcgcgttccg catccaccgc    221820
     cgccttgacc gcgcccgacg tggcctcctt gttccgcgcg ttctcgtcct tcagactctt    221880
     gatgagctca gcctgggact cgagcatggc gtccttgatg cgcacgttgt cgtgcgcgag    221940
     ctcgagctgc tttctgacgc cgtccacctc cgcgatggcc gcgatcgact gcgccttctg    222000
     gtccttgacc aggtccaacg ccttggtcgc ggcgcgctcg gcggcgacgg cagcggaggc    222060
     tcgtttctcc gcctccctga ttcgcacctg catctcgccc acgtccgccc tggcggccgc    222120
     cgcgtcagcc tcggcgcgct ccgccctgcg cctgtcgcgc gccatgtcct ctatggcgac    222180
     cctctgctgc tcgcaaactt cggcgagctc ctcggccaaa gcttccgcgt ccctcttacc    222240
     gtcgagagcg gctcgagcca ctcgcgtcat ctcctcaacc tccgcggtta accgcgtctt    222300
     gtcctcctcg gactccttga gcgcccacct gaactcgtcc tcgaccgcct tgacgcgttc    222360
     gttgaccctg cgaacctcgc tttccaacgc gtctcgcgcc gtcttcgagt cggccaggtc    222420
     ctggaccacc ttgcgggtca ggttgttcgc ggcgacgagg ttctcgtccc ggagctggca    222480
     ctcgcgcgcg tgcatggctc gaagcgcgtc gagattcgcg gcagcctcct cgcgaacctc    222540
     cctgagggtc gcctcgagct cctcagagac ggcgagcgcg gaaaccagct cggcgttgac    222600
     ccggtcgagt tcggcggcgt cgacggaagc cgggtgctct gccagcgatt tcaacgcgac    222660
     gtccctcgcc tccgtcgcct ccttcgccgc gcgcgtggac gcgtcgatag acttggcgtg    222720
     gtcgtctttg agcctctgcg tctcgagcgc gtgccgtttg cgctccgcgg tcacctcggc    222780
     gcgcgccgcc gcgagtttcc gcgcgagctc cgcctcgcgt tccgccgccg tggccagccg    222840
     cttggccggc gacgacgaaa cgcgagtctc cgcgtcggcg tagtcagtcc cctcggcacc    222900
     ctcggcacca tcatcggcac ccgccccgac ctcgacgtcg tccgctcccg gctgctgctg    222960
     ctgctgctgc tgcggttggt tccctctcac cggcggcggc gtggacggaa tggtcgccct    223020
     tcgccctgga tgctgccaat cgggcctcgc ccccgaaccc gaacccttgc cccgcgggtc    223080
     ccgctccctc agcagcgcct cgacctgcga cttgagcgcg gacacctccg cctcgagctg    223140
     ctcccggccg ccgctctggg gtttcggcgg cgggtgcgcg agagcgccgc ggccgaggct    223200
     gaccgacgtc tgcgtggaca caacctctcc ccgcgtcgac gccgcacctc tctgcgttga    223260
     cgccacctcc gcggcgtgga ccccgcccgc cgcctcgcgt cgcgcgttcg ccgctcggag    223320
     caggtcccgc tcgatgcgtc tcagcctgag ctcgtgatca accaccgcgg cgtcggcgtc    223380
     atccgtctcg gcgcgtcgcc gctcgcgttc ctttcgatcg cgcttcttcg cccgcttgcg    223440
     ttcgaccctc gcgtcctgct catcctcgtc cgtttcgtcg cgagccgcgg cggttgccgc    223500
     cgcgtcgctc gtgggctccg gcgggtcggg ctccgcgctc gcgacgctac cctccgccgc    223560
     cttcgtggat accccgtcgt cgtccagcgc ctggagaatt tcatccgtca gcgcaaacgt    223620
     aacctcgcga tgatcgcgct tggcggggga cctgcccgac cgcccttgtc cgaccgctct    223680
     ggccttgtat cgggtcagcg cctcgtccat cttcggcgtc gttcgattcc gtcgcgcggc    223740
     ggccgagtcg tcggacgcga tgaagttctc cggagactca tccgcggcgg cgaaagacag    223800
     atccaaagac tcttttccca ctcgcgcctc ttttccctct cgcgccgcct ccgccgcgga    223860
     ccgcgcgagc gccgcggtct ccgcggtctc cgccgcctcg cgcgcggcgc gctccagcag    223920
     atccgcgttc ctggcgtccg ccaccgcgcc ggatccctcc gccaattcgt cgggtccccg    223980
     cgataacggt tccccgtcga gctcccgaag ccacggcgcg agcgcggcga tggccagcct    224040
     gtaactgggc tccaggcaca cggggttacc cacgcggcgt ccacgcgtcc caacgtcctc    224100
     tcctgaaccc gccgtcgcct cgagcgagtc ggtcgtcgac ggcggcgcgg aggacaatcc    224160
     atgcactggg tcgtccgcgt ccgacgaggg ttcgaaagac ccaaacggcg acggcgacga    224220
     ccgcaggagg atggcgcgaa ggctcaccac cgccgccagc cccgcgccga ggtccgcgaa    224280
     cgtctccacg ttgttgtcgc ggatgtcgag gtgcgcgagc gaccacggct ggccgtcggc    224340
     ccgcgggatg gtgagcgcgt gcagcgaacg gacccggttg taccgcgcga cgagccggct    224400
     cagcttcggg gcgccgaggt cgatgccgtc gagggagacg atcgcgttgt tggtgacgtc    224460
     caacgtgcgc aggtttcgga gcacgggcaa cccctcgagg cgcgcgaggc ggttgctgga    224520
     gaggttaagg tctcggagcg agtcgccgca cgccctgagc atcggatcga cgtccatccg    224580
     ggtcagccgg cagccgtgca cgcacaagga gcgcaggttg gcgaacctgc tgatgccgac    224640
     gatctgcgac agcgactgca accgccctcc gtagcacgat atgtcggtga cttcgccgtc    224700
     gggtgtggtg gggtcgtccc tcagatccac ctgggggagg tcgcccttgc cgaaggatgg    224760
     ggcatccttg tcgagcgagc ggcgcgcggc gggttccttg tcggcatcac cctgtcgcga    224820
     gcgacgcctc tcggcctctt cccgctgacg ctcttgcagc tgctgcgcgc ggcgctgcac    224880
     ccttttgggg ctgtgcctgg gcggcgccat caccacggcg acgcccctct ctctgccctc    224940
     ggacaacgcc ctcggaaggc tcgatgagat tttgacagcc ggcgactgtc gcctccgaag    225000
     aggagggata cccctccgat cctactcgga agggcgcgag gtgtagaagt acgccctcgc    225060
     ggtaccggac cgtgccgccg gtgacgtgcg acgacgtgcg ccgcgcagtt tgcgtcgcag    225120
     cgcgcgcgtc gagcgcggct agttaccgta gccgttagtg aagtttcaaa ttgcgctcga    225180
     taaatttgca gccgaccaag tgttgtccga ccgttccggc agttcggagg tggaaaaggc    225240
     acgagacggc gcgcgtccca gcgccactta gcgtcgacgc ctggtccttt ccagaggacc    225300
     atgggcggcg cctacgatga gatcgaccta gaggatatgg actggaactc ggagctcggc    225360
     gcgttcacgt accagtgccc gtgcggcgac ctcttccaga tcacccccga ggagcttcgc    225420
     gcgggcgagg aggttggcca ctgtccgtcg tgctcgttgg tcatcacggt ggtttacgac    225480
     ccagacgagc tgaaggagct gataccggcg ggaaatcggg acgagagcgg gcggtgggtg    225540
     gaggcggagg agtagagaga gggacgaggc cggggatgga cacgaggaga gggacgcgtc    225600
     ggcatcgatg ggagtggcgg cgggggcggc ggtcgtcgct ggttggacgc gaacgtgagc    225660
     tccccacaga gccaccgccc ccctccgaca cttaccttcg agcccgagga cgcatccacg    225720
     gcccatcgag ggacgcgcgg aaccgctcgc gcaccctcac tcggcacgcc acgcgcggca    225780
     taggcgacgt agaccacata gctcacggac ctcgcgattc gagtttcgtc aatcaaaaag    225840
     acacgtagct agcacccgcg gcgctcatcg cctcgactcc gcgacacacc cgacgcaatc    225900
     gcgcagctcc ctaagcagcg ccctggcctg agcctccgcc accacgcctc gtacgtccgc    225960
     gccgtacgac gcgtacagcc actccaccgc atctccgagg tgatgcgacc cgacgccggt    226020
     tcccccgcga ggtatcgctc gagccgactc gatcgccgcg agcgttcgag ccgcccgcgc    226080
     gaagaggacg agcgccgcga cgtgacgctc gggagcctcc gagatctcgc gcctgcgaat    226140
     gtccgcggcg acggaccggt ccccgtcgtc cccgtgcgcg cgactcgcgg tccccttcga    226200
     tccctcgtcg tcgtcggcgg cgggcggctt ggacagcgcg gcggcggcgg cggcggcgag    226260
     gggctggagg gaacccaccg ccctcgccag ctgctccgtc gccatcgccg ccatcgcctc    226320
     gtctccacgc gcctcctcct cccgaagcgc gacgtccgcg agcgtgagcc gcgcggacgc    226380
     gagctggagg cgcatgttcg ccgccgcagc ctccgcggcg gcgcccggcc tcgcccaccc    226440
     gaacatcggg ttgaccgttt gttccacgag ctcgatgact ccgcggacca agccggctgg    226500
     tcgtatgtcg tccgcgtcga gtaactctct cggtatcccc aggcccatgg catcgctgag    226560
     ccgcgtttcg tggatacgaa ccgccgagcg cagtgactcg atcgcgtcgc ttcgtctccc    226620
     caacgcctcc agcgaccgcg cgcgagcctc gagcgcggac gccacggcgg ctcttcgctg    226680
     cgacatcgcc aaatccctga cgaacccccg cttaccgggc tcgtggtccc cgtgcgccct    226740
     gctcgagcgc tccctcgcct ccagcaccct ggcacgcaga cgctcggccg agacgtggtc    226800
     cccgagcacg tcgccgcgga cctgcgccag ccgctctatt cgacgaaggt tcgcgccgtc    226860
     atcgccccgg ccgcactcgt ccaacacccg gacgctgcgt tccagcagcg acgcgcacgc    226920
     ctcgtgttcg ccccccgcgc gcttggcctc ggccatgtgg aacagcgtct gcgcgtagtc    226980
     cgggtgcgac gtgccgatcg acgcggcttt cttcttcgcc gcgtcggcgt acgcggcgaa    227040
     ggcgcctcga aagtctcccc tcgcgagttt acatcccccg aggttgtgca ccgccgtcgc    227100
     ggtcgccggg tgcgacgggc cgaagtgccg ctccagcgcc ctcgccgcgt cttcgtacag    227160
     cctctccgcc tcgtcccatc gcttctgcag gcggtacagc tccgcgaggt tgttacgagc    227220
     ggcggcgacg tggggatcgt ccttgccgaa tccctcctgc gcctccttga gcgcgcgtcg    227280
     caggtacttc cccgcctctt cgtgctcgcc cctggacgat agatccctgg cgatgtcggt    227340
     gtacaccctc cactgagcgg tggccttgtt cgccgcggtc ggatacgccg cggcgatggg    227400
     cgcatcgagc ggtgtcacct cgcggcggtt ggcgccggcg atggtgttgg cgccctggtg    227460
     gtccgatgac gtggacggtc ccgcctcggt cgcggcggcg gcggagcaga ggtacgcggc    227520
     caccgcgccg gtcgcggcga tcgcccgagt cgacccggtc gccaacgcgc gcagcatcgc    227580
     tccgagcggc gcgctcgcgg gtgcgccggg gcggtgcgcg cgacgtccag aaaacgactc    227640
     ggaaccccaa ccccgcagtc ttgcaaaaca aaactgccaa aaaagtttga agcgcacctc    227700
     cctggcttcc ttctctcgga agccccgaaa gctttcgaat cgagtgactc gaggttggcg    227760
     gtgtattcgc gtcgttcgag gctcgagggc tcgaatttga acccccaaaa agcgccccga    227820
     cacgcacgcc gctgccaaaa gacaacgacg tcctcccgcc tcgtcctcgt cacgacggac    227880
     gctcgcctcg atacgagcgt cgagcgcacc tcctccgctc cgcgcgatgg tcagcacctc    227940
     ggaggctgac tggaccgagt acgagtgccc gcccacggac gtcgccgcgc cagccgcgcg    228000
     gtccgccccg cgccagaggc acgccggcgc ggtccagccc cccaccaggg cggtcacctc    228060
     caccggcgcc aagctcacgg aactcggcga cttgctggtc gacttggaga gccagatcat    228120
     cgcggaagcg cagcagagga cgtgggagca gtgccgccac cactggaggc agcgcgtgca    228180
     ctccctcgtg cccggcgagg acgcctgccg ccgactctcc ctcctcctcc tcggtgcgtt    228240
     cgaacgcggc ccctcgaaac caacaaaaag ccaaaaacca aaacctcccc tctccgcctt    228300
     ttccacaaaa agtttgacgc gacccgacgc cgaccgacca cctgacgacc tgaatccccg    228360
     cacccacccg cacccgcgaa cgcgcgcaga cctggaggcg tccctgctca tcgacgcgca    228420
     gcacgagagc tggatcgaca cccaccgcag gcactgggtc cgacggtgca aggacctcgc    228480
     gggactcgac gagaacctcg aggacgatac ccgaatccga tccgctcggg tcctgcgcct    228540
     cgacgtctcc ctgagctcgt actcggtcct ggcgctcggg ttgttcggag ggatcaggac    228600
     ggacgcgctg cgcaggatat ctgagggcgg ttgggacgcg gacgggtgca gggagtggaa    228660
     ccgtcgcatc aggctgatca tggacgacga cgaagaagaa cccgaagaac ccgaaccgac    228720
     gcccgtccct tcgtccgtcc tccgcgcgcg ggagttggcg ctggcgaggg aatcactcga    228780
     atcccttcga cggttgccgc gcagggcacc cgacgcgcgg gacgaggcgg tggcggcggc    228840
     gcagcggacg gcgacccggt tcgagcggga ttacctcgac gacggcgccg gcggcgtctc    228900
     ggatggaccc cgcgattccg ccgacgagga cgactcgtac aacggggacg actcgtacga    228960
     ggacgaggag gagacgaccg cggcggtggc cgggaccaac ctgacgcgcg agattctcca    229020
     cgaatccccg cactacaggc agctcgtcga gcactacagg cgtcgcatgg gcgaaccggg    229080
     gtacgacccg gacgcgtccg acgacgagga cgaccccatt cgcgattccc tggtcgccgc    229140
     gacggtcagg gagactgttg ggctgcacga gggggcgagg cggcggctcg cggtgggtca    229200
     cgacggcgcg cacggcctgg tgaccgcgac tcgggccagt cggggcgcgg aagcgaacgt    229260
     ggcggcgcga gcggccgtcg cggcgaggga ggtgtacgcc gccgccggtc tcccttatcc    229320
     gacgcgcccg ctgcacgagg gtttggggtt cagggaggct cacaggttcg cgggggtccc    229380
     ttacccggcg gacatcttcc cgacgggcgt cgccgatgcc gcgcgctccg aggacgaccg    229440
     cgcgggacgg cttctcgcca ggcgcctcgt cgagcgcgag cgactggtgc gagcgacggg    229500
     cgacttcgac gcagccggcg gcgaggacgg cgacgacgac gacaacgcga cggtcgcgcc    229560
     ttcgccgcct tccctcacgc ccgcgccgat cgacgaggcg ggggttaggg atatggacga    229620
     gcgcgacttg cgcgccgcgc tgatggacac cgcgcgtcgg ctcgaggcgg cgcaggacga    229680
     gctcctctgc cagatttgct tcaccgaacg tcgcgacgcg ctgatcatgc cgtgcctcca    229740
     cctgctgtac tgccggagct gcgtggacag gtcgagcgag gcgaacgagc ggcggggtct    229800
     gccggacagg tgcccgtgct gtcgcgcgag cgtcgggggc gtgttgcggt gcaagaggct    229860
     gtgaccgacg ggcgacgagg gacggacgaa cgacggatat gcacgaatca gacgacgaaa    229920
     atcagacaag tgttagaggt aacttccgag gagcgcaggc gtttttttct caacctttcg    229980
     cctcccgcga gattctcaat gtgatcgcag cctcccgcgt cgaggtcact tcgcacgcgc    230040
     ccgccgcccg tttcccccac gtatcgccat gccgctcatc gaggagatcg ccgaggagga    230100
     gcccatcgac gacgtcgagc ccgggcgcgg ggacgagtgc tccatgagcg tagacgtgaa    230160
     gatacagtgg agtgagcggc tgaaactcgc cggtaacgca cacttcaagc gcgggaacct    230220
     cgagaaggcc gtcgccaagt accgccgcgg cgccaagctc ttcgagatgc tctacgcggt    230280
     ttccgccacc gacgaggagg gttacgaggc ggcgaacgag cgctgctacg tcgccgccgc    230340
     tcccctctac aacaacctcg cgctctgcct gtacaagcag ggcaagtgga aggaggccgc    230400
     ggacgcgtgc acggacaatc tcgatctcac acccacggat gcgaaatcgc tcctccgacg    230460
     cgcggcgtgc tacgccaaga ttaacgagtg ggtagaagcg gagcgggata tcaagtgcgc    230520
     gctcatcctt tgcgaagaga agtgggcgct caggagcgcg gcggagacca ggaaggagat    230580
     cagggagctc aggcttaagc agaacatggc ggatcacgcc gtcatcggcg gcaagatcgc    230640
     ggacatgaag ctgtacgacg cggctgacgt ggcacccacc ggcgaggcgt ttccccacag    230700
     cggcaggcgc aaaccctccg tgaccaccgt ggaggacgtg aagaaggagc tcgacgagat    230760
     ggaagacgag gacagggagg agacgcgccg ccgcaaggag gacttttgtg agttgttgaa    230820
     ttcttatttt ttttgcgatg ggcaattaga atgacgtcgc gttttgttca cagacaacgg    230880
     catgattcgg agcggcaagt ggagactcgt caacgcatct ggcgaggaga tcaaacaaaa    230940
     ggcgagaccc gccgcatgag aacgcggatg acgttcgcgc atacgctttg acctttgaat    231000
     tacgtctcga ttctcgattc gtcaatcgcc tcacggggat atagccgacg caggcaagga    231060
     ggtagctagt gcggcagccg cgaatgtcca cgtcaatcaa atcaaatcaa atctcgattc    231120
     gcgactacct ggatcgcgtt cggcccttga tgcgctcgga cttgcccact acctggatcg    231180
     cgttctaccc ttgatgcgct tggacttgcc cggcctggcg ctcggtgact tcttcgcacc    231240
     cttccctttc ccgccgtcga gccccttacc ccccttccgc gcgatcttcg catccttctc    231300
     cttctccttc ttcttatccc gcttgcgctt ccgcgccccg agcgccgcca tatcctcctc    231360
     gatcttttcc ttctccgcct tctccttggc cttcttggcc acgttacgct cctgctcctc    231420
     ccttcgcctc ttgcgaagcg cctctttatc aaccgcgcga gtctccagtt ccttcacctc    231480
     gtcctcggtc ttgtcgacgt acgcgtggta cagcacacga ccctcgcaca tcccctcctc    231540
     caccttgacc agctccatct ccatccgtgg gccgatctcc tggagcttga cccgcgaggt    231600
     ggtgttggct ttggacaggc ggttgtaatc ctgcgcgagc tccacccgcg cgttgaccgc    231660
     atcctcacct tccgagtcgg aaaactccga cacgtggccg ctgttggctc ccgactcgaa    231720
     gaactcgccg atgtcggtca atcggcctaa gtcgggaact ttgttcttgg tgaggagctt    231780
     cttgaggtgc ctgttggtgc cggtgggcaa cgcgttgatg gagtagtggc gaaactgaaa    231840
     cttgttgctc tccttgtcgt agtcgactag caccgcgcgc tggcaggtgg agagcttcac    231900
     cttgcggacg ttgatggccg ggaagaggtt ctggaacgtt atcgtggcga gcttttgatg    231960
     cggggcgtcg ccgaagttgt tgagcacgac gagcggcggc gagaggaacg cgttgggggg    232020
     cgcgcgcgga ttgcgctgcg ccgccgccac ctcgcgcgcc agcgtgtact tgttcacctt    232080
     gaacgtgagc gtgggcccgc gcggggtctt ggcgatcttg acgtacttcg agttctccgt    232140
     ggcgctcagg atgatgaagt gcgacacgcc caacggaccg gccacctgca cgaagtcctt    232200
     gagcttgttc gccttggact ccttgaggtt cttggcggtg tgcggctcca tgacgtgccg    232260
     gacatcctcg gtgagctcct tcaccagctc gctcatcttg ccgcgcttca tgacgaagga    232320
     cttggggatg tcgcccttgc cgcccggtgc ctcccgcccg gcattctggt cgaggtgcgt    232380
     gcgtcgcttc ttgcggcgcg tcttcgccat ggctgtcggg tcggggtcct cgaggcgcgc    232440
     gcgcgcttct gaggaaaatc tgtcggcggc gctttccacc gagctcccga accttttccg    232500
     cttttcgtga gttaccgttg cggggtgcgc acgtgttttt gacagctgca cagctcagtt    232560
     agtcgtcaac ttttggaaaa tgcacgtgtt tttcagtagt ccggcggcta acaaaacctg    232620
     ttctttttta ccctctccgg atacctcgac ccgggcacat cgccggagcg cacgacgggc    232680
     tcgagcaggc caaactaggc ggatccacgt ctccggtgcg catcgatcgc gcagcccgcc    232740
     cgcgcaccga gaagcgcagc gtgtcatctg aaagggaacg tcccgaaaga tgttcggaag    232800
     gcaaaggagg gaaacatccg gggggatgat cgtgaggggc cgaaggctgg cgtcgccccg    232860
     cggcatgggc gagggcgcca cgctccgcgc gaccgccaaa tccggcgcga ccgtcgcgtt    232920
     cctcaacaac cccaagttcg cgtccctgac cggtgcgatg atggccaatc ccatcgcgtg    232980
