(data stored in SCRATCH zone)

EMBL: CP001340

ID   CP001340; SV 1; circular; genomic DNA; STD; PRO; 4042929 BP.
XX
AC   CP001340;
XX
PR   Project:PRJNA32027;
XX
DT   18-JAN-2009 (Rel. 99, Created)
DT   09-NOV-2018 (Rel. 138, Last updated, Version 22)
XX
DE   Caulobacter crescentus NA1000, complete genome.
XX
KW   .
XX
OS   Caulobacter vibrioides NA1000
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Caulobacterales;
OC   Caulobacteraceae; Caulobacter.
XX
RN   [1]
RP   1-4042929
RX   DOI; 10.1128/JB.00255-10.
RX   PUBMED; 20472802.
RA   Marks M.E., Castro-Rojas C.M., Teiling C., Du L., Kapatral V.,
RA   Walunas T.L., Crosson S.;
RT   "The genetic basis of laboratory adaptation in Caulobacter crescentus";
RL   J. Bacteriol. 192(14):3678-3688(2010).
XX
RN   [2]
RP   1-4042929
RA   Marks M.E., Teiling C., Du L., Kapatral V., Walunas T.L., Crosson S.;
RT   ;
RL   Submitted (05-JAN-2009) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Chicago, 929 E. 57th St.,
RL   Chicago, IL 60637, USA
XX
RN   [3]
RC   Protein update by submitter
RP   1-4042929
RA   Marks M.E., Teiling C., Du L., Kapatral V., Walunas T.L., Crosson S.;
RT   ;
RL   Submitted (28-JUL-2010) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Chicago, 929 E. 57th St.,
RL   Chicago, IL 60637, USA
XX
RN   [4]
RC   Protein update by submitter
RP   1-4042929
RA   Marks M.E., Teiling C., Du L., Kapatral V., Walunas T.L., Crosson S.;
RT   ;
RL   Submitted (15-SEP-2010) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Chicago, 929 E. 57th St.,
RL   Chicago, IL 60637, USA
XX
RN   [5]
RC   Protein update by submitter.
RP   1-4042929
RA   Crosson S.;
RT   ;
RL   Submitted (11-OCT-2011) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Chicago, 929 E. 57th St.
RL   - W138, Chicago, IL 60637, USA
XX
RN   [6]
RC   Protein update by submitter
RP   1-4042929
RA   Crosson S.;
RT   ;
RL   Submitted (18-APR-2013) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Chicago, 929 E. 57th St.
RL   - W138, Chicago, IL 60637, USA
XX
RN   [7]
RC   Protein update by submitter
RP   1-4042929
RA   Schrader J., Zhou B., Li G.-W., Lasker K., Long T., Etheredge L., Ely B.,
RA   McAdams H., Weissman J., Shapiro L., Crosson S.;
RT   ;
RL   Submitted (08-FEB-2014) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Chicago, 929 E. 57th St.
RL   - GCIS W138, Chicago, IL 60637, USA
XX
RN   [8]
RC   Protein update by submitter
RP   1-4042929
RA   Schrader J., Viollier P., Radhakrishnan S., Ely B., Crosson S.;
RT   ;
RL   Submitted (03-SEP-2016) to the INSDC.
RL   Biochemistry and Molecular Biology, University of Chicago, 929 E. 57th St.
RL   - GCIS W138, Chicago, IL 60637, USA
XX
DR   MD5; 76698eadefe2043a563ec81e15ee05e4.
DR   BioSample; SAMN02604151.
DR   EnsemblGenomes-Gn; CCNA_R0001.
DR   EnsemblGenomes-Gn; CCNA_R0002.
DR   EnsemblGenomes-Gn; CCNA_R0003.
DR   EnsemblGenomes-Gn; CCNA_R0004.
DR   EnsemblGenomes-Gn; CCNA_R0005.
DR   EnsemblGenomes-Gn; CCNA_R0006.
DR   EnsemblGenomes-Gn; CCNA_R0007.
DR   EnsemblGenomes-Gn; CCNA_R0008.
DR   EnsemblGenomes-Gn; CCNA_R0009.
DR   EnsemblGenomes-Gn; CCNA_R0010.
DR   EnsemblGenomes-Gn; CCNA_R0011.
DR   EnsemblGenomes-Gn; CCNA_R0012.
DR   EnsemblGenomes-Gn; CCNA_R0013.
DR   EnsemblGenomes-Gn; CCNA_R0014.
DR   EnsemblGenomes-Gn; CCNA_R0015.
DR   EnsemblGenomes-Gn; CCNA_R0016.
DR   EnsemblGenomes-Gn; CCNA_R0017.
DR   EnsemblGenomes-Gn; CCNA_R0018.
DR   EnsemblGenomes-Gn; CCNA_R0019.
DR   EnsemblGenomes-Gn; CCNA_R0020.
DR   EnsemblGenomes-Gn; CCNA_R0021.
DR   EnsemblGenomes-Gn; CCNA_R0022.
DR   EnsemblGenomes-Gn; CCNA_R0023.
DR   EnsemblGenomes-Gn; CCNA_R0024.
DR   EnsemblGenomes-Gn; CCNA_R0025.
DR   EnsemblGenomes-Gn; CCNA_R0026.
DR   EnsemblGenomes-Gn; CCNA_R0027.
DR   EnsemblGenomes-Gn; CCNA_R0028.
DR   EnsemblGenomes-Gn; CCNA_R0029.
DR   EnsemblGenomes-Gn; CCNA_R0030.
DR   EnsemblGenomes-Gn; CCNA_R0031.
DR   EnsemblGenomes-Gn; CCNA_R0032.
DR   EnsemblGenomes-Gn; CCNA_R0033.
DR   EnsemblGenomes-Gn; CCNA_R0034.
DR   EnsemblGenomes-Gn; CCNA_R0035.
DR   EnsemblGenomes-Gn; CCNA_R0036.
DR   EnsemblGenomes-Gn; CCNA_R0037.
DR   EnsemblGenomes-Gn; CCNA_R0038.
DR   EnsemblGenomes-Gn; CCNA_R0039.
DR   EnsemblGenomes-Gn; CCNA_R0040.
DR   EnsemblGenomes-Gn; CCNA_R0041.
DR   EnsemblGenomes-Gn; CCNA_R0042.
DR   EnsemblGenomes-Gn; CCNA_R0043.
DR   EnsemblGenomes-Gn; CCNA_R0044.
DR   EnsemblGenomes-Gn; CCNA_R0045.
DR   EnsemblGenomes-Gn; CCNA_R0046.
DR   EnsemblGenomes-Gn; CCNA_R0047.
DR   EnsemblGenomes-Gn; CCNA_R0048.
DR   EnsemblGenomes-Gn; CCNA_R0049.
DR   EnsemblGenomes-Gn; CCNA_R0050.
DR   EnsemblGenomes-Gn; CCNA_R0051.
DR   EnsemblGenomes-Gn; CCNA_R0052.
DR   EnsemblGenomes-Gn; CCNA_R0053.
DR   EnsemblGenomes-Gn; CCNA_R0054.
DR   EnsemblGenomes-Gn; CCNA_R0055.
DR   EnsemblGenomes-Gn; CCNA_R0056.
DR   EnsemblGenomes-Gn; CCNA_R0057.
DR   EnsemblGenomes-Gn; CCNA_R0058.
DR   EnsemblGenomes-Gn; CCNA_R0059.
DR   EnsemblGenomes-Gn; CCNA_R0060.
DR   EnsemblGenomes-Gn; CCNA_R0061.
DR   EnsemblGenomes-Gn; CCNA_R0062.
DR   EnsemblGenomes-Gn; CCNA_R0063.
DR   EnsemblGenomes-Gn; CCNA_R0064.
DR   EnsemblGenomes-Gn; CCNA_R0065.
DR   EnsemblGenomes-Gn; CCNA_R0066.
DR   EnsemblGenomes-Gn; CCNA_R0067.
DR   EnsemblGenomes-Gn; CCNA_R0068.
DR   EnsemblGenomes-Gn; CCNA_R0069.
DR   EnsemblGenomes-Gn; CCNA_R0070.
DR   EnsemblGenomes-Gn; CCNA_R0071.
DR   EnsemblGenomes-Gn; CCNA_R0072.
DR   EnsemblGenomes-Gn; CCNA_R0073.
DR   EnsemblGenomes-Gn; CCNA_R0074.
DR   EnsemblGenomes-Gn; CCNA_R0075.
DR   EnsemblGenomes-Gn; CCNA_R0076.
DR   EnsemblGenomes-Gn; CCNA_R0077.
DR   EnsemblGenomes-Gn; CCNA_R0078.
DR   EnsemblGenomes-Gn; CCNA_R0079.
DR   EnsemblGenomes-Gn; CCNA_R0080.
DR   EnsemblGenomes-Gn; CCNA_R0081.
DR   EnsemblGenomes-Gn; CCNA_R0082.
DR   EnsemblGenomes-Gn; CCNA_R0083.
DR   EnsemblGenomes-Gn; CCNA_R0084.
DR   EnsemblGenomes-Gn; CCNA_R0085.
DR   EnsemblGenomes-Gn; CCNA_R0086.
DR   EnsemblGenomes-Gn; CCNA_R0087.
DR   EnsemblGenomes-Gn; CCNA_R0088.
DR   EnsemblGenomes-Gn; CCNA_R0089.
DR   EnsemblGenomes-Gn; CCNA_R0090.
DR   EnsemblGenomes-Gn; CCNA_R0091.
DR   EnsemblGenomes-Gn; CCNA_R0092.
DR   EnsemblGenomes-Gn; CCNA_R0093.
DR   EnsemblGenomes-Gn; CCNA_R0094.
DR   EnsemblGenomes-Gn; CCNA_R0095.
DR   EnsemblGenomes-Gn; CCNA_R0096.
DR   EnsemblGenomes-Gn; CCNA_R0097.
DR   EnsemblGenomes-Gn; CCNA_R0098.
DR   EnsemblGenomes-Gn; CCNA_R0099.
DR   EnsemblGenomes-Gn; CCNA_R0100.
DR   EnsemblGenomes-Gn; CCNA_R0101.
DR   EnsemblGenomes-Gn; CCNA_R0102.
DR   EnsemblGenomes-Gn; CCNA_R0103.
DR   EnsemblGenomes-Gn; CCNA_R0104.
DR   EnsemblGenomes-Gn; CCNA_R0105.
DR   EnsemblGenomes-Gn; CCNA_R0106.
DR   EnsemblGenomes-Gn; CCNA_R0107.
DR   EnsemblGenomes-Gn; CCNA_R0108.
DR   EnsemblGenomes-Gn; CCNA_R0109.
DR   EnsemblGenomes-Gn; CCNA_R0110.
DR   EnsemblGenomes-Gn; CCNA_R0111.
DR   EnsemblGenomes-Gn; CCNA_R0112.
DR   EnsemblGenomes-Gn; CCNA_R0113.
DR   EnsemblGenomes-Gn; CCNA_R0114.
DR   EnsemblGenomes-Gn; CCNA_R0115.
DR   EnsemblGenomes-Gn; CCNA_R0116.
DR   EnsemblGenomes-Gn; CCNA_R0117.
DR   EnsemblGenomes-Gn; CCNA_R0118.
DR   EnsemblGenomes-Gn; CCNA_R0119.
DR   EnsemblGenomes-Gn; CCNA_R0120.
DR   EnsemblGenomes-Gn; CCNA_R0121.
DR   EnsemblGenomes-Gn; CCNA_R0122.
DR   EnsemblGenomes-Gn; CCNA_R0123.
DR   EnsemblGenomes-Gn; CCNA_R0124.
DR   EnsemblGenomes-Gn; CCNA_R0125.
DR   EnsemblGenomes-Gn; CCNA_R0126.
DR   EnsemblGenomes-Gn; CCNA_R0127.
DR   EnsemblGenomes-Gn; CCNA_R0128.
DR   EnsemblGenomes-Gn; CCNA_R0129.
DR   EnsemblGenomes-Gn; CCNA_R0130.
DR   EnsemblGenomes-Gn; CCNA_R0131.
DR   EnsemblGenomes-Gn; CCNA_R0132.
DR   EnsemblGenomes-Gn; CCNA_R0133.
DR   EnsemblGenomes-Gn; CCNA_R0134.
DR   EnsemblGenomes-Gn; CCNA_R0135.
DR   EnsemblGenomes-Gn; CCNA_R0136.
DR   EnsemblGenomes-Gn; CCNA_R0137.
DR   EnsemblGenomes-Gn; CCNA_R0138.
DR   EnsemblGenomes-Gn; CCNA_R0139.
DR   EnsemblGenomes-Gn; CCNA_R0140.
DR   EnsemblGenomes-Gn; CCNA_R0141.
DR   EnsemblGenomes-Gn; CCNA_R0142.
DR   EnsemblGenomes-Gn; CCNA_R0143.
DR   EnsemblGenomes-Gn; CCNA_R0144.
DR   EnsemblGenomes-Gn; CCNA_R0145.
DR   EnsemblGenomes-Gn; CCNA_R0146.
DR   EnsemblGenomes-Gn; CCNA_R0147.
DR   EnsemblGenomes-Gn; CCNA_R0148.
DR   EnsemblGenomes-Gn; CCNA_R0149.
DR   EnsemblGenomes-Gn; CCNA_R0150.
DR   EnsemblGenomes-Gn; CCNA_R0151.
DR   EnsemblGenomes-Gn; CCNA_R0152.
DR   EnsemblGenomes-Gn; CCNA_R0153.
DR   EnsemblGenomes-Gn; CCNA_R0154.
DR   EnsemblGenomes-Gn; CCNA_R0155.
DR   EnsemblGenomes-Gn; CCNA_R0156.
DR   EnsemblGenomes-Gn; CCNA_R0157.
DR   EnsemblGenomes-Gn; CCNA_R0158.
DR   EnsemblGenomes-Gn; CCNA_R0159.
DR   EnsemblGenomes-Gn; CCNA_R0160.
DR   EnsemblGenomes-Gn; CCNA_R0161.
DR   EnsemblGenomes-Gn; CCNA_R0162.
DR   EnsemblGenomes-Gn; CCNA_R0163.
DR   EnsemblGenomes-Gn; CCNA_R0164.
DR   EnsemblGenomes-Gn; CCNA_R0165.
DR   EnsemblGenomes-Gn; CCNA_R0166.
DR   EnsemblGenomes-Gn; CCNA_R0167.
DR   EnsemblGenomes-Gn; CCNA_R0168.
DR   EnsemblGenomes-Gn; CCNA_R0169.
DR   EnsemblGenomes-Gn; CCNA_R0170.
DR   EnsemblGenomes-Gn; CCNA_R0171.
DR   EnsemblGenomes-Gn; CCNA_R0172.
DR   EnsemblGenomes-Gn; CCNA_R0173.
DR   EnsemblGenomes-Gn; CCNA_R0174.
DR   EnsemblGenomes-Gn; CCNA_R0175.
DR   EnsemblGenomes-Gn; CCNA_R0176.
DR   EnsemblGenomes-Gn; CCNA_R0177.
DR   EnsemblGenomes-Gn; CCNA_R0178.
DR   EnsemblGenomes-Gn; CCNA_R0179.
DR   EnsemblGenomes-Gn; CCNA_R0180.
DR   EnsemblGenomes-Gn; CCNA_R0181.
DR   EnsemblGenomes-Gn; CCNA_R0182.
DR   EnsemblGenomes-Gn; CCNA_R0183.
DR   EnsemblGenomes-Gn; CCNA_R0184.
DR   EnsemblGenomes-Gn; CCNA_R0185.
DR   EnsemblGenomes-Gn; CCNA_R0186.
DR   EnsemblGenomes-Gn; CCNA_R0187.
DR   EnsemblGenomes-Gn; CCNA_R0188.
DR   EnsemblGenomes-Gn; CCNA_R0189.
DR   EnsemblGenomes-Gn; CCNA_R0190.
DR   EnsemblGenomes-Gn; CCNA_R0191.
DR   EnsemblGenomes-Gn; CCNA_R0192.
DR   EnsemblGenomes-Gn; CCNA_R0193.
DR   EnsemblGenomes-Gn; CCNA_R0194.
DR   EnsemblGenomes-Gn; CCNA_R0195.
DR   EnsemblGenomes-Gn; CCNA_R0196.
DR   EnsemblGenomes-Gn; CCNA_R0197.
DR   EnsemblGenomes-Gn; CCNA_R0198.
DR   EnsemblGenomes-Gn; CCNA_R0199.
DR   EnsemblGenomes-Gn; EBG00001009059.
DR   EnsemblGenomes-Gn; EBG00001009060.
DR   EnsemblGenomes-Gn; EBG00001009061.
DR   EnsemblGenomes-Gn; EBG00001009062.
DR   EnsemblGenomes-Gn; EBG00001009063.
DR   EnsemblGenomes-Gn; EBG00001009064.
DR   EnsemblGenomes-Gn; EBG00001009065.
DR   EnsemblGenomes-Gn; EBG00001009066.
DR   EnsemblGenomes-Gn; EBG00001009067.
DR   EnsemblGenomes-Gn; EBG00001009068.
DR   EnsemblGenomes-Gn; EBG00001009069.
DR   EnsemblGenomes-Gn; EBG00001009070.
DR   EnsemblGenomes-Gn; EBG00001009071.
DR   EnsemblGenomes-Gn; EBG00001009072.
DR   EnsemblGenomes-Gn; EBG00001009073.
DR   EnsemblGenomes-Gn; EBG00001009074.
DR   EnsemblGenomes-Gn; EBG00001009075.
DR   EnsemblGenomes-Gn; EBG00001009076.
DR   EnsemblGenomes-Gn; EBG00001009078.
DR   EnsemblGenomes-Gn; EBG00001009079.
DR   EnsemblGenomes-Gn; EBG00001009081.
DR   EnsemblGenomes-Gn; EBG00001009083.
DR   EnsemblGenomes-Gn; EBG00001009085.
DR   EnsemblGenomes-Gn; EBG00001009086.
DR   EnsemblGenomes-Gn; EBG00001009087.
DR   EnsemblGenomes-Gn; EBG00001009088.
DR   EnsemblGenomes-Gn; EBG00001009089.
DR   EnsemblGenomes-Gn; EBG00001009090.
DR   EnsemblGenomes-Gn; EBG00001009091.
DR   EnsemblGenomes-Gn; EBG00001009092.
DR   EnsemblGenomes-Gn; EBG00001009093.
DR   EnsemblGenomes-Gn; EBG00001009095.
DR   EnsemblGenomes-Gn; EBG00001009099.
DR   EnsemblGenomes-Gn; EBG00001009101.
DR   EnsemblGenomes-Gn; EBG00001009104.
DR   EnsemblGenomes-Gn; EBG00001009107.
DR   EnsemblGenomes-Gn; EBG00001009110.
DR   EnsemblGenomes-Gn; EBG00001009111.
DR   EnsemblGenomes-Gn; EBG00001009112.
DR   EnsemblGenomes-Gn; EBG00001009113.
DR   EnsemblGenomes-Gn; EBG00001009114.
DR   EnsemblGenomes-Gn; EBG00001009116.
DR   EnsemblGenomes-Gn; EBG00001009118.
DR   EnsemblGenomes-Gn; EBG00001009120.
DR   EnsemblGenomes-Gn; EBG00001009122.
DR   EnsemblGenomes-Gn; EBG00001009124.
DR   EnsemblGenomes-Gn; EBG00001009125.
DR   EnsemblGenomes-Gn; EBG00001009127.
DR   EnsemblGenomes-Gn; EBG00001009128.
DR   EnsemblGenomes-Gn; EBG00001009129.
DR   EnsemblGenomes-Gn; EBG00001009130.
DR   EnsemblGenomes-Gn; EBG00001009132.
DR   EnsemblGenomes-Gn; EBG00001009135.
DR   EnsemblGenomes-Gn; EBG00001009136.
DR   EnsemblGenomes-Gn; EBG00001009137.
DR   EnsemblGenomes-Gn; EBG00001009138.
DR   EnsemblGenomes-Gn; EBG00001009139.
DR   EnsemblGenomes-Gn; EBG00001009140.
DR   EnsemblGenomes-Gn; EBG00001009141.
DR   EnsemblGenomes-Gn; EBG00001009144.
DR   EnsemblGenomes-Gn; EBG00001009147.
DR   EnsemblGenomes-Gn; EBG00001009150.
DR   EnsemblGenomes-Gn; EBG00001009151.
DR   EnsemblGenomes-Gn; EBG00001009152.
DR   EnsemblGenomes-Gn; EBG00001009153.
DR   EnsemblGenomes-Gn; EBG00001009154.
DR   EnsemblGenomes-Gn; EBG00001009155.
DR   EnsemblGenomes-Gn; EBG00001009156.
DR   EnsemblGenomes-Gn; EBG00001009157.
DR   EnsemblGenomes-Gn; EBG00001009158.
DR   EnsemblGenomes-Gn; EBG00001009159.
DR   EnsemblGenomes-Gn; EBG00001009160.
DR   EnsemblGenomes-Gn; EBG00001009161.
DR   EnsemblGenomes-Gn; EBG00001009162.
DR   EnsemblGenomes-Gn; EBG00001009163.
DR   EnsemblGenomes-Gn; EBG00001009164.
DR   EnsemblGenomes-Gn; EBG00001009165.
DR   EnsemblGenomes-Gn; EBG00001009168.
DR   EnsemblGenomes-Gn; EBG00001009169.
DR   EnsemblGenomes-Gn; EBG00001009170.
DR   EnsemblGenomes-Gn; EBG00001009171.
DR   EnsemblGenomes-Tr; CCNA_R0001-1.
DR   EnsemblGenomes-Tr; CCNA_R0002-1.
DR   EnsemblGenomes-Tr; CCNA_R0003-1.
DR   EnsemblGenomes-Tr; CCNA_R0004-1.
DR   EnsemblGenomes-Tr; CCNA_R0005-1.
DR   EnsemblGenomes-Tr; CCNA_R0006-1.
DR   EnsemblGenomes-Tr; CCNA_R0007-1.
DR   EnsemblGenomes-Tr; CCNA_R0008-1.
DR   EnsemblGenomes-Tr; CCNA_R0009-1.
DR   EnsemblGenomes-Tr; CCNA_R0010-1.
DR   EnsemblGenomes-Tr; CCNA_R0011-1.
DR   EnsemblGenomes-Tr; CCNA_R0012-1.
DR   EnsemblGenomes-Tr; CCNA_R0013-1.
DR   EnsemblGenomes-Tr; CCNA_R0014-1.
DR   EnsemblGenomes-Tr; CCNA_R0015-1.
DR   EnsemblGenomes-Tr; CCNA_R0016-1.
DR   EnsemblGenomes-Tr; CCNA_R0017-1.
DR   EnsemblGenomes-Tr; CCNA_R0018-1.
DR   EnsemblGenomes-Tr; CCNA_R0019-1.
DR   EnsemblGenomes-Tr; CCNA_R0020-1.
DR   EnsemblGenomes-Tr; CCNA_R0021-1.
DR   EnsemblGenomes-Tr; CCNA_R0022-1.
DR   EnsemblGenomes-Tr; CCNA_R0023-1.
DR   EnsemblGenomes-Tr; CCNA_R0024-1.
DR   EnsemblGenomes-Tr; CCNA_R0025-1.
DR   EnsemblGenomes-Tr; CCNA_R0026-1.
DR   EnsemblGenomes-Tr; CCNA_R0027-1.
DR   EnsemblGenomes-Tr; CCNA_R0028-1.
DR   EnsemblGenomes-Tr; CCNA_R0029-1.
DR   EnsemblGenomes-Tr; CCNA_R0030-1.
DR   EnsemblGenomes-Tr; CCNA_R0031-1.
DR   EnsemblGenomes-Tr; CCNA_R0032-1.
DR   EnsemblGenomes-Tr; CCNA_R0033-1.
DR   EnsemblGenomes-Tr; CCNA_R0034-1.
DR   EnsemblGenomes-Tr; CCNA_R0035-1.
DR   EnsemblGenomes-Tr; CCNA_R0036-1.