     cgttgccgcg aagccggcgg ctgcgaccgc cgattccgac gatacaccca agctcacagt    233040
     ggcgcggctc atgcagcgaa ggcccgtcgc ggtcatcacg cacgtcatgg gcacgggcgt    233100
     cgcgctcttc ctcgcgggag gcaccgccgg cgcgctcgcc aagacgtgca ccgcgccgct    233160
     ggaccgcctg aagatcatca tgcaaatctc cagcgccaac cagcaaaccg ccgcggccaa    233220
     ggcggcggcg tccggcggcc tcattccggc gttcatcgcc atcggcaaga gcgagggcat    233280
     caaggggtac tggaagggca acgtcccgca ggtcatacgc attctgcctt actccacggc    233340
     catgctcaac tcgtatgagt tttacaagca gcagttcggc ggcgaccagt acagggagac    233400
     gggcaagctg cccgtggctt cgcgcctgat gtccggcgcc ctcgccgcgt gcaccgccac    233460
     gttggtcacc tacccgctcg acatcatccg cctgcgcctg tccgtcgatc ccaacatgac    233520
     caccatgacg caggtgtgca aggctatcat caaggaggag ggcgccaagg cgttcttcaa    233580
     gggcctcccg gcgacgtgcc tctccatctc cccgtacagc gccctgaact tctgcatgtt    233640
     cgacctgatc aagaaggcga tcccgggcga ggagacggcg cagacggtgg cgaccgcgtc    233700
     cttcatcgcc accatgctcg cgtccggcac gtgctacccg ctcgacacca tccgccgcca    233760
     gatgcagctg aagagctcgt cctacgcgaa cgtgttcgac gcgggcaagg ccatcttggc    233820
     tcgcgacggg gtgggcggga tgttccgcgg cttcgttccc aacgtcatca agaacgcccc    233880
     gaacaagtcg gtgcagctca ccacctttga cgtgttcaag cggaagatca aggagtcgga    233940
     gaaggcgctg gaggaggaga aggccatctg ggccgcggag tgcaaggcaa gcaagggaaa    234000
     gaagaggagg tgatcgccgt cggttcgcgc gtttgaagcc gacgctccat cacccgtaat    234060
     atacaatagg aggggggggg gaaccgcgaa ggtgtgtacg tattaataag agtttgctta    234120
     gttggtgatt gagatgtgtg tgttacaaat tgctactaca acgttggagg gacgatcagt    234180
     tctcctggca cttcccgtac tcgaagagcg cgcagtcgcc gccccacggg agctgcttga    234240
     gcctcctgcg catgtaggag tacgcctgac ggatggtggg gaaaggaaac ggggtcagtg    234300
     ggggttcgcg cgaaaacgca caattttgag agacgttgcg ttgcgcgggc cctcggcggg    234360
     tcaaggagcc agttggggcg gtgacgcacc ggctgctcgt gcgcgtggtg ctcgtggtgg    234420
     ttggagaaca ggtagacgcc gaggccgatg cacccgggca cggcgaggaa ggtgacgccc    234480
     ctccacttct ccatgtgagc tgcgcggtta cgggggggaa ggggaggacg ggtccggtca    234540
     gtctcgggcg tgcggtgtac ccctctctgt atgggcgtcc agtcagcgtg gggcaaagaa    234600
     acatcgacgg ggcgtcctgg ggttcccgcg cgcgacgggc gacggcgacg gtatcgtcca    234660
     ttcggccacc gcggcttccc gcattgaggc atccacgacg cgaacgaaga gtcgagggac    234720
     gcgcgcgtcc aacccgggac cgtccgcgcg tgactgaacc cgcgcgggaa ccctaaaata    234780
     tccgaaatca ctgaacgcga ccgccccgcg gttagcgccg ggccgcgcgt cgcgcacgca    234840
     cctctctcct cctcgatggt gccgccgccg gacatgttgc ggcgggtcac ccgcacggga    234900
     gccttggcgg cccgcttggc aaagttcagc agggtggcgc gagcggacat cgtcacacga    234960
     cgcctctgat tgtgtctcgc ggggtccgta gcactatctt tcagtgcgtc tgctcatcaa    235020
     gggcagcttg gcagcttgga gccgagtttt ggctgcgatt caacaagcgg ctgctatcga    235080
     tcccaacccc cgtgccgtca gtccacctcc accggaccct tcttctcctg cagtttggcc    235140
     atcagctgcc tcttcttctc cgccagcagc ttctccaggt cagtcgtgga ctccggtgga    235200
     ccgtcgtccg tcgtcctggc tcgcttcgcg gatggctcgc cggcgtcggc accgccaccc    235260
     gccgcagcag ccgcagccgc cgcctcccgc tcgggcgtcg tctccctctt cacctccacc    235320
     accacgacgt ggtccccacg atcgccgtcc cctccgccac ttccgacgcc gtttcggggc    235380
     agccccttac cctgcagcct gcgttcgtcc ccggttttgg cgccggcttc ccaaaagagc    235440
     gtctccgagc ccctcagcgt ctgaacctcg tggaacccgc cgtcgttcgc ctctttgtgc    235500
     gtgattcgca gcgtggaaca cacgtccgcg ccccggcggg tgaacatcct ggacgccatg    235560
     acgttgatct tggcgtgctc ccgtctgtcc ttgatcttca ccctcgcgcc gtcctccacc    235620
     cccgggggca cgacgacccg agcctggtga aactcatccg tcgcccccgc ggctccgcag    235680
     tgcgcgcacg cgacgggctt accgaagccg ttgccgccgc acgtcaggca cgactcgtcc    235740
     ttcctgccgt gcgtgtgctc ggtgcacggc gggcacgaca tgcccacccc ggcgcaccag    235800
     gcgcaccgct tccggtacgg gatcatggcg agcttggtcg cgccggtgag cgcctcggcg    235860
     agggtgatgt tcacgagcac gtcgtcggac gcggcgccgt tcaatcgcat gcgcttgtcg    235920
     tactccgcgc gcttgacggt gtcgctgagg acctcgtacg cggtcacgat ggcctggaaa    235980
     cgcttctccg cctcgggctt ggcggcctcg tcgcgcacct tgtcgggatg gcacttcagc    236040
     acgagcttcc tgtacacctt cctgacctcc tcggccgtga ccgtgctgga caccccgagg    236100
     gtggcgtaaa gggtctcgga tccatcgccg ccggacgcca tcgctcgata tatcgcccgt    236160
     cgccctccac tgtcctggtg gacttccccg ggtcgcggtc gggtgtgact tcaaacgaac    236220
     gttcaagaaa cttggggggc gggcgatcgt aacgagatct gatgatgaaa agcgaaaagc    236280
     gacggggcag tgcacacccg cagcgagcat ggggatacac gatctgccgc cttttcccat    236340
     cccggtcgat aaattcatcg aggaagtgga aagcgataat gcgtcaaccg cggcgcagtg    236400
     ctgcgccgcg ttcgcgaccc tcgccaccaa ggtgccggtg cccagggact tccgaggcgc    236460
     gtgccggagc gtgatggggc tggtggagcg cacgggaaac gggttcggac gcgcgacgaa    236520
     ggagagcgcg agcgccgcga tggccgcgct gctggcgtgc gttccgggcg cggataagca    236580
     catggtccag aggggagtgg tgggcaagct cgtcgccatc gccgtcgccg acgaggagga    236640
     tggcgaggga gacgaaacgc ccgccgccgc cgacgggacc tcgggtacca ccaggcgggg    236700
     cggcgtcaac ggcatgggca cgctgacctt gaacgcgctc gagtgcatcc gcatcctcgc    236760
     cgcatccgag cacggcgtgt cggagctcat gaagaacgac gaggcgatgc atttcgcgac    236820
     gcgtcggtgc gacagcggcg acgccaggat cgcggagtgc gcctgcgacg tcctctgcgc    236880
     gctcgcgtcg cgaggcgtcg cgcatcgaac gcgggtgaag gacgtcgggg gagtcggcgc    236940
     gctggcgagg gcgctagcgt cgcacggcgg cgctaacgag gaggtggcgc tgagggcgct    237000
     gctcgggctg gcgatgacgt gcgcgcagga cgcggaggcg caggcggagc tcgtgcgcgt    237060
     ggatggcgcc gtgccagcgt tgctcgccgc gcagaggagc ggcggcgacg cggcgggtgg    237120
     gatatcgaag gacctctggg ggtccatagg gaagaacccg acgctgaaga tggcggcgat    237180
     ggaggcgctg cgggcggacg tggagcgggc gaggctggtg gagtcggcgt agatgggccg    237240
     gcgaggagcc ggaacagctt gtactttttc agcacatcca cgttttttgc gaaatccgcc    237300
     gaaatttaat ttccgggcga tggtcgtgac tgtttgctct gtgaaaaaat cccaaaaagt    237360
     ccggcggaca tccgcctttc aaaatctccg gtcgagctgg gtttcagacg tcagttttgc    237420
     aacgagcttc ctcactagat tctgatcact cattcccaac gcgtcgcgta atggggcgtt    237480
     ctgatataac gatgactcat cgcgagatat ttccaatcgt ctctggcgat atgactcatc    237540
     gcgagattct ctgtggattc ggtcgacttg ctgtggattc ggtcgacttg ctctaactga    237600
     aagcccatag cgcacttttg caaatggtgc tgtgttctat cgagcggcaa aattgtcaac    237660
     gaactccttt caaagttttt ccagaagccc gcccgaccgg cttgaaccct gattcttggt    237720
     ctaaaagtcc acggggtcgc ctatagttgt tatctactgc tgagcgacga cagttggaag    237780
     ttctttccat ggcgccactg ttctacgcgc accgacgcca ccatggagag catgccgaaa    237840
     ctacctaaag tgacctacac gggctcgttc aagtccgtcg tcgcaggcac tcctggaagt    237900
     gtttggaaga cggacgagga caaaccatca tacgtcgatg gtcggctgat cggtcgttcc    237960
     aaagtactcg aattttgctt ggtgcgccca ggctgctggt gcaagatacc accgccgtgt    238020
     gtggggctgt gcgctccgtt catcgcgtgc ggcagcacgt gccgcaccac gtgtggttct    238080
     gtatgcggtt cagtatgcgg tccctgcttc aagctgcccg ggatgtgcaa gaccgaatgt    238140
     ggcaaggtct gcggtccagt atgcggtccc tgcttcaagc tgcccgggat gtgcaggacc    238200
     gaatgtggca aggtctgcgg tccagtatgc ggtccctgct tcaagctgcc cgggatgtgc    238260
     aggaccgaat gcggcaaggt ctgcggtcca gtatgcggtc cctgcttcaa gctgcccggg    238320
     atgtgcagga ccgaatgtgg caaggtctgc ggtccggtat gcggtccctg cttcaagctg    238380
     cccgggatgt gcaggaccga atgcggcaag gtctgcggtc cagtatgcgg tccctgcttc    238440
     aagctgcccg ggatgtgcaa gaccgaatgt ggcaaggtct gcggtccagt atgcggtccc    238500
     tgcttcaagc tgcccgggat gtgcaggact gaatgtggca aggtctgcaa ccctatctgt    238560
     aacccaatct gctcgtttgg gaagtcttgt tgggccggat gctggggcgg atgcggtaag    238620
     gtctgcgagc ctatctgtac accctgccgc tcgtttggga agtcttgttg gcttgcccta    238680
     gttccattta tgtgctgtgt gtgctgcacg tgccaccccc gcaagccgtc gatcgaagtt    238740
     gagggcgaca aacggctgca agtcggatac ccgtgccata ttgaagcttg ctggtactgt    238800
     ggtggctgct cccttgacgt gacattccta tgggaccttt gcggctgtct tggacctaca    238860
     tcggatctca tgcaaaatgg gcatttcgaa ccacgagagc tgcacaattc caagtgggcc    238920
     gctaagattc ctgaagctaa gcgatcggtg ccgaagctaa ccgctgcgcc cgcggcgcaa    238980
     accatggacg ccaacacggc gtgaggcttg ttcggcgctt gaggacgacg ttcgcacgcc    239040
     gtgtcaattt ctgttttgtt gatgaccggg gggaaataat aagctcggag actccgcgcc    239100
     tcttgcgcgt tgaagcccga cacccgttcc ccttcggtcc acgtgttgtg acttatcatg    239160
     tgttatacca tcgtatcatc acgcttcacc acgaccgccc tactcgccgc cgtcaatggg    239220
     acacaaactc ttgaatttgc cgctctcgcg ccgacccggg tccgccgtac gcctcgatcg    239280
     catccgccgc gttccacgga gcgggctcgt acctcgcgcg cgagtttgcg acgtccgcca    239340
     cccgcgtcgc gacgtcgcac atggcgcgat aggtatcgtg cgtctccgcc gttgaacacg    239400
     tcgcaaactc gcgggcgacg tgacgctcgt acaaacggac ggagcgctcg ctcgcgatga    239460
     acgcaccttc cagagctcct cctttccgat ctcctcgttt cggatcctgc tcgagggcaa    239520
     cccccgtcgt cgccgtcgcc gccgccgccc gtttggtccc cgtctcgtca ccgactccgc    239580
     cggcgacgca cgaccctcgc cacgccgcgg cgcggtcgaa cgacgtcaaa ttcgagtcgg    239640
     agcccatcgc gtcgtacacg ccgtctcctt ccagcgccga ccatcgcagc gacgcgatcg    239700
     gctccccctc ccctttcgcg agaacgtcca ccgcgcggac gggcgcgcgg gtgggcgcgc    239760
     ttggatcgtc ctcatcccat cggcgggtcg ccgcgtggtg acccaggaac aggtcgatac    239820
     cctcctgctt gtccgcgtcc gtgtacgcgt tggagtagaa tctcctggcg gacgtgagca    239880
     gcttggcgcc gccgctggcg acgcggttca cgacgcgcgc caccgcgccg gatggaccga    239940
     cgccgccgtc ccgcgccacc tccgccttgt ggtgcgcctg actaccgccg tactgcatgg    240000
     cgaggacgtc gcccatcgac ctgtacacgg acatcaacgc cgcggcgacg gaagagtccg    240060
     ggccgacggc gtcgccgtcg atgaccccca ggcgttcgag ctggcatccg agcgcggcga    240120
     gaccccacgc gaactgcgcc acgttggtcc tgtccaggca gtcgacgcag tgcgaccgga    240180
     ggacgccgct ctggcacgtg agcgcgagtc tcttcgagtc gtcgaggggg gtgacgcgag    240240
     acggcgcggt ggaaaacagc cacgggtcgg accccgagcc cgctccgggc gagggcgcgc    240300
     acggatcgcc cccgcccacg gccgtccctg acccgggttc gacgccggtg accagctcgc    240360
     aagccgcgtc cctgaacgag gcggcggcgg cggcgcgagc gtgcacaccc ccgcaccggg    240420
     cgcgctgccg ctcgagcgcg ggcgtcatcc tcgaggaggg accaatcgcg aagaccccgg    240480
     tgagaaagag ggcgccgccg gccaccttcc ccagccggta cagtcccgcg gccgtcgcgg    240540
     aggctcttac ggttgaaaat gaacccccga aaccttctga ttcgtccccg tcaccgtcac    240600
     cgtcaccgtg aaaatcgtcc ccgtccgccg agacggatcc cttcatctga cgctcaaagt    240660
     cccagtgcac gcacgcgatc ctctcccggt ctgcgggcaa agcgccgttg acgtagtgca    240720
     gcgccgccgc cagctcgcct cgaagcgccg attccctcgg ccgccgttcc tgcgaacgga    240780
     tcagtgacag gcacaccgcc gggtcgcaat acctctgacg cacgagcgaa aagtgcgccg    240840
     ccgtcgcgga gtgggtcacg tcgtgcccgc ggacgacgat cgtcggcctg gcgttcagcg    240900
     cggacgtgtc ctgggaccag aacagcggga cgctgccccg cagctgcgtc gcggaggaca    240960
     cgcggggttc gtacctcggc cggcggcggg gtacccggtt cgcgcctcta ccagaaccgg    241020
     ttagttcgaa ccggttatta gtcggcgtac ccgcgtctaa ccaggtgagc tgcgcgtcgc    241080
     cggcgtcgac gatctgctcc gtctccacct cgttcgccac cctgcctcgc acgttgactc    241140
     ccctgcgatt gaaccgcgtc cccgcgtggt gccgcgacct gcgcgcgagc accgtcatcg    241200
     tcacctcgcg gcccgacatc gacgcgcggg tctgcgcaaa gtacccgtgg cacagcggcg    241260
     cgatccaacg cgacgcggtc tccgtcccca gcgcgacgcg cagtgccctg gacaggtgcg    241320
     cgttccacgc gaaggcggac tcgaagtcac cggggcagta caccagatgg cccggatggc    241380
     gttcgccgga caaagggctc agcgcgtttg tctgaagcgt ctccgtgagg ttgtacgtgt    241440
     cgctccagaa gaagcccgtg gcgaggtcga cccactggag cagcctcttg agcctctgct    241500
     cgtccgcctt cgtgccccgt cggtcgaccg tgtccgccag cctgacaagc ttggtgtccc    241560
     ccacgcccca cacgacgtga ccgcacacca gacccaacgc cctcctcgcg gtgacgagca    241620
     agaggtggtg gccggtgagc agccgcatgg tgccgaccac ggcgaccccc tccgcgacga    241680
     gcgtgacgaa ccccgggctg tcgcgctgca gcagcagttc gagcgcgtcg tcgtcgtacg    241740
     tgagcgggtc ctcgaccgcg tccaaccccc ccgatgcggt ctccatccgg cctattcgaa    241800
     ccacccgcca ccgcacgctc ccatccgccg aagttctgcg gccccccgcc aggtggaacc    241860
     cgcgtcgcgt ctcgtacagg cgcacttccg acaggccgga agtcgacgcc gactcgggcg    241920
     acgcgtcgcc actcccttca cccggctgcg ggcgggaaag ctcccccatg tcgggggaga    241980
     gcccagccgg caagagaaat gacatcccga agcttgacga acgagctctt ggagacctgt    242040
     acaattaggt cacgccaaca agatccaacg cgcgacggca tgggttccga cgccgagatg    242100
     gaggatggcg aggccccggc ggcttccatg gacgacttcc ccgagggcat gaaggtcaat    242160
     acgtctaacg cgggcgggga ggtctccatg tccctggagg agaccaaccg agtccgcgag    242220
     aagctgggat tgaagcccct ccgcacgggc gagagtgatc ggaccaaggc gcgtcgcgag    242280
     gccgaggaga cggaacgcgc ggcgcgggag gcggacgcca aggatgcgga aaccgccgcg    242340
     ctcgccgcca agatagccgc ggccaaggag aagcggacca tggagcagcg caaccgcgcc    242400
     accaagcaac tcggcgaggc ggcggacgcc gacgacgacg acatgatggc ttgggtgaac    242460
     aagagccgca agatcgagga gaagcggcgc aaggaggaac gcaaaaaggc ggaggagctc    242520
     gcgcggaagc tcgcggagca ggacgacgag gcggaggagt cggagggcga cgagatctac    242580
     ggcggcaagg acctcgcggg catgagggtt cgtcacggcc tggaagacgt cgccgagggc    242640
     gagaccatga tcttaaccct gaaggactcg tccatcctcg acgataagct ccaggggatc    242700
     aacgaagagg acgacgagct cgagaacgtc aacgtggccc aggagcgcaa gcggcagaag    242760
     gcgaaaaagg ctgcgacgaa gcgaagcgac aacccttttg gcgccgacga cgaggacgcc    242820
     ggcaagaaga tactctcaaa gtacgacgag gaggacgagg acgagggtct cactctggac    242880
     gcggcgggcg cgatcgacgc cgcggaggag aagaggaaag ccgacatcaa gcgcaggctc    242940
     gccgcctcgc tcggcggcgt ttccgtcaac gccgtggctg agacggctga cgtgcggaag    243000
     agggagatgt cagagttcat gtccgcggcg gaggttgccg aggaggcggc ggccaagttt    243060
     aacaaaccaa agaagaagcg acggaagaag ctgcgggaga agaagtttga catctccgag    243120
     attgagaacg accacctcgc gcaggcggcg caggagaagc aggaggcagc cgccgagccc    243180
     gaaagggccc gaggccgttt ccggaatgac gcgggggagg aggagaggaa actgatgggg    243240
     tttcagaacg cgctcaacaa ggccaagatc aagacggacg agcgcatcct cgccgagatg    243300
     gccggcgacg tcgaagacga ggacacggag ctcgcgatgg cgctcgagcg gaccaagcgg    243360
     ctcgcggaga ggggcgttgg ggctcgaagc gacgtcgacg tcgcgagggt ggcggcggct    243420
     cggcgggcga cggatgcgcc ggatgttggg gagcgaggcg cgagcggcga gggcatggtg    243480
     ttcaacgacg tgcaagagtt cgttcacggg atcaacgtgg aggacaagag ggcgacgagg    243540
     agcgaggcgg ccgccgcggg cgacatgccc ccggttccgc ccccgccacc cggctcgggc    243600
     gacatgccgc ccgttcctcc cccgccgccc ggctcggatg tcgacggcat gccgcccgtt    243660
     cctcccccgc cgccctcggg ggttggcgcc gaggaggaac atgaggatga cgaggtgaac    243720
     cccttggacg gcgtgcaggc caaccccatg ggaagcggtt tggcggccac tctggccctg    243780
     ctgaaggaga ccggtaagct gcacgagaac gacatgtggg acgggcgcac caacgacaag    243840
     aaacccctgg cgctcatgcg cgtgagggaa gcggcggaaa tcaccggcgc agagtttgag    243900
     ggccacaagt tcgacttcaa gctggacagg tacgacgagt ttgggcgcaa gatgaccccg    243960
     aaggaggcgt tccgcgagct gtgccacagg ttccacggca tcgaacccgg ccgagccaag    244020
     aaggagaaac ggctgagggc gtatcaggag gaggtcaagg cgaagaagat gcgggagggc    244080
     gagtcggtga ccgggtccgt ggataagatg aagatggcgc aaaaggcaac cgcggcgccg    244140
     tacgtggttt tatcgggcaa gatccacgcc ggtcagatct cggacgcggt gagcaagtac    244200
     gccacagccg ggctggagga tgacgccggc aaggagacgg gtaaggcctc gcccgcaccc    244260
     ggcggcgcca agcggggcgg tggtggtggt gacggcggcg gcgggaacgc gatggacccg    244320
     accacgctgc cgatgctcac cggtgcggag aaggtcaagt tcatgatgtc gaagaagtaa    244380
     cattcgtcgt tacatggcgt tttgaaatat acaatcttat cctccatcac acctcatcga    244440
     cgagcgcggc gagaatcgag tccaccgcgg tgtcgtcact ggccaggcgc ctgatggccg    244500
     aacggatcgc gcttttcgtc acgggctcca cacctccgac cacgaactgc aacgacccgg    244560
     gaaccaccga aacgtcggtt ccgtcgttgc tcccgatgga gatcaaaacg agcgcgataa    244620
     tcatgagagc gatgagcgca ggcatgaacc acacggcatg tccccaccag tacgaagtgc    244680
     gggcgactct gtctgcggtg ctgttcgtct cgggcaccgg cacctcgacg gagctgacgc    244740
     tcatcgttga gtttgagcgg atgaggccgg cgtcttgcat cggcggcgcg ctcgctcctt    244800
     cgtttgcccg aagatcctcc tccaccaggt cgaagaacct gccgtaactc tttcgaacct    244860
     tgtccctcgt tccgcgctcg atgaggctct tgacgatgct ggagaccggc ttgagccatt    244920
     ccacgtggca cgacacctgg acctcggaag tgaggctgaa ggacacgtcg aacagcacga    244980
     gtgtctccac tttgtagcag tccgcgtagg gtgttccctg actatgagcg cgcgacgaca    245040
     tccatgcgcc tcggtcgtac atctgggcgt ccttcatgtg gcacaccttg ggcacggacg    245100
     ggaggtgaac acccgtgggc gtgtcgtaag agaggtaaca cttgccgtcc ctcatcgggc    245160
     tcctcacgac gttcttagcc ttacagttgc gcgtgagatg attcgtcaaa agggtcagct    245220
     ccgagtcgaa catgcgatcg tagagctcgc attgatcctt acagtcgggg aagcgcctgg    245280
     tgagcacgat ttccctcgcg tcgggagggg gcctgcggct cgcataggag aaggtgtctt    245340
     gggagccgta aaccttctcg gtggcctgag aggacgccac cgagtaggtt cgttctgagg    245400
     agccggtgat gcccgggatt cccgtcgcgt cgtcgtcgtc gttctcgtcg ccgctcgcgg    245460
     tgtgcgcgac gctgccgtcg tgtgtcgtcg cggtcgcgtt cgcgctgtgc tccagcctcc    245520
     acgcgtcgtg aatgcacttg aaggcgttgt ccctgtataa aaagctgcac aacacatagc    245580
     tcttgccgtc tgaggcgcga aggagctcga tggcagacac gacgccaacc ttattcacct    245640
     tgcgcaccac ggatacgtcc gcgaggtgga tgagccgagt ggtgacgata ccgaagatat    245700
     ccgaatgaaa ccacacgcgc gcgccccgtt ggccggaaac gacgtagact cgccccgaca    245760
     caagcagacg agaggcacgg tacgagccga cgaaggaacc cagcagcacg tcggtcgagt    245820
     cggtggggaa gtgctcctcg agccacggcg gcgcggcgtt cgcgttggcg gacgaccttt    245880
     tcaaacactc ggtcatggcg ttcggtcgag ttgtggctcg gcgagaaggg cgacggcacc    245940
     ctcaactcaa aagccacgac cttcgagcct cgttgttttc tcctcaactg ttgaggttca    246000
     aacagctcac agtggcgatg gctccgaagc gcgagatggt cgaccccgcg taccacaccc    246060
     tcgtgctctc cgagtcggat gacgacctcg actccgagga gatcgaggac gcgcccgtgt    246120
     gcgacgaccc acacgccgcg ctgaggcgcg tgagcagcgc cttcgacgcg aaggttgcgc    246180
     acctcacgtc tccgggcctc gctccttccg aagcgaccgc ggtgaccctc gacgccgagg    246240
     ttacctccag gctgaacgcc gcgcgcgcga tgctctccaa ggtgaagcgc gcgctcctcg    246300
     acccgttcaa gcagatgata gaaacaaaga gggacgaggc cgcgcagttg gaggaggcga    246360
     gggccgcgga gcagcgagtc ctcctggagc ggctcaccgc gcagtccaag ggcgtggacg    246420
     aggagttgtc catgctcgcc gacgccgccg gcctgagatc cgtgtgcgac ctttacgccg    246480
     ccgcggagga cgaggagatc gaggcgcggg cgaggcgcga caagtcgagg gcctgagggg    246540
     ggaacgtttc gagtgtatcg agagcgacgg ggagaaaatg accgagggag tgcaccgctc    246600
     acgacggaag agagagtaca cgacgacgca cgctgcttgt gatgacatcg aattaacacg    246660
     ctaagtctca cgtgctgctc gcacattcat cagtccatgg gcaccggctg ctccatgggc    246720
     tctggcggcg gcggtgtgta gtaccgcacg gggctcgggt ccgaaagcgg cctaggctcc    246780
     tccaggctct tgaggtccct cgagatcttg tcaatctgct ccaacgtgtc gatatcctcg    246840
     ccgaacacct ccctcgagga cttggtgagc gccacgtcga tcgccgccgc gaactgcttg    246900
     ggcgtggcgt cgatgggacc gtccaggtgg cccgggatga tccgctcaaa gtcccacgcc    246960
     gcgacgctct ccgcccaccg cttcacctcg tccctgcgcc gcgggaacgc cagggtgtga    247020
     aggatcggcg gcacgaacat gtccttgtcc gtcaggttct tgaacgcgtc cttccacttg    247080
     ggctcccagt agaacccgtc caggaaggac ttgttcacgc tcagcgggtt gatcctgacg    247140
     tcaaccgcgg tggggttgaa cagaaggccg aacagcaccg tcttgcccca gcccatcgac    247200
     ctcgcctccc tggtgttggg cagcatctgg tccggtccgt tcatgcccct caccagcagg    247260
     ggttccggtt cgatgaccgc caccggcacc gggtcctgcg acacgtgcag caccacgtcg    247320
     gtgaccagca tcgtcttgga cctcttgtga taaaacgcgg tgtcgacgaa ccacgggtcc    247380
     ttaaagtttc tcagcgagct ccctccaacc tccagggtgt agtgctcgat ctcgtccgcc    247440
     cacggcacgg cgccgatgcc cgagctggaa tccagcggga ggtacttggg cgatcccctg    247500
     gggtagtacg gaacgtacgc gtcgatgggg acgtccaccg ggaaggtcca gttcttctgc    247560
     gggacccaga cgtcggcggc tgggaacttc ttgctgaagg gtccggagta gattttgtgc    247620
     tcgatcgcgg cgctgcccac cacgatgtgc ttgaccggac cgtgcttggc gacgatgggc    247680
     gcgagcatgt ccatgagctc ctgcgtcggc gccaccgggt tgtgcaccca caggcccccg    247740
     tttgcgagcg ccacaaccgt catcctcacg ttcacgagca cgtccagcag accctgcagc    247800
     tggtcgaacg tccacacctg cccgggcacc acctcgttca tcgcggtggc cttgctcccg    247860
     tagggcgcga gggggagcgc ccaccagtac gggtaccacc gctcgggatg cgcctctcgc    247920
     gtcgccttgg cccagaagtt ctcctggagg gtgacgacgt cgggagcggg gtagtcgaac    247980
     gcgacgccgg cgagcgggga gagcgcggtg gtggcgatgg acgccgccgc ggagaggata    248040
     ccgcggcgcg acgagttcat cgacctgccg gtggtggcga cggactcgag cgcgtcgtcg    248100
     tcgttcgcgg cgcatcgcgc aatcgtcgaa gggcgggaca cggaggcgcg gcgatcggcg    248160
     cgggtggcgg ccggtcggaa accggtcttg gtcgcggggg cgacgcccgc gatgtgcgcg    248220
     acggcggcca tgtcggcgac gtgcacggga cgatgcgagt gcgccgggga ggaaccgggg    248280
     ctggtcgtta tggacgcgac gcttggtgga cgttcttcct ccgctttatc tcattctggg    248340
     ccacgatcga gcgacatgtc agcgtttccc gatgtcgtgc ggcaaccgac cacaaatgct    248400
     ggtaaatcct ggttcgtacc ttcgtacctt cgtagtagta aactaacact tattcgattc    248460
     cccgaatcgt tggtcggaca cctcgcaacc aacgcacggc aaaagatatt tggggcttct    248520
     tgctgttcgc ccgcattgac tggcgagtgg acgcgatgtg ggaccgtatc gtggtgtttc    248580
     tcgcgttcct cgcgcatcac atcgacgccg cgaggctgac accgcgcgca aacaccatcg    248640
     gaccctcgca acacgcgcta cgagcggaca actccaactg gatggccgag gatgcgtcga    248700
     ttctccgtga catgactctc ggcgaggtgg tcctccccgg cacgcacgac gcgggcgcct    248760
     acgcgctgac gtcgaagctg atgccgggtt caaggttccc gacaccgtgg gaggctgcgg    248820
     ctatcgcgat agccgaggac ttgggcatcg gcgtggacag ggtgattacc ccgtgggcgc    248880
     tgacgcaatc tctcgacgtc ctcgcgcagc tcgagttcgg gtacaggtac atcgacctga    248940
     gggcgggatg gaacggcacc gcgtggtgcg cgcatcacgc cgaggtcggt gttcccatcg    249000
     ccgacatcct gaacgacatc gcgacgttca tgcggacaca ccccggggag gtcgtggtcg    249060
     tgcagacgag ccacctggac ggcttcccca acgcgacacg cgtggacgaa ctgtcggcgg    249120
     aggtgacgaa aacactcggc gaatacgtgg ccggtccgga gtgggcgcga ggtaaggcgt    249180
     tcggggatgt caccataggg gagatggtgg actccgggcg gagactcgcg gtggtgtttg    249240
     gcgacggcga ctatgaatcg ttcggcggcg catccaagac cacatggccg cccgaggtgc    249300
     tgcacaacgc gtacgccgac gccgacgacc cgaccgcggt gatgaaatac gtgcgcgata    249360
     agattgtgga gtacaacaac tccagcgggg aggccgcacc tcccgggacg atgtccaaga    249420
     tatcgtggat tctcaccgcg caaactaaga ctgtcgtcgg catgttcgag cccggcgcgc    249480
     ggccgaggag cctgagggag ctgaccgagc gaagcaggcc cgcgttcggg gcactcgccg    249540
     aggaggtggt tcagtcggga tgtagggcgg gtaacattat gagcgtcgac ttcggcggcg    249600
     gcgcggggga ctacgcggtg tgggcggctc gagccatgaa ccagatgcca cgagacgcga    249660
     gctgttcgct gaagaatcaa gagcccattg cggttgcgtg acgcttgttt tacagattag    249720
     gcggctaatt ttgtttcatc agaacacctc cgtctctcca aagtgcaacg actgcaccga    249780
     ggtcctcgct gcgccgacgc ccgcccggtc cctgttgttc ttgtacgtca cacccggcgt    249840
     ggcctgcacc tcccgctcga gcacttttcg ccgcctggcc tcctcctgct ggtcaagcac    249900
     cctctgctcc ctgttgagcc gcgccgtttc cttccaccac ttgtcgtccc cgcccaccgc    249960
     acgcatcgcc tcctgatgaa gcctcctcgc cgtcttctcg gacacgcccg gcggattcgg    250020
     gaagttctcc gggtcggcgt cgtctgggag ctcggcgagc gaaccgtgtc gaaccgaacg    250080
     attctgcgag aaggtaacct ccgcctccct cagcagctcg gttcggtgct gcgcagcctc    250140
     ggcgtacgcc gcagatttct gcgcgtgttc catcaccaac cgccgcgtct gttcccgtcc    250200
     gttcatccag tcctcgatgg tgacgccgcc caccagcttg cgagcctccg cctttcgaga    250260
     ctgcagcatg gagttcagca gctgcgggga tatcctgctg ggctggggcg ctttgcgcgg    250320
     gggcgagtcc aggtcggaga cgcgcgatgc ttcaagggac gccgtgagca cgtccgcggc    250380
     gtcggggtcg gggtattcgc ggtccagggc gtcgttgggt cgggggaact tcgcgtcctc    250440
     gatccccttg cgcacggtcc ccgcgccctt ctgatgcccc ttcggtctgg tcgcggcctc    250500
     agccttgagc ttggctacct ccttcttggc cttgaggcgc ctgaacgacg actgcaccgt    250560
     cgtcgccgcg gtgtgctcct gctgccgctg ccagtcctcc acctcgcccg cgggcagctc    250620
     caagagcatc gccttctgct cctccctctg gcgcatgcga aactcgcgtt cgcgcgtcgc    250680
     cttctcgtac gcgaggatgt ccgcatccct ctgcctctgt tcggtgagct tcttgcgcgc    250740
     ctgaaagccg cgaaagcgcg cctggagctt ggtcgccgcc tcttcctcca tgttgtcgga    250800
     gtcgagcgat gtcaacacac tggcacgtcg aggcgtgttt gaacgttgaa gcaacggtcg    250860
     acaaatatgg aacgaaatac gaaataggaa aatacgccag ttcaaccgta aactttcgcc    250920
     ctttcccgta tgggtatttc aatcccagag tttgattttt gccatttttc aggcattttt    250980
     ttgaggcgat gtgagatgtt ttctcggcag gttttccacg tcgagccact cgctcggata    251040
     aaagttctac gtcatcgttc ccggactcgt gagccattct ttggtacgcg agagtgagag    251100
     atggctttcg ctatgtccgc caccgccagc gccagctccc tgagcttcgg ccgcaacgtc    251160
     gtcgaccagc gcctcaaggt cgcggtgcgt gtcacgtccc cctcgccggc cggcaaggct    251220
     cggaaatttc acccatggcg ttaaagtgaa cagtagtgga taaaatgggt cggaactcgg    251280
     cgctgacgta ccccgcccca atctcacgca ggctccctcc gcgcgcgttg tcgctccccg    251340
     ccccgcgctt caggttgaga acatggtgaa ggtgcgcatc cccgtcgcct gctcggcacg    251400
     cgctcgtttc cggacccgcg gaaccaaaaa aaccctagaa cctggtgggc cacgagtccg    251460
     tgatttctcc agcctgggaa ggctcggccg tcgtgctcgc cccatcgacg actcgctcac    251520
     ctctgccccg cccctccccc gtcgcagatc cgtttcaccc gcctcggtcg caagaggacc    251580
     cctttctacc gcatcatcgc gatcgactcc cgcaagcgtc gcgacggtgc ccccctcgag    251640
     tacctcggct ggtacgaccc ggtgaagaag cagtccaacc tcgacgctcc cgctatcaag    251700
     gcgtggctgg gcaagggtgc ccagccctcc gacaccgtca ggaacctcct gaagaagtct    251760
     ctcatcatgg attaaaatag tcgccggcgc gcgctttccg tgattggttt accgtgggtg    251820
     tatagcagct aatttgcaaa taataggcag ctttgacgaa cagaaagttt caagcccgtg    251880
     tcactcttgg cgacgcggcg cttgttcgcg cgacgtgggt cgacccgatg acgacgccgg    251940
     acgagccttt tacccgtctc acgcccgcgc ccgatgacgt cgtcatcgac agggaaaagt    252000
     tcaccaaaac ggtcccgctc atcgcgctgc gcgtgccgaa ggtgagcacg cgcggttagc    252060
     caccgccgcc gctccccgcc cccagttccc gcgccccaag acgtcatttg ctgatgtact    252120
     gacccgacac tggttccgac gctatattca taggccaagt gtcagtttta catgaaggct    252180
     ctgcgcgggc tcgtcctgga catcccccgg cagcagtcgg tggtgaggga tcccagcgac    252240
     gattccatgc gactgctgct gctgaaggag gaggtcaagg acggctcgtt gccgacgatg    252300
     agcgaggaga ggcgggcgga gatcggcgtg gacgcgctgg agcgaacgac gcatgatttg    252360
     gtcctgtctt acgattactt caacgccgag caggtgctac ggcggctcct gcccgagggt    252420
     tgcgacgtgc cgggatcgtt cgagactgtg ggacacatcg cgcacctcaa cctgagggac    252480
     gaggtgttgg aacacaagca cgtcatcggt cgcgtgttgc tcgataagaa cccgcggctg    252540
     aagacggtgg tgaacaaggt tgggagcatc gagagcgagt tcagggtgcc cacgtgggag    252600
     ctgctcgcgg gggatacgtc actcgagacg gaggtgcggc agcacggcat cccgttcaag    252660
     ctcgactttg gggaggtgta ctggaacagc aggctggagg cggagcacaa gcggttgatc    252720
     gagcagatac gaccggggga gatactgtgc gacgccatgt gcgggatagg accgttcgcg    252780
     gtgcccgccg ccaaggctgg acggagggtg tacgccaacg acctgaaccc atcctgcgcc    252840
     aggtacgcga gagtgaactg cgtcgggaac aaggtcaaga acctggtcaa gtgctacaac    252900
     atgtgcgccc gggagctcat tcggaagctg ctgcggccgg gtaaggttga ggacacgggt    252960
     gagacgacgg tcgggacgga cgggaagaga cgagcggtgc agtgggcggc gacgggtgaa    253020
     gacgcggacg gcgagccacc ctccggggct gtgtttgatc acgtcaccat gaaccttccc    253080
     gccacggcta ttgagtttct caacgtcttc aagggtgcgt tcgaccggga gacgtgggcg    253140
     gggcgtcggt tgcccgtaat acatgtctac acgttcaagc gcgcgacgga gaccgtagaa    253200
     gatgtggtgc ggcgcgggga aggccacctt ggggcggcga tagcaaaccc aaccgtgcac    253260
     gaggtgaggg acgtggctcc caacaaaatc atgctctgcc tctcgtttag gatcacaccc    253320
     gacgcggcgt ttccaccgga ggatggaacg aaagggaacg aggcgaagcg cgccaaaact    253380
     ggtgattaga tttgcaggac gaacgttccg ttgcgtcaat cgttttgcta ccgttgctaa    253440
     aattattccg tggctcttcg gctcatcaaa atacgttgtc cgttgacaca ccgttgatga    253500
     gttgacactc atccttcttc acccgcagcc ggtacatcgt ggactgaagg tgttggcgaa    253560
     tgtgcggctc gatctgctgc gcgagcaaga cggtctccga gtccccgatg gacttgcaga    253620
     ttcgtccgtg gtgctgcagc gtgtacaggg cacacgctcg aataaagtca tccgcgttgc    253680
     accgccccgc gagcgagatg aactcccgca gaaactcgca cttcggatcc tccatatgcg    253740
     tgaggatctc ctccatgcaa ccctcgcagt ggcgcttgag gccgttcatc tcgtacctgt    253800
     gcgcgaattg cagcagcctc tgtgcgagag gggcaactcc attctcgtca ttttcctcgg    253860
     tcagttcctc ggggacctcg atgtcgcctt ggtacacaaa ctgcatcaaa ccgtggaact    253920
     catccttctg catcacgtcg ctcatgtcca cgcgcaccgg catgtgggaa tcgccctgct    253980
     gcgtgtccgc gaccttgtgt tggtcgatga gctggtggaa ctcatcgctg acgtgcgtga    254040
     atgcaatctt gtgcgcgtga aactcccatc cgccgtcgcg gtccgagaag aagacaatgt    254100
     cgctcagctc ggggttgttg aagtgctcgt aagcgagatg cgtctctggg gtggcgggca    254160
     gcggcaccgc gtcgttggga tacctcgccg agagcagcgc cttcatgttc tgcgaaacct    254220
     tgaacaacgc acccgccgcg tctctcatcg ccaaggggaa aagagcgccc gcgctcgccg    254280
     agtacatctc gagcaaaatg tccaagccgc cctgctcgtc gaagatgacc cgctgttggt    254340
     cgtcgctgca aagatgtgcc aacgcgacgg cgatgcgctg ctgctcgtcc ttgttcgagg    254400
     atcgcatcag gtagacgagg tacttgagca cccgcccgtc aaccttctcc tccagcctct    254460
     tcagggtctt gttcacgcaa tccttgctgg gctgagcttt gagctcgccg cccatcagcc    254520
     gctgcaccgt gccctcgcgg atgatgtcgg ggacgttatc ctcgttgtcc gccagtccgt    254580
     acagcgcgaa cgcggcgttg tgctgcaggt tggtctcgtc cgagtccagg aggtccagga    254640
     ggggtcgcag tccgtcggcg tggcagatgc ccacctggtt gtccttgttc tgcgcaagtc    254700
     gaccgagcgc aaacgccgcc atctccctca gctgactctc ggtgtggttc agcatctgga    254760
     tcaaaggttg caccgcgccc ctctgcacga tcttgatctt atactcgatg ttggtgtcgt    254820
     ccgtggtcgt ggcgaactgt ccgaggagga gcgccgcctc cctcctgctc tcgttgcact    254880
     ccgaggagag gaggccaatg actggctgca gcgcaccctc gtcgagcacc ctccgcttga    254940
     tgtggttgga cgagtgcacc aggttaccaa tcacccccac ggcctcatag tggatgtgtg    255000
     gatcgccgga tcgcaccatg aagatgagca tcggaagggc gccctcctcg acgatctgtt    255060
     ccttgttctc gttgttcttg aacgcgagcg tcctcagcgc cgaggcagcc gccctctgaa    255120
     ccttggcgtc cctcgtctcc aacaacgcga cgagcggcgg gatgccaccc tcggtccgta    255180
     ccctgttctt gatcgggttg ttctcgtgcg caaggttggt caccgcatcc gccgccctgc    255240
     gagccacgga cggagccacg ttaccgctca tctggggtgg gtatctcttg agaagcgcga    255300