DR   EnsemblGenomes-Tr; CCNA_R0037-1.
DR   EnsemblGenomes-Tr; CCNA_R0038-1.
DR   EnsemblGenomes-Tr; CCNA_R0039-1.
DR   EnsemblGenomes-Tr; CCNA_R0040-1.
DR   EnsemblGenomes-Tr; CCNA_R0041-1.
DR   EnsemblGenomes-Tr; CCNA_R0042-1.
DR   EnsemblGenomes-Tr; CCNA_R0043-1.
DR   EnsemblGenomes-Tr; CCNA_R0044-1.
DR   EnsemblGenomes-Tr; CCNA_R0045-1.
DR   EnsemblGenomes-Tr; CCNA_R0046-1.
DR   EnsemblGenomes-Tr; CCNA_R0047-1.
DR   EnsemblGenomes-Tr; CCNA_R0048-1.
DR   EnsemblGenomes-Tr; CCNA_R0049-1.
DR   EnsemblGenomes-Tr; CCNA_R0050-1.
DR   EnsemblGenomes-Tr; CCNA_R0051-1.
DR   EnsemblGenomes-Tr; CCNA_R0052-1.
DR   EnsemblGenomes-Tr; CCNA_R0053-1.
DR   EnsemblGenomes-Tr; CCNA_R0054-1.
DR   EnsemblGenomes-Tr; CCNA_R0055-1.
DR   EnsemblGenomes-Tr; CCNA_R0056-1.
DR   EnsemblGenomes-Tr; CCNA_R0057-1.
DR   EnsemblGenomes-Tr; CCNA_R0058-1.
DR   EnsemblGenomes-Tr; CCNA_R0059-1.
DR   EnsemblGenomes-Tr; CCNA_R0060-1.
DR   EnsemblGenomes-Tr; CCNA_R0061-1.
DR   EnsemblGenomes-Tr; CCNA_R0062-1.
DR   EnsemblGenomes-Tr; CCNA_R0063-1.
DR   EnsemblGenomes-Tr; CCNA_R0064-1.
DR   EnsemblGenomes-Tr; CCNA_R0065-1.
DR   EnsemblGenomes-Tr; CCNA_R0066-1.
DR   EnsemblGenomes-Tr; CCNA_R0067-1.
DR   EnsemblGenomes-Tr; CCNA_R0068-1.
DR   EnsemblGenomes-Tr; CCNA_R0069-1.
DR   EnsemblGenomes-Tr; CCNA_R0070-1.
DR   EnsemblGenomes-Tr; CCNA_R0071-1.
DR   EnsemblGenomes-Tr; CCNA_R0072-1.
DR   EnsemblGenomes-Tr; CCNA_R0073-1.
DR   EnsemblGenomes-Tr; CCNA_R0074-1.
DR   EnsemblGenomes-Tr; CCNA_R0075-1.
DR   EnsemblGenomes-Tr; CCNA_R0076-1.
DR   EnsemblGenomes-Tr; CCNA_R0077-1.
DR   EnsemblGenomes-Tr; CCNA_R0078-1.
DR   EnsemblGenomes-Tr; CCNA_R0079-1.
DR   EnsemblGenomes-Tr; CCNA_R0080-1.
DR   EnsemblGenomes-Tr; CCNA_R0081-1.
DR   EnsemblGenomes-Tr; CCNA_R0082-1.
DR   EnsemblGenomes-Tr; CCNA_R0083-1.
DR   EnsemblGenomes-Tr; CCNA_R0084-1.
DR   EnsemblGenomes-Tr; CCNA_R0085-1.
DR   EnsemblGenomes-Tr; CCNA_R0086-1.
DR   EnsemblGenomes-Tr; CCNA_R0087-1.
DR   EnsemblGenomes-Tr; CCNA_R0088-1.
DR   EnsemblGenomes-Tr; CCNA_R0089-1.
DR   EnsemblGenomes-Tr; CCNA_R0090-1.
DR   EnsemblGenomes-Tr; CCNA_R0091-1.
DR   EnsemblGenomes-Tr; CCNA_R0092-1.
DR   EnsemblGenomes-Tr; CCNA_R0093-1.
DR   EnsemblGenomes-Tr; CCNA_R0094-1.
DR   EnsemblGenomes-Tr; CCNA_R0095-1.
DR   EnsemblGenomes-Tr; CCNA_R0096-1.
DR   EnsemblGenomes-Tr; CCNA_R0097-1.
DR   EnsemblGenomes-Tr; CCNA_R0098-1.
DR   EnsemblGenomes-Tr; CCNA_R0099-1.
DR   EnsemblGenomes-Tr; CCNA_R0100-1.
DR   EnsemblGenomes-Tr; CCNA_R0101-1.
DR   EnsemblGenomes-Tr; CCNA_R0102-1.
DR   EnsemblGenomes-Tr; CCNA_R0103-1.
DR   EnsemblGenomes-Tr; CCNA_R0104-1.
DR   EnsemblGenomes-Tr; CCNA_R0105-1.
DR   EnsemblGenomes-Tr; CCNA_R0106-1.
DR   EnsemblGenomes-Tr; CCNA_R0107-1.
DR   EnsemblGenomes-Tr; CCNA_R0108-1.
DR   EnsemblGenomes-Tr; CCNA_R0109-1.
DR   EnsemblGenomes-Tr; CCNA_R0110-1.
DR   EnsemblGenomes-Tr; CCNA_R0111-1.
DR   EnsemblGenomes-Tr; CCNA_R0112-1.
DR   EnsemblGenomes-Tr; CCNA_R0113-1.
DR   EnsemblGenomes-Tr; CCNA_R0114-1.
DR   EnsemblGenomes-Tr; CCNA_R0115-1.
DR   EnsemblGenomes-Tr; CCNA_R0116-1.
DR   EnsemblGenomes-Tr; CCNA_R0117-1.
DR   EnsemblGenomes-Tr; CCNA_R0118-1.
DR   EnsemblGenomes-Tr; CCNA_R0119-1.
DR   EnsemblGenomes-Tr; CCNA_R0120-1.
DR   EnsemblGenomes-Tr; CCNA_R0121-1.
DR   EnsemblGenomes-Tr; CCNA_R0122-1.
DR   EnsemblGenomes-Tr; CCNA_R0123-1.
DR   EnsemblGenomes-Tr; CCNA_R0124-1.
DR   EnsemblGenomes-Tr; CCNA_R0125-1.
DR   EnsemblGenomes-Tr; CCNA_R0126-1.
DR   EnsemblGenomes-Tr; CCNA_R0127-1.
DR   EnsemblGenomes-Tr; CCNA_R0128-1.
DR   EnsemblGenomes-Tr; CCNA_R0129-1.
DR   EnsemblGenomes-Tr; CCNA_R0130-1.
DR   EnsemblGenomes-Tr; CCNA_R0131-1.
DR   EnsemblGenomes-Tr; CCNA_R0132-1.
DR   EnsemblGenomes-Tr; CCNA_R0133-1.
DR   EnsemblGenomes-Tr; CCNA_R0134-1.
DR   EnsemblGenomes-Tr; CCNA_R0135-1.
DR   EnsemblGenomes-Tr; CCNA_R0136-1.
DR   EnsemblGenomes-Tr; CCNA_R0137-1.
DR   EnsemblGenomes-Tr; CCNA_R0138-1.
DR   EnsemblGenomes-Tr; CCNA_R0139-1.
DR   EnsemblGenomes-Tr; CCNA_R0140-1.
DR   EnsemblGenomes-Tr; CCNA_R0141-1.
DR   EnsemblGenomes-Tr; CCNA_R0142-1.
DR   EnsemblGenomes-Tr; CCNA_R0143-1.
DR   EnsemblGenomes-Tr; CCNA_R0144-1.
DR   EnsemblGenomes-Tr; CCNA_R0145-1.
DR   EnsemblGenomes-Tr; CCNA_R0146-1.
DR   EnsemblGenomes-Tr; CCNA_R0147-1.
DR   EnsemblGenomes-Tr; CCNA_R0148-1.
DR   EnsemblGenomes-Tr; CCNA_R0149-1.
DR   EnsemblGenomes-Tr; CCNA_R0150-1.
DR   EnsemblGenomes-Tr; CCNA_R0151-1.
DR   EnsemblGenomes-Tr; CCNA_R0152-1.
DR   EnsemblGenomes-Tr; CCNA_R0153-1.
DR   EnsemblGenomes-Tr; CCNA_R0154-1.
DR   EnsemblGenomes-Tr; CCNA_R0155-1.
DR   EnsemblGenomes-Tr; CCNA_R0156-1.
DR   EnsemblGenomes-Tr; CCNA_R0157-1.
DR   EnsemblGenomes-Tr; CCNA_R0158-1.
DR   EnsemblGenomes-Tr; CCNA_R0159-1.
DR   EnsemblGenomes-Tr; CCNA_R0160-1.
DR   EnsemblGenomes-Tr; CCNA_R0161-1.
DR   EnsemblGenomes-Tr; CCNA_R0162-1.
DR   EnsemblGenomes-Tr; CCNA_R0163-1.
DR   EnsemblGenomes-Tr; CCNA_R0164-1.
DR   EnsemblGenomes-Tr; CCNA_R0165-1.
DR   EnsemblGenomes-Tr; CCNA_R0166-1.
DR   EnsemblGenomes-Tr; CCNA_R0167-1.
DR   EnsemblGenomes-Tr; CCNA_R0168-1.
DR   EnsemblGenomes-Tr; CCNA_R0169-1.
DR   EnsemblGenomes-Tr; CCNA_R0170-1.
DR   EnsemblGenomes-Tr; CCNA_R0171-1.
DR   EnsemblGenomes-Tr; CCNA_R0172-1.
DR   EnsemblGenomes-Tr; CCNA_R0173-1.
DR   EnsemblGenomes-Tr; CCNA_R0174-1.
DR   EnsemblGenomes-Tr; CCNA_R0175-1.
DR   EnsemblGenomes-Tr; CCNA_R0176-1.
DR   EnsemblGenomes-Tr; CCNA_R0177-1.
DR   EnsemblGenomes-Tr; CCNA_R0178-1.
DR   EnsemblGenomes-Tr; CCNA_R0179-1.
DR   EnsemblGenomes-Tr; CCNA_R0180-1.
DR   EnsemblGenomes-Tr; CCNA_R0181-1.
DR   EnsemblGenomes-Tr; CCNA_R0182-1.
DR   EnsemblGenomes-Tr; CCNA_R0183-1.
DR   EnsemblGenomes-Tr; CCNA_R0184-1.
DR   EnsemblGenomes-Tr; CCNA_R0185-1.
DR   EnsemblGenomes-Tr; CCNA_R0186-1.
DR   EnsemblGenomes-Tr; CCNA_R0187-1.
DR   EnsemblGenomes-Tr; CCNA_R0188-1.
DR   EnsemblGenomes-Tr; CCNA_R0189-1.
DR   EnsemblGenomes-Tr; CCNA_R0190-1.
DR   EnsemblGenomes-Tr; CCNA_R0191-1.
DR   EnsemblGenomes-Tr; CCNA_R0192-1.
DR   EnsemblGenomes-Tr; CCNA_R0193-1.
DR   EnsemblGenomes-Tr; CCNA_R0194-1.
DR   EnsemblGenomes-Tr; CCNA_R0195-1.
DR   EnsemblGenomes-Tr; CCNA_R0196-1.
DR   EnsemblGenomes-Tr; CCNA_R0197-1.
DR   EnsemblGenomes-Tr; CCNA_R0198-1.
DR   EnsemblGenomes-Tr; CCNA_R0199-1.
DR   EnsemblGenomes-Tr; EBT00001534448.
DR   EnsemblGenomes-Tr; EBT00001534453.
DR   EnsemblGenomes-Tr; EBT00001534458.
DR   EnsemblGenomes-Tr; EBT00001534463.
DR   EnsemblGenomes-Tr; EBT00001534473.
DR   EnsemblGenomes-Tr; EBT00001534476.
DR   EnsemblGenomes-Tr; EBT00001534482.
DR   EnsemblGenomes-Tr; EBT00001534485.
DR   EnsemblGenomes-Tr; EBT00001534489.
DR   EnsemblGenomes-Tr; EBT00001534495.
DR   EnsemblGenomes-Tr; EBT00001534500.
DR   EnsemblGenomes-Tr; EBT00001534505.
DR   EnsemblGenomes-Tr; EBT00001534511.
DR   EnsemblGenomes-Tr; EBT00001534520.
DR   EnsemblGenomes-Tr; EBT00001534528.
DR   EnsemblGenomes-Tr; EBT00001534540.
DR   EnsemblGenomes-Tr; EBT00001534543.
DR   EnsemblGenomes-Tr; EBT00001534549.
DR   EnsemblGenomes-Tr; EBT00001534553.
DR   EnsemblGenomes-Tr; EBT00001534556.
DR   EnsemblGenomes-Tr; EBT00001534563.
DR   EnsemblGenomes-Tr; EBT00001534566.
DR   EnsemblGenomes-Tr; EBT00001534573.
DR   EnsemblGenomes-Tr; EBT00001534577.
DR   EnsemblGenomes-Tr; EBT00001534579.
DR   EnsemblGenomes-Tr; EBT00001534582.
DR   EnsemblGenomes-Tr; EBT00001534584.
DR   EnsemblGenomes-Tr; EBT00001534587.
DR   EnsemblGenomes-Tr; EBT00001534594.
DR   EnsemblGenomes-Tr; EBT00001534598.
DR   EnsemblGenomes-Tr; EBT00001534600.
DR   EnsemblGenomes-Tr; EBT00001534603.
DR   EnsemblGenomes-Tr; EBT00001534608.
DR   EnsemblGenomes-Tr; EBT00001534614.
DR   EnsemblGenomes-Tr; EBT00001534617.
DR   EnsemblGenomes-Tr; EBT00001534621.
DR   EnsemblGenomes-Tr; EBT00001534623.
DR   EnsemblGenomes-Tr; EBT00001534628.
DR   EnsemblGenomes-Tr; EBT00001534630.
DR   EnsemblGenomes-Tr; EBT00001534634.
DR   EnsemblGenomes-Tr; EBT00001534635.
DR   EnsemblGenomes-Tr; EBT00001534640.
DR   EnsemblGenomes-Tr; EBT00001534643.
DR   EnsemblGenomes-Tr; EBT00001534648.
DR   EnsemblGenomes-Tr; EBT00001534651.
DR   EnsemblGenomes-Tr; EBT00001534658.
DR   EnsemblGenomes-Tr; EBT00001534661.
DR   EnsemblGenomes-Tr; EBT00001534665.
DR   EnsemblGenomes-Tr; EBT00001534671.
DR   EnsemblGenomes-Tr; EBT00001534673.
DR   EnsemblGenomes-Tr; EBT00001534677.
DR   EnsemblGenomes-Tr; EBT00001534680.
DR   EnsemblGenomes-Tr; EBT00001534685.
DR   EnsemblGenomes-Tr; EBT00001534687.
DR   EnsemblGenomes-Tr; EBT00001534690.
DR   EnsemblGenomes-Tr; EBT00001534693.
DR   EnsemblGenomes-Tr; EBT00001534696.
DR   EnsemblGenomes-Tr; EBT00001534699.
DR   EnsemblGenomes-Tr; EBT00001534703.
DR   EnsemblGenomes-Tr; EBT00001534707.
DR   EnsemblGenomes-Tr; EBT00001534709.
DR   EnsemblGenomes-Tr; EBT00001534714.
DR   EnsemblGenomes-Tr; EBT00001534716.
DR   EnsemblGenomes-Tr; EBT00001534720.
DR   EnsemblGenomes-Tr; EBT00001534725.
DR   EnsemblGenomes-Tr; EBT00001534728.
DR   EnsemblGenomes-Tr; EBT00001534731.
DR   EnsemblGenomes-Tr; EBT00001534734.
DR   EnsemblGenomes-Tr; EBT00001534737.
DR   EnsemblGenomes-Tr; EBT00001534740.
DR   EnsemblGenomes-Tr; EBT00001534742.
DR   EnsemblGenomes-Tr; EBT00001534745.
DR   EnsemblGenomes-Tr; EBT00001534751.
DR   EnsemblGenomes-Tr; EBT00001534755.
DR   EnsemblGenomes-Tr; EBT00001534758.
DR   EnsemblGenomes-Tr; EBT00001534761.
DR   EnsemblGenomes-Tr; EBT00001534766.
DR   EnsemblGenomes-Tr; EBT00001534770.
DR   EnsemblGenomes-Tr; EBT00001534773.
DR   EnsemblGenomes-Tr; EBT00001534777.
DR   EnsemblGenomes-Tr; EBT00001534780.
DR   EuropePMC; PMC2897358; 20472802.
DR   EuropePMC; PMC3073932; 21494595.
DR   EuropePMC; PMC3764195; 24039597.
DR   EuropePMC; PMC3845142; 24218615.
DR   EuropePMC; PMC4117421; 25078267.
DR   EuropePMC; PMC4137073; 25048541.
DR   EuropePMC; PMC4702786; 26476443.
DR   EuropePMC; PMC5056096; 27647925.
DR   EuropePMC; PMC5869019; 29537368.
DR   EuropePMC; PMC5978003; 29606352.
DR   EuropePMC; PMC6148470; 30012732.
DR   EuropePMC; PMC6299973; 30567498.
DR   EuropePMC; PMC6530869; 31075103.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01068; mini-ykkC.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01519; CC0196.
DR   RFAM; RF01520; CC0734.
DR   RFAM; RF01521; CC1840.
DR   RFAM; RF01527; CC3510.
DR   RFAM; RF01528; CC3513.
DR   RFAM; RF01529; CC3552.
DR   RFAM; RF01530; CC3664.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001340.
DR   SILVA-SSU; CP001340.
XX
CC   Bacterial strain Caulobacter crescentus NA1000 and source genomic
CC   DNA are available from Crosson Lab, Department of Biochemistry and
CC   Molecular Biology, The University of Chicago, 929 E. 57th St.,
CC   Chicago, IL 60637.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4042929
FT                   /organism="Caulobacter vibrioides NA1000"
FT                   /strain="NA1000"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:565050"
FT   gene            complement(1..182)
FT                   /locus_tag="CCNA_R0094"
FT   ncRNA           complement(1..182)
FT                   /locus_tag="CCNA_R0094"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            202..1107
FT                   /locus_tag="CCNA_00001"
FT   CDS_pept        202..1107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00001"
FT                   /product="ATP/GTP-binding protein"
FT                   /EC_number="2.7.-.-"
FT                   /note="CC_0001"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93468"
FT                   /db_xref="GOA:A0A0H3C520"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C520"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93468.1"
FT                   /translation="MVKQPLTDDPQESLAQGESERLPPRFATYFHIHLVSDSTGETLNA
FT                   MARAVCARFTDILPIEHIYALVRSTRQLDRALEEIAGAPGVVMHTIVDPGLRAALEEGC
FT                   RKLEMPCIAALDPVISAMSRYLGARISTRVGAQHALTNDYFDRIEALDYAIAHDDGQGG
FT                   QDLTQADVILVGVSRTSKTPTCIYLAHRGVRAANVPLVPGRPPPPELFELKNTLIVGLI
FT                   TSPDRLIQIRRNRLLSLKENRESDYVDADAVRQEIIAARRLFERQNWPVIDITRRSVEE
FT                   TAAAVINLLSGGRGKVEVLG"
FT   gene            1104..1703
FT                   /locus_tag="CCNA_00002"
FT   CDS_pept        1104..1703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00002"
FT                   /product="septum formation protein Maf"
FT                   /note="CC_0002"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93469"
FT                   /db_xref="GOA:A0A0H3C5Q9"
FT                   /db_xref="InterPro:IPR003697"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Q9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93469.1"
FT                   /translation="MSLTPVTLASQSSARQMILKNAGVAFEAVSPGVDEDAAKAGLLAE
FT                   DVTPRDIADALAEMKAVKVSTKRPGLVIGADQTLDLKGRLIDKAGSLDEARARLLELRG
FT                   TTHKLHSAVVVARDGRPIWRIVESAKLSVRPFSDAWLDRYIERRGEALLWSVGCYELES
FT                   EGVQLFDKIEGDYFTILGLPLVGLLDFLRLHGALTV"
FT   gene            1700..2557
FT                   /locus_tag="CCNA_00003"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        1700..2557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00003"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /EC_number="1.1.1.25"
FT                   /note="CC_0003"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93470"
FT                   /db_xref="GOA:B8GWW0"
FT                   /db_xref="InterPro:IPR006151"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWW0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93470.1"
FT                   /translation="MTNAITGAAIVGGVCGQPIKHSMSPVIHNAWIAAAGLDAAYVPFA
FT                   PAADRFETFVDGLRGGAVRGLNVTIPFKERALAVADTASDLARMAGAANLLVFNEDGSV
FT                   HADNTDGPGLLGAIAIQAPGFDVTAAPVVILGAGGAARGAVAALLLAGAPRIAVVNRTV
FT                   ARAQDLADTFGEKVVAKGEDALPALLPEAGLIINATSLGLGGGAGPSADLTLTPKTAVV
FT                   MDMVYKPLRTEFLRRAEAAGRRTVDGLEMLLRQAIPTFETIYGQAPSPKIDVRVLALKL
FT                   LGEV"
FT   gene            2559..3158
FT                   /locus_tag="CCNA_00004"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        2559..3158
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00004"
FT                   /product="dephospho-CoA kinase"
FT                   /EC_number="2.7.1.24"
FT                   /note="CC_0004"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00004"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93471"
FT                   /db_xref="GOA:A0A0H3C2I0"
FT                   /db_xref="InterPro:IPR001977"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2I0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93471.1"
FT                   /translation="MLILGLTGSIGMGKSTTSKMFQDEGVPVYDADAAVHALYASGGAA
FT                   VAPVETAFPGVVVDGAIDRAKLSAQVVGNSEALAKLEAIVHPLVGAHRIGFFEQAKAEG
FT                   HEIVVLDIPLLFETGGEKRVDKVVVVSAPAEVQRERVLARPEMTPEKFEAILARQTPDA
FT                   DKRARADFVIDTGQGLDHARRQVRDLLTLLRTARSA"
FT   gene            3190..3903
FT                   /gene="dnaQ"
FT                   /locus_tag="CCNA_00005"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        3190..3903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaQ"
FT                   /locus_tag="CCNA_00005"
FT                   /product="DNA polymerase III, epsilon chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="CC_0005"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93472"
FT                   /db_xref="GOA:A0A0H3C3K6"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3K6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93472.1"
FT                   /translation="MAREIILDTETTGFDPKTGDRLVEIGCIEVVDFMPTGRSFHEYCD
FT                   PLRDMPAEAEKVHGLSSAFLTGKPKFHEIADRFLDFVGDSVVVAHNAAFDRQFVNFELE
FT                   KCGKAPIHEERWVDTLAMAKKRFPGMYNSLDALCKRFKISLESRDKHGALIDAHLLAEV
FT                   YLELQGGKERALELTHSTGAMAVSTAIQGVYAARSRPLAPRSTDAEREIHAAWVRKNLK
FT                   DKALWIQFGVVAAEA"
FT   gene            4022..4810
FT                   /locus_tag="CCNA_00006"
FT   CDS_pept        4022..4810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00006"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="4.2.1.17"
FT                   /note="CC_0006"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93473"
FT                   /db_xref="GOA:A0A0H3C490"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C490"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93473.1"
FT                   /translation="MAQFQTLIVEAPESAPGVTLIRLNRPEALNALNTALLGELAQALA
FT                   AAQADDSVGCIVLTGSAKAFAAGADIKEMSDKTYAQMFKADFFTAGARAIEQCRKPIIA
FT                   AVAGYALGGGCELAMMCDFILAADTAKFGQPEINLGVAPGIGGTQRLTRFVGKSKAMDM
FT                   ILTGRMMGAEEAERSGLVSRIFPADSLVDETLAIAAKIAGQSPLAVAMNKELVEAAYET
FT                   TLTTGVALERRLFHSLFAFEDQKEGMTAFVEKRKPLFKGA"
FT   gene            complement(4292..4950)
FT                   /locus_tag="CCNA_R0095"
FT   ncRNA           complement(4292..4950)
FT                   /locus_tag="CCNA_R0095"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            4960..5235
FT                   /locus_tag="CCNA_00007"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        4960..5235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00007"
FT                   /product="SSU ribosomal protein S20P"
FT                   /note="CC_0007"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93474"
FT                   /db_xref="GOA:B8GWW4"
FT                   /db_xref="InterPro:IPR002583"
FT                   /db_xref="InterPro:IPR036510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWW4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93474.2"
FT                   /translation="MANNPGAKKAIRKIARRTEVNTARRSRVRTFLRKFEDAIAKGDVA
FT                   VAKAAFVEAQSELMRAVSKGVVHPNTGSRKVSRLAARLKKLDKAAA"
FT   gene            5636..7108
FT                   /gene="dnaA"
FT                   /locus_tag="CCNA_00008"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        5636..7108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /locus_tag="CCNA_00008"
FT                   /product="chromosome replication initiator protein DnaA"
FT                   /note="CC_0008"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93475"
FT                   /db_xref="GOA:B8GWW5"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWW5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93475.1"
FT                   /translation="MTMKGGVASQDFSAAIATACEPAANVWSKVCVALKRELGDAAFGS
FT                   WIAPAMLREAATGDVVLVTSTGIARDWIRRSAWRRIGELWAAHDATGRRIDLKSRLEFE
FT                   AAAGAYVEATPKAVAAEPIEIVLPVSTDAPTVVAPSAKSPRTQGLQERFTFETFVPGPA
FT                   NEFAHAVARRIANWADGHFNPVLFHGPYGFGKTHLLNALAWEAMRNAPEKRVVYLTAER
FT                   FLSTFVRAVMDRQTAAFKEELRAADLLIIDDVHFIAGKQSTQEELFHTLTALVGEGGRV
FT                   VFSADRPPSAMTEMDAHLRSHLSAGLVCGLEPADRNLRLGILERKIQTLGAAHGFEPSI
FT                   RPEVMQFLADRFTDSVRELEGALNTLSARAGEGLSRMTLDEVQAILRPHLRSGEKRITI
FT                   DDIQKATAEHYGMKQADLLSERRNRAVARPRQAAMWLAKQLTTRSLPDIGRRFGGRDHT
FT                   TVLHAVRRIEALRAEDSALSHDLETLTRKLRG"
FT   gene            complement(7170..7790)
FT                   /gene="alkB"
FT                   /locus_tag="CCNA_00009"
FT   CDS_pept        complement(7170..7790)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="alkB"
FT                   /locus_tag="CCNA_00009"
FT                   /product="alkylated DNA repair protein AlkB"
FT                   /note="CC_0009"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93476"
FT                   /db_xref="GOA:B8GWW6"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWW6"
FT                   /protein_id="ACL93476.1"
FT                   /translation="MIAKPLTVVPGFDVWPGLLDISAQRALVEAVLAGAEQAPFSNYRT
FT                   AYGKPMSVAMTALGSLGWTSDARGYRYVDRHPETGRPWPDMPPALLDLWTVLGDPETPP
FT                   DSCLVNLYRDGARMGLHQDRDEADPRFPVLSISLGDTAVFRIGGVNRKDPTRSLRLASG
FT                   DVCRLLGPARLAFHGVDRILPGSSSLVPGGGRINLTLRRARTA"
FT   gene            8165..10060
FT                   /gene="dnaK"
FT                   /locus_tag="CCNA_00010"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        8165..10060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaK"
FT                   /locus_tag="CCNA_00010"
FT                   /product="chaperone protein DnaK"
FT                   /note="CC_0010"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93477"
FT                   /db_xref="GOA:A0A0H3C527"
FT                   /db_xref="InterPro:IPR012725"
FT                   /db_xref="InterPro:IPR013126"
FT                   /db_xref="InterPro:IPR018181"
FT                   /db_xref="InterPro:IPR029047"
FT                   /db_xref="InterPro:IPR029048"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C527"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93477.1"
FT                   /translation="MSKIIGIDLGTTNSCVAIMDGKTPKVIENAEGARTTPSVVAFLED
FT                   GERLIGQPAKRQAVTNPTNTLFAIKRLIGRTASDPVVEKDKGMVPYEIVKGPTGDAWVK
FT                   AHGKDYSPQEVSAFILQKMKEAAEAHLGEPVTKAVITVPAYFNDAQRQATKDAGKIAGL
FT                   EVLRIINEPTAAALAYGLDKNDGKKIAVYDLGGGTFDVSILEIGDGVFEVKSTNGDTFL
FT                   GGEDFDLRIVDYLADEFKKEQGVDLRKDKLALQRLREEAEKAKKELSSTAQYEVNLPFI
FT                   SMNASGPLHLNIKLSRAKLEALVDDLIARTIGPCEQALKDAGLKKSDIDEVILVGGMSR
FT                   MPKVQQAVQDFFGREPHKGVNPDEVVALGAAVQAGVLQGDVKDVLLLDVTPLTLGIETL
FT                   GGVFTPLIERNTTIPTKRSQTFSTADDNQSAVTIRVFQGERPMAQDNKMLGQFDLVGIP
FT                   PAPRGVPQIEVTFDIDANGIVQVHAKDKATNKEHSIRIQANGGLSDSDIERMVKEAEAN
FT                   KAADEKKKQLVEAKNQGEAILHSTEKALAEHGDKVGAAEKTAIETGITELKTALEGEDV
FT                   EAIQAKTQALIQASMKLGEAMYAAQQGSAEGGDAKADDGVVDAEFEEVDDNKPAA"
FT   gene            10223..11380
FT                   /gene="dnaJ"
FT                   /locus_tag="CCNA_00011"
FT   CDS_pept        10223..11380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaJ"
FT                   /locus_tag="CCNA_00011"
FT                   /product="chaperone protein DnaJ"
FT                   /note="CC_0011"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93478"
FT                   /db_xref="GOA:A0A0H3C5R3"
FT                   /db_xref="InterPro:IPR001305"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR002939"
FT                   /db_xref="InterPro:IPR008971"
FT                   /db_xref="InterPro:IPR012724"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR036410"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5R3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93478.1"
FT                   /translation="MRDYYEILGVTRTIDEAGLKSAFRKLAMEHHPDRNGGCENAAGRF
FT                   KEINEAYSVLSDPQKRAAYDRFGHAGVNGPQGGPGGFGGQGFDASDIFNDVFGDVFGEM
FT                   FGGGRRQSNAPQRGQDLRYDLEITLEQAYAGAEVEITVPAAMTCEVCEGSGAKPGTSPS
FT                   VCGTCGGAGRVRATQGFFAVERGCPRCGGSGRLVLDPCSNCHGHGQVRRERILSVRIPA
FT                   GVDDGARIRLAGEGDAGARGGPRGDLYIFLSVTPHELFERDGLDLLCTVPVPMTTAALG
FT                   GEIDAPCLLGGESCDGECKVKVHVPEGAQTGKTVRLKGKGMPSLRSRQRGDLVVELFVE
FT                   TPTHLSARQKELMRELAGLCGEKQNPKSANFVGKAKRFWEEVTGS"
FT   gene            11467..14178
FT                   /gene="mutS"
FT                   /locus_tag="CCNA_00012"
FT   CDS_pept        11467..14178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mutS"
FT                   /locus_tag="CCNA_00012"
FT                   /product="DNA mismatch repair protein MutS"
FT                   /note="CC_0012"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93479"
FT                   /db_xref="GOA:A0A0H3C2I6"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR005748"
FT                   /db_xref="InterPro:IPR007695"
FT                   /db_xref="InterPro:IPR007696"
FT                   /db_xref="InterPro:IPR007860"
FT                   /db_xref="InterPro:IPR007861"
FT                   /db_xref="InterPro:IPR016151"
FT                   /db_xref="InterPro:IPR017261"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="InterPro:IPR036678"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2I6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93479.1"
FT                   /translation="MNAHATPTPAHEIDPTGATPVMAQFFEMKARQPDALIFFRMGDFY
FT                   ELFFDDAYKAAAALGISQTFRGTHNGQPIPMAGVPQHAAEAYLSKLIRLGFKVAVCEQM
FT                   EDPAEAKKRGSKAVVRRDIVRVVTPGTLTEDGLLDARGANRLAAVALRAGQAAVASVEL
FT                   STGEVEVLAVAKEGVAPILAALAPSETLVADRLLSDDSLSQTLRICGGLVQPMPSALSE
FT                   PQASETRVKRLYGVETLDGFGGLSPAEIGALGLIAAHLEMTQAGRLPALRAPRRAADAD
FT                   VMAIDPATRSSLEIDRTQSGDRNGSLLAAIDRTVTAGGARMLASRLARPLLDVAAIDQR
FT                   LDAVEWFVEHRQLRQRLREVLKGAGDMARALSRLALGRGGPRDLGCIRDTLKVGERLAG
FT                   MAGGAPDPLSPPPFELEHAFKALTPALHEGLSQFLTTLEHGLGPDLPALARDGGFVAAG
FT                   VRPELDQARGLRDDSRKVIAALESQLALESGVPLKIRHNGVLGYFVEATAGKADPLFQP
FT                   PLNATFIHRQTLANQVRFTTVELADLDARIAQAAERALAMEVAAFEDWREQARLLADAI
FT                   QIASEALARIDVASSLAEWAEDAGAVRPVVDASYAFDAKAARHPVVEAAVKRAGEPYTP
FT                   NDCRLDASGETAARLSIVTGPNMAGKSTFLRQNALLAILAQSGCYVPAASFRLGVVDRL
FT                   FSRVGAGDDLARGRSTFMMEMVETASILTQAGPRSLVILDEIGRGTATYDGLAIAWACA
FT                   EALHDTNRCRALFATHYHELATLETRMAFVSNLSLRAKEWNGDLVFLHEAAPGPADRSY
FT                   GVQVAKLAGVPAPVVVRAREVLDRLESKDQSPAKLDDLPLFAVSQAVAVTSAPAKAAPS
FT                   AVETSLADLDVDGMSPREALEALYRLKGLLTA"
FT   gene            13417..13499
FT                   /locus_tag="CCNA_R0096"
FT   ncRNA           13417..13499
FT                   /locus_tag="CCNA_R0096"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            14199..17021
FT                   /gene="glnD"
FT                   /locus_tag="CCNA_00013"
FT   CDS_pept        14199..17021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnD"
FT                   /locus_tag="CCNA_00013"
FT                   /product="protein-PII uridylyltransferase"
FT                   /EC_number="2.7.7.59"
FT                   /note="CC_0013"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93480"
FT                   /db_xref="GOA:B8GWX0"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR010043"
FT                   /db_xref="InterPro:IPR013546"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWX0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93480.1"
FT                   /translation="MPRRLRPTRLEHVVDGHALRARLSAAALDSIGNEAEQRARAIDIL
FT                   KQALFRGRMIAKERLENGASGVETSRLLSGVTDEVITALYDFTTVHVFRARNPTEGERL
FT                   CLLAVGGYGRGTLAPFSDIDLLFLRPYKQTPHAESVIEYMLYALWDLGFKVGHASRTIE
FT                   ECVRLSKEDFTIRTSILEARRLTGDERLAEDLKKRFRDEVMKATGAQFVAAKLKERDDR
FT                   QARAGASRYMVEPNVKEGKGGLRDLHTLMWIAEYLHPVDRPEDVFKMEVFSIRETKAFI
FT                   RAFDFLHAVRAHLHFTTGRPEERLTFDLQPEIARRMGYGDRGDAPAVERFMRRYFLIAK
FT                   EVGTLTRAFSAKLEAEHFKNEPKGISRFLPGARPKRKALDVEGFYEDGGRLNIEGQEIF
FT                   EADPVNLIRLFKIADERDLDLHPDAFTAVTRALPLITSRVRRDPDACRAFLDLLARGKR
FT                   SYRTLTLMNDAGVLGRFIPEFGRVVAQMQFNMYHSYTVDEHTLRAVGVIGDIAAGRLVD
FT                   DHPLAVSIMPLIEDREALFLAMLLHDTGKGGVGGQEKAGARSARSACERLGVERSKVEL
FT                   VAWLVENHLVMSDFAQKRDVSDPGTVAAFARIVENPERLRLLLVITVADIRAVGPGVWN
FT                   GWKGQLLRELYNATEAVFRGGRGSDAAANVQRHQESTAEAARAALLETDPAAKGWVAAM
FT                   ENAYFSAFSQDDLFHHAELARRAAIQGGAAAEGQVRPGSNAAEVVIAAKDRRGLFADLA
FT                   LAISSLGGNVVGARVFTSRQGQALDVFYVQDVTGAPFGCENPRALRRLADALEAAGKGD
FT                   ALAVEPRRGSEQTRAAAFAIAPSVTIDNDASNDATVVEASGRDRPGLLHALAKTLADSA
FT                   LSIQSAHIDGYGERAVDAFYVQTTEGGKVTDTRKLNALKADLLAALEQNEASAPAARPG
FT                   LRRARASVAR"
FT   gene            complement(17018..17494)
FT                   /gene="moaC"
FT                   /locus_tag="CCNA_00014"
FT   CDS_pept        complement(17018..17494)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="CCNA_00014"
FT                   /product="molybdenum cofactor biosynthesis protein C"
FT                   /note="CC_0014"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93481"
FT                   /db_xref="GOA:B8GWX1"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWX1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93481.1"
FT                   /translation="MSKLTHIDDQGRARMVDVSEKPATAREAVAAGFVRMSAETLALAI
FT                   SGSGRKGDVRAVAELAGVMAAKKTSDLIPLCHPLALSKVEVAVEPADGGLSVTARVKTT
FT                   GPTGVEMEALTAASVACLTIYDMLKAAEKGMVIEAVRLLEKTGGKSGDWKADQP"
FT   gene            complement(17491..18042)
FT                   /gene="moaB"
FT                   /locus_tag="CCNA_00015"
FT   CDS_pept        complement(17491..18042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaB"
FT                   /locus_tag="CCNA_00015"
FT                   /product="molybdenum cofactor biosynthesis protein B"
FT                   /note="CC_0015"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93482"
FT                   /db_xref="GOA:A0A0H3C3L0"
FT                   /db_xref="InterPro:IPR001453"
FT                   /db_xref="InterPro:IPR008284"
FT                   /db_xref="InterPro:IPR012245"
FT                   /db_xref="InterPro:IPR013484"
FT                   /db_xref="InterPro:IPR036425"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3L0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93482.1"
FT                   /translation="MSEALKPGGGIKPDLPFTPVRVAVLTITDTRDEASDTSGQILVER
FT                   IKAAGHELGGRVVVRDDIEQIRAQVRSWIDSKTVDAIVTTGGTGLTGRDVTVEALEPLF
FT                   DKKIDGFSVVFHLVSYASVGLSTLQSRATAGLIESVFVFCLPGSNGAVKDGWDKVIAAQ
FT                   LDSRHKPCNMVELMPRLLER"
FT   gene            complement(18043..18495)
FT                   /gene="moaE"
FT                   /locus_tag="CCNA_00016"
FT   CDS_pept        complement(18043..18495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaE"
FT                   /locus_tag="CCNA_00016"
FT                   /product="molybdopterin converting factor, large subunit"
FT                   /note="CC_0016"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93483"
FT                   /db_xref="GOA:A0A0H3C497"
FT                   /db_xref="InterPro:IPR003448"
FT                   /db_xref="InterPro:IPR036563"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C497"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93483.1"
FT                   /translation="MIVTLTDQPFEPGVLVSAFCAGREETGAVATFIGLARAEQGAARA
FT                   LELEAYPGFTDAAITEIAQGAVTRFALQDVHIVHRVGVIAPGEAIVFVATAAAHRREAF
FT                   EACDYLMDYLKSRAPFWKKEHGPEGPRWIEPTARDRTDAQRWDQEA"
FT   gene            complement(18492..18731)
FT                   /gene="moaD"
FT                   /locus_tag="CCNA_00017"
FT   CDS_pept        complement(18492..18731)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaD"
FT                   /locus_tag="CCNA_00017"
FT                   /product="molybdopterin converting factor, small subunit"
FT                   /note="CC_0017"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93484"
FT                   /db_xref="InterPro:IPR003749"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR016155"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C533"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93484.1"
FT                   /translation="MARVLLFGRLADQAGWREREIEAADLSTLRASLSQADPVLGEALA
FT                   GPGVQVAVDKTIVRGEAALSAASEVAFLPPMSGG"
FT   gene            complement(18735..19784)
FT                   /gene="moaA"
FT                   /locus_tag="CCNA_00018"
FT   CDS_pept        complement(18735..19784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="CCNA_00018"
FT                   /product="molybdenum cofactor biosynthesis protein A"
FT                   /note="CC_0018"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93485"
FT                   /db_xref="GOA:A0A0H3C5R8"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013483"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5R8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93485.1"
FT                   /translation="MTPYDDSPAQAVSTAPRTTGPSLIDGFGRAVTYLRVSVTDRCDLR
FT                   CVYCMAEHMTFLPKAEVLTLEELDRLASTFVGLGVRKLRLTGGEPLVRKGFIGLVARLS
FT                   RHLSSGALDELTLTTNGSQLERYASDLARHGVRRINVSLDTLKPALFRALTRGGDVTRV
FT                   IAGIDAAQAAGMTVKINAVALKHDNAGEIPALIQWAHGRGCDITLIETMPLGEVDQDRT
FT                   DQFLSLQDVRRDLSSFWTLTDIPDSTGGPARYVHVAETGGRLGLITPLSNHFCDTCNRV
FT                   RLTCTGTLHTCLGRDDASDLRAEIRRGASDAELVDAIHLAIGAKPKGHDFQIAAAQPAV
FT                   ARHMSTTGG"
FT   gene            19815..20447
FT                   /locus_tag="CCNA_00019"
FT   CDS_pept        19815..20447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00019"
FT                   /product="molybdopterin-guanine dinucleotide biosynthesis
FT                   protein A"
FT                   /note="CC_0019"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93486"
FT                   /db_xref="InterPro:IPR025877"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2J2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93486.1"