     caaggccggg gagggccccc gcgtcggcga ttctgttctg gtgattctcc ttggacgcga    255360
     gcaggccgat ggcgtagcac gcctccttct caatgtcccc gatgcccggc gctcggtcct    255420
     cgccgatgtc cttcgcgagg gtgagcaggg gcacgatagc ctccaccgca tccgcgctca    255480
     cgacctggtc aaccatcttg ttctcctgct cctcgggctg gggctgggtc gagggggtat    255540
     ccttggctag ctccgcgagg gtcctgacgc tctgcttcag ctgggcgaac aggttcttgt    255600
     cctccgggtt ctgcatgatc ttcgcgcgcg tctcgttgat catcgccacc agtcgcctgt    255660
     gctcgtccag cgcaatgagc gcacccgccg ccgcgcgttg caccttgtta tcgcggcgct    255720
     cgaggagaat cttcagcgcg ctcacgccgt tcggctcacc cttgccgacg ggctttagga    255780
     tgagttcctt caccgcctcg ttgtcggtgg ccatcttgca cacagcgtct gccgccctgc    255840
     gcgtcacctc gtgcaccagc gccaggtttc cctggggtcg cttcatgttc aaattcagcg    255900
     cgtcgcgcac atccggctgc ggcagatcca gcatcctcac cagcgcgtcg tgtgcgcccg    255960
     ctttggccat cttcgcgcgt ctcgccttct tctcgtcgtc cgtgccaccg gatccgagca    256020
     gcacgcagat cgacgagcag acatccttgt ccagctcgac cagcgacctc ggcctgcact    256080
     gctcccaaac ctcgtgcaca gtccccgggt tgaaatgccc aatcttctga ctctcgttcg    256140
     ggtattcgcc atcctcgcgg tcgcccaggc gctcgtacgc gaaatacctc gtcgacaccg    256200
     ccaacgccgt ctgcagcgcc tgcgtggcac ccgcttccac caggatgtca gagtgttccc    256260
     cgtagtgccg cccgagctcg ccgatgtgcc gcgcccaccg cctcatcttc tccaccgtgc    256320
     gatcgtccgg gaaactgacg tccacgacgc cgtgcgtgag cagcttctta tcggatttgg    256380
     tgtcgttctg ccggaaatct agtgtatccg cgttggcgat gtacgctgaa gactttttgg    256440
     tcaactcgcc gatgatgaac tcgtgctcat ccagggcgat gagggcgttg gccaccgccc    256500
     tttgcacctt gttctccctc gggttgaagt ggcggtccag gagcgcccac atcttatcca    256560
     ccatgccacc gttagtcgta ctgggtacca tcgggggctt cttggcgtcg ttcgtctcgt    256620
     tcgtgggagt cgagacggcg gttcgaacca cccgcttgga tccctccggg tccgccgcgg    256680
     cgatcttctg gatggcgtct gcggctcgcc tgcacgtctc ctggcccagg gcctgagcgg    256740
     agtcgatgaa cttcttgtac ttgttatccg gggagcagaa gaacctgggg cactccaacg    256800
     cgtccaccag ctggggcatg gcggcgaggt tatccttggc actcttgccg atcttgtgct    256860
     tgctcgtctt tgagaggagc tcctttgcct tggtcgcctg gcgctccagg ctctcggcgc    256920
     tcaaaagccc gctggcctcg accgtgaccg cgccgtcgtc gagacccttg acaagcggcg    256980
     tcatggcctg caacgcagcg tgcgcagctt tcacgcactc caccaggttg ggcctcgagg    257040
     cttcgcatct cagcctaagt tcagccaccg cgccctcgag ttccgtgagc ttgctctgga    257100
     cggtgaggcg ggagagcggg gagtacgcct cgccagcctt caacgccgca cgctgcgata    257160
     agggggggag atgagggtag gtgagggtcg tcagatcagt gcgagaaaga gaatcgcgga    257220
     catcgcttcg ttgtcgcaac cgcgtgaggc tctttcaaat aaaagaggct gagtggacgg    257280
     cactcggcga gatttctccg gagcggaggg gcttcttctc acctccgccg agcccggcgc    257340
     ggggctgtcc gccttggagg attcgatgcc cgcatcctgg gccttcctct tctggctcct    257400
     cgacgccctc gtcgaggatt tcatctcccc ggaggcaccg caccgcagga gacccagatc    257460
     tctgagcggt cttgtccgtt tggccggggt tccgagtaaa atggacccag ctttcgaaaa    257520
     aataaatctc gcgggaagcg cgcaaaggca gcaaaatcca gggttcgttg aaccatcaag    257580
     aggtgacgtg gaaaaaggat cggtcagccg ccctttattc ccgagagaac gaagaaggga    257640
     ggctgcgggg cggagtcgac gggcacttcg cgaagcccag cccgccgacg ttcgtgggtt    257700
     cgcccccgag tcgcaccggc cttcgtgagt cacccgagcg tcaccaaacc cgcgactcgt    257760
     tggagcgatg gcgacttccc tcctcgcgcc aagggcgacg gttgcggcga gacacagtgt    257820
     cgggcgccag cacgtggggc gaaaatgcgc gccggcgcgc gcggtgtctc gcgtcgcgct    257880
     gcgaccgtgg gcggcgccgg tgctgaggcg cgaggccgtt ctcgcgcgtg cgctttccag    257940
     ggatgatgat gaggactcct tcgacgagga cgatgacacg gacatccgct gcgagctcga    258000
     caggtgagag ccgcgccgcc cgaacgttga acctgtgaac cgccgtcaat ttctctcaaa    258060
     cgccgcgcgc gtgctgacct cctcgcctct ctcctgaacg cagggtcccg ggcgacggca    258120
     acaagtacac cagggttatg ctcaaggtga gcggcgaggc cctctccggc tccagcgggt    258180
     tcggcatcga ccccgaggtt gtccagacca tcgccaggga ggttgccgag gctagcctgg    258240
     ctggggtgca agtcgcggtg gtggttggcg gcggcaactt cttccggggc gcgcagcacg    258300
     agggcaaggg tttggaccgc gcttccgccg actacatggg catgctcgcc acggtcatga    258360
     acgccatcaa cctgcaggct gcggtggaat ccaacggcgt gcccacgcgg gtcatgacgg    258420
     cgttttccat ccaggaggtt gccgagccgt acatccgccg ccgagccatc agacacctgg    258480
     agaagggccg cgtcgtcatc ttcggcgcgg gaaccggcaa ccccttcttc accacggaca    258540
     ccggcgccgc gctgagggcc gctgagattg gcgcgcagtg cgtgttcaag gcgaccatgg    258600
     ttgacggcgt gtacgactca gacccgcggc gcaacccgga tgcgcagctg tacgagaacc    258660
     tcacctacga gaccgtgcag cggctgggtt tgggcgtgat ggatcagacg gccatcacgc    258720
     tctgccagga gaacgacatc ccggtcgtgg tgtttaacct gaacacgcgg gggaacatcg    258780
     tgcacgcgct caggggcgga accgtcggaa cccgcgtgag ctccaagatg gacgcgccac    258840
     agaagaacgg cgccaagaac ggcgccaagc gtggggctga gcagaagggg gatgcggcga    258900
     agaagtgagc gcgagattat tgttaatcta gggatttgaa atgcacaacc ttagttcacc    258960
     gttgcgagct gcgcgtgaag aaacagggac ggtttagctg actgagacgc agttcgagcg    259020
     ttgacgagac gtgctctttg cgacggactg agatggacca ttacaaaaaa gcattttttt    259080
     taatcgagga acgacgaccg cgagggccgt cgcccttcct tcaagtggac gcggcggtta    259140
     acacagacat ccgaccgtgt ttcgagattt aatcgaagag gtcgaagtcc atggcctcct    259200
     cctcctcctc ctcgggctcg ggctcgggct cggcagccgc ggcagcgccg ccatcaccgc    259260
     cggcagcggc accgccgccg ccggcaccac cgccgccgcc ggcaccgacg ttggcgatga    259320
     gctcctcaac gggcttgccg gagaggaact tggagaagag catggtccag tagggctcga    259380
     tggtgacacc agcggccttg atgatggtgt ccatcttgtc accggtcacc tcctgaccat    259440
     cgtcggagag gatgagcgcg gcgtaggtgc aagcgaggtc accagacatt gttctgcgcg    259500
     ttcggaggat ggagaagtcg gaggtcagcg tcgtgttcga ggtcgcggtc tgaggtaaaa    259560
     ccctaaaaac atgatcggtc gagaggtcca aggaggacgc aaccgagccc ctgaccaggg    259620
     tcaaatcgcg cgtgtggtcg atggtggacg tagatcgcgc cacattggac catcgcgcgg    259680
     gtcgcgaccg tcctcgcaaa ggctcaggcc gcgtccaccg gccccgccgg agacggagaa    259740
     aaacctatgt actcccgcgg gcgtggcatc gacggatagg cgcgggcggg acgtgcacgc    259800
     gcggggttcg cgcgacgcgt cgtcgcggac gtatcgctca ccgtgtatat aaatcgcagg    259860
     ctgcacgcga ggtgctttaa ccgtgagggg cttgcgagtg cgtcccgaag aagggcaagc    259920
     tactcggctt cgaaccgctt ttctcccaaa cactcgcctt cgtctttttt tccgaaaatc    259980
     ggtcgcacta ctccatcccc ttcttcctaa ccgaaataca tgtgtgtatg aaattatttg    260040
     ccgttgtatt acaaaattta aatctacatg taacctcgtt gccggtgtcg tgaatcatgt    260100
     gacctggaat ggcccactcg tcggtggtct cgcactctgc gcccaccact atcgaccgag    260160
     caaagcaaga tggccaagcg tctcatcccc ctcctcgacc gcgtcctggt ggagaagatt    260220
     gttgctccca cgaagagcgt gggcggcatc atcctcccgg agtcggccgt gtcgaaggtg    260280
     cgtcgggcgc ccctaccaga acatcgacca atcggcgcgc caccaatcgt cggcccacct    260340
     ctccctttct gtccatcacc gactgaccct cttttcgctt acgtcgatcg cttccgcaga    260400
     ttaacgaggc taaggtcctc gcggtgggcc cgggcaggcg cgcggcgcag aatggcgatc    260460
     tcattcccat gggtgcgtcc cgatctcgtg ccagcgcgac acggtttccg aacccttcga    260520
     ttgcctgaac cctgtacgcg tagagcgacc aaagccctta cgttgccgaa tcccatctcc    260580
     ccgtcgtgtg ctcacaggtg tgaaggttgg tgacagcgtg ctactgccgg actacggcgg    260640
     tcagaaggtc gacctcgggg acaaggacaa ggagctcttc ctctacagcg accaggagat    260700
     cctcggtgtg gtcgagtcaa actgagaaaa aatgttgaag actcgccacg cgcgagatcc    260760
     ttgggcttta gctgggtgca ggtttcatgg gggcgcgatg cgatcgaagg ttcgttgaag    260820
     tgaaacatgt gacttcacat taatcaataa aagcgtgctt actcaaacaa ataccttttt    260880
     gggtctttca aaaatgtgtc gcccagcact ccgtgccgcg acttgctttt tcgccgtcct    260940
     cctcccgatc tcccgcctcc accctctctc tatttccacc caacctcgcg tctatacggt    261000
     ttagtagggc ttacgcgcgg cgtgatagat ctcgatgtac tcgagcgccg gcctgttcca    261060
     gctccagtcc tgggacatgc agtttgcctg cagcgcgcgg aaatccttgg gcttgtcgta    261120
     tgcgaggttg attgcgcggt cgagggcaaa gtcgatcgcg ccgtcatcca tcccgtcgaa    261180
     cgagaatccg ttgggcttca taccctccca ctctgccttc ttgtggtcga cgtcgtagtc    261240
     gaacacggtg tcgttcaagc caccggtgcg cctcaccacg ggcacggtac cgtacctcat    261300
     ggcgatgagc tgcgacaagc cgcagggctc aaacatggac ggcacgagca gcaggtcaga    261360
     gccggcgtag atgagatgcg agagcggttc gttatagtac aggtggaaag ccatgaagtc    261420
     gtggtggttc tgcttcagct ggtggaacat catgtcgaag tcctgctgaa tggtgggatc    261480
     cggcgcggtg ccgaggagga tcacctggca tccgcgctcc agagccctca tgacgccacg    261540
     cttgatgagg tgcacaccct tctgcggcgt gagtcgggtg acgataccca ccatgggaac    261600
     gccgggcttg ttggggatgt tgctgtacgc gcagagcgcc tcgcggcacg cagccttacc    261660
     ctcaatgacc tccgtctcgt cgtaatacct ggggaggaag tcgtcgttgg cgggatccca    261720
     gatgtcgggg tcaatgccgt tgacgacgcc gtggaacttg ccaatattct cgtggattga    261780
     ctcgtggccg gacacctcgt ctctgtacgt gcgggacacg gtggtggccg cctgggagta    261840
     ggtcatggcc tcctgaatga gctcagcgcc gtagttaagg ttgtgaatgg tgaacacgac    261900
     cctggggttg ttgagaccgt agggggcgta gtcctcccag tacgccttag cgcagggcgc    261960
     cgtctgccag tcgtggcagt ggatgatgtc cggctgcctc ttgctctgca gcatgaactc    262020
     gagcgcggcc ttggagaaga atccgaacct ctccgcgtca gtcattggga tctcgaggta    262080
     gtccgtgccg taaatcatgc cgacgcggaa catgccgttc tcaggatcga tgaagtaggt    262140
     gtcgatgtcc tcaaccttgc cgtggaacac gcggttgtac gtggcgcccc agctgaaccc    262200
     ggtgatctcc ttgaagtcct gaatggcgga gtagtccagg gtgtcgtact tggggaggat    262260
     gacctcaacc ttgtgacctt cctcctggca cgcacggccg agggaggtga cgacgtcgcc    262320
     aagaccgcca accttggcga tgggcgccat ctcgaccgag atggaaacga tgtggagcgg    262380
     cggctccttc aacttctcgc ccgtggcctt atcgacgccg cccttgatgt cgacgtggta    262440
     gtcgaggcgg ttgttgttgt cgaaggtacc cttgccgtcg ggcttggacg caaagacaaa    262500
     gtccatcttg aacacgtctt cggggacggt aaactcggcg gagacgtgcg actgaccctc    262560
     ctggccaacc atcttgatgg ggccgatgtt ctcggggtgc gtccacctgt tccagccgcc    262620
     gattatgtac acctcgttgg acgcggccag gttggtgttc ctggggttgt agtggacgcg    262680
     caccgtctgg cccgcgcggg gctgcggggg gtcgacgtag agcacgtgct cgcgctgctt    262740
     gcgggtcacc tcggcagcct tatccttggc gataccgcgg agaatgtcac ggcgctcctt    262800
     gcgctccttg gcgcgcttct cgcggacgat gcgctcctcg acgagctggt agtacagctc    262860
     ggcggacttc tcgtagcgct caacctcgag gatctcctca gcgccttcgc aggcgacgtg    262920
     gtagtccgcg cggttgttgt tgtcatactg atggccgccg tcactgaaga cgaagtccat    262980
     gacgaaggcc tcatcgggga cgtcgacctc gcacttctgc caccacgaac ccttcacagc    263040
     cttgaccgcc ttgccgttca ccttgaagcg gcccttcacc ggggtcatca gggtcttctc    263100
     cggagactcc cagttgttgc agccgctctg gcaggtgatc gagccgtact gcttcacgcc    263160
     cgccaggcag gtggcggcgg cgttgtaata gatggtcagc gtctcaccag ggacgggctc    263220
     cgcgggctcg atgtgccaga cgtcgccaat cttgggctgg gtgcccgccc tgacgacgtg    263280
     gagaaggtgg ccgatggtgt cctcagcctg cctcctcgcc tcggcccagt cctcggcgtt    263340
     gccctcgcct gattcaacga gtgcatcgat ctcctggcag gcgccgaggg gatcctcctc    263400
     ggccctctct ctcatcgcct ggagcctggc ggcgacagcg gcggcctcgg cagcctcggc    263460
     ctcctccgcg gccctcttct cggcggcaat cctctcagcc tctgccttgg cagcggcagc    263520
     ctcctccgcg gcagcctttg ccgcggcagc ctcctcggcg gcagcctcct tggcagcagc    263580
     gtcgtcggcg atcgcctggg cggcctttgc ctcggcgtcc ttcttgtcga actgggcctt    263640
     ctcgacggcg gccttcgcgg aggtggcgcg gtcggtggca gccttctcgg caacctgctt    263700
     gtcggaggca gccttttccg cggcggcgag gtcagcctcg tacttctcgt gcgcagcctg    263760
     ggcggcgtga gcacggaaag cgtcggggtc cggggaggag agaacgtcga ggttgacctt    263820
     ggcctcggtg gcgtcgttct cggtttggcg cttgatcacg gccatctcct ccgcagtctc    263880
     aattgccttg atcaccgaga cggcagcctc gagggcggcg cgctcagcaa cggcggagat    263940
     ctcagaggcg gcggccattt cggtggcaga ctgggcctct gcgatggagt cggcggccat    264000
     cttggccttg gcctcggcgc ccagagcgag cgtctggttg gtgagggcgt tcctggcacg    264060
     gagcttggac gcggtctctg ccttgttcac cacctggagg cgggcaagct cagccttggc    264120
     ggcggcgaga gccttggcct tagcctccgc gatcgccttg gccctggcgt cagccgctgc    264180
     ggcagcctcg gcctcggcgg acttgaagat gtcggccttc tccttgtaga cggcggtggc    264240
     ggtcttgatg gcctccgcgt tctccatggc ggccctggca gccctggcgg cggcagcggc    264300
     ggcagccttg gcctcagcct tggcgcgctc ctcagcctcc ttcttgcgga tatgctccat    264360
     ggagccgaca tcgccggtga cgagggcggc cgcctcaaag tcctcgatgc ccgcctcggc    264420
     ctcggcctcc tgtgcgccga ccttggcagt gacgagctcc ttctcctgcg cggcgccaaa    264480
     cgctgccgca agcatagccg cctcgtcatc ctcgacggag acggcgttgg ccctgcgctg    264540
     ctcagcctcc acggccttgc gctcagcctc catgaggtaa gcggcctcgg cctcggcggc    264600
     tgcctgtgca gccttggcgt cgatctcggc ggcacgctgc gcctgggtct gtgcctccgc    264660
     ctctgcctgc gcagcagcag cctcagccgc ggctagggat tcagcctcgg tcttctgctc    264720
     catctgggcg gcgagcgcct gagcctcagc ggattcctcc gcagcggctg cggcggcgag    264780
     cgcctcggcc tcaagctgtg cggcggtggc ctcggcggcc tcctgggcag ccgcctgggc    264840
     ctcctggcgc tgcatggact cgagctcctg cttggccacc tggtcagcct tctcctgcgc    264900
     agccttctgg tccttctggg cgagggcctt ggcgcggaca ttctcctcga gctccatgac    264960
     gtgggcgagc tcctgcttct tctggaggag catggtcatc tcctgttgct ttttgtcgag    265020
     atcggcctgg ggcgcgttct tgagcctgag gttctccatc tcgagctcct tgagctgaag    265080
     aagagcctca ttctcacgct tgagcctctc gagctccttg cgaggatcgc gcatctcctg    265140
     gccgttggcg gcaccattgg acgtgggagg aggagtgggc atggacacgc cggtggcgga    265200
     gggcatcttg cccgccttga gatcagcgat cttcctgcgc atggctcgaa cttcggaaga    265260
     gctgggcgcg ggggtatccg gggagagcat cgcgcgaagc tggttttcag cgcgggcgag    265320
     ctcctgctcc acgttcacgc cggcggcggt gatgatggag gtacggtcgg tttcggatga    265380
     gacggaaagt ccatcctcga cgcgacggtg ggagagggcg cgacggccgc ctgcggatcg    265440
     aagggtaggt cgggagcgac gcggtgagtt tttttatcca aattgcgtgt ggtaaattat    265500
     cgagtggctg ccgggcattg acccactggc tttctttcgc cgcgaacgcc ggggcaattg    265560
     cgtcgggggc gggtagaggg tctcgaactc acctccgggg gccactttgg gggcggatga    265620
     ccgctgggaa gcctgcgtga ttgagggtgg ggcgcaacgc gtcagtctcg ccgccgcggt    265680
     tttgtggttt tactaatcct tcttttcgtt tcgagcggga gggatctgcc acgtttcggg    265740
     acggcgcgca ccttggaaac tcttccggca cggcgctcgc cgccaggggc ggcggcgtag    265800
     atgccaggat tcaccgcgac ggtggaaatg gctggcgcca tttgaagtgt atcgcgtgtg    265860
     gcggtggacc caagaatgac cgcgcagaag ccagaaacta ccaacttgtt tctcacactc    265920
     acatccctca tccacgattt ctgtggtgat tttgcagcca tggactttaa gcggctcaca    265980
     attgacaacg aggacagtct gatcaaatca aaccgcgccg ttgccgacga ttcgaggctc    266040
     gtgttcgaga aatatcctaa ttttgcaatt tccgtcgttt cttgatcgat tcccccccct    266100
     acagacgcac ggttcgtgaa ccaaagatga ccggaaggga gtcgacgtgc actgacggtt    266160
     cggaagctcc cgccactttc aaccacgaac cgccagtaaa aattcttccc ggtgccagcg    266220
     gtgccgcaaa cccaatccat ttagactgaa aaagctgtgg gcgggaatgc gacgttctcg    266280
     gagaccaaag atctttggtc tgtgcgaacc acgaagaggc accgtttgcg gtctcggcag    266340
     gagcacggga gaaaaaaaaa accctcatcg aaccccgaag cgaagtgtgc tcgcgaggaa    266400
     acgcggctga ggtgcccgaa acgcgatttt cccaggtgtc cgggacggcg cacaacgagg    266460