FT                   /translation="MTQRDTGRLDAIVLAAGRGVRFGGGKLTALLDGDPLVAAALLTAF
FT                   LAPARRVVVAVGPEPDVRQAVEATATRLLARERLVLVPIDDPSAGMGASLAAAARSLPG
FT                   DTDGVFVFLGDMPRIDPATPRHLAAALRDPGDIVAPTYLGRRGHPVLFGARWAPVLGAL
FT                   SGDEGARAIVDKAGESLVLVPVDDPGVHLDVDRPSDLARVQTDRRTL"
FT   gene            complement(20444..20668)
FT                   /locus_tag="CCNA_00020"
FT   CDS_pept        complement(20444..20668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00020"
FT                   /product="hypothetical protein"
FT                   /note="CC_0020"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93487"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3L3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93487.1"
FT                   /translation="MKAGPDAEADALGDEEDIAMFVQALAGVNMDYRRVLSLLIPRLAA
FT                   LEERGDTAGAVRLIQEIQAIINAPERPEH"
FT   gene            complement(20665..20778)
FT                   /locus_tag="CCNA_03911"
FT   CDS_pept        complement(20665..20778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03911"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03911"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IZ92"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88513.1"
FT                   /translation="MVERMRAALGERICVRRDASRRKRTRAHQGSRREIRP"
FT   gene            complement(20840..23032)
FT                   /locus_tag="CCNA_00021"
FT   CDS_pept        complement(20840..23032)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00021"
FT                   /product="putative aerobic-type carbon monoxide
FT                   dehydrogenase, large subunit CoxL"
FT                   /EC_number="1.2.5.2"
FT                   /note="CC_0021"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93488"
FT                   /db_xref="GOA:A0A0H3C4A2"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4A2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93488.1"
FT                   /translation="MNAPVDPKGLKAIQPSRRDVVVASTMVGGALLVGCSPADLMSAGS
FT                   KVEVGAFGPFIKIAPDGVVTVISKHIEFGQGNHAGLAAIVAEELDADWSKVKVEQAPAN
FT                   AKLYANGNMGAQLTGGSSAISNSWDQLRKAGAGARAMFVQAAANRWNVPVGEITVKDSV
FT                   LAHTSGKTAIFGELLSDAAKVNPPTDPKLKDPKAFTLIGSDRVRRKDSQAKSDGTALYT
FT                   QDVRLPDMLTAMVAHPPRFGGKVKSFDATEAKKVAGVVEVFEIPTGIAVVAQNTYAARM
FT                   GREALKVEWDEEKAEKRGSPAIIQGYRDVLSGKDASVKWEPFDQRGDAAALETAKGADV
FT                   VELNYEFPYLAHATMEPMNCVAAVDGNKVKLTFGSQGQTLDQLNVAKVVGCLPGSVEIE
FT                   TLFAGGSFGRRATFQSDYAVECVHIAKKVGKGRPVKLVWTREDDMRSGYFRPIVLHALK
FT                   VKLDKDGLPAAWRHRIVTQSIMKGAPMPMGKGPDSSAFEGINDSPYLKATPVVDAQVAF
FT                   PDIGVPVLWWRSVGATHTAFVMEHTIDQLAAKAGKDPVAYRRAIYTKAGAERHLAVLNL
FT                   ALEKAGPKATAGWTRGVAVHESFGSVVAQIAEVKLENGAPRVGRVVTAIDCGVAISPDQ
FT                   IAAQMEGGTCYGLSAALFGEVTLTDGQVDQTNFDGYRVLRINEAPSVETHIVPSGNPPS
FT                   GVGEPGTPVIAPAVANALFALNKAATSRLPFVRSEA"
FT   gene            complement(23029..23559)
FT                   /locus_tag="CCNA_00022"
FT   CDS_pept        complement(23029..23559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00022"
FT                   /product="putative aerobic-type carbon monoxide
FT                   dehydrogenase, small subunit CoxS"
FT                   /EC_number="1.2.5.2"
FT                   /note="CC_0022"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93489"
FT                   /db_xref="GOA:A0A0H3C536"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C536"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93489.1"
FT                   /translation="MAMTLDINGKPVSVQAAPETPLLWVLRDELGMTGTKFGCGLAQCG
FT                   ACTVHMDGQPIRSCVTPIEAVGAAKVTTIEGLGGQHPVQQAWVRHDVPQCGYCQSGQIM
FT                   SACALLAQKPKPSDQDIDEAMAGNICRCGAYQRIRAAIKDAADFGPPTGEAHADIDEAI
FT                   VAASGATHRGAGR"
FT   gene            23742..24074
FT                   /locus_tag="CCNA_00023"
FT   CDS_pept        23742..24074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00023"
FT                   /product="putative periplasmic protein"
FT                   /note="CC_0023"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93490"
FT                   /db_xref="InterPro:IPR018660"
FT                   /db_xref="InterPro:IPR036328"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5S3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93490.2"
FT                   /translation="MQGVRVMRRIVIVVAIVSAALAGCATVAPMDATDAPIRYSCKAGK
FT                   RFTAAYALHGKRVVVSAGGVTKTLKLARSASGARYTAGQAEIWSKGDDAALTGFPGGPY
FT                   DACRSQ"
FT   gene            24091..24981
FT                   /locus_tag="CCNA_00024"
FT   CDS_pept        24091..24981
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00024"
FT                   /product="uroporphyrin-III C-methyltransferase/Precorrin-2
FT                   dehydrogenase/Sirohydrochlorin ferrochelatase"
FT                   /EC_number="2.1.1.107"
FT                   /note="CC_0024"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93491"
FT                   /db_xref="GOA:A0A0H3C2J6"
FT                   /db_xref="InterPro:IPR006367"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR019478"
FT                   /db_xref="InterPro:IPR028161"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2J6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93491.1"
FT                   /translation="MDSFPAFFPLAGRKVVIAGSGEAAEAKARLFDGSPATLVRLDGHA
FT                   AYLPGSYSGAAFAFIASSDEVFVQAAAGAARAARVLVNVVDRPELCDFNTPAVIDRGQV
FT                   VAAVGTGGGAPVLATMLRNDIEAQVPEGTGRVAALLAKFQTEVRKTLPALHERRAFLRD
FT                   AVMGEAAAAAREGDMDRAGQLFREALAKGGARKGVVRFIAGKGPADLLTLRALRALGSA
FT                   DVLVLDGDVEPEVLKMARRDAERLDADGADAPHLIQLAREGRQIVRLITHPVDPALVHA
FT                   LTQAEVAVEVLPVAT"
FT   gene            complement(24991..26643)
FT                   /locus_tag="CCNA_00025"
FT   CDS_pept        complement(24991..26643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00025"
FT                   /product="major facilitator superfamily transporter"
FT                   /note="CC_0025"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93492"
FT                   /db_xref="GOA:A0A0H3C3L7"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3L7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93492.1"
FT                   /translation="MAEEGQKRASMRTVVSASSAGTAFEWYDFFIFGSLTQVISKTFFA
FT                   GLNETAGYIAALALFGVGFAFRPLGALVFGKIGDQDGRKGAFLATVLLMGGATFAIAFL
FT                   PTYEQAGIIAPILLIILRCLQGFALGGEYGGAAIYVAEHSPANKRGWATSWVQTSAAFG
FT                   LFGALLVILATRWVLGKYVGPDAFDEWGWRIPFAVSLGLLGISVWMRLKLTESPTFEAM
FT                   KAEGQASKAPYAEAFGQWSNLKLVILAFVSMMCAQGAVWYTSFFYVQTFMEKFLKVDPV
FT                   TINELMMIATAVSAIFYVVFGWLSDKVGRKPVMLGGMTLALLFYFPGFHLLEKAANPAL
FT                   AEASAKAPVVVFADPKDCSLQFDPVGKTAFVTSCDIVKSTLANAGVSYANEAAPAGAVA
FT                   VMRIGGAEVLSKSAAGLGKDEVKATKAEVEGRIKAALAGAGYPTKADPARMNMPMILGV
FT                   LFVFVIAATALFGPLAACLVELFPTRVRYTALSLPYHIGTGWVGGFVPFFAFAIVAAVG
FT                   NIYAGLWYPFAFTLLSVLTTLFLLPETKERPLN"
FT   gene            complement(26701..29403)
FT                   /locus_tag="CCNA_00026"
FT   CDS_pept        complement(26701..29403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00026"
FT                   /product="PAS-family sensor histidine kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0026"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93493"
FT                   /db_xref="GOA:A0A0H3C4A7"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4A7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93493.1"
FT                   /translation="MSQASTPEPAPASSFGEGEAARWFFDNASDLFTVISAEGRFISVN
FT                   DAWSHLTGWARDELVGQPTIKFVHPDSQAELVDTGRRLRQTGSAINELKIRCKDGRWIW
FT                   LQGRSRLGPHGEMVGVMHDISAEVEARLELEAARRTQALLAEKAGIGVWSYEPETQRID
FT                   WAPDALALMGVSPEDIATPELFLARLPENHRAEVQAAFVHAARTGEGGTLEYRLRANDG
FT                   RWFTLRATYRTEARPGSGFALKGVSQNITDVARSRDKAIWSERRARRLIEDAPFAVAVY
FT                   DVDMRLRMVSPRFLEIFRSTEAQVIGKTLTELTNGTRRRFVNRVARALSGEVVTRREDR
FT                   LYDAEGVERAFRWEARPWRDVAGEIVGVITYMDEITALTEARREARNNARRLKVALGAA
FT                   RAGVYEIDHEKQAFWGSPEFHRMMGRRIEYQDVREGIWPMVHPEDLTQLYETAATWRRE
FT                   GRRTPQEHEVRLLSPGGEARWARVFHEVRRDGQGKALKAVGLILDIDEKKKAELALIEA
FT                   ERAAQAANEAKAQFLANMSHEIRTPMNGVLGVMHVLKRELPPGDSASLLNEALAAGQML
FT                   STLLDDVIDISRIEAGRLDLNHEPVDPRDLVRGVARLLATQAAHKGLRLELDLPDDLGW
FT                   IETDPTRVRQALFNLIGNAVKFTLKGSVTVRAQRRITDAGPYLVFDIIDTGVGVPLEAQ
FT                   KRLFERFQQADAGTTRRFGGSGLGLAITRKLARMLGGEVSFRSVPGEGSTFSLTIAAPP
FT                   VGPPSAQAGETSELLTSLKVLVVEDNPTNQLVARRILEQLGAEVSVADDGAAGVEAAER
FT                   GRFDLILMDVQMPGMDGLEAARRIRALPGPAGRAPIIALTANVMAHQRAAYRAAGMDGV
FT                   AAKPISPAALVAEILRLSRIEPDPRCAVA"
FT   gene            complement(29502..30191)
FT                   /locus_tag="CCNA_00027"
FT   CDS_pept        complement(29502..30191)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00027"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="CC_0027"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93494"
FT                   /db_xref="GOA:A0A0H3C539"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR006620"
FT                   /db_xref="InterPro:IPR023550"
FT                   /db_xref="InterPro:IPR041097"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C539"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93494.1"
FT                   /translation="MPMMLQIPEVLTKAQVAECRAILDAGPWVDGNVTSGFQAAMAKNN
FT                   EQLPQDSAEARHVGAIIVQALEANPLFVSAALPRTILSPMFNRYGEGMGFRDHVDNAIR
FT                   RDPVTGQRLRTDLSCTLFLAEPEDYDGGELVVNDLYGDHVVKLAAGDAILYPSTSLHHV
FT                   TTVTRGRRTASFFWIQSLIRDDARRSLLLDMDVAIQQLSRKVERDDEAILSLTGVYHNL
FT                   LRQWAEV"
FT   gene            complement(30271..30354)
FT                   /locus_tag="CCNA_R0097"
FT   ncRNA           complement(30271..30354)
FT                   /locus_tag="CCNA_R0097"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(30337..32658)
FT                   /locus_tag="CCNA_00028"
FT   CDS_pept        complement(30337..32658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00028"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0028"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93495"
FT                   /db_xref="GOA:A0A0H3C5S7"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR030148"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5S7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="ribosome profiling evidence for a possible
FT                   non-canonical translation start site at nucleotide position
FT                   32667"
FT                   /protein_id="ACL93495.2"
FT                   /translation="MRNPNFTGVVSRPRRALSIAAVAGVAGLGLAQAAVAGPDSADAAV
FT                   TTANADDRSVSSVTIDAKRVADPSSSKFTAPLVDTPKSVTVIPAKIIEQTAATSLADIL
FT                   RTSPGITFGAGEGGQPLADRPFIRGQASANNVFVDGVRDSGGQVREIFNLEQVEVVKGP
FT                   DSAYGGRGSGGGSINLSSKSPKADSFARGSVGVGTDAYVRATADLNHALNESVAVRLNL
FT                   LATQGDTPGRKSVSFDRWGVAPSLAIGLDGDTQLTASYYHLEGDQTPDYGVPLLTKTTQ
FT                   PRTASGILDVDRRSFYGVASRDYQKTKSDIATFAIDHRIDETLNLRQVVRYSKSLNDYI
FT                   VTNPGDGGAAQFVQGQWWMKRGTKTRWNPTETVAAVTDLHGKKTFLGLEHSFDVGLELS
FT                   REENLNATYSTFTTSGAACPTGFTIAATTLASLGAGDCTLVYKPNDKDAWTGVINRAPA
FT                   ARNVAKTTALYGFDTVKFGEKVLLNLGLRHDRYESKGVDVATTQANGVFTSVTYTPRSG
FT                   SWAFTNYQVGLVYKPTPGSSLYVSYSTASTPPGISAGDQNSNTATGTGNLATVQLEPED
FT                   SESFEAGAKANVFHDTLALSAALFQTSRKNAQIQIDATTYAQVGEVEVKGFEFGVSGNI
FT                   TPKWQVFGGYTYMDSELVRGAYTSVNQGDPLANTPKHSISSFTTYKVTRKIALGGGAYH
FT                   VSKSFGGNQGGAGGGASRIYAPAYWRYDAFASWAVSTGVDLQLNIQNLTDERYIARTNG
FT                   VHHADPAPGRQAILTINVKY"
FT   gene            32914..33546
FT                   /locus_tag="CCNA_00029"
FT   CDS_pept        32914..33546
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00029"
FT                   /product="lysine exporter protein"
FT                   /note="CC_0029"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93496"
FT                   /db_xref="GOA:A0A0H3C2K2"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2K2"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93496.1"
FT                   /translation="MPEAKTWIAFTLVCLSMALTPGPNMLYLVSRSICQGRWAGIVSLI
FT                   GTAAGFVVYLLCAALGITALLMAAPIAYDLLRFGGALYLAWLAWQAIRPGGASPFQVRE
FT                   LPKDSPAKLITMGFVTNMLNPKAAMLYLSLLPQFIKPEHGGVFTQSLALGLTQICVSLT
FT                   VNGVICLAAGTIAGFLAARPGFALVQRWLMATVLGGLAVRMATEARR"
FT   gene            33595..34329
FT                   /locus_tag="CCNA_00030"
FT   CDS_pept        33595..34329
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00030"
FT                   /product="ribonuclease T2"
FT                   /EC_number="3.1.27.-"
FT                   /note="CC_0030"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93497"
FT                   /db_xref="GOA:A0A0H3C3L9"
FT                   /db_xref="InterPro:IPR001568"
FT                   /db_xref="InterPro:IPR018188"
FT                   /db_xref="InterPro:IPR036430"
FT                   /db_xref="InterPro:IPR039378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3L9"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93497.1"
FT                   /translation="MESPMKTVPAAILAAALALTAAAAEASSLQACAVPKAVTPAPTEI
FT                   PPPDEIHPNVPIAAYLLALYWSPEACRAGIPESDKAIQCEANRFGFTVHGLWPNGPDRV
FT                   HPRYCRSSPPMRVKTVKANLCMTPSPWLLQHEWQAHGTCNWKTPEAYFKKTRQIRERLD
FT                   VPDLDPGADGTMTAGEIRQAFIARNPGVPAQGLNVRIKQGRLTEVWVCMDLKFKWAACR
FT                   GGNGPADAVVAAVTPRASPGQQ"
FT   gene            complement(34312..34698)
FT                   /gene="vapC"
FT                   /locus_tag="CCNA_00031"
FT   CDS_pept        complement(34312..34698)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapC"
FT                   /locus_tag="CCNA_00031"
FT                   /product="toxin protein VapC"
FT                   /note="CC_0031"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93498"
FT                   /db_xref="GOA:A0A0H3C4B2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4B2"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93498.1"
FT                   /translation="MAYVLDTNVAIHLRDGDPEVTTRVTALNGAILLSIISRVELEGGV
FT                   YREAAQAGLRRSRLDVMLKVLPVLDFDGAAADEYRRIVESAGYSRRKVVDRMIAAQALA
FT                   HRATFVTFNADDFRDIPGLSLLAW"
FT   gene            complement(34699..34941)
FT                   /gene="vapB"
FT                   /locus_tag="CCNA_00032"
FT   CDS_pept        complement(34699..34941)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="vapB"
FT                   /locus_tag="CCNA_00032"
FT                   /product="antitoxin protein VapB"
FT                   /note="CC_0032"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93499"
FT                   /db_xref="GOA:A0A0H3C543"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C543"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93499.1"
FT                   /translation="MMARATGKTFRSGNSEAVRLPRDLAFGADVELTLIRSGDVLTIYP
FT                   SKGSIADLVATLNQMPRPDSVEIRDEDLFPERPGL"
FT   gene            complement(35047..35667)
FT                   /locus_tag="CCNA_03912"
FT   CDS_pept        complement(35047..35667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03912"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03912"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88514"
FT                   /db_xref="GOA:A0A0H3J1G0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3J1G0"
FT                   /protein_id="AHI88514.1"
FT                   /translation="MDGLLTHAGWIAAGLVSAGIAVILRSKTRALDAQVLGERPRTYAR
FT                   RRAKLQAEITSRAMYLPVAVMLFALAAVWPPPEVQRVSGKPVEMRSWSRLVVMPDGSQY
FT                   TFVCGSRSSRCSRSDKESWDRLPRWPEPNHVEMLVSGHEINSLIMDGQLIVNRPPDDER
FT                   FGFVMIGFGLLAYVMVSISLRAFKLRKIPLRARGRSRASPETP"
FT   gene            complement(35824..37962)
FT                   /gene="pnp"
FT                   /locus_tag="CCNA_00033"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(35824..37962)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pnp"
FT                   /locus_tag="CCNA_00033"
FT                   /product="polyribonucleotide nucleotidyltransferase"
FT                   /EC_number="2.7.7.8"
FT                   /note="CC_0034"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93500"
FT                   /db_xref="GOA:B8GWZ0"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR004088"
FT                   /db_xref="InterPro:IPR012162"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR015848"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="InterPro:IPR036456"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWZ0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93500.1"
FT                   /translation="MFDIKRKTIEWGGKTLVLETGRIARQADGAVLATMGETVVLATAV
FT                   FAKSQKPGQDFFPLTVNYQEKTFAAGKIPGGFFKREGRPSEKETLVSRLIDRPIRPLFV
FT                   KGFKNEVQVVVTVLQHDLENDPDILGMVAASAALCLSGAPFMGPIGAARVGWVDGAYVL
FT                   NPTLDEMKESKMDLVVAGTADAVMMVESEIQELSEEIVLGGVNFAHQQMQAVIDAIIDL
FT                   AEHAAKEPFAFEPEDTDAIKAKMKDLVGADIAAAYKIQKKQDRYEAVGAAKKKAIAALG
FT                   LSDENPTGYDPLKLGAIFKELEADVVRRGILDTGLRIDGRDVKTVRPILGEVGILPRTH
FT                   GSALFTRGETQAIVVATLGTGDDEQFIDALEGTYKESFLLHYNFPPYSVGETGRMGSPG
FT                   RREIGHGKLAWRALRPMLPTKEDFPYTIRLVSEITESNGSSSMATVCGSSLAMMDAGVP
FT                   LVRPVSGIAMGLILEQDGFAVLSDILGDEDHLGDMDFKVAGTSEGLTSLQMDIKIAGIT
FT                   PAIMEQALAQAKEGRAHILGEMNKAMDAPRADVGDFAPKIETINIPTDKIREVIGSGGK
FT                   VIREIVATTGAKVDINDDGVVKVSASDGAKIKAAIDWIKSITDEAEVGKIYDGKVVKVV
FT                   DFGAFVNFFGAKDGLVHVSQISNERVAKPSDVLKEGQMVKVKLLGFDDRGKTKLSMKVV
FT                   DQETGEDLSKKEAAAEEA"
FT   gene            complement(38211..38480)
FT                   /locus_tag="CCNA_00034"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(38211..38480)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00034"
FT                   /product="SSU ribosomal protein S15P"
FT                   /note="CC_0035"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93501"
FT                   /db_xref="GOA:B8GWZ1"
FT                   /db_xref="InterPro:IPR000589"
FT                   /db_xref="InterPro:IPR005290"
FT                   /db_xref="InterPro:IPR009068"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWZ1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93501.1"
FT                   /translation="MSITLERKAALIAEHARSTGDTGSAEVQVAILSERIANLTEHFKT
FT                   HKKDNHSRRGLLKLVSQRRRLLDHLKKSDAARYQSLIEKLGLRR"
FT   gene            complement(38495..39427)
FT                   /locus_tag="CCNA_00035"
FT   CDS_pept        complement(38495..39427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00035"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="CC_0036"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93502"
FT                   /db_xref="GOA:A0A0H3C5T2"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5T2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93502.1"
FT                   /translation="MARRKKGDAVSGWLCLDKPYDLTSTTAVSRVRRAFNAQKGGHAGT
FT                   LDPLATGILPIALGEATKTVPFLMDADKAYRFTIAWGRDTTTLDREGETTGTSDVRPTR
FT                   EQVEAALPAFIGEVDQIPPNFSAIKVDGERAYDLARDGVEFELPTRKVSIFDLKVVDQP
FT                   DADHVTLTMECGKGTYVRAVVRDLAKALGTCGHVADLRRTRVGGFSEASAIALETLENL
FT                   SYEARLSEALLPVETALDDIPALAVTDEDAFRLAQGRAIVLLPRQVETLKAELPPGDRT
FT                   VSAMSGDRLVALCEMRAGKLNPVRVFQLT"
FT   gene            complement(39430..39879)
FT                   /locus_tag="CCNA_00036"
FT   CDS_pept        complement(39430..39879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00036"
FT                   /product="ribosome-binding factor A"
FT                   /note="CC_0037"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93503"
FT                   /db_xref="GOA:B8GWZ3"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GWZ3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93503.1"
FT                   /translation="MKRQSDPKKGALTGPSQRQLRAGELIRHALVEILREEELQDEALQ
FT                   NISVTVSEVRMSPDLKHAICFVEPLGAGLTGQDTTDIIKGLNRVSKFLRGRLGRSIDMK
FT                   FTPDLKFIHDESFGTAAYMDKLFLDPRVQQDTRRLSDVVDDEDEA"
FT   gene            complement(39980..40768)
FT                   /locus_tag="CCNA_00037"
FT   CDS_pept        complement(39980..40768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00037"
FT                   /product="esterase lipase family protein"
FT                   /EC_number="3.1.1.-"
FT                   /note="CC_0038"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93504"
FT                   /db_xref="GOA:A0A0H3C2K6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2K6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93504.1"
FT                   /translation="MADDKVLAGFERFDFDDGRWSREVYKIGSGPAVIVIHEVPGLHPG
FT                   VLAFARDLAQAGLTAYCPSLFGKPGKKVSRGYAIGEILKNICVRREFSVWKDGRSSPIV
FT                   DWLRALARQVHADCGGKGVGAVGMCFTGGFALAMMTEPSVVAPVLSQPSLPFKDRGGLD
FT                   CSASEIACAKKRFQDENLSLIAMRFTSDKLVPDARIARLKAEFGDKVEVVELADADAAP
FT                   GQPMAPHSVLTLHLHRSVPTSGSMRARDKVIAFFKERAGG"
FT   gene            complement(40828..41403)
FT                   /locus_tag="CCNA_00038"
FT   CDS_pept        complement(40828..41403)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00038"
FT                   /product="hypothetical protein"
FT                   /note="CC_0039"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3M3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93505.1"
FT                   /translation="MRRSIVRSAVLAVAMIGATSSTAHAETRMFSYDPISADAKRLTGA
FT                   GVTILFKDGLLGASRPLKVLATGVPAQAMLKPARSKDLGPGGLSAISGVDANAALYAVD
FT                   TSAAQGKIYLRAFCPGSTRLWLSFSPIAVRRDLRIQAFGDDPKASGQARLCGTLDFSYR
FT                   GEWRLPDNRTPDPMSDWTDNPQRPDVSN"
FT   gene            complement(41403..41921)
FT                   /locus_tag="CCNA_00039"
FT   CDS_pept        complement(41403..41921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00039"
FT                   /product="hypothetical protein"
FT                   /note="CC_0040"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93506"
FT                   /db_xref="InterPro:IPR021330"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4C3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93506.1"
FT                   /translation="MRMRLKAILALTAVAASLSACATVDRLDAGGDVHDLLVAIRDNDR
FT                   AAFDAHVDRRALKGQIEARLMAEARQRAGQNDGVIALAAIAAGPLANAAGEALIRPETF
FT                   RAAANYYGYTPDRPIPGRVAIAAALRPTGDGRVCAARKDGPCLMTFTREGDRWRLSGFD
FT                   ASAANLRGK"
FT   gene            complement(41960..42511)
FT                   /locus_tag="CCNA_00040"
FT   CDS_pept        complement(41960..42511)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00040"
FT                   /product="YcxB-like membrane protein"
FT                   /note="CC_0041"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93507"
FT                   /db_xref="GOA:A0A0H3C547"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C547"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93507.2"
FT                   /translation="MEVNGIIPLGEMAQASGELIKRQIGWRRYAYCAYLGLLVSCAVIW
FT                   MNTPGVLGLDWESAFGGLAVTAVLVTSGYLWWARSMLPASWKRMGAPPQTTVSYQLDEQ
FT                   TLTVSTGGGVRTVMPWTVVQAIWRSSDAWLIVVGTLAYVVPHRFLGDAAAEQSFLAFCL
FT                   DRLSPEARNRSPDLIAQVQR"
FT   gene            complement(42585..45614)
FT                   /locus_tag="CCNA_00041"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(42585..45614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00041"
FT                   /product="protein translation initiation factor 2 IF-2"
FT                   /note="CC_0042"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93508"
FT                   /db_xref="GOA:A0A0H3C5T8"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR013575"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5T8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93508.2"
FT                   /translation="MSDENENGRPGGRTPMTLKPRQGSVSAGVVKQSFSHGRTKTVVVE
FT                   TKRTRTHAPASGNLAAPSSAERRHGEAPAPRPAPPQGGGGGSAGGLSQEELRARQRVVD
FT                   AAREAQARQVAEQAAAEARARAAQEAAQREAAAKAAAERAAAAPPPVAQAPAAPAPAAP
FT                   VTPPPAAPQAPRPVAQAPVAPSAPRQDAPRQDTRAAAPGQTRTYEPSRDRRDDRPSTTT
FT                   YRPAPQGDRPFNQRAPRPDANANFGQRAPRPEGDRPRGPRPDGDRPQGDRGGYRGDRPQ
FT                   GDRPQGDRPQQTVRYSALAPRPAPGARGPGGPPRGPRPGVPAAAPATPEIQRATRSAPR
FT                   PGGGAMDRRPDEDDDRRKNAAPNKAVSRVKGAPQRREGRLTIQAVAGDGDSADRMRSLA
FT                   SVRRAREREKEKRRGGAVEQARVAREVVIPDVITVQELSNRMAVRGVDIIKFLMRQGVM
FT                   LKINDVIDNDTAELVATEFGHTVKRVSEADVEEGFIGADDHDEHMDLRPPVVTIMGHVD
FT                   HGKTSLLDALRSTDVAAGEAGGITQHIGAYQVRLKDGQRVTFLDTPGHAAFSSMRARGA
FT                   NITDIVVLVVAGDDGVMPQTIEAIKHAKAAEVPIIVAVNKMDKPGSDPTRVVNELLQHE
FT                   IVVESLGGDTQLIEVSAKARTGLDNLLEAILLQAEVLDLKANPDRSADGVVIEAKLDKG
FT                   RGAVSTVLVNRGTLKRGDIVVAGSQWGKVRALLNERNEQLQEAGPATPVEILGLDGVPS
FT                   PGDAFAVVENEARARELTEYRIRLKREKSMAPVGAGASMADMMAKLQDKKLKELPLVIK
FT                   ADVQGSAEAIIGSLDKMATDEVRARIILSGAGAISESDVMLAKGAGAPVIGFNVRASAQ
FT                   ARALAEREGVEIRYYAIIYDLLDDIKGVLSGMLAPIQRETFLGNAEVLQAFDISKIGKV
FT                   AGCKVTEGVVRKGAKVRIIRQDIVVLELGTLQTLKRFKDEVNEVPVGQECGMMFAGFQD
FT                   IKVGDTIECFTVEEIKRQLD"
FT   gene            complement(45805..46002)
FT                   /locus_tag="CCNA_R0098"
FT   ncRNA           complement(45805..46002)
FT                   /locus_tag="CCNA_R0098"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(45893..46543)
FT                   /locus_tag="CCNA_00042"
FT   CDS_pept        complement(45893..46543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00042"
FT                   /product="RNA-binding protein, YlxR family"
FT                   /note="CC_0043"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93509"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2L2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93509.1"
FT                   /translation="MTETAAPKTHAEANRLRKDIVLGEATDEARLIRFVAGPDGTVVPD
FT                   LARKLPGRGIWVGADRDSITTAARKGLFSRAAKTKLTAPADLADQVEALLARRVLEGLG
FT                   LARKAGSIISGFEKVVAALGTGKVAWLIEASDGAEDGRRKVLSAARRAANTPRLLGAFN
FT                   SDELGLALGGENVIHTALLAGRGIDRWALDVERLSGFRPLLPPEWSANGREDD"
FT   gene            complement(46622..48268)
FT                   /gene="nusA"
FT                   /locus_tag="CCNA_00043"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(46622..48268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nusA"
FT                   /locus_tag="CCNA_00043"
FT                   /product="N utilization substance protein A NusA"
FT                   /note="CC_0044"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93510"
FT                   /db_xref="GOA:A0A0H3C3M7"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR010214"
FT                   /db_xref="InterPro:IPR010995"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3M7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93510.1"
FT                   /translation="MAIGIAANRLELLQIADAVAREKGIEKEVVIEAIEDALQKAARAR
FT                   YGAEHDIRVKIDPKTGETTQKRVIEVVSDDAELEGEIGKMPFSIAKRTWRDAEIGKVYE
FT                   EVLPPFEIGRVQTQMARQVVMHKVREAERERQYDEYKDRVGEIVNGSVKRVEYGNVIVD
FT                   LGRGEGIMRRDQSIPRENFNVGDRIRAYIYDVRRETKGPQIMLSRAHGGFMAKLFAQEV
FT                   PEVYDGVIEIRAVARDPGSRAKMAVISNDGSIDPVGACVGMRGSRVQAVVAELQGEKID
FT                   IIQWSEDEATFIVNALAPAEVSKVVMDEEDERVEVVVPDEQLSLAIGRRGQNVRLASQL
FT                   TGWQIDIMTESQESERRQREFAERTALFQEALDVDEVIAQLLVTEGFAAVEDVAYVEPH
FT                   EIASIEGFDEETAEELQTRAREFLEKEAAELDAKRKALGVEDELLTIEGVTLAMAVALG
FT                   EGDVKSIEDLAGLVPDDMRGWFENKGGERVREPGILESFNLSPEDAEALIMRARIAMGW
FT                   VEAPPEPEPEPEFEEESSAEGDVVAEAEEEA"
FT   gene            complement(48271..48846)
FT                   /locus_tag="CCNA_00044"
FT   CDS_pept        complement(48271..48846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00044"
FT                   /product="ribosome maturation protein RimP"
FT                   /note="CC_0045"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93511"
FT                   /db_xref="GOA:B8GX01"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GX01"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93511.1"
FT                   /translation="MRGKTQEDRDLIEMLDPVAESLGYEIVRLRLMGGTEQRRLQIMAE
FT                   HPLLEDGSGGDMNVEDCAKLSRAVSEVLDAADPIAGEYTLEVSSPGIDRPLTRLKDFDD
FT                   YAGLEARIELDRVAEGRKRFKGELAGVEDDQVGLNIEGEDDVTVYFPFAWVIDAKLVMT
FT                   DALMERGAKQRAARLESDNEDLSESEED"
FT   gene            49105..49638
FT                   /locus_tag="CCNA_00045"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        49105..49638
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00045"
FT                   /product="inorganic pyrophosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="CC_0047"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93512"
FT                   /db_xref="GOA:A0A0H3C4C9"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4C9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93512.1"
FT                   /translation="MDLSKIAVGVNPPYDLNAIIEIPQGGEPVKYEIDKESGALMVDRF
FT                   LHTAMFYPANYGFIPHTLADDGDPADIMVVGPTPVVPGAIIRCRPIGTLMMVDEAGSDE
FT                   KILAVPVDKLHPFYTGVTSWRDLPTILTEQIAHFFQHYKDLEKGKSTKISGWADPDETA
FT                   EIIRTAIKRYNESY"
FT   gene            complement(49645..50031)
FT                   /locus_tag="CCNA_00046"
FT   CDS_pept        complement(49645..50031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00046"
FT                   /product="hypothetical protein"
FT                   /note="CC_0048"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93513"
FT                   /db_xref="GOA:A0A0H3C551"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C551"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93513.1"
FT                   /translation="MIWVGEHYAGILVVSGLLTLTMLQFALAPSRSQHSTFGEALEGPL
FT                   ANVIVRGWGLLIALIGGGLIWAAFHPETRTLAVAFAVISKAFFIGSLIAQGRRYLKGFA
FT                   RIAILIDAVVIALLVTGLWAGHQS"
FT   gene            complement(50132..50812)
FT                   /locus_tag="CCNA_00047"
FT   CDS_pept        complement(50132..50812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00047"
FT                   /product="tRNA m7-G46 methyltransferase"
FT                   /EC_number="2.1.1.33"
FT                   /note="CC_0049"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93514"
FT                   /db_xref="GOA:B8GX04"
FT                   /db_xref="InterPro:IPR003358"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GX04"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93514.1"
FT                   /translation="MTTPQQPHGPLRSFGRLKSRPVKPRQQALLDTLLPEIAVPTGPFQ
FT                   PLDLMPEAKAVWLEIGFGGGEHMASQAGRNPETLVIGAEPFVNGVASAVRHVEEQALKN
FT                   VRIHEGDARDVVDWLPDACLDRVFIMFPDPWHKARHNKRRLIQPEFVAKLARVMKPGAA
FT                   LRFATDWADYAEWTTERVLADPSFRFADEAADRNAIPADHVTTRYEEKKLGDCAPVFLD
FT                   FTRG"
FT   gene            complement(50902..52125)
FT                   /gene="metK"
FT                   /locus_tag="CCNA_00048"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(50902..52125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="metK"
FT                   /locus_tag="CCNA_00048"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /EC_number="2.5.1.6"
FT                   /note="CC_0050"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93515"
FT                   /db_xref="GOA:A0A0H3C5U2"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5U2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93515.1"
FT                   /translation="MSRSSYIFTSESVSEGHPDKVADRISDTVVDAFLSVDPEARVACE
FT                   TLVTTNRVVLAGEVRAGKPDGDKKANKQLTKDILGSLEPKVRAAIKDIGYEQKGFHWNK
FT                   AKYSNFLHGQSAHIAQGVDATDKKEEGAGDQGIMFGYASTETPELMPATLQYSHNILKR
FT                   LAELRHSGALSELEPDAKSQVTLEYDGNGRPLRVVSIVVSHQHKKKIDGKAATSKRVLE
FT                   LIKPHILPIFPDGLITKKTQWLVNPTGRFEIGGPDGDAGLTGRKIIVDTYGGAAPHGGG
FT                   AFSGKDPTKVDRSAAYACRYLAKNVVAAGLADRCTIQIAYAIGVAQPVSFHVDLHGTGK
FT                   VDPAVLEKTLPQLIGGATPRAIREHLQLNRPIYARTAAYGHFGRTPDNEGGFSWEKTDL
FT                   VGDLKGLA"
FT   gene            complement(52245..52679)
FT                   /gene="hipB"
FT                   /locus_tag="CCNA_00049"
FT   CDS_pept        complement(52245..52679)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hipB"
FT                   /locus_tag="CCNA_00049"
FT                   /product="HTH transcriptional regulator"
FT                   /note="CC_0051"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93516"
FT                   /db_xref="GOA:A0A0H3C2L6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2L6"
FT                   /protein_id="ACL93516.1"
FT                   /translation="MGMRESSDTERHPNPVDLHVGARIRMRRRILGVSQERLAEDLGLT
FT                   FQQVQKYERGANRVSASKLYEIARSLQSPVDYFFEGLEDTTGGGMAERGEPFVHDFLMT
FT                   PEGLELATLFPKVSRQKVRRRILELVRSMAAEDAASGLDD"
FT   gene            complement(52707..54299)
FT                   /locus_tag="CCNA_00050"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(52707..54299)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00050"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="CC_0052"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93517"
FT                   /db_xref="GOA:A0A0H3C3N0"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3N0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93517.1"
FT                   /translation="MIAWTRFRERPWSGPALALIAGLAAALAHPPFGVLPGLLGYAGLL
FT                   HLLDNADVQRPLRSVFWRGWLAGVGYFGLGTWWVGEAFLVDAATHGWMAPFAVTGMAAG
FT                   LALFWGLAALLYRALRPASAWRVLTFAGAFAALEWMRGHVLTGFPWNLPGETWKAGSAP
FT                   SQLAALVGAYGLTWITLAIAGAPAVWRQGRGGRAATGLAVASLIGLYGYGAIALSRPLS
FT                   PSGPTTVRIVQADIKQDLKWDAERFAQIVQAYVSLTATPYAAKPADIVIWPEGALPAAV
FT                   NDYLAPGTWVRQAIVDSLAPGQLLLIGGYRYEGAGPHPTYYNSLVALRRTETDLELVGI
FT                   YDKHRLVPFGEYLPADRFLTVIGFKSLARLSDNFTTGPTPAPLRISPELLVQPLICYES
FT                   LFPGLAKPDPNVRALINVSNDAWFGVTSGPPQHLNLASYRAIESAKPILRATPTGISAV
FT                   VDARGRIVPGASLGLGESGVIDAQIPGMGQVTPYDNFGDVAFLALILISGVVSARVRIG
FT                   KISSSIAPKRKLS"
FT   gene            complement(54296..55222)
FT                   /gene="corC"
FT                   /locus_tag="CCNA_00051"
FT   CDS_pept        complement(54296..55222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="corC"
FT                   /locus_tag="CCNA_00051"
FT                   /product="magnesium and cobalt efflux protein CorC"
FT                   /note="CC_0053"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93518"
FT                   /db_xref="GOA:A0A0H3C4D4"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4D4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93518.1"
FT                   /translation="MPSDEPSQQPAARRSRGVRAFFRRMRKRLTGGGEPPRPPETAASA
FT                   AASAAAVDLVDQAEAFQSLRVADVMTPRADIVAVELSTPFEAVAAQFAEAEHSRMPIYR
FT                   ETLDDPVGVIHVKDVFRLLADEAKRPAPSDLILNKLRRDALYVPASMKAADLLLRMRTS
FT                   RIHMALVIDEFGGTDGLVSMEDLIEAVVGEIDDEHDDATAVAVVARPGGIFDADARAPL
FT                   EELEAALSHDLAPPDMDEDIDTVAGLVVALAGRVPQRGEVIAHPDGFEFEVVEADPRRV
FT                   RRVRVRGGPSQPAEPALDGAQPDIERS"
FT   gene            complement(55231..55686)
FT                   /locus_tag="CCNA_00052"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(55231..55686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00052"
FT                   /product="metal-dependent hydrolase/metalloproteinase"
FT                   /note="CC_0054"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93519"
FT                   /db_xref="GOA:B8GX09"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR020549"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GX09"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93519.3"
FT                   /translation="MEIEDEAWTTAEADAEALVWRAAQAVLDAHEDIEGQGIVILLTDD
FT                   DSVQALNRDFRKKDYATNVLSFPSPPNPEGQIGDIALAYGVCAREAAEQGKPLAHHLQH
FT                   LVAHGVLHLLGYDHERDDEAEAMEALEREILAGLDVPDPYASDEEGR"
FT   gene            complement(55724..56668)
FT                   /gene="phoH"
FT                   /locus_tag="CCNA_00053"
FT   CDS_pept        complement(55724..56668)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoH"
FT                   /locus_tag="CCNA_00053"
FT                   /product="phosphate starvation-inducible protein PhoH"
FT                   /note="CC_0055"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93520"
FT                   /db_xref="GOA:A0A0H3C556"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036612"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C556"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93520.1"
FT                   /translation="MSRTPEFLPLSDDAVHAVSGPSGRHAALIEDAFKVLIETPGGGVT
FT                   LTGDARGRTSAKRALQTLAARADAGEEVVEADVRIAIGGAHESSGQASPRAVRKGNVSP
FT                   KTKSQAQYLERMATHPLVFGLGPAGTGKTFLAVAHGAGMLMRGEVDRLIVTRPAVEAGE
FT                   KLGFLPGDLNEKVDPYMAPVWEALTDIMGADQLRRRREKLEIEVAPIAFMRGRTLAHAF
FT                   VIVDEAQNCSRLQMKMVLTRIGEGARMVVTGDPTQVDLLNPRDSGLAHAVSILEGVEGV
FT                   AVSRFTSSDVVRHPLVERIVKAYDADAAQSTPR"
FT   gene            complement(56665..58011)
FT                   /locus_tag="CCNA_00054"
FT   CDS_pept        complement(56665..58011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00054"
FT                   /product="tRNA 2-methylthioadenosine synthase"
FT                   /EC_number="2.8.-.-"
FT                   /note="CC_0056"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93521"
FT                   /db_xref="GOA:A0A0H3C5U7"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5U7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93521.1"
FT                   /translation="MSETPQKRLFIKTYGCQMNVYDSERMADVLRPLGYGVVDEPEGAD
FT                   LVVLNTCHIREKATEKVYSELGYIKQMKDRKAEAGGRMTIAVAGCVAQAEGKEIMNRQK
FT                   AVDLVVGPQAYHQLPELIARAHRATGERLAADFAADEKFDALPAERHVTGVTAFLTVQE
FT                   GCDKFCTFCVVPYTRGGEWSRPVNDIVEEAKRLADQGVREVTLLGQNVNAYDGDGSTLA
FT                   KLVRQLAKIDGLDRIRYTTSHPRDMGDDLIEAHGELPELMPYLHLPVQAGSDKILKAMN
FT                   RDHTAESYVKLIEKIRAARPDIAMSGDFIVGFPGERDGDFEKTLELVREVGFASAFSFK
FT                   YSRRPGTPASAMPGQVDEAVKAERLERLNQLLDEQQRAFNASQVGKVLPVLFEKAGRHP
FT                   GQIVGRSPYLQAVHAEGGEQLIGTIVPVHIESAAKMSLAGRLEPVLETA"
FT   gene            complement(58201..58608)
FT                   /locus_tag="CCNA_00055"
FT   CDS_pept        complement(58201..58608)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00055"
FT                   /product="ferric uptake regulation protein"
FT                   /note="CC_0057"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93522"
FT                   /db_xref="GOA:A0A0H3C2M1"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2M1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93522.1"
FT                   /translation="MDRLEKACIEKGMRMTDQRRVIARVLSSAEDHPDVEELHRRAHAI
FT                   DPHISIATVYRTVRLFEESGIIERHDFRDGRSRYEQSPDHHHDHLIDMKTGKVVEFVDE
FT                   EIEALQHAIAKKLGYKLIDHRLELYGMPLEE"
FT   gene            complement(58654..59106)
FT                   /locus_tag="CCNA_00056"
FT   CDS_pept        complement(58654..59106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00056"
FT                   /product="ribosomal-protein-S18-alanine acetyltransferase"
FT                   /EC_number="2.3.1.267"
FT                   /note="CC_0058"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93523"
FT                   /db_xref="GOA:A0A0H3C3N4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3N4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93523.1"
FT                   /translation="MNLRPVGSEAAFDLADLHDKAFDRPWTALEFDDLLKSPGAFAILG
FT                   EAGEPAEAKGFILCRSIAGEAEILTVAVDPAARRRGWGAALVEVAAGIAAETKAEAMFL
FT                   EVAADNLAAIALYQTTGFLKVGLRKGYYPHPDGAKDALVMRRALNT"
FT   gene            complement(59115..59750)
FT                   /locus_tag="CCNA_00057"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(59115..59750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00057"
FT                   /product="tRNA threonylcarbamoyl adenosine modification
FT                   protein, YeaZ family"
FT                   /note="CC_0059"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93524"
FT                   /db_xref="GOA:A0A0H3C4D9"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR022496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4D9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93524.1"
FT                   /translation="MILSIDTCLGASSVALLDGEHVLATRTEPMTRGHQERIGILAREA
FT                   AAEAGVAFEDLTRIAVTVGPGSFTGLRVGLAFAKGLATALSIPCVGVNTLESLAFGTKG
FT                   FAVALIDARMDQVYMQAFVDGAAVMAPDALGLGEASARLVELYRGGPATLIGSGAPLLA
FT                   DTMRGAVILTPAAPDPVAVARLAAGRPAPTHAPRPLYLRAPYATLPTT"
FT   gene            complement(59754..60386)
FT                   /locus_tag="CCNA_00058"
FT   CDS_pept        complement(59754..60386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00058"
FT                   /product="hypothetical protein"
FT                   /note="CC_0060"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93525"
FT                   /db_xref="InterPro:IPR010938"
FT                   /db_xref="InterPro:IPR038714"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C558"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93525.1"
FT                   /translation="MTPRHSYLALPLLLLAACGPAKTDQVSKADDSAKGPVTVAIAPYA
FT                   GGPLKISNDGVGPITSAVAFDLATLKVLFPKAKVEQAFLQSGEGPTLPIITVEQDNTPL
FT                   AEIGKRDEGDIAYVRVEAGDARGPGDEQLLAKWGVLGFTANQCRAGEGREVNMTICVRP
FT                   DAPQVAYVFGVPGWTKPELPPEATLKAKGQLNALIWRPAEGAVVGAA"
FT   gene            complement(60534..61121)
FT                   /locus_tag="CCNA_00059"
FT   CDS_pept        complement(60534..61121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00059"
FT                   /product="malonic semialdehyde reductase"
FT                   /EC_number="1.-.-.-"
FT                   /note="CC_0061"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93526"
FT                   /db_xref="GOA:B8GXF0"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR023936"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXF0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93526.1"
FT                   /translation="MAKLDDATLAQLFTEARSHNGWNPEPLPESVLRELYALTKFGPTA
FT                   ANGSPARFYFVTSAEAKERLAKLSSGSNGPKIMQAPCTVIIGYDLDFPQTLPKLFPHAP
FT                   GAKDWFNDPVAKEWCALRNSSLQGGYFMIGARALGLDVGPMSGFDNAAVDAEFFAGTNI
FT                   KSNFIVSIGHGTDEGLFPRNPRLDFDEAAKIL"
FT   gene            complement(61191..61763)
FT                   /locus_tag="CCNA_00060"
FT   CDS_pept        complement(61191..61763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00060"
FT                   /product="mitochondrial-type Fe-S cluster assembly protein
FT                   NFU"
FT                   /note="CC_0062"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93527"
FT                   /db_xref="GOA:A0A0H3C5V1"
FT                   /db_xref="InterPro:IPR001075"
FT                   /db_xref="InterPro:IPR014824"
FT                   /db_xref="InterPro:IPR034904"
FT                   /db_xref="InterPro:IPR035433"
FT                   /db_xref="InterPro:IPR036498"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5V1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93527.1"
FT                   /translation="MFIQTETTPNPEVLKFLPGREVLGDGAREFRTPEEGDASPLAKAL
FT                   FELGDVSRVFFGPDFLTVTKGEDAQWPHLKAPILAAIMDHFTSGRPLLLDQTAESGGHD
FT                   EGDYDEETSQIVAEIKELLDTRIRPAVAQDGGDIVFSRFEPQTGVVWLHMRGACSGCPS
FT                   SSATLKSGVENMLKHYVPEVTRVEQTL"
FT   gene            61885..63153
FT                   /locus_tag="CCNA_00061"
FT   CDS_pept        61885..63153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00061"
FT                   /product="cytochrome p450"
FT                   /note="CC_0063"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93528"
FT                   /db_xref="GOA:A0A0H3C2M5"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2M5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93528.2"
FT                   /translation="MSDGSIDLKADARARAYSIPLEDYHVADPALFQADAMWPYFERLR