     ggcgctcacc gaagagatcg acctcagcgg agcggcggag ataacgtgta acacagcatg    266520
     agcgcagcat acacgcgcac gtcatcgatg ccgtgcatcg cgcgcgtcag cgtcaacgca    266580
     aggcgagccc cgcgcgccac tcgtacgtca tcatcgtcct ggaacaacgt ctccgcgcgg    266640
     ggcggtcgcg cggtgttcgc gttcgccaac gaccgtgcgt gcagggcgca gcggctcgtg    266700
     atgcgcactg cgctgaccag aatcgagggc gttggggatg aggaggagtc gaccggttcg    266760
     gcggcggcgg cggcggcggc gaatgcggaa ggtgggctca aggacaacca ggtgcagctc    266820
     ccaatgccgc ggcgacgcgc agagttgacg ttcacctgca acaagtgcga acagcggggg    266880
     acgaggatgg tcaaccctga ggtgtacaaa aagggcaccc tcttcgtcca gtgccccaac    266940
     cccgactgcg cggtgtggca caagatcgtc gataacctcg gactcatcta cgagttcaag    267000
     gacgtagagg acgatgcgtg agctccttcc gcagtcttct tccacgcgtg cgcggaaggg    267060
     tgaagcctta gtcgcgtcga tagctcaggt agcagctagt tcaccgtaga tagcttttac    267120
     gaaacacgag aaatcgtaga ctgctggtgg tctcgtcgtg ccccgtttgt gcacacgagc    267180
     acaaaggcac agaaccaaaa aagcaaaaac aaacgtggcc aaaaacgaat accaaaatca    267240
     cacaacgtcc acacgtacag cctcggcgca cgataccatg agccacacgt gtgccaacgc    267300
     ggtgaagcta ggcaatagtc tcatcgtggc gcatcgaggt gcttaccgcc gcgccgctcg    267360
     tcacgttcga tgggtcaggg cgagcgccga ggcgggcccg ggttcgaccg ccgaaaaact    267420
     tggcgtagtt attgtcgacc acggctcgag gaggaaagca tcaaacgacc tgctggtgag    267480
     tccgcggttc cccgcccgtg atacttggct cgtggtatag ccctgacaca tccgattcgt    267540
     ctcgcaggaa gaattcgtga ggatgtacag ggaggagact ggtcgtccca ttgtggagtt    267600
     agctcacatg gaactgtgcg agcccggcat agacgtcgcg ttctcgcggt gcgtcgagca    267660
     gggagcgacg ctagtagcgg tgagcccatt ctttctatcc cccgggagac attggcagga    267720
     ggatatcccc gcgctcaccg ccgaggcggc gtcgaaacat ccgggagttg ggtattttgt    267780
     cgcggcgcca ctcgggctgc atccactcat ggcaactatc gtggagagcc ggctggagac    267840
     gtgcatggcg cacctcacga ccggtggcgg taagtgtgac gtgtgcgacg ggacgaagtt    267900
     cgggtgtaag ctagtcaagg gtgccgcgag cgagtaaccc aaaggtagcg cagcggtttg    267960
     taagttatag ccagacacca tcttgcctat ttcaaagact acatccagct actagccgta    268020
     agcccaaccc aaaagcgact taagcctggc cgacgccggc cttcttcttc tgccagagaa    268080
     ggtcggtggc ggagtcgcca tcaccctgag ataagaaaag aaagggtcga gcggatcaga    268140
     gaacgtcctg tgggagctgc gaagcgtcga ggagatacag cagggcgagc cgtggggcga    268200
     ttttcgagct ttgcgaggct agcaggcgcg gcgaggcgcc gcgctgatgg gtggtaaaca    268260
     cgctctctga tcgccaacgt agcgaataga cgcgaacgtg accgtgccag cctccctcga    268320
     cgaaatcacc gccgcgcggc gctcaaacca acccgcgtga accctaggag aagatttgga    268380
     cccgagaaaa ccctagccgt acgaccccgt caggctactc gcgcttcccc gtgagagcgc    268440
     gagcgtaccc gcgacctcca gcgtcggcgg gcagtcgatt gaggctatgt gtcgtcattc    268500
     gggctcaggt cgcgtctaag ttacttacca tgcacctcac gaagccggag agggcgacgg    268560
     tggtgtactt gccattgtag acaccggact ggtcgaggtg gccgatgttg atctgcacgg    268620
     aagcgtggtc cttggcctcg atgaggcggt tggtccagct gcacttgcgg gggatgtaaa    268680
     ggtcgacgtt ctcaccctcg gcgttgatca tcttgaaatg tgttgactgc tcgcgctggt    268740
     caaagagggc agcgacgccc gcgctcttcg gcaaaaatgt cttgagctct caacgaaaaa    268800
     cccgagaaat tattcggaat ctgtaaaggc attccttcac cgatttcaca catacagtca    268860
     gtcatatcga tcacgtggtt ctcaaataac gaactgatat ttccgtttct gcctaaactg    268920
     ctgtgggaac gaaccaaatc tttgtgggcg ctccaccaat ttcacccccc gtctcctcag    268980
     cacgccatca tgactcgctc gtcctccttg acctgcctca gcgtctcgtt taccatgaac    269040
     gccgagtata ccctgcacgt cacccacacc gacaggaact tcccgctgct tccgcgctcc    269100
     ttgatctcca cctgcgtctc cctcgatatc tcgcaaccgc acacgtggcc gatgacgccg    269160
     cagaggtcat ccaacgcgga gtcctggccg agatcctcct tcctcccgct gacctggaag    269220
     gtgtaatccg tgggaaattg cgtgagggtg tccatgatct gaccctcctc gtgctcggtg    269280
     ctggcgccga tgggatcgta ctcgccgcgc atggccctca cggcgacgtc gaagcgggtc    269340
     gcgccaaact cgttcagaac cttgccggtc ttcgtgtcca cgaggtcgcc gtcctcgttg    269400
     agcaccagac ccttgagcgc atccggtatg agctcctcgg gaatctcatc ggggatgtcg    269460
     tctatgctgg atcgcaccgc cacggagcct ctgccgccag cggagacacg ctgagatgga    269520
     gtcggcttgc tcagtcgcgc ccggtcttga cgcaccagcg tcgacccacg gtcccgggca    269580
     cccgcgagcg ccgaagccgg cccagggtac gagaggtcga acgcccgatg aggcattgcg    269640
     gagatcgccg ccatgacctc ttcgagggcc gcgcctgcct gcctgccttg ggtgtgacgt    269700
     gtatactgcg tgattccagt tttcacctgg ccttatcggg cgtggatctt gccgcgcgaa    269760
     aggcaaaaac gatttcactt tccaagtcct gattgattga tgagggtaaa aagccagtga    269820
     cgctgcgtag aaaatgcgcg gaaatcaaaa acgcattgtt ccccgctctc gaaaaagccg    269880
     ggatgattag ccgttgttaa tcgcgatttt ggcatcggcg gagccgagac ggtcgcgagt    269940
     gagcacttta aagggcgaca aggcggtact tagaccgtgg atcgtcgaca cgtcgagata    270000
     tcggcacgag gaggcgtgtc gtgcatcgga accatgcgtg acatatgaga cagcgcggca    270060
     cgaggccagc gacgaggagg gaagaaacaa tcgcccctcg ccaaacagcc ggcgtcgggc    270120
     gccccgtcat gaggcctcgc gttgggatgt cgctgagtcg gacgttagcg ttgatcgcgc    270180
     tgctctgcgt gctcagtgcc agtccggtcc aaccgcgctc gttcagcagc tgcaagagcc    270240
     tgtgcaacat cgacaagggg cgcggtgtct gcctggtgag ctataaacgg cacccataaa    270300
     gcagtttcca ccaccttccc tcgtcgcgcg ctgccccacc cgttcccgcg gaccccacga    270360
     ccgacatcgc cccgctgact ccgaacattg cacgcatcga tgattaatat cccgcaggag    270420
     gacggaacgt gcgcgtgcaa agacggttgg accggggagg gatgcgagcg cgcgactccg    270480
     ggcatttcca aggaacgtcg acgcgacggt acgtacggct attccttcac caccgaggcg    270540
     gagaggggcg tgggcgcggc gatttttgac ccgcagaaga aggttttgta cgtatccgtg    270600
     tacgatgccg cggcgggagc agatgcggtg ttcgaggtgg accccttgaa ccccgcaacc    270660
     ttcacggcga gcagcctgac gtcgcgcggc tggggcgtgg ctggtcccca ccgcgcagat    270720
     ggcgcgacaa agcagcccgt cgcgctcgcc cctgatgcgg gctactgcgg cacggcgacg    270780
     ggtattcaga ccgcagcggg atgttcagat gggacacatc ccagggctca cggtcattac    270840
     aacgcaacgc tttccggcgg atggtactcg gtcttcaggg gcctggctct cgacctcagt    270900
     ggtcccttga ctggtgtatt cggctcgctc aacatgcacg gagccgccca gccgacgcca    270960
     tacaagttta agatcgtcaa gtacgtcggc aaagattgca ccggttcctc gtgggacgat    271020
     tgcgtcatcg ggtccgcgag ctcgcgaaat ccgagctacg tgtacggtgg gaacggcacc    271080
     cttgatgcga tggcatctaa cgaggtaacc ggccaggtgg tttacaagtt ttcaccacac    271140
     gacggtgtgt ccccggggaa ggtcgggatg cttgcagctg atctgtctac gtctacggag    271200
     tttcacatcg atcccacgct aatggacacg agggttagcg gtacgtgccc ggcgtgcgcg    271260
     acgcaccacg aggctctgag gttcgagact gcgatgtacg cgcagactgc tttggacggc    271320
     aaaaactggg tcatctttgc gggcgcagcg aggatggagt cggacggaac ctcgtaccca    271380
     gcgctgttca agatctccgc ggactcctcg gcctttacca cgggccaggg cactggtcag    271440
     gaaatgtatc tcgacggatc gagcgaagcg cttaagcttc ccagcgcgtg cgagggtgtg    271500
     acggatgcga agcagggtcg ccacacctcg ttcacgtcgc tgacgaagca cgggtcatac    271560
     gggtacgcag gcacttcggg tcgagacgcg aattgcgatg gttgcgagca tcgctcggcg    271620
     tgtgtggtca tgttttcgct cgactacaac agtttagact ccccgacgaa ggtcatcgtg    271680
     ttcgagggtg gggacggggg tctggacgag aaggacgtct gggccgcggc ggtcgagccc    271740
     atcactgaaa tgggtgccga cggtgggttc atctacttcg cagtcggtga ccgctcgaac    271800
     tctggttttg ggaggatcgt caaggtcatg atcggtggga cggatacggc atcgacgtgc    271860
     acatcgggct gcttcaaacg cgtgggtacg ttcgaggaga gcgctccgtt tggaggtatt    271920
     gtccacgtcg ccgacctcaa cgggattgta tccctcagtc ggtcgttcac aaacacgaca    271980
     tacacgaagt tttcgacagc gtcggtgacc tccatatctc ctcagtttgt gagctctact    272040
     acgtctggga cgattgttac gatccgaggg accgggttct actctccctg gaacgacgag    272100
     tcgacctaca acgtgagctg caggtttggc cacacctcca ctttggactc ggactttcag    272160
     gaggaggcgt ggagcggcgc gatttacgtg tcttccacgg agattcgctg cacggtgccc    272220
     tcggcattgg attcgatgac ttctacgaaa acgaacaacc ggcaaacgta cacggaactt    272280
     gaggtttcct ttgacgggtt ccccgtcgat ggtgttccaa cgtctggatc gctcaaccct    272340
     tactggggga aaagcatgtg gactcgtcac aacgccgttg tcttttacta cgatgaacca    272400
     atcatcgcct ctttcgacgt tggacacggc gactacggga acaaggtatt gttcactggc    272460
     gaaaatgaga ccaacgcgcc cgtcacgctt cgattgtttg gtggtccatt catcgacagt    272520
     gacggcagtg atggtggacc ggcgcgcctg aagtgcaggt acaacggcga tgccaccacc    272580
     gatgtcgcgg caacttttgt cgccgtgaac cagctgcatt gcccactgtg tgaggtctcc    272640
     aacgcgtctg gagtcgatcg ttgcggtgct catggaactt cgggcgcagc acagtacatc    272700
     ccactcccat ggctggcagg tggacagccc aagtctgacg tcgacgtgtc gatcacgatg    272760
     aatggtgtcg agtatcactc ctcaggctca acggttctgc acttgtacgg atcaccccac    272820
     gggttgagcg tgatacaccc gaaatgcact atggatggat tttccggtgt ggtgacggat    272880
     tccacgctgg gcgtactgaa cgggggtcga gactgccgac acaacttgct cagctacccc    272940
     ggtaacgccg aggccgacgg gacaatgaaa cttgacccgg tcgaggtgag cttggcggac    273000
     atcaacggca cggtgattaa aaacgacatg ggcgttggtg gtatccgtgg attcaaaata    273060
     acagctgcag tgaacgcgac tggctctgaa ggatccagca ggaacatcct gaccctggcg    273120
     cctggtggtg tggaacgcac cactgtgaat ggcaccacaa cttttgagct ttcactcagc    273180
     tttgtcccaa tccagggagt gtacgagatt ttcttcaccg gggaggattg caccgatgga    273240
     tcgacttgta cggcactgag ttccactcaa tcattcaaat ttacggttca acctggaaaa    273300
     gcgattggcc ttgatttaga acccgggaaa gctgtcgggt catatttgac cggtccccaa    273360
     tttcctcccg gaacccaagt ggtgaatgcg tctcaatccg tcgaaatcga ttatttgatt    273420
     gtttacacag tcgatgcagg cggaaacaaa ttgttaggcc ttgatggtgg aggacactcg    273480
     atttcagcgg agttagttac tactgaaacc cactccaatg gaacccatat tgcgaggagt    273540
     tcgggagcga ctctgaaagg cactgtcacg caaacgatga tggatatcaa cgatggcaag    273600
     ttgcaattca ttgatctcac tttggactcc gctgctcctt ctggtgaacg actaccaaat    273660
     caaaatacgg acataactta cggagaccca tcgaggggac cgcatggcac cgattataaa    273720
     tatttggttc aattcagtac atcctttgac ggaaacacag cttatgctca tgctgccgtc    273780
     gaaatgcgcc ttggaatagc ggtgtatttg cgcgtaaatg gcacgtacag cgtggtaagt    273840
     gttgccttga atttggttcc gcattttttt ccctgacaat gcaaaccgtt tcgcagattg    273900
     taatcgatgc cactgaagag gtcatgcccg tgccgcaaaa tatagagatc gcggcgtacg    273960
     acggcggtaa taactggtac gatatcgtga ttcgtttact ctatgccagc atccctagac    274020
     attgactttt cctctaattc tgacagggtt ggagccaatg ttgatgatgt taatataacg    274080
     gtttcgaacc catcgaatcc cgcattagag ctctcgggga cgctgatgac tcctttgaat    274140
     acgtcgaagg gcgcttggtc gttcgcaact gcgcaggatc caatcaatgt gcacacgccg    274200
     ctaataaatg aatacacctt gcgcttcacc cccgacattt cttccagcct aattccggtg    274260
     gaccagatca taagaatcat tcttggcaag aggggttatc agcttaccgc ttctttaccc    274320
     gctggcttcg gcccattcgc ctccgcaaca actgtgctac tcgatacgtt cgaggtgcaa    274380
     gttatggacg ccggaggtaa cttcataggg aactcagatc gctacgcaaa taccgacacg    274440
     tcaactgtca tcagaaagat taagttatca tcttcaacgt tgcagttgac aggaacgaca    274500
     actctttaca ctgctggaga tggaaagtct actgcaaatt cggtatcgtg cctgacgcca    274560
     aagaacggca cacacgtcat cgtaatcgaa gaggaagaag ccacggtcga tagcgtcgtc    274620
     aaggttccgg tattgaaatc aggcacattc acggttgaga tttctgtcgg gattgcatct    274680
     cacctggaaa tatcaggaaa tccagacaat atggtttcta tctccttagg cgctaagctg    274740
     aagccaactg agatcgccta ctatggcttg agtgataaag tcacgccgct tgatgtttat    274800
     accattcaat ccgtggacag cggaggaaac cttctcactt cattccaacc gttttatgag    274860
     aacgtgacaa cggttctgtc aaccgcaatc acggattatg tcgcaacaga ggattcaagc    274920
     atgtcagtga gcagctcgtc cgtcacaata acgcagcaag ttggaagcga tgtttatact    274980
     tcgctcaaca cagtggagaa gacgtacaga aatactacgc aggtgaccga agtcaacgca    275040
     acgcatgttg ttcagtacag ggatgtcgta aatttcaaaa ccgcgtacac attgtacacg    275100
     cagcgcacaa tcactgcgag tctgaacgac acgagccgag aagcatactc gttcacgata    275160
     aatgacaacg agatcctgaa ccgaggtcct attctcgtcg ctgacccaag ttatcaccgg    275220
     gctggaactc tgtctgtcgt tcagcaagat gggatcgcgg tgttttcagg tgcgtaaaaa    275280
     tttacggaaa tgactcgatt cccgaacatg tttttcacaa aattccttat ctgcggtcct    275340
     cgatttcttt ctgaatcctg ttcccaccaa attgtcactc agggctgcat ctcgcgagac    275400
     cgtcagttgg aaattacgag ttgactttca cctcgaatga tccatccttc caacctgcca    275460
     aaactattgt cacggtggtg cacggccgct cacatcatct cggcctccca aatccatgcg    275520
     acacctacct cgactctgct aaggatcttc agtgtgttgc caacagcacc tgtacctgca    275580
     ataattacat ggcgactaat gaggttgcct tgaacacact agcggtgcac gtcatggacg    275640
     caggagttaa tcctgtttac gagcttgaca cgctgccatt gcctcaaccc tatacccgtg    275700
     aggtcttcct ccaggcagag atgagtagcg tcatactttg caagttgaac gtctctaata    275760
     ctgtgagtcc ttgcgagtgt gttggcaaca tgacgagcgg cgagcgaaag gtctcgggca    275820
     cttcatgcac atcagtggac gctttgagtg ttacttcgat tgacggcgtc gcccggtttg    275880
     aaggattgta catgctgaca ccaaccatca gctcggtgta cggtcctgac ggctacaaat    275940
     taatgttcag ctcccctgga gtactcgata tgtcgtttgg catgaagatt tctcccggaa    276000
     aaggatacgc tctggaggtg gtgatgccaa ctgctttccc tgctcctgcg acttcaaagg    276060
     acaccttccg ctctgcgctc accacatgga tcactaaccc tctcgacacc gcgacgctga    276120
     aggttaagat cctcgatggt ggcggcaatt tcatcggtgg cactgagccg tcgggtcgtc    276180
     tgatttacgt gacatgcgaa actgcagagt tggcaccgaa tcctcaaggg gtcggtgttg    276240
     gagggagcca atatgcggtc acgtgcatgc cagggaactg cgcggcaggc gaggaaccag    276300
     gagttgcgaa attccgcaac atcaagcttc tgtcacctgt ggctggatcg cacgatatca    276360
     aattttcggg gcctggactc tctgtcgcgg cgacgtacac aatcaccgtg atcatcggcg    276420
     acgccgtggg cctcagggtg gtcgagtttg ccaagactga atatgaagcc ttggagacgg    276480
     ttgcactctc accgccgaag gtggctgtcg ttgacgccgg tggtaacctt gttgggaatc    276540
     agaattcaat gacacgtctg attaaagtgg tgattgccgg acccaggcac acattcgacg    276600
     tcgctgatgg ccaagacgaa gctatcctcg tgaggctgac cggtgaaatt tcctttgaaa    276660
     gattggcgat tggaagtcct gcagttgggg atttcaacat gacattcacc tctactggcc    276720
     tgttgggcac cgtggcacac ttcaagattg ttcaaggccc ctcatctcgc ctgtacatcc    276780
     ccgttacttt caagattccg agcacaggac agatgattgc cccttcggtg aaatacgagt    276840
     ccctcaagga gaccaagctg acacccttgg ttgtgcttgt gctggacgga ggcctcaatt    276900
     acgtcaagga cgcatcgagg acggttaacg tcacgatcga caagggtaat atttcgtaca    276960
     ctccgagaga ttcaagcctg ggttacctac tcttcgacga catcgtcatg atacgcccag    277020
     cagttggaaa gtacaggctc acgttcagtt caaataatct gacggccatc aacatggaca    277080
     tcaccatcac cgcaggttac actgcggtgt tggacacttg cgttggcaat tccttcttga    277140
     ctagaaatgc caacaccagc tactgtgagg atggggtcgc gtacgggtca gccgatgagg    277200
     tcgtcctgcg agactttcag gttcaagttc tggatgctgg cagggtattt gttggaagcc    277260
     gctggaactc agaaaagcga aacgtgtcag tgagtcttga ctcttacatt gacacgcgcg    277320
     gagtcaaaca acttgtcgca gctaataatc cactcgtgcc cgattttgat ggagcgatgg    277380
     aggttaagga cggctccatc ggttggtgca aaaatgggta cgacattaac cctgtgacgc    277440
     agaccaggat tgatcctgcg acaggagagg ttttggaata caccgtgtac tccgattctt    277500
     ccccatcatt ctgcagagag ataagctaca gtggaatcgc cccggatgta cacgtcaatg    277560
     caggactcaa gttgagatat ccaaaagctg gcacgtacct tctgaagttc acctccgaat    277620