FT                   KEAPVHYSKGDEEVGPYWSVTRYNDIMTVDTTHQVFSSDAHLGGITIRNFDEDFVLPMF
FT                   IAMDQPKHDIQRKTVSPIVSPANLGRLEGIIRERVCGILDALPINEPFDWVDKVSIELT
FT                   TQMLATLFDFPWEERRKLTRWSDIATASPESGLIESEEARRAELLECLAYFTNLWNERV
FT                   NLTEPGNDLISMLAHGEATRDMPPMEYLGNVILLIVGGNDTTRNSLTGGLYALSKNPQE
FT                   EAKLRADPGLIPNMVSEIIRWQTPLAHMRRTALEDYELAGQTIKKGDKVVMWYVSGNRD
FT                   DTVIENADQFIVDRPNARRHLSFGFGIHRCVGNRLAEMQLKIVWEEILKRFPKIEVLEE
FT                   PKRVYSTFVKGYERMMVRIPERI"
FT   gene            complement(63327..64361)
FT                   /gene="trpS"
FT                   /locus_tag="CCNA_00062"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(63327..64361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trpS"
FT                   /locus_tag="CCNA_00062"
FT                   /product="tryptophanyl-tRNA synthetase"
FT                   /EC_number="6.1.1.2"
FT                   /note="CC_0064"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93529"
FT                   /db_xref="GOA:A0A0H3C3N8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002306"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3N8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93529.1"
FT                   /translation="MTDQAPVTYAGPPRVLSGVQPSGALHLGNYLGALVKFTRLQHEID
FT                   TFIFVADLHAITVWQDPAALAQQTREIAAAYIASGLDPDKATIFPQSAVREHAELSWIF
FT                   NCVARLGWLDRMTQFKEKSGKHKERSSVGLYTYPVLQAADILIYKATHVPVGEDQKQHL
FT                   ELTRDIAQKFNHDFNAPGFFPLPDPLIQGPGARVMSLRDGSAKMSKSDPSDYSRINLTD
FT                   TADDIAAKVKKARTDPEPLPETIEELATRAEADNLVGIFAALAGKTKAEVLADYAGKGF
FT                   GTFKPALAELAVESLAPVGERMRGLLGDPAVLDAILAKGAEKAREAAAPTLAEVKKLVG
FT                   FWGA"
FT   gene            complement(64440..64487)
FT                   /locus_tag="CCNA_03913"
FT   CDS_pept        complement(64440..64487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03913"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03913"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88515"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IXL3"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88515.1"
FT                   /translation="MAVIGLYAPRWRGSH"
FT   gene            complement(64529..66091)
FT                   /gene="mviN"
FT                   /locus_tag="CCNA_00063"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(64529..66091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mviN"
FT                   /locus_tag="CCNA_00063"
FT                   /product="MviN-family integral membrane protein"
FT                   /note="CC_0065"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93530"
FT                   /db_xref="GOA:A0A0H3C4E4"
FT                   /db_xref="InterPro:IPR004268"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4E4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93530.1"
FT                   /translation="MIRSSAIYSGLTLVSRLMGFVRDLVISYFLGASANFAADAFNTAQ
FT                   MFPNLFRRIFAEGAFAAAFVPAYSKTLDRDGAEVADKLAADAMATIAAFTVGLTLIAQA
FT                   TMPWLMMVISPGFGFGTDKYKLAVILTQITMPYLPCMAIVALLSGVLNARGKFIVSAAA
FT                   PILLNLVTLIAVIPTRNAHDAALAASWGIFAAGIAQVALLVWAVRKAGATIRWRLPRLT
FT                   PEIRGLIALAIPGAIAASASQINITISGVLASHVNGARTWLAYADRLYQLPLGLVGVAI
FT                   GVALLPRLSRAVAAEDRAEAQGAMDQAIVFALALTLPAAVALFSIPFFLIDGLFTRGEF
FT                   TVFDARQTANALLHYGWGTPAFVLARILSPAFFARGDTKGPMRFALISVAVNIGLGLAL
FT                   FPVMGVPGLAAATSAASWINVLQMALTLRKRGDYAPSAAAWGKIIRVLGASVALGLILA
FT                   AISRGRAALEAPILAMGIGSAKELAILATCALAAGLYPVLLLLSGGVTLAEARTVLRRG
FT                   TGR"
FT   gene            complement(66331..68127)
FT                   /locus_tag="CCNA_00064"
FT   CDS_pept        complement(66331..68127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00064"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CC_0066"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93531"
FT                   /db_xref="GOA:A0A0H3C560"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C560"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93531.1"
FT                   /translation="MASLGQKVMGAAGGAALLCAATAGAGLWVAWSLDSALSRAEASAR
FT                   ILRLHMHADMMHDALRADVLGAIMSSDPTLGVDLKVVRADLAEHTQAFRDDIAQSGELA
FT                   HNPRTKAALLAVETPLNAYIAAAEDIVGTADVDPAAAHAKLTDFGQQFSTLEDKMEAAS
FT                   TEIEAAASHDTNAAKSLGLLGQAIMAGLLLLAVALAAVLMFAARRGLVAPLTEITRCLR
FT                   RLAAGDLDVILPRKKSQDEIGQITDALRSFHETVEARRKELEAADVREALEIERRAADQ
FT                   RRAEADATQKAVVESLALALGRMSQGDLTCRIDRAFPSGYEALRVDFNTAIEKLSGVIA
FT                   ASLDATRAIHGGTAEISEAADELATRTERQAASLEEAVAALDEITSTVRQTADGASRAR
FT                   KVVERARSAADASGSIVSQAVEAMGAIEKSSSQIGQIIGVIDEIAFQTNLLALNAGVEA
FT                   ARAGEAGRGFAVVAQEVRALAQRSADAAKEIKTLISTSTAEVGQGVEYVGKAGEALRAI
FT                   AHEVDEIDDLVTAMAASTQQQARGLSEVNTTMNQMDQVTQRNAAMVEETTAASHTLAQE
FT                   ATRLAQRMGELRIMRAGMQAAA"
FT   gene            complement(68179..68196)
FT                   /locus_tag="CCNA_03914"
FT   CDS_pept        complement(68179..68196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03914"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03914"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88516"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88516.1"
FT                   /translation="MVKAR"
FT   gene            complement(68289..69062)
FT                   /locus_tag="CCNA_00065"
FT   CDS_pept        complement(68289..69062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00065"
FT                   /product="S-adenosylmethionine-dependent methyltransferase"
FT                   /note="CC_0067"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93532"
FT                   /db_xref="GOA:A0A0H3C5V4"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5V4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93532.1"
FT                   /translation="MTADMHFDAETVTHRGGLSKLRSLTKVNPRLAPNLAKTMLGGPRD
FT                   HAVVEAFNAHAADKGFEFTSTWASNNIPFVTPLLRDFAAKRPAGEAIRYMEIGAYEGRN
FT                   LAFMDWLLPDRLAVTVIDPWFDEALNPEEKYHAVEPRFRRNMDKCGFKSLSTHKGFSTY
FT                   VLPQMLERGEQFDLIYVDGSHTALAVLIDLCFCASLLSVGGMMVLDDYWHDISEIGGPG
FT                   VKQAVDQFHAAFGRYFEIAAVYRQVALVKTSEIPR"
FT   gene            complement(69120..69488)
FT                   /locus_tag="CCNA_00066"
FT   CDS_pept        complement(69120..69488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00066"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="CC_0068"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93533"
FT                   /db_xref="GOA:A0A0H3C2M9"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2M9"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93533.1"
FT                   /translation="MRDAEDNPARPPPGTVLCGLDEIASPGSKGFRWREGDAMFAGFVV
FT                   RKGEALVGYVDSCPHAGWPLAGFAGRYLTRDNDLILCSGHAALFRIEDGGCVAGPCPTS
FT                   ARLTPWPVAVRDGQIVTA"
FT   gene            complement(69493..69774)
FT                   /locus_tag="CCNA_00067"
FT   CDS_pept        complement(69493..69774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00067"
FT                   /product="YciI-like protein"
FT                   /note="CC_0069"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93534"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3P4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93534.1"
FT                   /translation="MALFAILCKDKPGALDTRLATRPTHLDYLNQSTGLKLAGALLGDD
FT                   GNPIGSLLIVEAEDLAAAQAQADNDPFTTAGVFESVEVRPWRVAIGAL"
FT   gene            complement(69794..70804)
FT                   /gene="gpsA"
FT                   /locus_tag="CCNA_00068"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(69794..70804)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gpsA"
FT                   /locus_tag="CCNA_00068"
FT                   /product="NAD(P)H-dependent glycerol-3-phosphate
FT                   dehydrogenase"
FT                   /EC_number="1.1.1.94"
FT                   /note="CC_0070"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93535"
FT                   /db_xref="GOA:A0A0H3C4E8"
FT                   /db_xref="InterPro:IPR006109"
FT                   /db_xref="InterPro:IPR006168"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR011128"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4E8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93535.1"
FT                   /translation="MTLQPMTFEKVGVIGAGAWGTALAQVAARAGLAVTLQAREPEIVA
FT                   AINDTHENAVFLPGIALEPGIKAVADLADLADCDLILAVAPAQHLRAALTAFAPHRKAG
FT                   APVVLCSKGVEQGSLKLMTDVAAEALPGAPIAVLSGPSFAGEVARNLPAAVTLACEDEA
FT                   LGRAIAEAIAIPTFRPYTANDLIGAEAGGAVKNVLAIACGIVEGKGLGRNAHATVITRG
FT                   FAELTRLAVALGARPETVAGLCGLGDLVLTCSSPQSRNMSVGLALGQGLTLEQALAGKV
FT                   SVAEGVASAPAVRALARKVGVEAPICEAVAAILAGEVAVDAAIAGLLSRPLKPEA"
FT   gene            complement(70801..71904)
FT                   /locus_tag="CCNA_00069"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(70801..71904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00069"
FT                   /product="O-sialoglycoprotein endopeptidase"
FT                   /EC_number="3.4.24.57"
FT                   /note="CC_0071"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93536"
FT                   /db_xref="GOA:A0A0H3C563"
FT                   /db_xref="InterPro:IPR000905"
FT                   /db_xref="InterPro:IPR017861"
FT                   /db_xref="InterPro:IPR022450"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C563"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93536.1"
FT                   /translation="MTSPKQSDLLILGLETSCDETAASVVRRAADGTVTVLSSVIGTQF
FT                   EKHAPFGGVVPEIAARAHVESIDAIAAEAVRAAGVGFGDLDGVAATAGPGLVGGVMVGL
FT                   AFGKAVALARGAPLVAVNHLEGHAVSARLGADIAYPFLLLLVSGGHCQLLEVSGVGACK
FT                   RLGTTIDDAAGEAFDKIAKSLGLPYPGGPALEKLAVGGDPTRYALPRALLGRKDCDFSF
FT                   SGLKTAAARIAETLTTDDARRDLAAGVQAAIARQLSERVDRAMKLYKDSHDPEDLRFVV
FT                   AGGVAANGAVRAALLADCEKNGFSFAAPPLAYCTDNAAMIALAGAERLALGIFDDLDAI
FT                   ARPRWPLDEAAALANPANAYGRKGAKA"
FT   gene            71977..72945
FT                   /locus_tag="CCNA_00070"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        71977..72945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00070"
FT                   /product="porphobilinogen deaminase"
FT                   /EC_number="2.5.1.61"
FT                   /note="CC_0072"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93537"
FT                   /db_xref="GOA:B8GXG1"
FT                   /db_xref="InterPro:IPR000860"
FT                   /db_xref="InterPro:IPR022417"
FT                   /db_xref="InterPro:IPR022418"
FT                   /db_xref="InterPro:IPR022419"
FT                   /db_xref="InterPro:IPR036803"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXG1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93537.1"
FT                   /translation="MSRQPPIRIGARGSKLSLAQSGLMQARIAHALGVPAGASKDEIEA
FT                   AAPLIPIVTSGDRIQDRRLMEIGGKGLFTKEIEEALLDGRIDCAVHSLKDMPAELPPGL
FT                   VLAATPEREDPRDAFISHVCERLEDLPKGARLGTASLRRQAQALHVRPDLEIVMLRGNV
FT                   DTRLAKLERGEADAILLAQSGLNRLGLGHLTRSWLDPDACPPAPGQGALVIETRAEDIG
FT                   APWLEAVRCRQTTIAVAAERGALLALEGSCRTAIGARAILDGARLSMIVEALTPDGAQR
FT                   FRREGDITLTGADDIAEARAFGLTLGAEVRAAGGDAIILPE"
FT   gene            72950..73636
FT                   /locus_tag="CCNA_00071"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        72950..73636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00071"
FT                   /product="uroporphyrinogen-III synthase"
FT                   /EC_number="4.2.1.75"
FT                   /note="CC_0073"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93538"
FT                   /db_xref="GOA:A0A0H3C5V8"
FT                   /db_xref="InterPro:IPR003754"
FT                   /db_xref="InterPro:IPR036108"
FT                   /db_xref="InterPro:IPR039793"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5V8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93538.1"
FT                   /translation="MVSGAPVWITRAQPGAAATAQRVAALGFRPVVDPLLAIEPSLAKI
FT                   DLSGIAALAFTSANGVEGFARCNARRDLPVFTVGAATAKAAKDAGFAHAFSAEGDVEAL
FT                   ERLIIDARPGPVLWAGAQAPAGDLVAALRAQGLEARGVAVYATVERAPSPATLALLDAP
FT                   LSVLVHSPRAARALGRILAGRDHGDLRLLCLSPAVAAPLDKIAEPRFVASAPRPDESAL
FT                   LQLLDA"
FT   gene            73680..74576
FT                   /locus_tag="CCNA_00072"
FT   CDS_pept        73680..74576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00072"
FT                   /product="hypothetical protein"
FT                   /note="CC_0074"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93539"
FT                   /db_xref="GOA:A0A0H3C2N3"
FT                   /db_xref="InterPro:IPR019133"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2N3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93539.2"
FT                   /translation="MNADADPAEIAAPSDPALYARRRVMGPGVWAWLLLCLFCVALGAG
FT                   VAWFGPSWFSAKPVTPEPAVSATPNPRPVAERVAASAALPLESNLPAAAETALADVERL
FT                   NGRITALEASQKTVADAAVAALAVATLAEAAGTSRPFGPELLGLERVLPGSPDLRALEP
FT                   LSRTGAPTRAGLATQFGNLAGRAASASRNPGMDADLFSRIRYALSSIVSIRHVGSTKGS
FT                   TPDAMLARAQALLDEGDVEGAVAALDPLNDSSREVLAPWFVAANRRIEIDRHVSAVRAD
FT                   ALAELARVSRATAPVAP"
FT   gene            74573..76108
FT                   /locus_tag="CCNA_00073"
FT   CDS_pept        74573..76108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00073"
FT                   /product="HemY domain membrane protein"
FT                   /note="CC_0075"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93540"
FT                   /db_xref="GOA:A0A0H3C3P8"
FT                   /db_xref="InterPro:IPR010817"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR016982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3P8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93540.1"
FT                   /translation="MTRVAFALFLVAVVAVSVLALTGEPGRASMEWMGWRVEMTAAAAA
FT                   LLTLFSALMFTLLWRGVIWIVEAPRRAARARAEAKRKQAIEALSRGFLAVAAGDGSEAR
FT                   RLAQKSSELAEDAPALVRVLAAQAAEAAGDRGAAKSAYNAMLGFPEMRLAGLRCLMLAA
FT                   QAEGDRQTAIRHAETAYGLARTARWAWRALLEARLEAGDWAAALQLVQGALERKIVSPV
FT                   VAERSRAALLAASAASLVNADDPKTRAQALDFATQSVKLKPDFAPGVVMAARLLAEDGK
FT                   TAKAGGLIETAWKAEPHPALWLAYRDLKTNETPKARAQRLAALAAMKPEARESRLLRVE
FT                   SALIGGDPVAARAAARLLDDEAPTARFAGLMARVAAANGDADEARAWIARGVAAPQEPD
FT                   WSDLDPEGLAFAYQRDDWARLAVSYAETGQLIHPRHERRERTMNDLPELPSAYAESTPF
FT                   IRAAETGGALMPIPDDPGVYDAPLVTDPPEGGPAPRRNSGARRRLPSGSRAAK"
FT   gene            76150..76225
FT                   /locus_tag="CCNA_R0001"
FT   tRNA            76150..76225
FT                   /locus_tag="CCNA_R0001"
FT                   /product="tRNA-Thr"
FT                   /note="CC_t01"
FT                   /experiment="EXISTENCE:RNA-seq"
FT   gene            complement(76477..78678)
FT                   /locus_tag="CCNA_00074"
FT   CDS_pept        complement(76477..78678)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00074"
FT                   /product="multifunctional fatty acid oxidation complex
FT                   subunit alpha FadJ"
FT                   /EC_number="4.2.1.17"
FT                   /note="CC_0076"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93541"
FT                   /db_xref="GOA:A0A0H3C4F3"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4F3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93541.1"
FT                   /translation="MENFKIEVDSDGVALVTFDVPGRSMNTLTASVIKEIGEIVERIKS
FT                   DAEIKGVVITSGKTTGFCAGADLGELGGGGGMAGGAAGGEAALKAAFDAGFALNKAFRG
FT                   LETCGKPVAAAINGLAMGGGLEIALACHYRVVADHPKIQLALPEAKVGLLPGAGGTQRL
FT                   PRLMGVMAAAPYLLEGKSMKPAEALANKVVHEVVPVDQVVEAAKTWVKTKGDPVAPWDK
FT                   KDFKLPGGGPYTPTGGQVFIMGNAMLRKQTYGNYPAQLNILKAVYEGTQVPFDAAIRIE
FT                   TRYFLKTMMSPQAKGMIRTLFLSLQELGKGSGRPADVPPSEAKKVAVLGAGMMGAGIAY
FT                   VQAMAGIETVLIDQSQEAAEKGKGYAENLLKKAVSRGKMTQDKADAVLALITPTTDYAH
FT                   VKGSDLVIEAVFESREIKADVTQKAEAQLAEDAIFGSNTSTLPITGLAKASVRPKNFIG
FT                   IHFFSPVDKMGLVEIIMGEETSDEALAKSIDYVLKIKKTPIVVNDSRGFYTSRCFGTFV
FT                   QEGLEMLADGIAPAIIDNVGRATGMPRGPLEMNDDVALDLGYKVTQQTKKDLGDKFEDR
FT                   PFAPIIEKMVVELQRFGRKNGKGFYDYPETGPKTLWKGLSELAPVTIAEADQALIQEIR
FT                   TRLLYRQAVEAARCFEEGVITDPREADVGAILGWGFAPWTGGPISLIDGVGAKAFVETC
FT                   DQLAQKYGKRFAPPALLREMAEKGETFYGRFGAKAKAAA"
FT   gene            complement(78703..79908)
FT                   /locus_tag="CCNA_00075"
FT   CDS_pept        complement(78703..79908)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00075"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="CC_0077"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93542"
FT                   /db_xref="GOA:A0A0H3C565"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C565"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93542.1"
FT                   /translation="MADAYIFDAVRTPRGKGKKDGSLHETTALSLATQVLEALRDRNGL
FT                   DTSKVDDVVLGCVSPVGEQGSDIARTAVLTADYAESVAGVQINRFCASGLEAVNMAAAK
FT                   VASGEAGLAIGGGVESMSRVPMGSDGGAWPTDPSSAFKTYFAPQGVSADLIATLYGFSR
FT                   DDVDAYAVESQKRAAAAWADNRFKKSVIPVKDQLGLTLLDHDETVRGSTTMQTLASLNP
FT                   SFTGMGEMAFDAVVTQRYPQVERVNHVHHAGNSSGIVDGAAGVLIGTKEMGEALGLKAR
FT                   ARIKGAASIGSEPSIMLTGPALVSEKLLKKLGMEVKDIDLYELNEAFASVVLRMMQALD
FT                   IPHDKMNVNGGAIAMGHPLGATGAMILGTVLDELERSDKETALITLCVGAGMGTATVIE
FT                   RV"
FT   gene            complement(79975..80358)
FT                   /locus_tag="CCNA_00076"
FT   CDS_pept        complement(79975..80358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00076"
FT                   /product="hypothetical protein"
FT                   /note="CC_0078"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93543"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5W4"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93543.1"
FT                   /translation="MIVTLLVGLLAGSAAAEPAAKDARSAVVCVRAVQGPRPLNFSGEL
FT                   VGKRPQPGAFKLPLQPAGKDICNTLLRSKVAEWKLEVRTPGFTACELPPPEFGSRLYYR
FT                   AKVTARGLKCEPIGKYPIGNWKP"
FT   gene            complement(80355..81530)
FT                   /locus_tag="CCNA_00077"
FT   CDS_pept        complement(80355..81530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00077"
FT                   /product="acyl-CoA dehydrogenase, long-chain specific"
FT                   /EC_number="1.3.8.8"
FT                   /note="CC_0079"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93544"
FT                   /db_xref="GOA:A0A0H3C2N9"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2N9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93544.1"
FT                   /translation="MSVLNVEKPAFMAEEDIAIFEDAVGKFFDEHASEATVATWRKNHC
FT                   VDRDMWTKAGEAGLLGLSTPEQYGGAGGDYRHEVVLMEQLGKKGVDGFGASLHNAIVMP
FT                   YIVHYGTEEQKQRWLPRMVTGELVSAIAMTEPGAGSDLQGIKTTAKKAGNQYVINGSKT
FT                   FITNGQTANLICVVAKTDPAGGARGTSLIFVETDGPDGLLEGFERGRNLDKLGQEAQDT
FT                   SELFFNDVKVPTENLLGTDEGQGFFQLMGQLPQERLNIAVQGMATIERALELTIAYVKD
FT                   RKAFGKAIIDFQNTQFVLAECKTEATVAKVFVNHCIGQHLEGKLDAATASMAKYWVSDL
FT                   ENKIVDRCLQLFGGYGFMNEYPIARMYKDSRIQRIYGGTNEIMKLLIARTL"
FT   gene            complement(81533..83326)
FT                   /locus_tag="CCNA_00078"
FT   CDS_pept        complement(81533..83326)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00078"
FT                   /product="acyl-CoA dehydrogenase"
FT                   /EC_number="1.3.8.7"
FT                   /note="CC_0080"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93545"
FT                   /db_xref="GOA:A0A0H3C3Q3"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR020953"
FT                   /db_xref="InterPro:IPR025878"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Q3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93545.1"
FT                   /translation="MTYQPPVRDHAFILRDVLNIDQHGDLPGFSDAPFDVVEQILEAAA
FT                   QFTGEVLAPLNTVGDKTGCKLDPVTNTVTTPPGFKDAYKQMCEGGWTAIGSDPAYGGQG
FT                   LPHVVNLAFSEMSSSANMAFSMYPGLAHGAYSAIHVGGSDEQKQTFLPKMVSGEWTGTM
FT                   NLTEPHCGTDLGLLRTKAVPQADGSYKITGQKIWISAGEHDMADNIVHLVLARIEGAPA
FT                   GVKGISLFIVPKFIPNADGSVGPRNEGAKCVGLEEKMGIHGNATCVMQYDEAVGYLIGE
FT                   ENSGLKIMFVMMNEARLGVGMQGVAQGEAAYQAAVAFAKDRLQGRSLTGPKNAEGPADP
FT                   IIVHPDVRRMLLESKALIEGGRAFLFWTALHGDLSHVHPDPAVREKSSDYMGLMTPVLK
FT                   GYLTDKGFQVCSNAVQVHGGSGFTEHFPVSQFMRDCRIALIYEGTNGVQALDLVGRKLA
FT                   AKGGRAVMTFFQEIDQFIGENDSDEALKPFIEALGGVKAQLQDGTMWLMQNGLQNPDNA
FT                   GAASTDYMHLFGLAGLAYMWALMAKAANAKIAAGSSDPFFTTKLTTGRYFIERILPDAA
FT                   SHLAKLKTGSATLMALPAEAF"
FT   gene            complement(83414..83893)
FT                   /locus_tag="CCNA_00079"
FT   CDS_pept        complement(83414..83893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00079"
FT                   /product="MerR-family transcriptional regulator"
FT                   /note="CC_0081"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93546"
FT                   /db_xref="GOA:A0A0H3C4F7"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="InterPro:IPR015358"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4F7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93546.1"
FT                   /translation="MADLRRPERTFTIRQLCNEFKATPRALRFYEDKGLLNPAREGLNR
FT                   VYSHKDRVRLQLILRGKRVGLSLTEIRELLDLYDENDEGAAQMARSLKKFRERATALEQ
FT                   QRDDIDNALIELREACNRLERRLTEIRPDLLPRAADYEQVLRARLDGHAEAMLGK"
FT   gene            84087..84728
FT                   /locus_tag="CCNA_00080"
FT   CDS_pept        84087..84728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00080"
FT                   /product="LexA-related transcriptional repressor"
FT                   /note="CC_0082"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93547"
FT                   /db_xref="GOA:A0A0H3C567"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C567"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93547.1"