     gttccttcaa gtactgcgga gacgcaatct atcctaccct ggaagcggat atccttcaga    277680
     tcagaatttc tccgggaacc cctcataaca tgaaattcat tgtggagcct ccagctgtga    277740
     atgagaacga cttccgatta aatccaatgc cattggttgg tgtttacgat caggctgata    277800
     atttgtgcac tgagacacac tcgttcatga ctggagacct caaccctcac cctcatcagc    277860
     tgcgcggtaa cgtcgctcca gtcatcgggg gagtggcaaa cttcaccaga ctccgtttca    277920
     gcgcagagcg aggaaaacct ttcactctcg tctttgacct gcatgagttt ggcttgaagc    277980
     ttgagtttta tccattcatg actcgaccgt gtcaggaggt aaagccaaac agctattcgg    278040
     attggaaggg taactgccac tgcctgcctg ggtacaccga agatactgct cttcccgacc    278100
     aaaatggtac tggatacttt ctggacctca acaacactca agtcgcaccg atgtcgttgt    278160
     acgagccagt ggtgttcttt gagggcgatt gggttggtgc cctaaatcca tacggagtct    278220
     gcgtgccatg taggaatggg tactataagg aataccccgg gtctcacccg tgcacaaagt    278280
     gtccagagaa ttttgacact gcgcgcatag acggcaactg ggctcccccg cacaattcta    278340
     cgtcggggaa gatccttgcc ggtcccctcg ggaagaccag attagaagac tgccactgca    278400
     tcgcaaacac tccgatcgaa ggtgtggtat gggtggacga gcctgagctt gaatcctatt    278460
     accgaaacta ttctcgcgaa gggtacagat gcgatgtttg tccccatggt ggtaactgca    278520
     cgggccttga cataccgtat attgctgcgc agcccggatt ttacaggact agcacggtta    278580
     ccaccaaatt caacaaatgc cctaatccag aagcctgtgt tggcgggttt gacagcctct    278640
     gcctcgtggg caacaacagt gggtacacag gaacgctctg tgcaaactgt ctgcctggat    278700
     atgctcaccc gaccatcaat gggcgcttcc ctcctcgatg tctgggatgt ggaaacgttg    278760
     gcatcaatac agcaatcttc ctcgtgcagc ttgcaggcat tgtgtccatc atctccatag    278820
     ttgtgtggac aaatgtcagg cgcggatccg atgccatctg cctgatcaag accttcatca    278880
     cgtatatgca gactgtctcc ctcgctaagg accttgactt gcgatggcca gaagcaacgt    278940
     ctggctttat ggtcttcatg gagaagttaa gtactataga catgcgatct ttctcggtgc    279000
     agtgtttgtt cccgggcaac tactactccg agactggatt gtatcttgca acacccctga    279060
     tcatgggcac tgccctgctg ctgtactact cagttttcca gttcttcgaa gaacagagaa    279120
     gctcaatctc gagtagacgg ggaaggacgt ctaagattgc agaaattgaa gaggaatcgg    279180
     agagcgacga tgatggagat cgtagccctg tggtcaaagc tgcagatctc aggactaagg    279240
     taagggtcga ggcaatggac aacgcaatgt ttgaggagtc atgggaagcg aaagcatttg    279300
     acaaggtttt catgctggcg atcattatgc tgtggttcat gtaccccacg ctcgccaagt    279360
     acatgatcgg tcttctgcaa tgcaagcgcc ttgacaccgg atccgacaac gtctttctgg    279420
     tcgcagatat gagcatcaag tgctacgact cgacacacag cagctggctg ttcctcttct    279480
     tcgttgttct catcatctac gtcctcggca ttccattgct gtcgatgttc ctcctacaac    279540
     tggaaggcga aaaccacgat cgactcggta tgcggttccg agtcggattt ctttacaaag    279600
     gacatgatat cgagagggct tggtggtggg accttgtgat atttgctcgc aaattcacga    279660
     tgatcagcgt tgtcgtcctc ggagctaaga ccactcgcgt cagcagttat tttgctgggt    279720
     ggatcctcga gatattcatg attggtcatt tacttttcgc gccgtatgac aacgagaggc    279780
     agcacaagat cgagacgtat ggattggtgg caaatatttt cacctttaac atgggttact    279840
     tgttctacga acgggacgag tggtggatcc atctcatagc gtcgtttgtg ttcttcgcct    279900
     tcaacctctt catgtggtac ttgttgttcg tctgcttgaa gcaggagctc gccctcgaag    279960
     gtgagacgat gaggatcgcc cgcgcgaatc acgactatga attggaagac aagatcgcgg    280020
     atgagttcga gaagaggcgc gacaaggaga aggaccaaca gaaggcgatg gaggagaagg    280080
     ccaagctcga ccagatggta ggccggccac ttccctttgc cgatgacaat ctctgggaga    280140
     agatgaggac cgcaacggtc ccggagatgc gacaggatca taaggagctg tcggacaaac    280200
     tcgaggacat gagatctaag tggaagcagc gctggaacgc caacgtagag aggaaatacc    280260
     gcgtggatga ggtccacaga gtgaaggagg tctccgcggc tgagaagtgg cgagagcgca    280320
     aggctgcaga acagagcgcg acactgaagg cgagggaggg aacgctcagg cagacctggc    280380
     aagagaggat ggcacagcgt aaagctgaaa gagataagtc aaacggaggt cgaaggtgag    280440
     ttcacaccca cctccgcctg gcatagattt taatttagag gaaagagaac gaacaccgtt    280500
     tacttcgcag ccggcagcta tatctgcccg cctttttctg tattttaaaa tgggtttttg    280560
     ttggtctcta tgttagcagt tctatccccc caacggcgct tacgcgagct gcttgatgag    280620
     ggcgttgccc tgctcctgga cggaggcgag cgcggcggtg gcggcagcct ggtccttctg    280680
     gcggatggag aagtcgagct tctcgatgga ggcgtagaaa gccttggccg cagccttgtc    280740
     gccacccttg tccgcaacga ggttgttcat gtcgaagcgg agggtaccaa cctggcggcg    280800
     gagctcgttg gcggcctggg tccagtaggc cttgccgacg tactcaccca cgtcagtgtt    280860
     gaggcgcttg atcgactcgg acgcgcgggt cgcggtctgg gcagtggtga gcttctggaa    280920
     ggagaagcgg gagttgccgt cctggcgcac ggactgggtg atgttgagat cacgggcctg    280980
     atggaaaagg gaaagggatc gtcagtggat cgctcagggt gggttgtcgt tgttgtttgc    281040
     agataagttt gttggaaggg ccacggacaa atttgacgac accgcggggc gatcacgtcg    281100
     gatcaccagg gggggtgggg ttcggcccag tacgcacctc atagatgagc tggagaccgt    281160
     tcttgttggt ctggcgctcg tcctggagct cgatcatgtt gagcgccatg gcgggggtgg    281220
     cctggagagc gatgacaccg gccgcgagga gggaggcagc ctgcgaggaa ggaatcggtt    281280
     gggagggaag agggcgatga gttcagggtt tctttgccgg caacaacgcc gggtgatcgc    281340
     gacgagggga gcgccgagcc acgaactccc cgcgcgtgcg ggcgattatg tcgctgagac    281400
     atccttcaag cacctcgcgc gcgcgaaacc ggcggaagat tccccacggg tcgccggttg    281460
     ccgcgcgaaa gccggagtct tgttaatatc cgcaacgcaa tcgcgagaga tttctcacct    281520
     tgcgggcatc ggcggaggcg gtcacggcga cggacgcctt ggccttgggg gcggtcttcg    281580
     cctggacgag ggccttgccg gtgaacacgg aagcagcgga ggaaatggca gccattttga    281640
     cgagtataag gctcgtttgc ggtcggggag tgtgcgaata tgacggcatt taggagcagg    281700
     aaacggagca agtcagctgg taggatttcc tcgtttcgtc ccagccaatc agatcgtgag    281760
     atttttttta tctggcagcc acacgcaata tctcaagaat agaccaaggc tttccaccga    281820
     taaatcggcc tcaatccaac tgcgatgatt caggacgagt cgtgaaccga gcctttgatt    281880
     tcgtgcattt tcagagcctt ttttcgagct caggcctgtg ccgcagctgc gtgtgagatc    281940
     gatcaccttg ctttcccgtg gcggtcttgt cacccgcggt ggaagctatt ttcgcgggtc    282000
     ctttcacgag tccgccggcg cagcgcgtca cacaccacga cgcgcgtcgg gaaccatgag    282060
     cgcagccatg cgaaggacca gtgggaacga gctttgcgtc cgcaccttcc tgctcgtgcc    282120
     cgtggcggcg gtttgcctgc tgttggcccg cgccgcgctg cttatgtggt tctacagttc    282180
     cccgctggtc gtggcactct ccccggccgc ggagacggga gcgggagccg gatgggcggg    282240
     atcatcagga ctgctcgacc gcgtgctcgc gctcggcccg atcgagcacg cacgacctcg    282300
     tcacccacga cgaccaaagg acgaggcggc gatgttcgcg gtacacgtca ggcgaggtga    282360
     ccccaaaaac gacgggagtc aagcagggga ggtggagagg ctcgccgctc agaggctcgc    282420
     gagggacgac ggcgcggaga tggaggttgg tgacggactc aacatcgtac gcgcgcactt    282480
     cgtgtacgag aacgacctga cggatcccct cgaacccgac gaggtcgagc ggtggctcgg    282540
     tggcgcgccg ggctctgact cgtccaggct cgtcgaggct tccaggcgtc gagagcgcga    282600
     cgccgtgggc gaggctttcg acgagttcag cggcatctac ggggcagccg tcaagaccaa    282660
     agcaatccgg tggttgcacg agtctccgtc cacgtacgac cgcgcgtggg tgatcgaacc    282720
     cgacgttgtc tacaccggac ggtgggccga gcttttcgcc ttttacgacg agaaatatcc    282780
     acgctcggac ctcgtatcag taaacagcac ccacagcacc ggagggtcga gctgggccca    282840
     cgctgcggag tgcacgctct gctcagaggg cgatggacgg tggcagacgg cgttcctgcc    282900
     ggtgttcagg atatctcgaa ggctcgcgtc cgcggttctc gagaccctcc gctccaaccg    282960
     cacaggtcac cacgaggctc tcctgccaac cgtgtgcgag agactttcgt ggtgcgagtg    283020
     gaccagcatc agccacgggg acatatacag gtaccgtcca ttcattgcgt tagacgaggc    283080
     ggagcaaagc gcgaagcccg gaaggctgta ccacccggtc aagtccgctg atgttttaag    283140
     ggcgctggca cgcgtggagg aggtttgaga ctacccttgt ttcctactgc acgacgaata    283200
     tgatatgatg acccctcact ccacgtcctg gtaaactcct atggtcgcgc atcgcctaga    283260
     tttccctgcc agtacgatcg atcgggcgag gcgcagcttg tacgccaccg tgtcgtcgtc    283320
     ctcgtcgtca atatcgtcga acagctccgg cacgacctcc ttgtacaacg cattctccag    283380
     gtgcgccatg aagaagttca tctggatctg ctgccacacc agcgcaatct ccacgtactg    283440
     cgtcctgtcg cagctcaggt tgggttccgg gggttgaggc ggcgccgagc cgtccagcca    283500
     acactcgcga ggcagccagg tcaggaacga gggctcgccc gtcgctccgt ccatctgtcg    283560
     cagcgcccgc tcatccacct cggcgtagac gttcctgttg gcgtacctga ggtgcttgga    283620
     ctgcgccagg acggtgagga aatcgtcccg ccgccgcaac actttgacgt cgtctgagtt    283680
     cattagcgca tcgagcaccg gaccgcactc cttccacagc ctgaccacgt taccgagagc    283740
     gtacgcggcg tcgcacagct cgccagtgga catctcctcg gccctgagcc gcgtccagtc    283800
     cgtggctttc atcgtgccct ggatccaccg gagcgcgccc aggaccgacc tggcattcag    283860
     acagtcttcg cgctcgtccg aactcccacc gcttgcgccc ccgcgtcgtc gtctccgcgc    283920
     ggcgagcttg tccatgaagc cccgcgacgc ttcgctgacg cgctcgcgga tgtccagcag    283980
     cacccgctcg ttcgtcggga cgacgctcat gtatcgctgc ttgagctcga cgaaatcgac    284040
     cggcagcgta cgtctcttgc tcgacgtcga gggcgcgtcg ccgtcgtcca gtcgcatctg    284100
     ccggatgccc ttcgcgcggt ccaggacgtc gtccagcgag gttgggtcac cggtgccggt    284160
     ctgcgaccat ctcctgaccg tcgcctgagc cgtctcgtac tccgcacacg ccgcttcaag    284220
     cgtccccgcg gccctactca ccagcaagca cgcgtcgctg aggcgatgat gagccgcctc    284280
     catgctcgtt gttgtcgcct cctcctttgc gctggagggg cgtcggggct gccttttctg    284340
     ttttcacgtt ttgaaaaaaa aatgttcttc taactgctta acgtcaaatc gtgttccttt    284400
     tctaaccatg tttcctgtga ttcacctaat ttcgtaattg cctactgaac ctcgtatgaa    284460
     gagatcgtca agtttgaggg aagagtcgca agcagagaga caggagagaa aagcgaaatc    284520
     ccgtcttcct gctctccctc tttgaaccgc gcgcaagtgg cacgcgagtt ccggcttcgt    284580
     tactttagag cttaaacatg ggtaaccaga gggctcgctc ccgcggtctc cgccatggca    284640
     cgcgtaacat gttcagccgt cccttccgca agaagggacc gaacaacgcc accacctacc    284700
     tgaggacctt cagggtgagt agccgctaga aacacgtggg atggcgcgcc tcgagcggcg    284760
     ctccggcgcc gagggcgacc cgtcgcgcgc gtgtacgtcg cgttgacgat gttttcgtca    284820
     cgtgcgccgc gtcgacgccg tcatccgcgc ttccgcatcg cgtcgcggct ccgatttcgg    284880
     ccgagtctcg cgcgtatcaa catctttact gacgctaggg ttttcccctt tcccgcagat    284940
     cggtgactac gtcgacatca aggtgaaccc ttcccagcag aagggtatgc cttacctggc    285000
     gtaccagggc cgcactggta tcgtgtggaa cgtcaccccc cgtgccgtcg gtgttgaggt    285060
     taacaagcag gtgcgtgtcc aaccccgcgt ctccgcgccc tcctgcggaa aaatctcccg    285120
     cagaaaacac caacagactg ggaacgcagt actaaaccct aggtgccttc tccccttcac    285180
     agattggtgg tcgcgtcgct aggaagcgca tccacgtccg catcgagcac gtgcagcact    285240
     ccaactgccg cgcggacttc ctcgcccgcc gcaaggcgaa cgatgaggcc cacgaggctg    285300
     cgcacaagtc tggacgtgag tgccccctca tctcgcccca gaccggccct tttttttcag    285360
     atgcgcagtg agctctcctc ggcgctgccc ctcgacgccc ctcccttgac gcgattcact    285420
     cacatgtcac ctccccttct attcaacaga gcccgcgccc cagactaagc gcaccgtccc    285480
     cggtccccgt gagggtttca ccctggagaa cgtcaagacc gagatcctga cggccgtccc    285540
     ctacgacatc gttcgtgagg gtatcaagta ctaaattggg ggggttcgcc attgtgcatt    285600
     tgtgcgtagt ttttatggaa taagatctgc gcaatcttaa aagcgtcgtc gtcgctgccg    285660
     cgttcctacg attcgaccct cagtcgccgt cccctcaacc ccctccaacc cagtggccaa    285720
     aaagttccat ttcgtttcca gcgaacaaat gagacggttc ctttttcagg ctttttccag    285780
     agtagaacgc gccaggatag aatggacgcg aggaagaatg cggcgattag aaaattgaag    285840
     cgctcgaaca acgcgtgggg taagctcgta gctaagtatg aggctgaaat gtttgcgagc    285900
     ctgcccgcgg agcacgctgc gagggcgaaa ccgagcgagc gtttgataaa gtaccatgcg    285960
     acgcgtgacg ggcaggtcgt ggcgggcctc gttgcggaca tcctcggcgt gctaggttgc    286020
     gaatcgacgc tcagagtgct aaatactgaa tctggggtga atgaaccgat gtctcgagac    286080
     gcactggagc gtacgttgcg tctggagggg tctgaagggc cgcttcttgc cgggttgcta    286140
     acgagatctg acgaagcgga tgagggacgc gagagctcca ggacacggga tcgaacgcca    286200
     gaggtcacga aacgggagcc acccgagccc atcgtcctag cggtaggggt tctagaagag    286260
     aaggacacga atcggcccga gcgagcgacg ggggagacag ctgtgaagag gacggagtcg    286320
     acgtcgccgt cgacgggtgc gggtccctcc acgaatcttg gcggcgtgga gcgggcactg    286380
     gaaggaagct tcgagctgga gaacagcgac gacgatgagg tggtggacgc gattgaagag    286440
     tccgtggacg acctcgaggt gtccgtggtg tccatcgagg ttgacggtcg tgtctccggg    286500
     tctgtcaaga gcggcggcgg ttcgtcgatg cggggcaact tctccgtcga ttacgaggac    286560
     gtcgggatgg gatcgacgcc accgacgagc gcggcggggg gtgatgccgc atttgacgtg    286620
     gagcgtggtg gcgtctctct cgacgacgag gacttcgagg tggaccacga cgacgtctgg    286680
     taacttttgg agcctgcttt ttcctctctc gtgtaaaagt gtttaacatc acccaccgaa    286740
     tttcgcgcat ctcctcatcg tgaaaaagca gggttcacga accgtgtaaa tttcccgctt    286800
     cgtgattggt tcgcgatatt atccacggat cgccaagtgg acgtgagtcg aaggtttccg    286860
     ccggttcgtg gcggctgcga ggcgtgtccg cgctcagttg aacacgagca cgtgtttcgc    286920
     cgatccgtca agccgcatcg gtgttgccat gttctccacc gccgccacga cggccgttcc    286980
     cgtccccgcc acccgtgtgg tgcgtcgccc gtcccccatc ccgacccgat ccagaaatca    287040
     acaacctgcg atgtggaaag ttcacccaga tgaacacgga cagatgtcga ccctcaccgg    287100
     cgacccgaat cccaacgaac tcgagctgac cctccccgcg tgatgaactt ctcctttact    287160
     cgcaggcggg ctcccgccgc gtgcgccgcg ccgccaagtc tcgcacttcg gtccgcgcct    287220
     cggccgctcg caaggatgag gatgtccagg tgaacgaggt tgccgcgggc gtcgcgggcg    287280
     ttgccgcggc cgccgtggtc ttcggtgccc cggacgccgc gatggctgat gcgtacaccg    287340
     actaccttga ggccatgaag gctcagaaca tcgagccggc ctcggtcacg ctccctgctg    287400
     aggctcccgc agccaaggcc atcccggccg gagccaagaa ggctgccccc gcccccaagg    287460
     cccccaaggc ccccaaggtt gccgcgccca aggttgacaa ggaggctgcc gccgccgcca    287520
     aggctgaggc tgccgccaag gctgcggccg agaaggctga ggccaaagcc aaggctgacg    287580
     ccgagaaggc tcaaaaggct gcagccgctg aggccgccaa ggctgaggct gatgccgcca    287640
     aggctgagaa ggctgccgcc gctgaggccg ccaaggccga gaaggccgcc gccgctgagg    287700
     ccgccaaggc tgagaaggcc gctgccgctg aggccgccaa ggctgagaag gctgccgccg    287760
     ctgaggccgc caaggccgag aaggccgccg ccaaggctga caaggctgac aacaccgcct    287820
     ccaagcagtc tctcgaggag aaggccgctg cgcgcgccga gaaggctgcc gctgctgaag    287880
     ccgccaaggc tgaggctgac gctgccaagg ccgagaaggc cgccgccgct gaggccgaga    287940
     aggccgagaa ggctgctgcc gctgaggccg cgaaggccga gaaggctgcc gctgccgagg    288000
     ctgctgctgc cgagaaggag gccgccaagg cggcgctcgc tgaggccagg gccgagaagg    288060
     ctgcggccgc caaggctgcc gccgcgaagt ccaaggcttc caagcccgcc tcatcttcat    288120
     cctctggcga cgccggttct ttcgcccccg ttgccggcat tgccgtcgtt ggcgctgctg    288180
     ctgccctcgt tggtggtggc aagaagaagg agcctgagcc cgagcctgag cccgagccgg    288240
     tcaacacgcc cttctccttc tttggcagga agccggagcc cgagccggag cccgagcccc    288300
     cgaagaagaa gggtttctcc ttcggagcca agaagactcc gcctccccct cctccggctc    288360
     ccgagcccgt caagaaggct ctcttctcct tcggcgccaa gaaacctgag cccgagcctg    288420
     agcccgagcc tgtgaagaag aagccggcct tctccttcgg tggcacccag aagatgaaga    288480
     aggcacccga gccggagccc gagcccgagc ccgtgaagaa gaagccgatg ttctccttcg    288540
     gtggcacgca gaagatgaag aaggcccccg agcctgagcc cgagcctgag cccgagcccg    288600
     tcaagaagaa gccgatgttc tcctttggcg gcacccggaa gatgaagaag gcccccgagc    288660
     ctgagcccga gttcgagccc gagcctgagc ccgtcaagaa gactcctccc aagcccctct    288720
     tcgcgcgcaa ggctccggtc aagaaggctc ctgagcccga gcctgagccc gagcctgagc    288780