FT                   /translation="MATLSHGEIWRAIDALAERFDMTPSAMARMAGLDPTSFNRSKRGS
FT                   AETGHARWPSTESLSKLLEATGVNFSEFAALTERSPVRAPGRRGAPLIDLAQAGKDGFF
FT                   DEAGMPVGAGWDEAPAPDLGEGLFALEVTGDDLAPVYRDGDRLLVSPTLEPRKGDRVVT
FT                   RTHGGEVLVRELGRVTARSIELLALDRVSGERLLSRDEVAWIARIVWVSQ"
FT   gene            complement(84763..84972)
FT                   /locus_tag="CCNA_00081"
FT   CDS_pept        complement(84763..84972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00081"
FT                   /product="hypothetical protein"
FT                   /note="CC_0083"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93548"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5W9"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93548.1"
FT                   /translation="MASFTLRPSDREEFDSLLGGIVQQFPDAQVEAAHNDTWNSYRVDV
FT                   SCADPAAGPLIAWLLDSHASCPRT"
FT   gene            complement(85222..86880)
FT                   /gene="lysS"
FT                   /locus_tag="CCNA_00082"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(85222..86880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lysS"
FT                   /locus_tag="CCNA_00082"
FT                   /product="class 1 lysyl-tRNA synthetase"
FT                   /EC_number="6.1.1.6"
FT                   /note="CC_0084"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00082"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93549"
FT                   /db_xref="GOA:B8GXH3"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002904"
FT                   /db_xref="InterPro:IPR008925"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR020751"
FT                   /db_xref="InterPro:IPR023386"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXH3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93549.1"
FT                   /translation="MFEGLSPLARDARSWPFEQARATIARVLRVRLPDRADQDAAKALI
FT                   DAGKTDEAVKAYPALAKAVIFETGYGPSGLPHLGTFGEVARTTMVRQAFRALTDEAIPT
FT                   RLIAFSDDMDGLRKVPDNIENKQPLIEDLGKPLTVVRDPFGTHDSFGAHNNARLRAFLD
FT                   GFGFEYEFVSSTDCYKGGLFDATLLTALERFDAIQKVMLPTLGEERRATYSPFLPISPS
FT                   TGKVLQVPTLERNVEKGTIVFEDEDGSKVEVPVTGGHVKMQWKPDWAMRWTALGVDYEM
FT                   SGKDLIDSVKASGAICKALGGVPPEGFNYELFLDENNQKISKSKGNGLSMEDWLRYGAP
FT                   ESLSYYMFQSPKSAKKLYFDVIPKASDEYLQQLDGFGRQEPAKQLDNPVWHIHGGKPPQ
FT                   QGSPVSFSLMLNLVSAADASTKEILWGFLSRYIPGASPETQPLLDRLAGYAINYYEDFV
FT                   KPSKVFRAPSDQERAAMLDLLAKLKAMPAGTQDAELIQNEVFEVGKTHGFDPLRAWFQA
FT                   LYEVLLGQSQGPRFGSFAAIFGIDRTVALIEEKLG"
FT   gene            complement(87043..88683)
FT                   /locus_tag="CCNA_00083"
FT   CDS_pept        complement(87043..88683)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00083"
FT                   /product="phosphoglucomutase/phosphomannomutase"
FT                   /EC_number="5.4.2.2"
FT                   /note="CC_0085"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93550"
FT                   /db_xref="GOA:A0A0H3C2P3"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2P3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93550.1"
FT                   /translation="MMHDRAGLRALPEDLVDLDALIGAYFEIKPDVSNPAQKVVFGTSG
FT                   HRGSSLDGAFNEAHILAVTQAIVEYRAAQGVTGPLFVGRDTHGLSEPAWRSVLEVLAAN
FT                   GVEALVDSRDGFTPTPAVSHAILTHNRQGGRQADGLLLTPSHNPPRDGGIKYNPPSGGP
FT                   AGSDATSAIAARANELLAQGLAGVKRVPFETARKAVGDYDFLGRYVDDLPAVIDIAAIR
FT                   AAKVRIGADPLGGAAVAYWGAIAERHALDLTVVNDAVDPRWAFMPLDTDGKIRMDCSSS
FT                   SAMANLIGIMKGGAAYDVATGNDADADRHGIVTPDGGLMNPNHYLAAAISYLFSHRPGW
FT                   GADTAVGKTLVSSSMIDRVVSGLGRRLLEVPVGFKYFVPGLLDGSVGFGGEESAGAAFL
FT                   RHDGGVWTTDKDGIQLALLAAEIQAVTGKSASQLYAGLTDQYGAPAYARVDAPASREEK
FT                   ARLSKLSPSDVSAKTLAGEAITDILTAAPGNGEAIGGLKVCTQNAWFAARPSGTEDVYK
FT                   VYAESFLGADHLKQVQAEAREVVAGALKG"
FT   gene            89053..90642
FT                   /gene="purH"
FT                   /locus_tag="CCNA_00084"
FT   CDS_pept        89053..90642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="purH"
FT                   /locus_tag="CCNA_00084"
FT                   /product="phosphoribosylaminoimidazolecarboxamide
FT                   formyltransferase/IMP cyclohydrolase"
FT                   /EC_number="2.1.2.3"
FT                   /EC_number="3.5.4.10"
FT                   /note="CC_0086"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93551"
FT                   /db_xref="GOA:A0A0H3C3Q7"
FT                   /db_xref="InterPro:IPR002695"
FT                   /db_xref="InterPro:IPR011607"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR024051"
FT                   /db_xref="InterPro:IPR036914"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Q7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93551.1"
FT                   /translation="MPAAPDYPSAPDLVAPKRALLSVSDKTGLVDAAKILHAAGVELVS
FT                   TGGTKAAIAAAGVPVKDVSDLTGFPEMMDGRVKTLHPVVHGGLLGVRDAADHAKAMADH
FT                   GIGGIDILYVNLYPFEATVAKGGSYAECVENIDIGGPAMIRSAAKNHGYVAVCTDPSDL
FT                   AEVLEALKAGGTTLALRQQLAARAYARTAAYDAAISAWFAEALGQDFPARKSIAGTLRQ
FT                   TMRYGENPHQKAAFYTFPNPRPGVATATQLQGKELSYNNINDTDAAFELIAEFDPAAGP
FT                   AVAIIKHANPCGVAVGATQREAYERALACDPTSAFGGIVAVNSRLTREAAEAMVEIFTE
FT                   VVIAPEADEDAIAVFAAKKNLRLLVTGGLPDALSTGDTFKSVAGGFLVQSRDDARIKAS
FT                   DLKIVTQRQPTEEEVRDMLFAFTVGKHVKSNAIVYARAGQTLGVGAGQMNRKDSARIAA
FT                   LRAADFGLDLKGCACASEAFFPFADGLIQAAEAGATAIIQPGGSMRDPEVIEAADKLGL
FT                   TMAFTGVRVFRH"
FT   gene            90655..91413
FT                   /locus_tag="CCNA_00085"
FT   CDS_pept        90655..91413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00085"
FT                   /product="dienelactone hydrolase-related protein"
FT                   /note="CC_0087"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93552"
FT                   /db_xref="GOA:A0A0H3C4G2"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4G2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93552.1"
FT                   /translation="MKMDSAAWGEKVAKHSRVFKPAGPGPFPVALILHGCGGKTPFLEA
FT                   YARVAVQAGWAAVVVDSLKPRGMSTLDAKLFVCTGVALHGLKRAADIFAMLTWLETQGW
FT                   ADANRVFLAGWSHGGWTIMDSYAVGRSAARGTTLVDADPAKLRARVKGTLLVYPYAGYG
FT                   SLTSARGWDQGGPPVWSVLAGKDQVVGWKAPAKALDRLAADGLKVDRVFHADATHAFDD
FT                   DRANDPRARYRPDLFQAVQGYFAGALGRCS"
FT   gene            complement(91467..96290)
FT                   /gene="gdhZ"
FT                   /locus_tag="CCNA_00086"
FT   CDS_pept        complement(91467..96290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gdhZ"
FT                   /locus_tag="CCNA_00086"
FT                   /product="NAD-specific glutamate dehydrogenase GdhZ"
FT                   /EC_number="1.4.1.2"
FT                   /note="CC_0088"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93553"
FT                   /db_xref="GOA:A0A0H3C571"
FT                   /db_xref="InterPro:IPR007780"
FT                   /db_xref="InterPro:IPR028971"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C571"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /experiment="protein colocalizes with FtsZ at the midcell
FT                   and is required for proper cell division[doi:
FT                   10.15252/embj.201490730]"
FT                   /protein_id="ACL93553.1"
FT                   /translation="MSGVKIDPSNSLTAAYALTRGKTVQELALEERDFLAQVGADWAIE
FT                   DAPVLSAKAAAASLAEFFDFARTLKGDQPTVRLRSAGEAGAARDLLEIVQPDRPFLVDS
FT                   VMGEITESGFRVRAMFHPVVEIDGIARSFIQVHLDPVGEDRVESLLEQIRETLFDVRRA
FT                   VGDFKAMRDLMHRAVAELAATPGVTSEEGRQEDLAFLRWLEDDNFVFLGARVYEYPRSS
FT                   DGGYAAEEPLYEAEASLGVLRDSSRSVLRRAYEPAILSKQLQRQLETGAPVVVAKSNLR
FT                   SRVHRRGFMDYVGVRRYGDDGKPSGEVRFVGLFTAEAYETPAVEVPLIRHRVARIMRRA
FT                   AKAPGSHNEKRLRNILETWPRDELFQTSEDTLLSMALGVLHLIDRPRVRLFARLDPFDR
FT                   FASVLVYIPRERFDTEVCARAGAILADAYDGKVLEYYPEISDAPLARAHFIIEVTPGDH
FT                   PDPDLSQVEARIADTALTWEDRFEAVVRAGGAPTGGVRTLLDKYGYAFPPGYRDQYDAL
FT                   EALADIDIIETLTEGALPRVRAFRRFEDGPRTFRFKLYLRGAAAPLAEVLPILERMGLK
FT                   ALIEDGFRLSIHEKDGPHSVWVHEFVLDDPAGEHIVFDEVRQVFEEAFIAIWTGATEND
FT                   GFNRIVLEMAVGWREAALLRALARYRQQSGLDPSQQVQEAALRDHPMVARLILDLFRVK
FT                   FDPAIRADLRTRREQAEAVQFSIVEALQAVESLDADRVLRRLAALVGAIQRTNFYQLGA
FT                   DGEPKSYISFKIASRELEDLPAPKPYREIYVSAPHVEGVHLRFGPVARGGLRWSDRRDD
FT                   FRTEVLGLVKAQQVKNAVIVPVGSKGGFYPKQLPRGGDRDAIQAEAIRAYKTFLSGLLD
FT                   LTDNIDSDNQVVPPPSVIAHDAQDPYLVVAADKGTATFSDIANGVAESYGFWLGDAFAS
FT                   GGSVGYDHKVMGITARGAWEAVKRHFRELGKDIQTEAFTVVGVGDMSGDVFGNGMLLSK
FT                   QTKLLAAFDHRHIFLDPNPDPAVSWAERDRMFKLPRSSWEDYDKSKISAGGGVFARSLK
FT                   SIPLSAEVRAMLEIKAEAVSPAELMTAILKSKAELLYLGGIGTYVKAKGETNADAGDKA
FT                   NDAIRINGSDLRVKVVGEGANLGLTQAGRIEFAQAGGHINTDAIDNSAGVDSSDHEVNI
FT                   KILTGILERGGQLDRESRNTLLASMTDDVAHHVLEHNYDQTLALTLLESDAVSEVDAQI
FT                   RYMVNLEQRGRLDRRVEGLPTNTTLLERKAAGRGLTRPELAVLLAYGKLDLFDEIVASQ
FT                   SPDDPWFERTLRGYFPRALDQYADAMQKHRLKREIIATVVGNQMVNMCGPTFVSRLKAA
FT                   AGADVNAVVVGFTAAREILGIDGLWDQVNGLDNKASAEGQTALYKALAYALRSLTFWLA
FT                   RRAQRDAANVQTLVEAYGPSVAALKALAPAILSPFEQKAVSKRVKAYVADGAPEALALS
FT                   VAALQPLTTAADLVDLANASSWSVENVARLYHQVGAAFGFDRLRGAAGSFVGGDAFERL
FT                   AVRRLIEDMLTEQTSITQQVLKFAANAQAGEDEAAAKAAISSWAALRGDRPRAVKRTIE
FT                   DIEQAGGGWTFAKLTIANAALRELSSAA"
FT   gene            complement(96456..96584)
FT                   /locus_tag="CCNA_R0002"
FT   ncRNA           complement(96456..96584)
FT                   /locus_tag="CCNA_R0002"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /experiment="EXISTENCE:ncRNA mapped by tiling arrays
FT                   experiments of Landt, et al. (2008) Mol Micro. 68;3:600-14.
FT                   doi: 10.1111/j.1365-2958.2008.06172.x"
FT                   /ncRNA_class="other"
FT   gene            complement(96628..97737)
FT                   /locus_tag="CCNA_00087"
FT   CDS_pept        complement(96628..97737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00087"
FT                   /product="PerM-family permease"
FT                   /note="CC_0089"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93554"
FT                   /db_xref="GOA:A0A0H3C5X4"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5X4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93554.1"
FT                   /translation="MPAPAPPSVTTRNAVVFLAVIAGAATLKWMQDILTPLALALFLAV
FT                   MIDSFARVLTDRTPRFPRRLALPTAVVLSLWLFGMSVWIVIDNGKEFFDHSSQYVDSLN
FT                   AIIARFTPTIARLAPGLELSVAPTIGDLVKHLNPQRYFGDVAQSFNSFATSAILVLIYL
FT                   GFILASRRGFARKIVALFPHHAERETNMKMFQRIRDGVEQYLWIQTVTGLMIAASAFMV
FT                   MTLVGLDNAFFWAFLIFLAAYIPILGGAIGCFLPPIFALIQFPESLWPAVLLFVALQGI
FT                   FFVVGNVILPRMQGDSLNMDPTVVLLSLAVWGALWGVPGMFLSTPLTVAAMVILAQFEG
FT                   SRWIAILLSEDGDPQGVPEIPAADVAQKK"
FT   gene            97841..99385
FT                   /locus_tag="CCNA_00088"
FT   CDS_pept        97841..99385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00088"
FT                   /product="HerA helicase-related ATPase"
FT                   /note="CC_0090"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93555"
FT                   /db_xref="GOA:A0A0H3C2P9"
FT                   /db_xref="InterPro:IPR002048"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033186"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2P9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93555.2"
FT                   /translation="MPLSISENEILVGLGEGPVTQRLDRSNRHGVVAGATGTGKTVTLQ
FT                   VLTQAFSDAGVPVFAADVKGDLSGVAIPGTPNEKMLARAASMDLVLAPAAPPVIFWDLF
FT                   GQKGHPIRTTISEMGPLLLSRLLELNDVQEGVLTIAFHVADKDGLLLLDLKDLQAALKY
FT                   VADNADEIGTQYGNVAPATVGAIQRKLLTLQTQGAEHFFGEPALDLSDIMRTDAAGRGY
FT                   VSLLAADRLIQSPKLYSTFLLWLLSELFEVLPEVGDPEKPKLVFFFDEAHLLFNDAPKP
FT                   LLEKIEQVVRLIRSKGVGIYFVTQNPADIPDGVLGQLGARVQHALRAYTPADQKGLKAA
FT                   AQSFRVNPGFDTAETIQALGVGEALVSTLDEKGAPRIVQKTLIRPPASRLGPLTPQERA
FT                   ALHAESPVAGVYDTAEDRDSAYEILQGRAAQAQRQAEAERQETEADQRAAAEAKVRERE
FT                   AAREARESRPRASGRQTMVEAFAVTLVRTVASQAGRELMRGLLGGLSGGASRRRRR"
FT   gene            complement(99466..101895)
FT                   /locus_tag="CCNA_00089"
FT   CDS_pept        complement(99466..101895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00089"
FT                   /product="MHYT/PAS-family GGDEF/EAL protein"
FT                   /note="CC_0091"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93556"
FT                   /db_xref="GOA:A0A0H3C3R3"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3R3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93556.1"
FT                   /translation="MTLKERCVFKLLTCLTTQHDLRLVLVASAVCLAGCFTTFRLYSRM
FT                   RGARGVVRAAWLLLTGLVAGSSVWATHFIAMVAFTPGLKTGYSPTGTLLSLMIAALFMA
FT                   SGFAVASAQRSTTNDFAGGVLIGLGVAAMHYMGMSAFVTQGQLVWEHATVGMSAVLGVG
FT                   GATAALLLAGTARTIRRQAVGGGMLCLGIVMLHFTGMSAITIVPDASLTVPDQLLSGGM
FT                   LTLAVGSITSMIILGGLGAVAIESQTSRSALERIRRLANAAYEGLVVVQSGRINDANAA
FT                   FCDLVGAPLAELVGRPLFGEILTFDEADPSREDVRREGRLRPLVGGREIPVEVFSRLMD
FT                   DGARVETSGLTVLAVRDLRERRAAEEKIRYLAEHDGLTGLLNRNSLQMRLAAAIDRVEA
FT                   SGESLAVICIDLDHFKEANDQHGHLAGDALLVETARRLQSAVQAPSFAARLGGDEFIVV
FT                   QIAGGDQPAVAAELAGRLIEMLAAPVPFDGQELAMGSSLGVSLYPDDGRTAEALMANAD
FT                   MALYRAKESGRGVYRFFKREMDDTIRERRNLARDLRQGIADNELIVHYQPLARAADGEV
FT                   CGFEALVRWKHPTRGMIPPLDFIPVAEENGLIEALGDWVLRRACADAAAWEKPLRIAVN
FT                   LSPIQLHNPALPTLVHEVLITTGLSPSRLELEITESALFKDYQRALDNLRRLKALGVRI
FT                   AMDDFGTGFSSLSTLQSFPFDKIKIDKSFVENIHRHDRATAIVRAVLGLGRSLEIPVVA
FT                   EGVETEEQILFLRGEDCAELQGYAIGRPAPVDALTMWTTAGDPGAIAPKSKTRRSA"
FT   gene            complement(101960..102943)
FT                   /locus_tag="CCNA_00090"
FT   CDS_pept        complement(101960..102943)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00090"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /EC_number="5.1.3.2"
FT                   /note="CC_0092"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93557"
FT                   /db_xref="GOA:A0A0H3C4G6"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4G6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93557.1"
FT                   /translation="MQTVLVTGGAGYVGSHCCLALAEAGFRPVVFDDLSNGHREHVQWG
FT                   PLEVGDIRDAARLDAVFAAYAPVAVLHFAARIEVGESVKNPGAFFDTNVGGTITLIEAA
FT                   RRAGVKVVVFSSTCATFGDPVDLPMKETHPQAPLNPYGRSKLMVEQALADYDRYVGLKS
FT                   AVMRYFNAAGADPQGRIGEWHEPETHAVPLAIQVALGQRPRFTIFGDDYDTRDGTAVRD
FT                   YVHVLDLADAHVAALKRLLVGGSSETYNLGTGTGTTVRELVDGVGKVAGAPLPVEIASR
FT                   RPGDAPVLVGDHAKARAELGWKASRSLDEILSTAWRWHRGRLEQEP"
FT   gene            complement(103149..104042)
FT                   /locus_tag="CCNA_00091"
FT   CDS_pept        complement(103149..104042)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00091"
FT                   /product="transporter, drug/metabolite exporter family"
FT                   /note="CC_0093"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93558"
FT                   /db_xref="GOA:A0A0H3C575"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C575"
FT                   /protein_id="ACL93558.1"
FT                   /translation="MTLSPNLRGALWMLASAVGFTVMTTLIKFLGDDYPAALQTFYRQL
FT                   AGVLVLLPLIARDWRGAFRTTRPGIVIFRSSAGVLALIMSFYAYQKLPLADANALSFTR
FT                   TLWLVPLAGLVLREPIGPRRISAALVGFVGVLIMLQPGAGGVEAWLGWPQLCALGAAFL
FT                   FALTITGMKVMTRDHTPFVLLVYAAVLGLVFAIPPALFVWRWPTWPDLGLLAAMGVIGT
FT                   LTQGAYIKGMEAGEAAVMAPVDYTRLVFAVIVGFLLFQEVPRTATVVGAVIVVGSTLFI
FT                   SWREHQLAKQAAAEPT"
FT   gene            complement(104039..104929)
FT                   /locus_tag="CCNA_00092"
FT   CDS_pept        complement(104039..104929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00092"
FT                   /product="short chain dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="CC_0094"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93559"
FT                   /db_xref="GOA:A0A0H3C5X9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5X9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93559.1"
FT                   /translation="MVGRLNGKVAVITGGCSGIGLGTVELFVAEGACVVAADLQDEKGR
FT                   MLEQRFPDQVRFARCDVTADDDLAKTMALAESSFGGLDILFNNAGHGGTPASVPELTAE
FT                   AWDKTFALLVRGPAMGMTHALPLMQKRGGGSIINTASIAGLQAGFGPLAYSSAKAAVIH
FT                   MSRCAAAELSPQKIRVNAICPGLIATSIFGASMGLPREVADQMAAQIASIGPKIQPIPK
FT                   SGLPEDIAAAALYLASDDSRFVTGTHIVVDGGITVGPRSAWDINTPSPILAAMGITPEQ
FT                   AEQMRAQLLAAGGTG"
FT   gene            complement(105028..105237)
FT                   /locus_tag="CCNA_00093"
FT   CDS_pept        complement(105028..105237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00093"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00093"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93560"
FT                   /db_xref="GOA:A0A0H3C2Q5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2Q5"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93560.1"
FT                   /translation="MGLDIRVMTLEAKERSSFAHRAVAALGLVSLGLAWAVLLVPCMLW
FT                   LAVTHLGRRMEPLARRPAPEGLKS"
FT   gene            complement(105310..106230)
FT                   /gene="hfsJ"
FT                   /locus_tag="CCNA_00094"
FT   CDS_pept        complement(105310..106230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfsJ"
FT                   /locus_tag="CCNA_00094"
FT                   /product="WecG/TagA-family glycosyltransferase HfsJ"
FT                   /EC_number="2.4.1.-"
FT                   /note="CC_0095"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93561"
FT                   /db_xref="GOA:A0A0H3C3R6"
FT                   /db_xref="InterPro:IPR004629"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3R6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="required for production of the holdfast polar
FT                   adhesin[doi: 10.1371/journal.pgen.1004101]"
FT                   /protein_id="ACL93561.1"
FT                   /translation="MFVPQEQSGLNEAAPAAPRRPYRLSRRPEERVHVLGGTMDLVRPE
FT                   EVFHFVTGKLEARQNAIVANHNLHSLYLIGKDHQIGQFYKAADLIEVDSVPLIFWARLV
FT                   GRASRRFHRCTYLDWRDAFWALASEKNWKVFFVGGAPGVGEKAVERIRQDWPNARIETH
FT                   HGYFDATQGSAENTAVVAKIRDYAPDIVLVGMGMPRQEIWTLENHQAYGPAATFTVGGA
FT                   FDYEAGVQKAAPRWMGPLGMEWLFRLMSDPQRLFFRYCIEPWSLIGPACGDVVRALSRR
FT                   STTGESRAAENARWEQIRARNEAAR"
FT   gene            complement(106334..107332)
FT                   /locus_tag="CCNA_00095"
FT   CDS_pept        complement(106334..107332)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00095"
FT                   /product="quinone oxidoreductase"
FT                   /EC_number="1.6.5.5"
FT                   /note="CC_0096"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93562"
FT                   /db_xref="GOA:A0A0H3C4H1"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4H1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93562.1"
FT                   /translation="MKAVLSKEVGGPETLVLEELPDPVAGAGQVLIDVKACGVNYPDVL
FT                   IIEDKYQFKPTRPFAPGGEVSGVISAVSEGVTRFKVGDRVLASTGWGGYAEKLALEEGR
FT                   CTHIPDNMPFDEAAAFVLTYGTSYYALKERGALKAGETLLVLGAAGGVGLAAVELGKAM
FT                   GAKVIAAASSQEKIDLAIKHGADSGVVYPRGPFDKDGQKELANLIKGACGPDGWDVAYD
FT                   AVGGDYSEATIRAAGWNGRFLVIGFPSGIPKIPLNLTLLKSCDIVGVFWGAAVARDPKG
FT                   HAQNLKELMDLYAAGKIRPYVSERFPLARAGEAIAHLSSRKAMGKVVITVD"
FT   gene            107402..108280
FT                   /locus_tag="CCNA_00096"
FT   CDS_pept        107402..108280
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00096"
FT                   /product="L-asparaginase"
FT                   /EC_number="3.5.1.1"
FT                   /note="CC_0097"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93563"
FT                   /db_xref="GOA:A0A0H3C578"
FT                   /db_xref="InterPro:IPR000246"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C578"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93563.1"
FT                   /translation="MSNKRFSLALHGGAGAKRGHDYGVEIAHMRGLVEAARDRLAAGAG
FT                   ALDVAVETVVGLEASGLYIAGKGASPNADGEYELDASLMDGATLRAGSVAALQGFKSPI
FT                   LAARAVMEHTPHVMLAGQGAIAFAREQGLETVEDPDAWFTRAGAFEDNHPPDALPTGTV
FT                   GCVVRDGEGRLAAATSTAGVFGKRPGRVGDSPIIGAGAWADGHAAVSCTGQGEYFIRAA
FT                   VAAQIAHRVRFGGEALDAAAQAAIDSVAALGGHGGLIAVDRDGNIAMPFVSSGLKRAAL
FT                   MPDGTIVSAAF"
FT   gene            108334..108792
FT                   /locus_tag="CCNA_00097"
FT   CDS_pept        108334..108792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00097"
FT                   /product="hypothetical protein"
FT                   /note="CC_0098"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00097"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93564"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Y6"
FT                   /protein_id="ACL93564.1"
FT                   /translation="MSRPLPPPSAAPTPPPLGGGFRTRHRCFTRPAAEVMERDAERRTS
FT                   VRKNLINTVSTKPDAPRSRYPPASREGGPVRALPGPGRFRFRQRPAIEEGRTLSRDHAD
FT                   GGRVSPASSAPDRSSTPLEPVPARPPPAATMVAGHAPFPRDEVGPLCG"
FT   mobile_element  complement(108427..108932)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            complement(108943..109233)
FT                   /locus_tag="CCNA_00098"
FT   CDS_pept        complement(108943..109233)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00098"
FT                   /product="hypothetical protein"
FT                   /note="CC_0099"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93565"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2R0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93565.1"
FT                   /translation="MGFSRRPPIDPGRAHAPPEYTAEEIDEVLTALRAEAPEALALVER
FT                   EARTPGSVPMSDHDDAYDRLLTVLFERGFVHTHIEMAMVFRAVRERSGKTV"
FT   gene            complement(109239..110969)