     ccgagcccga gcccgtcaag aaggcccccg agatgcccaa gatgcccgcg gcgcccaagg    288840
     ttgcgttcaa gaaccccttc tccttcaact tcggcaagaa gaaggcagca gcgcccgcca    288900
     aggcagtggc tgccgtcgac gctgcccccg gcgccgccga ggccgccacc gtcaccgacg    288960
     aggtgattgt cgaggcggtt cccatcccgg ttgtgcccga ggacgacatc gtcgcccgcg    289020
     tgctcgccga gaaggaggct gccgctgccg ccgccgctgc caaggccgcc aaggatagag    289080
     ccgccgcact cgacaaggcg aagaaggagc aggaggctgc cgccaagaag gctcaggagg    289140
     ctgccgccaa ggctgccgcc aagaaggaga aggagctcgc tgacaagatc gccgcgtatg    289200
     agaaggagca ggccgacaag aaggctgccg ccgagaagaa ggcggctgat atcaaggctg    289260
     cggcggaggc aaagaaggct gaggccgagg ccaagaggca ggagcagatc aaggcgaggg    289320
     aagaggctaa ggcagcggcg gctgccaaaa agaagcaggg tggcggactc ttcgccttcg    289380
     gagggaagaa ggaggaggcc aagcctgccc ccgcggccaa ggcggctgcc ccggcggcca    289440
     agcccgcccc cgccgcgccg gccggtgcca gcgacgccgc tgccaacgcc gctgatgccc    289500
     agaagtggat tgatgcctgg aaatccggtt cctccggttc ctccaagccg gcggcgagcg    289560
     gcggcaagtc tgatgccgcg gcgaacgcgg cggatgctca ggcgtggatc gacgcgtgga    289620
     agtcaggatc ttccgccgcg ccccccgccg ccaagcccgc gcccgccgcc aagcccgcgc    289680
     ccgccgccaa gcccgcgccc gctgcccagc ctgcaaagaa gaagattgag tacaagggtc    289740
     ccttcggcaa cctcttcggc ggcaagaagg aggaggctaa gcccgctgcc aaggaggctg    289800
     cggtcgccgc caagcctgcc gcccccaagg ctggtgctag cgacgccgcg gccaacgccg    289860
     cggacgcgca gaagtggata gacgagtgga agggttcttc gggtgcaggt ggctcctctg    289920
     ccgacacccc cgagggtcgt gccaaggagg cccaggcctg gattgacgcg tggaagtcca    289980
     agcagtaaac atttattaca cgtcattgac agtgttcata atcgcagctc ttatcatgat    290040
     caatgaatga ataagcttat atttatttat caactcgaag cagtcgtcaa cgacacggcg    290100
     tcaagccgtg gcggacaaga attggctgag cgttctctaa gatacagcgg caagcaaaat    290160
     tgcggcaaac cccccctcta cacgtgcacc tgttgtttag gcgctgacga gctcaggctc    290220
     gagctcgagc tccacgccat cgacgagctc ggcagccacc atgcccttct ccgcgcgctc    290280
     ctggaggcgg cggttgtact cgccagccgg gtaggggtcg cgggtctcag cacccgcggg    290340
     catcctcgcc ttagcgtacc actcctcctc ggggcagtag gtgccgagga tgtggtccat    290400
     gccggggcag cacacgttgt agttcatcct gccgctcatc acgtggtggc ccatgtggtt    290460
     cttgtagagc cagttgtagt agccggtctt gcggagcatc ttggccagcg ggagggggac    290520
     gttgaggccc tcgctgaggg gaatgtcctc catgccgtgc atcgcagggt ggagggagtt    290580
     ccagaccgcg gcgtggatgg cgacggcgcc gaggatgatg gccatccccg agggggcgct    290640
     gaagcccatg agcgccagga tggggatgga ggtggggagc atctggagga ccatcaggcc    290700
     ggtgatgtcg tactcaaacg cggtgccgcg gtacttggag ttgacgagca tcttggcggg    290760
     ctcggacttg agccacttgg ggtcggtctt gagggacatg tcgtcgaggg tctcggcgtg    290820
     atgctcgatg tgaccgccgc cgtcgcactt gggcgccacc tcagcaccgg tcagcttgca    290880
     ccacagcgcc ttcatccagt cggtcttgtt gaactcggcg tgctggaacc agcggtgagt    290940
     gacgtactcg ttgaaggaca cgaccgcgta catggtgggc acggcgaggg cccagcgggt    291000
     ggcgacggcc acggcggtct cggcgccggc catggcgacc accttggagg aacggcggcc    291060
     ggcggggacg gcgcgcatct ggcgaaagga cttggtctgg gtcaccggga cgccgacgag    291120
     cgccttaccc atcgtggagg cggcagtgaa ggacatctta tctgtgtagt ctgcgctcgg    291180
     agttagcctg agcgtgtttg tggtgtgagt acttcagcga cggtgacacg agaacgtggt    291240
     cgtcggattg agctcgggag ggaagtgcga ggcgtgcgta ggagtggggc acgggcggag    291300
     gcgatcgaat caaccgtcga aaatccggcg tttcggcgcc gaaaagagcg gctctgcagt    291360
     cagccacgac aaccacagcc gcacgtggcc tctcaaaatc ctcagtgtgg ggtgggatcg    291420
     agaaccagga aacgagggtt taccagtccc gatgattgga gactcgtttg gttttccaaa    291480
     aaatcagtta cagttttgtg tgggctaagc taaactggct aaaagtcacc gtcgctgtgt    291540
     ctcaagcgta cgaggacgac gaggcctgcg gcgggtagga tgaccgcgac gaaccggagg    291600
     tgacgccagg cacaaactcg tacgcgccgc tccccggcac gtggtagtcg acgtccctcc    291660
     actccttgta cgtgaacaac atcgagaagc acaccgccag ccacgtgaaa aacgcaaacg    291720
     caatcgaagc cttcgccgac gtggcccgct tgcacaccgg gtacacgggg tcgacgatgg    291780
     tgatgttgca tgacgtggcg gacatcgcga acgcggcgaa gagcaggacg ttcatgacgg    291840
     tgtacgcggt gagctccgtc accggcgggg gaaccctctg gagcaagtac gccgccatca    291900
     cgacgagaga aaagacggcg tagattatgc acacggcgat gaggaacttg aagttggaga    291960
     acttctggta cccgcaagcc tgcgggccgc actcctccaa ggtcatctca tcgggcccgg    292020
     ctaggccgtg gcgctggctc agcatcgcgg cgaacgcggt gattgaaaag agctgcgggg    292080
     cggacggcgg attagagaga cggtgttacg tttggtcggc gaaaggagcg cgcgaggaga    292140
     aatatcaggt tgatcttggg cccggcgcga cgcgtgatag gtgcatcggt gcgtgaataa    292200
     gtcacgccgg gccgtcgatt gcaatgttga ggaagcgtag aggctgcgac gcgggggtaa    292260
     ccacccgacg atcggacggt gcctcttttt cctcgctcgg ctcccggcgc agtgggacgg    292320
     gacgcggcgt gggagaggcg gacgggggac tcacgcattg cacggcgatc aggcggaact    292380
     taggcgagtt ggtgacggtg gggtcaaagt cgtccatagc ggcgaggctg cgagtcagag    292440
     ggtcaacact ctcgtctctg tgtgcctctc gacacgcggc ccggcgaaat ttatttccgc    292500
     ctgcagcagc gcggaaatca cgatagtcgc gaaatcttcg ttcccaattt gtcacccgcg    292560
     ccagcggccc aaactgtgtc ggcctcggaa ttgtcgtatt tcaagcgacg tggagggccc    292620
     gcggaattca gtcctccccc gttccgcagc gataagcggc gcctcgaaga agttcgtagg    292680
     ctcgtttgcg gtggtgacgg gggacaaggg attcactaaa taaaggggca ggggtgccgc    292740
     tttattggag ggtttccgcg gatacgtggg agcacttccg ggggggggtg aaaagggaga    292800
     gcgggaaaac aaagcgggga taatgggagt ttccgcggga agcacgctgc tcgacaagaa    292860
     cgtcgagcga ctgctctcgg agccctgggg cgcggctcag gccggagttc agtacaacaa    292920
     ggaggtcctc gggtctctat gtgaacagtt ctctcggctc gagccccagg ctcgtcgagg    292980
     ggccttgcag ggcaccctct tcatgaggaa aggtcagcgg gactctttga aggaggagat    293040
     ccggactctc gtagatctcg cgaccaacga caaagaccag tgggtgagct tgatcgcacg    293100
     ggctctgggt ggcctcaggg aaagatttga ccttcagcag cttcagcagg acgttcctgc    293160
     ggtgagttac taggccaatt gcgcccctcc gcggtagcca aaaaaaccct accttcttcg    293220
     tggcaggaac tggcttgatt tttcgaaccc gagtgagagc tgaacagtcc aaccatttct    293280
     tcctcctttc tcgaaaaggt tgccgacgcc gtcgcgtcga ttagggacaa gattcaggtg    293340
     gatggaacgc cggacaatta ccgacctatg gaggtgaatg cctgacaatc gccactttca    293400
     ttctttcgaa aatctcgccc cgggtttcgc ctcgaacggc tctgagtcgt gtgggctggt    293460
     ttgcgcgcac gatagtcgcc ctccagcctc gctctctctt ccacgatggt tattcaaccg    293520
     cggtatcccc cacgctttgc gcgtgaacag gaaatgtacc tctccccgcg gcttctcgct    293580
     gcggcggggg cgcctccgtg cgaagcctcc gcgccgaccc acgggcactt cacgccgagg    293640
     gctcgaaggg agcccaagaa gaggttcgcc ggcacagcga ccgcgagtgt cgccccgaag    293700
     actaccgttc aggccagccg cccggcgtcc acgtccatgt tcgcgccgcc cagccgtaag    293760
     ccggcgacgt catttttccg agactcgggt ccgagctcga agaagacggg tgcggcgtcg    293820
     gccaagtcgt tcctgtccaa aagcagagac accgggacaa agacgatgat gatcgacgtc    293880
     aacgaggcgg cggccctcgg tcaggtgatg ggtgaggacc tcaacagggc tcagcgtgag    293940
     ctcgagaagc gggaggagca ggaggctcgt gagcaggcga gggagcgcga gcgggaggag    294000
     cgcgagcaga agaagaagct cgagcaagag cagaagaagc tccgcatcca aaagatgatg    294060
     gaggagcgcg aacagaagaa aaagctcgag ctcgaacgca agcgcgcccg cgaagaggaa    294120
     ctcgccaagc gcaagaatga cgccaagcgc ccgagaaccg aggctccctc gcgagaagag    294180
     gtgtcgactc cgagtcccca tgagtcggac ccgatgccca tacacggcgt gatttgattc    294240
     tggattcaca aacattcatt cattttcggg gaaaggagag aaaccagtgt atgtacaagg    294300
     acacggaaaa cagtattata ttcgtagaac agggaaacaa acggggaaac tagaagcagc    294360
     agtagacaaa caaaagctcg gcccagtcga gcaccaaaaa aataggaaga aaataggaga    294420
     acgcagggtt ctgccctgca acaaaaacag gttttaggac tgtcacattt ggaattgatg    294480
     attattcaaa tcgcacgaat gccatcgtct cgtattactc gggcctgcgt gccctcgtgc    294540
     ctctcttcat tgctgacatc accggccgct ccaccaaaag ccacgcaata gctgcgaaca    294600
     ggaaagaaaa cgccgagttg aacagcgcgt gagccatcat atatcgccat ccgaagtgat    294660
     agctgctcgt cgcggtgcca gcgaaccatt tgatgacgac tgggtgcatc agatacgcgc    294720
     caaacgtgag cctggcgaac ggtgtccaac ccgggtgcgc caagaacgcg ttgagacctt    294780
     cgagctgacc cgcggcgcac agggtcgcga tgatgccgag gcccgcagcc cacatgggtc    294840
     gacacagggt gatgaacgtg gcattgaccc acggcgacca actttcgggg tccatgtagt    294900
     cggacagcgg cgccaaaacg cacgcaaaca gcgcggtgac ggccgcggca ccccaggttt    294960
     tgaccgctgc gcggttgagg ttcggcctca tcggtcggac tcccgggtcg gagacccacc    295020
     gttcgttaac aaaaccaaac gccatcccga ccagatgagc agggactcgc gtgtagggct    295080
     tgctgtaggc gtagtagctg tagtcccgcc acgattcacc gaacacgtag caacccaggt    295140
     cgtagtgtac caccagccaa aactgaaaga gacaagagtg agagtcagga aggttcacgc    295200
     aaagcaggcg aaaattttgc ttgcagatcc gcgcaacgct cattgacctt gtctcagcat    295260
     ggagagtgcc tctttcattc caccagcggc cgaactctag aaagagatgg ttgcttggcg    295320
     gcggaagtca cctcataaga taagatcaag taattcggta atcattgcgt aggacagatc    295380
     cgcgggcaga gaaagggata tgaatgagcg caccgtgagg acagaggagg ccaatgccac    295440
     ggctatcatc accgtccaca ttactttcgg acggtggtga tgcagcagaa gcaggccagg    295500
     agacataaca aagaatatca tgtcgcagcc gaggtaccag ctccacccca tgcagacttg    295560
     atccgaatca aagggaacaa agttatggag gtacaggagg gaggttaccc aactcgcgtt    295620
     gtcgcaccgc cggaagacgg attgctgata cctcacgaag aacggtccat cgccgatcct    295680
     ggacacaatc tgcgaataga acaccatcgt aaacgcgaaa gccggggtga ttctgatgta    295740
     tcggtgcaaa accatagcgc cgtacggtat cttcccgccc ctcttctcca ggtcccgaac    295800
     gccgaggtac gcaatgagaa agccgcccaa gaagaaaaaa ctgtcaactg cgatctgccc    295860
     gccgatgacg gtcatgaacc aaacttccga cctggcgccg aaactggcga cgagatcctc    295920
     cgggttatca aagccgttca acggcgcggg catcatcatc gtgtgtccca ggacgatcca    295980
     aaccatggat agaaccctca tcccgttgag acagtccgtc ggtgacggct cggctggcgc    296040
     cgccaccagc ttcggccagt tccttcgaat ggagaacatc ttcaacccat ccgctatctg    296100
     atttggaacc cgagacgact gcccgtcccg atcgcccccg tccccggcat cgacgagctc    296160
     ctcggattcc tctccgtgat cctcctcgga ttcctctccg tgatcctcct cgtcgcccaa    296220
     cagcggctcc gacacggtcc catcgcgcgc ctccccgccg gccgcctcga acgcgtccag    296280
     cgccgtcccg acgacggcga ccgcgaccag cgcgacgaga acgaccgcga agaacgccgc    296340
     ccaacccgac tttgcgtttg tgaagaatcc cacgcggtcc tccgcggacg acgctacccg    296400
     cagccgcacc gtcgcgtcct cgccgagcgt gaagggtccc aaggagaccc cgccgccgcc    296460
     tccgtcgtcg ctcgccaact cattcgccat cgccgccgcc gcgtccatga cggcgatgac    296520
     cgcgcgatac tccctgcagt gcgccgccgc cgccgagtcg gcaccggctc tcgcgcagaa    296580
     gctcgtgccg aatggacgaa gcatcgcctc cgccttggcg accgcctctt gggtgccgtt    296640
     cgcgatggcg cccgcggata tgccgccatt cgagaccgct cccgtcagct tctccacgtc    296700
     cgccttgcga cacgcggctg gaaggcacag cccgagctcg gcgaccggga tatccctccc    296760
     gtcgacgtgc cacgcgagcg tgaagtaacc ggcgccctcc gtgttgacgc aggtggtgta    296820
     gtgccccgcg tcgtacggga gggacgaccc cgacgcgtag gccatccgtg ctaaaggtcg    296880
     acgaaccatc ggcaggtgtg agctggcgtt ggatgacagc gcgcggcagc acgcctcgtc    296940
     aatgccgggg tataccgccg cgcagtcaac ggagccgctc gacgggtcgg cgaagcctcc    297000
     ctccgacccg tcgccccctc gggcggatcc gacgagaagg aggatgatca cggcgagccg    297060
     ccacatcgtg atgatcggct cgtgtcgtga ccgggcccgg tcacccgcga gacgccggcg    297120
     cgacgcgttg tgttgacgat gaattttctt taggtgacct tttggtccac cgcctcagtg    297180
     tcagtgggtt agcagctgct tattacaagt gtctatggaa agtacgcccg acgcgaacgg    297240
     ctgggcgtca cagtttggac gctgtcatcg gagcggcaag tcattccttg aggtacatct    297300
     tggacatgtc tcccacggcg tgctccagcg cgtcggcgac ggccacgtcc acattctgct    297360
     tcgccttcat ggcggactgc atcaccgcgt ggtgggcctt gagggcgtcg acgtagtcct    297420
     cgggtttgga gaagacctcg ggcttgaccc tctggcacag cgcgtactcg ctcatgatct    297480
     tgatgatctt cccgcagtgc tcctcctttg tcatgaccca gcgcgtcatc tggttgaagt    297540
     tctgcgcgct gctccccgcg gcgtggagct cattgatctg aaccattgcc ttgcggatgg    297600
     tggcgcacgc ctccttgacc tcggcgacca tggcggggtc gtcgaagatg ccgcagggga    297660
     cctggcagtg gccgccgcgg agacggagca cgaggtggag ggtggactcc ttctggatgt    297720
     tgtagtccgc gagagtgcgg ccgtcctcga gctgcttgcc cgcgaagatc aggcgctgct    297780
     ggtcaggggg gatgccctcc ttgtcctgga tcttggcctt gacgttgtcg atggtgtcgg    297840
     acgactccac ctcgagggtg atggtcttgc cggtgactgt taagagggga atggacgggt    297900
     tgccgggtca gcgaagaagg cgatcggttg tttaattaat tccaatcggg ggtgacgagg    297960
     atcaaaaaag cgaaacgacg ggggcgacga cgcgacgggc gcgttatcgc gcaagagggg    298020
     cgggggtcac gaggcgggcg gctactcacg ggtcttgaca aaaatttgca tggctcttgt    298080
     ggcgaacaaa ggtgtgctcg agaagtactg gaagggggcg gctacgtcct cggacctctc    298140
     acgtcaccaa caagaaaagc ggtccccgga ctttcccaaa ccttcgttca agaccgcgca    298200
     ttttcgtcgc gcattttcca accgtgaatc tgtttggatc catgtcatgt ttacggttac    298260
     tacattttat ttatctttga ctgatatcca tacggcgaaa cgagccaaaa ccatctcccg    298320
     agaaggaatc tgggcaatgg tcagaaactc ggcgttgcac ctccgcctct cgtggtgaac    298380
     gttgtgtggc ggtctggtca cgttattgac gtccggctcg acaacggact caagctctgg    298440
     ggttcgccct cggacagtcg cgcgcacgac ctaggacggg ttggaggact cacggcgttc    298500
     ggagagtcac ccgcaccttc tcggatagtc accgaggggt tatcgcacgc gcacgaccgg    298560
     agacgacgac gcgaccgagc caccgcgggc gtcggagaac tttcgcggcg ccagaacatt    298620
     ccaacacagt tttttcttcc cgtcaacgtt aggcgatgga gtgttgagca ggggaatcgg    298680
     ggcatcgacg atttgacggg atgagcgagc agatcaagag cgttcggggc aatggtctga    298740
     cccacctccc gtcccccgag agcaaggccg agacgctcct gaggttcttc gacagcgagc    298800
     acttcgacga gtggatcgcc atatcctacc tgtggaggac gacggacgag tccatgattg    298860
     agcagctgtg caggcgcatg ctcgcgctgc cggactccgg ggtcaagagg tacctgagcc    298920
     agattatcat gctccagatc atcaggccca gcgacgcgct gaggcagatg atcgtcgacc    298980
     tctgcggccg ctcgctccgg ctcgccacca agacgtgctg gctgctgaac gcagccgcgg    299040
     gggactccga tgacccgagg cccatactgg agctcagggg gcagtgcgag caggcggcac    299100
     tcgcggggaa gtgggagccg ccgttcaggt gcctgtcgcc catgctcgac agggccctga    299160
     ccctcgacga ccttccgatc agcccgcaca gggcgaggag gtccttgact gcgcaggagg    299220
     aggcttcgtc gtttggcagc gcggagtact cgagggaggg actggacacg ccgccggggt    299280
     cgccgagcag gcgagcgcgg ctcttcgcta acggagaagg gggtaacaac caggacggga    299340
     gatggttggg cacgcccagc gccggcgggg gtgcgctcga gacgctcggc aaggctctgg    299400
     acaagatcag gatcttcgcc aaggggagcg acggcgagga cgacgagagg cgacggcgag    299460
     aagaggccga cgcgcagctc cggggggtga tggcgaacgc ggagctcgcc aaggagcaac    299520
     tggagcagcg gagggacacg ttcatatcga ccctcaagct ggccgaggac ctgtgtggct    299580
     tgtcggcgca gctgtcgcgg cagccgcagg agggtcgcca gggggcgctc cgagcgggca    299640
     tcaggagggt cagcgacggg ctggtcgagg ggcacccgaa gggcacgggg gtgatgtttc    299700
     ccatgggaaa cgacgtggcg cgcgtggtca ggcttcccgc ggaggaggct gtactgctca    299760
     actcgcgcga gaaggctccc tacctcgtct tcctcgaggt ggtccacgcc atcgacgacg    299820
     acgcggcgag cgtcccgtcg tccggacccg cgtcgttcag ttccctcagg gattcgccgt    299880
     ccacccccct cgaggtgggc gttggtaagc caccggtacc ggtcccgtcc acgtcacccg    299940
     cgccggtccc gccgctgcat cccggtctgc ccgtcaccgg cgtgggcaga ccgcatcacg    300000
     ttcgaagcaa gagcggctcg ctggccagct tctcggacct gagctccttg ggtgagatcg    300060
     acgagctcag cgcggaccac aggcccggtc acgtcaggca gaggtcccag gacgccggac    300120
     gcggtctgcc ccccaggtcc ccgccgtcga tgtccccaaa gggcgtgtcg cccacgggtg    300180
     ccgcgtctgt cgggttcacc tccatattca gcggcaacgc ggcgagcgtc aagccgacgc    300240
     acctcaggac cccgtcgtac gagagcatct cgcgcaaggt ggaccgggtg ctgcagcagg    300300
     tgtaccgcgg ggacgaacag atcgtgcgcg tgtccctggc ggtcatgtcg gagaggggcg    300360
     attcgcaggc ggggtcggcg caccattccc ggtcgggcag cggggactcg tccagtcggt    300420
     ggaacagcgt cgcgtggttt tcgggcaaca gatcgacgaa caagggcgac ggcgccgagt    300480
     cggggagcca agacggcagc gacgggggcg ggggcagtcc caaggggagc cacgttcgcg    300540
     tgaccctctt cgtggagaac ccggctcccg gaaggagggg accgccgcgc gtcccgacgc    300600
     accagcgcaa accctccgaa gttggactgg aggagatggc cgaggccatc caccacgaga    300660
     tccacgcgcc gctggaggcc ttggacgcca cggcggcacc ccccgcgctg acgcccacga    300720
     ggccccggtc ggcggatgcg tcgcgccccg cgccgctcga gcccgggtcg ccgacgacgc    300780
     cgcagatccc gtcgccgtgg aagcgaagcg cgggtggcct gggggagaag tggtgcgaca    300840
     aggtggagag ggttcgatcc tcgagcccgt acggtaccct gcccgggtgg tcgctcaagc    300900
     ccgtcatcat caaggctgga gacaactgcc ggcaggagct cctggccatc cagctcacgc    300960
     agcagtttcg ccagatttac cgcgaatccg ggcttccgct ctggatccgt cccttcgagg    301020
     tcatcgcgca gagtaccacg tcggcgttca tcgaggccgt caccgacgcc ccgtccattc    301080
     acgccatcaa gagcagggcg ccgcggggca ccagcctgag gcagcacttc gaggccaggt    301140
     tcggcgcgcc cggccagccg aggttcaggc aggcgcagcg gaactttgtc gagtcgctcg    301200
     cgggatactc catcctgacg tacatcctgc aggtgaagga ccgccacaac ggtaacatcc    301260
     tgctgcacga cgacggtcac ctcatacaca tcgacttcaa cttcatgctg tccacctcgc    301320
     ccgggggtat caacttcgaa tcgtccccct tcaagctcac tcgcgagtac ctcgaggtga    301380
     tggacagcga cgacacgggc gccgcgtcgg aggctttcaa ctactacaag gtgctctgca    301440
     ttcagggcta cctgtcggtg aggaagcacg ccgagcgcat cgtgcagctg gtggagatga    301500
     tgtccgcgtc gggttgcccc tgcttcaagg ctggacctaa ggttttgcag aacctcaggc    301560
     ggcggttcaa catggagtgc accgaggagc agtgcgtcga gatcatgctc ggtctgatat    301620
     ccgactctat ggacgcgtgg tgcaccaggc agtacgattt ctaccagcgc gtcctgaacg    301680
     gcatcttgta gactcttgtg gtgatgggtg cgacttagcg tgttgacctt gtttacgtgt    301740
     tgaatcatag taaaaccgca acgacggctt ccccaccttc tgaatttttg ctcagagctt    301800
     cgttagggcg gctcgggcgg gattttcccg tttgaactga cccatcctgc tggcacgatt    301860
     tctgttctgt ccacagagca gccgcgcgcc cttttccggg aagcgcacga gtaaaagacc    301920
     ctcaaggttc aaccttgtgg cggtccagct gtcgcacgcg cgcacggcga atctggaggt    301980
     tggcgctcgt cgtcgagagg acgatcgtgt ggaggtaacg gtgaacgagc acacgaaaaa    302040
     tggtgcagcc ggtgatgatc gccggtccgg tgggtttggg ggtgctggtc ctgcagagga    302100
     ccttccgacg caagaagggc gcgcgtgagg aggatgggag gaggcgagag ggcgagggcg    302160
     acgagacatc cttcgcgtgt gagcgcgtgt gcgcctccga caggctcatc aagcgcctgg    302220
     gctacctctc caaggatcca accccgaact cttgcgtcac cgtctgcggc tcctcgggca    302280
     tcgacgcgtg cacggaggcg tgccagcgct gcgtgtgcag tctgccgcac accgtgccgg    302340
     cgtggcagga ccagtgcaac aagcgatgca cgcaggagtg cctccgggga aggacgtaga    302400
     ttattatcgc cgtgactgta ttatcaactc actttcagtc tacatgtcgt cgaggtactg    302460
     cgagggaacc tgatcctccg gcaggaaatc gctatccttt gccctgtgca tcgccagcat    302520
     gtcgttctcc agcgggtgcg tctcgcccac cagcaccatg gagtgcagcg gcccgcccat    302580
     gtcgatgttg cacatctcct tgagcgtgca cgacttgatg agctcgtcgt cctgacccat    302640
     cctcgccacc gcgacgcaca tgctgtccgg cccgtacacc ttctcgcccc gcgcgtcctc    302700
     cacctccagc atctgcctcg cgcacgtggc gcagctcatg aaccgcggcg gctcgtactc    302760
     cttcttcccc cggcacagcg cctccacgct cggctccttc acccgaatgt ccagcagcag    302820
     cagcgtgtgc agaccgaggt ccgcgttctc cttgatcctg tcgtagaacg agtccggcct    302880
     ccacgtccgg gtgaagaagc agatggacac cgcctgaccg aaccggtaca gctgcaagcc    302940
     gcacccggcg acggcgttca tgatggacgc gttgtagatg tgcttcacct tgcaccccaa    303000
     acccttggcc ctgagtacca ggtcggagtg cgtcgtggcg gcgaaagcgt caccgacgac    303060
     ctgtttcgat ccgtggagga aggaaagggt ggtcagcgtt tcggttcggg gacgggggaa    303120
     cggggaacgc gtcggatttg gatttggatt tggatttctc cgccgccgcc gccgacttgc    303180
     ggatgaggcg gctcatccgc ggggttccgt gcacgtatcg cgaagggcgt tggacgcacc    303240
     aggaaggcca catccatctt gagcgcctcg ttgagcatgc cgtcgatgcc ctgctcgacg    303300
     aactccctgt ccgcgacgac aacctcgcgg ccgtacagag cctccagcct ctccttgggc    303360
     acccccagga tgctggtgta cgcctccagg tatacgcgct cgcacccctt cacagcctcc    303420
     aggccgttaa cggtgatgtc cttctcgtca ccgaggccta aaccgacgac gtacagcatg    303480
     tttgtcgacc gcctttacct ccggtagcac gcggcggtgt gtgtcgggag gaggcccttt    303540
     ttcccgtcct gtccaccacc actgcgagtc ttggcttgaa gaaagtcgtg gctcgaacag    303600
     agtcgaaggc gtgccctcca ggcgcgtcat gacgacgcca accacgaccg aggctgatgc    303660
     gaaccggcgc gaacacttcc caaggtcttg gtcgaggccg ggtacgctgc ttccccggaa    303720
     gggaggaggt agggaggagg ccgtggaggg cgcgaccctc tggctcgagt tctatgacgc    303780
     tcccgaagga ccgctcgggt gcgccccttc ggtgagcgtg gcgtgcgcct ctcgacggct    303840
     ggagctcgtg cgcatggaac ccacgcccgg cggcggcgaa gcgaatgtgg ccagatctcc    303900
     tcgcgatcgc caggtcataa tcgtgcgggg acccagcgcg ctcagggcta ggctcctcgc    303960
     cgacagggag cccggagagg aggtcctctt tcgcttcaga ctggactcat ccgtcgacgc    304020
     cgacgaatgc ttccacctcc tcaggcactg gctcggcgct ccgttcgact cgacgcgaaa    304080
     gacgacgtct gtgattctcg atccgatgcc cgtgagcgcc cggctcctga acctgtccct    304140
     cggcgacgac aaggacgagg aagacaagag cgacgtgtcc ttcgaggagg tcaaaccgga    304200
     ggaggcgaag gagactccgc ccgcattgga gggtgacgat gactccaaag cccaccacta    304260
     cgacccgatt ggttggatgt ttgagagcac ggcggtcaga cgctacgtcc gagacatgat    304320
     actggccttg gcgagcgatg gcggtgaagt gacggagccg gtcatcaact ttgccaacac    304380
     tcctgtggga gcggcgaatg acgagagggg caaactgtcc ttcgctcgat acatcgttct    304440
     cgccgactcc gtcatcgaag agatgcaggc gacgggtgag ctcgagcttc taggtgagct    304500
     cgaggaggag gaggaggaag aagaagaaga agaagacacg cagctggaga ttcacgacga    304560
     gtactactga cgatgatgac atgacgacag acgagttcca acaaacgggt tggaaaacga    304620
     gcagcgccga ctttttacat tgacatgatg agatccttga acgtgtcctg cacctgcggc    304680
     gtccacgact ccgggaaatt ctttttcttc agcatgccgc actgcaccaa accagccttg    304740
     tcgtcgttgc ccagaccctc cgtcttgatt cgttcaagcg ccttaaggct ctcctccggc    304800
     gtcctcgcct ccctcagctc ggctaggggc gcgacgaacc cgtccggtcc cttgtctccc    304860
     tccagaccgt tcttggcggc gtggccctcg gagttgacga tggtgccgtc cgcgccgctg    304920
     ctgtagagga attcggcgca ctcgtcgtag tcgtacccga gcgccatgtg aagcgcggtg    304980
     ttgttcttca tgttgacggc gttcacctcg gcacccttgg cgatgagcag cttgcacacg    305040
     ggggtgaaac cgttctgcgc ggcgatgtgc agcgccctgt tgccgttccg cgggtcctcg    305100
     cagttggcct ggtccgcgtt ggtgatcaga gccgcgagtt cccccaaagg tttattccat    305160
     cgaatagcag agtggatctt cttcatatca tcctcggaca gggcgttggg attgacgggt    305220
     ttcttgtgct tgccgctctc cttctccctc tccctctcgg ccttctccag ctgttccttc    305280
     tccctgcgct tggtttcctc ctcctgcttg cgtttctttt cctcggcgtc tttcctttcc    305340
     cgagcctccc tggctttcct ctcgtcctcc tccctcgaat cagcgccgcg ctgatgcggc    305400
     atcatcccct tagacgcgag gccgccctcg gataggtcgc gatcacgcgt gggggtctgc    305460
     tcggcctgcg cctcgcgtct cctctgcgac cagctcatgc catcatttcc gcctcctcct    305520
     ccctgctgca tgttctgtgc gccgcccatg cctccgccca tcatcatccc tccgccgccg    305580
     cccccgtttt gaattgcctg atggacgatg tattctatca ttccccggtc catcatgggg    305640
     gacggggaca tcacctgcgg ctgcatcggc tgctgctgca tctgcttggt catgctcacc    305700
     aggctggcgg cctgcgacag gtccaccgcc gcgcgcctca catcggagac tacgtccttc    305760
     atgtcctgca ctttaggtcc gagctcgttc ttgatggagt ccctcatcgc gggaccgagc    305820
     gcggtgcaca gaccctccac cgccttggcc aacttgccta cctgcttgga catgtcgctt    305880
     atacacttct cagtctgcgc cgagcgtctg tcctgggtca ccatgaactc catgagctgc    305940
     tgctcgagct gttgttacgg gttggggagg gaattctcgt gagaaagggc ggtttgacaa    306000
     ttcgcgcgag tggggagggt tgcgcgttcg gaagagggga ggcgacgcac cgcgtggctc    306060
     atctgggtca tgatctcaaa agcgcgcgaa agttacgcgc gccgcaggcg tcctcttgga    306120
     cggcgctcgt tcttagtgtt ttcaccggag agcccgtttt caactctcac actttggtca    306180
     agtcccggtg ctcatctcag accgcgcctg gcaccgctcg ctgactggcg cagcagtgga    306240
     atcaagagct ggccaatcga aatcggcgat tcaggaactt tccaagctta atgcgatgag    306300
     cgcctttggg acgacgctcg cggcgcccgc cgcggctggc ggttgggccc ccgcgctgcg    306360
     tcgatgccgc acacggaggg tcggcatcac ctcgagggcg gcggcatcgt cctccgggcg    306420
     tggagcgacg gatggggagg aagaagagcc ctcagacgag aaacgctttg gctttggcag    306480
     gcgcgatgcc ctgattgcct cggcgaccgc gtgcctgagc acaggactgg gacccgaggg    306540
     ttggaccgcc gctcgagcca gtacggagct gaatgccatc gcgctggggg acgacggcat    306600
     cccggactac accgtgcgcg gtccctacgg cgtgaggagg ctcccaaagc tggaacacac    306660
     ctgcataagc tgtttccctc gctgcgtggg agacgcttgt ttggtgcaga ttgacgcgta    306720
     cgtaccgtcg gctcctcccc cgctgcccga caccatgttc ccgctactgg gcgaggacgg    306780
     tgcgccgctc agacccgtcg ccgggcccac gaggggcgcc ctgtcggagg tgagccgagg    306840
     cccgtaccct ctcgcggtgt tcacgtcggg gttcctggtg gactcggagg cgacggcgag    306900
     ctactgccga cgcctgtgct cgtgggggta cgtggtgctg gggtacaaca agagggacgg    306960
     cgtgggcgtg gcgggtggta acgccctgga cgacgtggtg agcgccaaga tggtggacga    307020
     cctgatcggg tgggcgagga cggatgtgct cctcgcgccg ctggtgaggg atgggggcgc    307080
     gatggacacc gcggacgaaa cggatgacga tatcgtcacc gcaccggcca agggaggggt    307140
     gtacctgatt ggtcactcca ggggcgggaa gatatccatg ctccaggcgt gcggggacga    307200
     acgtgtccgc gcggcgtgtc tgttggaccc ggttgacaac accgtgtacg ctccccttgg    307260
     cgagggcttt ccgtctgcgg tggccaagat gagaaacacc aaagacggtg gacccccgct    307320
     gctggtggtt gggggtaagt acggggggga ctgcgcgccc aaggggagca actacctgtc    307380
     cttcctggag cagtccaacc caaagagctg ggggttggag gtgagggccg gtcactttca    307440
     attcttggac agcgccacgc tcgtgcagcg cgcagtttgc gaggaaaatc ccggagttgc    307500
     ggaagctcag gttagggaag tgagccaggc gttgatggtg gcgcatgcgg agaccgtgtt    307560
     ccggggagtc ccgagggagg cagccttgcg acggacgatg aaaacgctgg agcagtcatg    307620
     gggagatggt gcgtttgatc gtgtcaacgc gcaggttgcg ccggggcaaa agtcacccga    307680
     gctcccgtgg gtgctccttc gggatggaat ctcgtcagct taaatgtaat cggtgtgacg    307740
     ttcacttgaa cgcgttcaaa tctctatctt gggcggctcg atcgccacga gcgcaccagc    307800
     cttctcgaag atggagtcca gatatgtttg aagatactcc gggaaagtga tcgacggtcc    307860
     gtccggctcg gcttccgtca cctccgccgc ctcgccatct tcatccatac cctcatcctc    307920
     ctcgccgtcc tcgtacccct cagcctcgcg cgctgcggca gcggcagcct ccttcgcctt    307980
     tttctcctct tccctctgct tagcctccgt cgccatcgcc gcgttgtacg tgaaatacgc    308040
     catcgacacc aggagcctct caaactcccc ttgatcaacc tcgtacggcg ctgcctggat    308100
     cgtgaacttc tccacgtccc cggcggcggc gagctgcttg acgtacacga cgtaagtggt    308160
     gagctgctcg aggctcacga cgtcgtccct cccttcgccg gcgtcctcgg aaacgatacc    308220
     ccaccgcgtc gcgtggacgc tcaagtacct gacgtccagg tgcccggcgg ttgccggcgt    308280
     gcgacgcagc tggcagctgt ccaaagtctt ggccatcagc ctcttacacc tcttgagcaa    308340
     cgagagcacc tccggggtga cggcgccgcg gagctcgtcg tgaaccttct cgaaaaccgg    308400
     cgccaacacc gggaacgcgt ccctcttgag aaagtgctcg agcctgggcg cgagctcctg    308460
     gaacccgccc ttggtctccg gcccgaacac cttagccgcc accttgagga tcgcgacgaa    308520
     gaatccgttg agatccgcgg tggtcgacac ggaccctttc ctcgctccct tcatgttctg    308580
     gggcagcacc gcgttgaagc actcgtcaac gtactcgttc gtcagaccct tggcgaagtc    308640
     gcggcacagc atccggaact gctccagcgt cagtcgatcc acgtcgccgt cgtcgccgtc    308700
     ccctttcgcc tcgtacagct tgaacaccgc ctggatgaag ccgccgaact cggtcatgac    308760
     ggctttgacg tttttcacat cgtcagccct ggcattctcg tgcgtcttgg cgtgtatctc    308820
     ctccaccatg tcgtccacgc cgtacatgta caggtccaag tctttgagcc acgcgtcgtg    308880
     gtcgggtcgg atcgccacgc ccttggagtc catggcgtcc caatcgaagg gtcgcgccgt    308940
     cggccggttc cgccacttgg tcgtgaaagc ttcgggcccg cgaccgaacc gcaccagcac    309000
     cgagtccccg tccttcgcca cctccttgag cacggtgtcg gggtcgagga tgatcccggt    309060
     ggcatcactc accgcctggg ggaccagaga cggggtggag gtgggtatgc cggcgagttc    309120
     ttccatgcga cgaaccgcct cgtgggcaag ccatctgacg atctgggttc ccttcccgca    309180
     ttcaacgttg acgaagccaa cctcggcggt tcccgcgttg aactcctccg acggaacgag    309240
     gctgaccctg attcgcattc gtgccgactc ctctcgtggg ggcctaagct ccgacgtcta    309300
     taccgtgcga cgcaaggtat gcccgctcgt cggccaaatt aggcgcattt tccttcgttg    309360
     agttgttcgc atttggcagc caaaaatagt gctatttgac ggagtagcgt cggcgcgcat    309420
     gctgctcaac tacgctacat cgcccactga gagatcaaat ctctcgttcg acctggcccg    309480
     tctatcgccc ctgaccgagt ttcgccctga tgcgttccac ggtcgccgat cgcagccggc    309540
     acttggcaca cgcaacaccc tcaatgatgt tagtcaggct cgccttcctg aacgcgttgc    309600
     aatcgccgca gagtcgacgc cacgcctcct gccttcgttc ccttcccgcc agcctgtccc    309660
     cttcgcttcc cgtcggccgc atcagctcct tcgtggtcac gtcgcagcag aagatccaca    309720
     cgtgcgacgc cgcgaagcac gcgagcacgg acatgtaccc gtacgttatg gcgcaaccca    309780
     acaggatcca cggcgtcaac cgctcccagc tgcccctgcc cacgaaccat ccgcccgccc    309840
     tgagcctatg caccgaaacc gacagcatca acaccaccag cgcggagcac gcgcacagga    309900
     acgcgacgaa ccacctgtgg ttatcgcgac ccacgcagtt gccgacggcg ccgcagtgat    309960
     ggtcaaagcg cttgacgcag tagccgcact cggtgcagtg cgcggcgcgc gggggacgcc    310020
     atatattgca cgtgcggcac caacgctcgc acttggacca gtcccagcgc gcggcgggct    310080
     cctcgaggtc gtactcgccc cgggacccgg cgttcgacgt cctcgagggc atcctcgccc    310140
     actgtccggt gccggggtcc ctcctgacgc ctcccaactc cggggtgggt ccgtcgatcg    310200
     acgacgtgct cgcgccgagt ccatcgcccg agggtcccgt cctacccgcc gcctccgatt    310260
     ctctccgttc cttctccctc tcctccaacc gcgccaccac cggatcggtt tccttctccg    310320
     ggacgatgat gcccgggtcg aggaagtgcg tcagcgccag gaacgcctcg gtggcgacga    310380
     acagaaccca caccgcgaca cgagcgtggg ctgacacgtt gggatggttc agcggcacgg    310440
     ccagacccac caccgcgcac agagctatcc acagccccaa actgagcggg ggcgcccacc    310500
     gctcctcgca agcgtgtttg tgacggtggg ggctccggcc ggtccggtac tgatcgatca    310560
     ggatatctat tggcaaccgg ggctccccgt cgcgggcatc gtcgccggac tccaggaaag    310620
     gttgtacctc ctccccgggc cctcccagcg gtggggtgct tgcccgcggc tgctgcgcca    310680
     tttactttga cgaggcgggc ttgaatttcg ttgtgttttc cggtccctct attatcaaaa    310740
     ccagaaagat ggaagctagt aggatccgcc cgcgttgacg ggggatcaaa taataataat    310800
     aacgtgtccg tccctcacac gtgcagggcc tcggcgattg gtcgcgcgag cgagaggatc    310860
     tcgaacggct cggtccccct cacagcctcc gcagtcccag ggcacgagtc ggtgaggaaa    310920
     aacttgtaaa agccctgccc gccgcccccc gcgcagaact tcttccagct gttacccggg    310980
     aagacgccgt gcgtgacgta cgcgctcacc ttcaccgcac ccagcctcga gagcagcttc    311040
     tggcactcga tcagggtacc ccccgactgc accaggtcgt cca