FT                   /gene="fzlC"
FT                   /locus_tag="CCNA_00099"
FT   CDS_pept        complement(109239..110969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fzlC"
FT                   /locus_tag="CCNA_00099"
FT                   /product="FtsZ-binding protein FzlC"
FT                   /note="CC_0100"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93566"
FT                   /db_xref="GOA:A0A0H3C3S1"
FT                   /db_xref="InterPro:IPR008929"
FT                   /db_xref="InterPro:IPR012480"
FT                   /db_xref="UniProtKB/Swiss-Prot:A0A0H3C3S1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93566.1"
FT                   /translation="MAGKPPVLGLAFPARLRGGVLWKAIRAEAAGHVEREWFGSGPHRL
FT                   KIALPRPEGLSARPHDPRPVDPAHGQKILSGALTLDGGALRLGVDGDPFDTASPSRRFA
FT                   VSLHRFDWLPDLVAVGPDGARRALRLIDDWRRVFGKWNAFSWGPECLERRVHHLACAAK
FT                   TLAAEASDAEVADLVFDLARQGRHLLEITRAPERTLERAVAAGLAGCVLAGKPGEPLID
FT                   AALKALVPQLDAMVLGDGGHATRSPEAGVELLFDLLTLDDALGQRGRPSPEALSRAIDR
FT                   LSSATRFFILGDGHLAAFHGGETVGPARIAAALAHDDAGPRSLNAAPHSGYHKMIGGSI
FT                   EVIADCGPPPVGPLSVNACAQPAAFEIVCAKDRLITSCGWSPEAAGAHAFRLSDAASTV
FT                   SVADGSAGRPLSGFRAKALGPWLVDGAAKVEAKRHDDVGGVWLDIVHDGWRHLGLTHAR
FT                   RLFLDAVQDELRGEDSLSPLALDPKAAEGPRRYLPFAVRFHLHPDARASIARDGKSVLI
FT                   RGPSNIGWWLRNDAVDVEIAPSAHFDHGLARKAGQIVLKSQVRPEVGAKIRWKLTKAEG
FT                   "
FT   gene            complement(110979..111638)
FT                   /locus_tag="CCNA_00100"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(110979..111638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00100"
FT                   /product="Ribulose-5-phosphate 3-epimerase"
FT                   /EC_number="5.1.3.1"
FT                   /note="CC_0101"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93567"
FT                   /db_xref="GOA:A0A0H3C4H5"
FT                   /db_xref="InterPro:IPR000056"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR026019"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4H5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93567.2"
FT                   /translation="MTAPIIAPSILASDFAKLGEEVAAIEAAGADWVHVDVMDGHFVPN
FT                   ITLGPDIVKAIRPHAKIPFDVHLMISPADPYLEAFRAAGADLISIHPEAGPHLHRSLKR
FT                   IRELGAKAGVVFNPSTGIDHVEWILEDVDLLLVMSVNPGFGGQSFIPGQLRKVEALRKM
FT                   VDKAGLDIIIEVDGGVTPVTAPQCVAAGATALVAGSAVFKGGPAAYADNIRALKGG"
FT   gene            complement(111745..113034)
FT                   /gene="rsmB"
FT                   /locus_tag="CCNA_00101"
FT   CDS_pept        complement(111745..113034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rsmB"
FT                   /locus_tag="CCNA_00101"
FT                   /product="16S rRNA m5C methyltransferase RsmB"
FT                   /EC_number="2.1.1.-"
FT                   /note="CC_0102"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93568"
FT                   /db_xref="GOA:A0A0H3C582"
FT                   /db_xref="InterPro:IPR001678"
FT                   /db_xref="InterPro:IPR006027"
FT                   /db_xref="InterPro:IPR018314"
FT                   /db_xref="InterPro:IPR023267"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035926"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C582"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93568.1"
FT                   /translation="MTQELNDGLPAREAALTLIDAALSRRGGLDEAASANGFRFLEPRE
FT                   RAFARALAMAVLRHLGPIDRALTARLQKAPPDRVMHLLRLGAAQAFYLEVPAFAAVATS
FT                   VELAGANKTSRPFKGLVNAVLRGLLRDAPPADDPSLLAPPWLYARWVAAFGEATARQIA
FT                   GQIAIEPATDLSAKPGADLAPLVEALEAEVLPGGTLRLRRKGDVAAWPGFEDGTWWVQD
FT                   AAAAVPARLLDVQPGASVLDLCAAPGGKTLQLAAAGAQVVALDRSAARLKRLSENLTRT
FT                   GLSAEIVAADAAVWDDTRTFDAILLDAPCSATGTFRRHPDVLWAARPGDVASLANVQAR
FT                   ILDAAADRLKPGARLVYCVCSLEPEEGEAQVEAFLARRQDVALEPITAAEAPSAGFPEA
FT                   SLTPRGTLRLLPHHRDDGQDGFFAARFRKL"
FT   gene            113151..113375
FT                   /locus_tag="CCNA_00102"
FT   CDS_pept        113151..113375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00102"
FT                   /product="hypothetical protein"
FT                   /note="CC_0103"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93569"
FT                   /db_xref="InterPro:IPR012875"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Z3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93569.2"
FT                   /translation="MTDTPPPETDAAPEVPGAAPGKTLTPAARRALEEAAARRAAEAAL
FT                   SLPPEEGGRDGPEPTRFGDWEKKGVAVDF"
FT   gene            113463..115160
FT                   /locus_tag="CCNA_00103"
FT   CDS_pept        113463..115160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00103"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /note="CC_0104"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93570"
FT                   /db_xref="GOA:A0A0H3C2R7"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2R7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93570.1"
FT                   /translation="MRLFAPLAAALSAALLLVAPSVEAKPRSAAAAVRALEAGAVASPD
FT                   QYGALAAQEVLKAGGNAVDAAVATGFALAVTYPEAGNLGGGGFMTVYMDGKPYFLDYRE
FT                   TAPAAARADMYLGPDGELVEGLSLYGGLAAGVPGTVRGLAMAHQRFGKLPWGQVLAPAI
FT                   RYARDGFVVDAHLAGVLADEPPPEFAKTNFRTYFAAHKAGTLFKQPELAATLERIALVG
FT                   DRAFYEGKTADLIVAQMARGPVKGLITKADLSTYKAAWRTPLVAKWRGYDVITAPPPSS
FT                   GGIALMQLLLMKQNLAPMFQGVALNDPQYVHLLAEIEKRVYADRAEYLGDPDFVKVPVS
FT                   NLIDPAYVARRAKEVDPAKPSATKAVQPGLEKHETTHYSIVDQWGNAVSNTYTLNGSFG
FT                   SGVVVEGAGFILNNEMDDFSAKPGAPNMFGVVGGAANAIAPGKRPLSSMTPTILTKDGR
FT                   VAMVIGTPGGSRIFAWVFQVLANVYDHGLSLKAAQAAPRFHHQLLPQNVIFYERSGPPS
FT                   ADLKAALEARGYTWTESFSGDVEAIQVLGRTPVPEPDPRARGVGLVVK"
FT   gene            complement(115289..115990)
FT                   /locus_tag="CCNA_00104"
FT   CDS_pept        complement(115289..115990)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00104"
FT                   /product="orotidine 5'-phosphate decarboxylase"
FT                   /EC_number="4.1.1.23"
FT                   /note="CC_0105"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93571"
FT                   /db_xref="GOA:B8GXJ5"
FT                   /db_xref="InterPro:IPR001754"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR014732"
FT                   /db_xref="InterPro:IPR018089"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXJ5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93571.1"
FT                   /translation="MTADPRLIVPLDLPTVDDARAMVERLGDAVSFYKIGLELLASDGM
FT                   GLAHDLKASGKSIFLDWKLHDIGATVERSARVLATSGCDLLTVHAEPQVMQAAVKARGD
FT                   SSLKILAVTVLTSLTDADLVEMGYAFTARDLVERRVRQALACGVDGIVSSPHEAALARE
FT                   IANDAGQPEFLIVTPGVRPEWSAKNDQARAATPADALRAGATHLVCGRPITAANDPREA
FT                   ALKVVTEMAGI"
FT   gene            116088..116786
FT                   /locus_tag="CCNA_00105"
FT   CDS_pept        116088..116786
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00105"
FT                   /product="MarC family integral membrane protein"
FT                   /note="CC_0106"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93572"
FT                   /db_xref="GOA:A0A0H3C3S7"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3S7"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93572.1"
FT                   /translation="MTEANLAVNFFVALFALIDPIGNVPLFAAATLGAAAAGRRMVAVY
FT                   IGLFMAAFLIFFYFTGVGLLEFFGISMPAFRIAGGIILFILGLDMVRDDFTTMFADAAE
FT                   GIEDQSPRAYAKQRFERLIVPFAMPLLIGPGSISTVIIYAAEAKDFGAAGMGIGVAVIA
FT                   AVSLVTVLTFWASPLVSKVLGRIGMSIVVRVLGLILCALAVQFVLVGVADATRGLIKND
FT                   AKAPYAESHK"
FT   gene            116834..118099
FT                   /locus_tag="CCNA_00106"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        116834..118099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00106"
FT                   /product="2-polyprenyl-6-methoxyphenol hydroxylase"
FT                   /EC_number="1.13.-.-"
FT                   /note="CC_0107"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93573"
FT                   /db_xref="GOA:A0A0H3C4H9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR010971"
FT                   /db_xref="InterPro:IPR018168"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4H9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93573.1"
FT                   /translation="MRAPNAPSHDADVIIAGAGMAGSTLALALASGGLRPLLVDPAPFE
FT                   AQLAPTFDGRSSAIAYSSFRQWRAIGAGQALEPHAQRIEQILVTDGRTPGAAARKPLPA
FT                   FLRFDSSEISGRIEGEPLGYLVENRQIRAALSKAVIDKNIPVIAPMAAKALSVEPGAAK
FT                   LTLSDGRVLTAPLAVSAEGRGSVLRRAAGIGDIGWSYGQSGVVCTVRLERPHEGVAHEY
FT                   FLPSGPFAILPLTDNRASLVWTESTARGEALRQAGPEAFHAHLMRRFGDFLGAVSIEGP
FT                   IFVYPLSLSLAERMVAPRLALIGDAAHGVHPIAGQGLNLGLKDAAALAEVLVEAVRHGE
FT                   DIGAEAVLERYARWRRFDTVTNALAFDAFVRIFSNDNPLLRLARGAGLAVVNQIAPARR
FT                   FFMHEAGGGVGDLPKLLRGQAL"
FT   gene            complement(118260..118457)
FT                   /locus_tag="CCNA_00107"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(118260..118457)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00107"
FT                   /product="Trm112p-like protein"
FT                   /note="CC_0108"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93574"
FT                   /db_xref="InterPro:IPR005651"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXJ8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93574.1"
FT                   /translation="MTEASAPLIDVDPRLLEVLVCPVTRGPLEYDRAKGELISRAAKLA
FT                   YPIRDGVPIMLPEEARELEG"
FT   gene            complement(118467..119144)
FT                   /locus_tag="CCNA_00108"
FT   CDS_pept        complement(118467..119144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00108"
FT                   /product="lon endopeptidase-related protein"
FT                   /EC_number="3.4.21.53"
FT                   /note="CC_0109"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93575"
FT                   /db_xref="GOA:A0A0H3C586"
FT                   /db_xref="InterPro:IPR003111"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C586"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93575.1"
FT                   /translation="MPVAYRKIDDLPLVIPVFPLDGVLLLPSGQLPLNIFEPRYLNMLD
FT                   DAMSGERMIGMIQTRPLPGGKGDPQRPALAPVGCAGRVTSFAETSDGRYLITLTGVCRF
FT                   RTGEELPVRTPYRQVRADFAPYQADLREDAAGTRTASEIDRLMTALRRYLDHRGLAIDW
FT                   SDAEAAPSDALINSLAMALPFDPMEKQALLEAETIFERKATLTALLEIDAAGGDDDEPT
FT                   SIQ"
FT   gene            complement(119160..120059)
FT                   /locus_tag="CCNA_00109"
FT   CDS_pept        complement(119160..120059)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00109"
FT                   /product="thioredoxin"
FT                   /EC_number="1.8.1.-"
FT                   /note="CC_0110"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93576"
FT                   /db_xref="GOA:A0A0H3C5Z7"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Z7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93576.1"
FT                   /translation="MSLIGEKPAPSSKSDHIKDGTDASFMADVIEASKTQPVIVDFWAT
FT                   WCGPCRQLTPTIEKVVTAAKGAVKLVKIDVDKNPGFAGQLRVQSIPTVYAFVDGRPVDA
FT                   FQGALPESQVRAFVEKLAGAAEGGALDEIIAMGKESLEIGDLGGAAQAFAQALQIDPTS
FT                   AKALGGMARVYLANGDPEGAAEVVAMAPADAKDPDLDAARAALALAAEAPSETAAFEQR
FT                   LAADPDDHEARLELAKALAGVGRLQDAADHLLTIIARDRTWNDDAARKQLLTVFEAAGP
FT                   TSEVAKQGRRKLSSILFS"
FT   gene            complement(120169..120675)
FT                   /locus_tag="CCNA_00110"
FT   CDS_pept        complement(120169..120675)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00110"
FT                   /product="RNA-binding protein ProXp-ala"
FT                   /note="CC_0111"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93577"
FT                   /db_xref="GOA:A0A0H3C2S2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2S2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93577.1"
FT                   /translation="MKTRADLFAFFDAHGVDHKTLDHPPVFRVEEGLEIKAAMPGGHTK
FT                   NLFLKDAKGQLWLISALGETTIDLKKLHHVIGSGRLSFGPQEMMLETLGVTPGSVTAFG
FT                   LINDTEKRVRFVLDKALADSDPVNFHPLKNDATTAVSQAGLRRFLAALGVEPMIVDFAA
FT                   MEVVG"
FT   gene            120752..121498
FT                   /locus_tag="CCNA_00111"
FT   CDS_pept        120752..121498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00111"
FT                   /product="hypothetical protein"
FT                   /note="CC_0112"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93578"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3T1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93578.1"
FT                   /translation="MELECYPTENRPPEIVPGRPQRAWMDRFAERHPYRCLPLTMANTT
FT                   GWDILCPVGFTATWDGGAHQECIKFQPDHPYPGFHDFVKSHFTRGVVTFHTGYLFRTPP
FT                   GWSLMAMGPPNHVKDGIQPLAGVIETDWLPFPFTMNWIFTRPGTVRFEKGETFCFIMLI
FT                   QDKPMEAFQPVIRSMNSNPELRRQYDVWAEKRTEFNNLIFKRDPEATKEAWQRFYFKGE
FT                   YPEEIQAEAPSHHVNKRRMKAPKVGV"
FT   gene            121503..121892
FT                   /locus_tag="CCNA_00112"
FT   CDS_pept        121503..121892
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00112"
FT                   /product="glyoxalase family protein"
FT                   /note="CC_0113"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93579"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4I4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93579.1"
FT                   /translation="MAALAYATVGSNRLEEAKVFYDALLGAVGIPPLFDHPSGGRVYGV
FT                   GAPNFAVLGPFDGAPATVGNGAMFAFRFDTRAEVDLFHATALSLGGTCEGAPGERGPGW
FT                   WFCYVRDLDGNKLCAHCLATPGADQ"
FT   gene            121972..122544
FT                   /locus_tag="CCNA_00113"
FT   CDS_pept        121972..122544
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00113"
FT                   /product="hypothetical protein"
FT                   /note="CC_0114"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93580"
FT                   /db_xref="GOA:A0A0H3C590"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C590"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93580.1"
FT                   /translation="MEGPMAITRNEAAAALSDIENTQRRGMTLRGYRLGGPILMMWSLI
FT                   WAAGYLTMGLAPPELWLPVWLGLDVVGVAGALLLARTGKPAAAGAPPGMTWRLLGGSLS
FT                   MMVFALSVFWVMKPTDPAAAMAFPGLLIGVIYAVVGFWAAPRYAVIGALMFALTLIGYF
FT                   LFQPWLAFWMAAASGALFLSGVWLWRR"
FT   gene            122547..122852
FT                   /locus_tag="CCNA_00114"
FT   CDS_pept        122547..122852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00114"
FT                   /product="MarR/EmrR-family transcriptional regulator"
FT                   /note="CC_0115"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93581"
FT                   /db_xref="InterPro:IPR027395"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C604"
FT                   /protein_id="ACL93581.1"
FT                   /translation="MADSDDIIHQPLRLKIMAALSAEKGQPLDFPRLKTITKATDGNLG
FT                   SHLATLEKAGYVVIEKDFVGKRPRTQAKLTPQGRKAFRAHVDYLRSVVEAAEDEGG"
FT   gene            122939..126268
FT                   /locus_tag="CCNA_00115"
FT   CDS_pept        122939..126268
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00115"
FT                   /product="TolB protein"
FT                   /note="CC_0116"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93582"
FT                   /db_xref="GOA:A0A0H3C2S9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011659"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2S9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93582.2"
FT                   /translation="MDRRLTALAALLLMSGSALAHQALAQTAPASAPPAATAKADKPEK
FT                   WNVNAPPGVATREVRISVDNGTWMNVDVSRDGKLIAFDILGDIYTMPITGGTPTRIAEG
FT                   LAYDQQPRFSPDGKRIAFTSDRGGGDNIWVMNLDGGDKRQVTKEEFRLLNQPSWSPDGR
FT                   FIVAKKHFTTGRSLGTGEVWVYHVSGGGGVQLVKRASEQLQKELGEPIYAADGKSVFYT
FT                   RNVTPGPIFEYAQDSNTALFDIERYDLETGEVTTAVSGLGGSVRPTPSPDGKKIAFVRR
FT                   ERTKSKLYVKDLTSGEERKIYDALDQDVQETWAVTGVYPNMAWTPDGAAVVVWAGGKIR
FT                   RVNVADGASSVIPFKIDDTRVVIDAIHPEVAVAPDRFTTKMPRWASVSPDGKSVVFETL
FT                   GKLWIKSTAGGEARRLVSGDEDAFELYPSWSRDGRTIVFVSWTDAGLGRLRTVPAAGGV
FT                   GKDVIAQPGHYGAPRFSPDGKTIVFERRRGGGLTSGRWSQDPGIYRVAAAGGTPVRVSR
FT                   GGSEPQFGAANDRVFMLMSSGDKRQLVSTDLNGQARRVHASGDMVNDFQVSPDGRNVAF
FT                   RQNYEAFVMPLMPGTQEVAVDQKGGALPVTRVSAEGAEFIHWSRDGKQVHWSMGPTLFT
FT                   AETEALYASAPAADGAGKDDGKFKPVKTGLSLSMEVAADKPTGVVVLTGARVVTMADTS
FT                   GGIIDDGVIVIKGDRIVAVGPKASTPVPADAKVVDVTGKTIIPGLVDAHAHGPQGTDDL
FT                   IPQQNWSAMANLALGTTTIHDPSSRASMIFPAAELQRAGKILAPRTFSTGEIIYGAKAA
FT                   EVYAEINSLDDALAHVRRLKAQGAHSVKNYNQPRRDQRQMVVVAAQKENMEVVPEGGSL
FT                   YNMDVTLIQDGNATVEHNVPVDRFYDDIVSLWSQTKTNYTPTLVVAYGGPAGDPYWRQH
FT                   MDVWRHPLLSKHAPPALLAAQNVRRTAAPEEDYVDGAAAREAKKLADRGVQVAIGAHGQ
FT                   QAGLGSHWEMWSFARGGWSPVEALAAGTINAARSLGYAKDVGSLEIGKLADLLVLDADP
FT                   TVDIRNSDKLHRVMLGGRLYDAATLNETVTGQRVRQPYWWERSGEVWSGGSGGSGHTDD
FT                   VG"
FT   gene            complement(124027..124282)
FT                   /locus_tag="CCNA_R0099"
FT   ncRNA           complement(124027..124282)
FT                   /locus_tag="CCNA_R0099"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(126407..127753)
FT                   /locus_tag="CCNA_00116"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(126407..127753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00116"
FT                   /product="phosphoglucosamine mutase"
FT                   /EC_number="5.4.2.10"
FT                   /note="CC_0117"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93583"
FT                   /db_xref="GOA:B8GXK7"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR006352"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXK7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93583.1"
FT                   /translation="MSKRAYFGTDGIRGQANKHPMTAEVALRVGLAAGKLFRSQDERRH
FT                   LVVIGKDTRLSGYMIEPALVAGLTSVGLDVRLFGPLPTPAVAMMTRSMRADLGIMISAS
FT                   HNSFADNGIKLFGPDGYKLSDAQELGIEALMDQGLQEGLAAPRELGRVKRIDDAQARYV
FT                   EIVKATFPRHLNLSGLRIVIDCANGAAYKVAPTALYELGAEVITLGVSPDGTNINEECG
FT                   STHPEAMAKMVREYRADIGIALDGDADRLVICDEKGVVVDGDQIMAIIAAASHKAGTLK
FT                   GGGVVATVMSNLGLERQLNTMGLSLERTAVGDRYVMQRMREGGFNVGGEQSGHLILSDF
FT                   STTGDGLIAALQVLAVMVETDKPMSALGRQFEPVPQLLENVRFVGGKPLEAAAVKEAIA
FT                   DGEAQLNGAGRIVVRASGTEPLIRIMAEGDDPALVKKVVKSIASAVKAA"
FT   gene            127915..129735
FT                   /locus_tag="CCNA_00117"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        127915..129735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00117"
FT                   /product="glucosamine-fructose-6-phosphate
FT                   aminotransferase, isomerizing"
FT                   /EC_number="2.6.1.16"
FT                   /note="CC_0118"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93584"
FT                   /db_xref="GOA:A0A0H3C3T5"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR005855"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3T5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93584.1"
FT                   /translation="MCGIIGIVGKEPVADRLIESLKRLEYRGYDSAGVAGVVGGKVERR
FT                   RAQGKIKALEAVLADEPLTATTGIGHTRWATHGAPNVRNAHPHTAGRVTLVHNGIIENF
FT                   AELKAELAGMGRTFESDTDTEVIAQLIDVALAKGLAPLDAFKATLDRLTGAYALAVLIQ
FT                   GEADLLLGARRGSPLVVGEGQGEMFLGSDALAVGPFTNRVIYLEEGDYVALDHDSRRIF
FT                   DASGARVERPVRVVPTSSVMLEKGNYRHFMEKEIHDQPEGCQRTIAAYVDTLTSKAAVP
FT                   GDIDFATLDRIQIVACGTSYIAGVIGKYLIEQLADLPVDVEIASEFRYRTPALRPGSLV
FT                   VAMSQSGETADTLAALRYCKAKGMKSAVVVNAQESTMAREVDVVWPIHCGPEIGVASTK
FT                   AFTAQVSVMIALAIAAAKARGTIDAAEEQRLVKVLLEAPRLIAEAIGLEDAIKEIAADV
FT                   AKARDVLYLGRGPMSALALEGALKLKEISYIHAEGYAAGELKHGPIALVDDQTPIVILA
FT                   PYDSYFEKSASNMSEVMARGGQVIFITDTEGVKHAPAGAKVVVTAPASDPLVSTLVMSA
FT                   PIQLLAYHVAVVKGADVDQPRNLAKSVTVE"
FT   gene            129746..131989
FT                   /locus_tag="CCNA_00118"
FT   CDS_pept        129746..131989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00118"
FT                   /product="porphyrin biosynthesis protein"
FT                   /note="CC_0119"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93585"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029489"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4I9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93585.1"
FT                   /translation="MRLTVDQALAQAIAAHRSGQLQDAERLYRAILDAAPGHADANHNL
FT                   GVLAVGVGKPQAGLSFLKAALEINPAQGQFWVSYIDALIAAGLPAAARDHLEQAKRRGL
FT                   TGDAVERLEKRLDPASQPPQALLDSVVAQYRSGNLAAAESQAHALTLSFPNHELGWKVL
FT                   GAVFSVTGRSEESLASMRQALSLNPQDAETFKNLAILLLKLKRAEEAEAACRSALALAP
FT                   DYPQVHLTLGNALIDLARAAEAEESFRQAIRLKPDYSEAHCNLGCALKLSGRLTEAETC
FT                   FRRAIQLNPADAQAHNNLGDVFKDLGRFADAEAFYRAAIGLKPEYLEAHSNLLLCLNYF
FT                   ETSSPDTYLAEAKQYGSVASAAATPKFSAWSIQPEPRRLRVGFISGDLNSHPVGYFSES
FT                   VFQHLDRDRFELFAFPTTPKTDALTSRISPFFAGWCPIFGMDDHAAATAIHTQGVHVLV
FT                   DLSGHTADNRLPVFAFRPAPVQASWLGYFATTGLPEMDYFLGDRYMVTETEQQRFTETL
FT                   WRLPETWLCLAPHERSIPINPPPVLTNGFMTFGCLGNLSKMNGEVVALWSQILRAVPES
FT                   KLLLKAKPFVDAQVVADIQARFAREGVSSDRLILEGPSSRAEYFETYNRIDLVLDTFPY
FT                   PGGTTSVDALWMGVPVLTLAGDRFLARLGESIARNAGQSAWVARDRADYLAKAVAFASV
FT                   RDVAHDRPALRRSVLTTPLFDPERFARDFGDTLWGMWSQGRSHPLRKDAPCRS"
FT   gene            131977..132438
FT                   /locus_tag="CCNA_00119"
FT   CDS_pept        131977..132438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00119"
FT                   /product="hypothetical protein"
FT                   /note="CC_0120"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93586"
FT                   /db_xref="InterPro:IPR023370"
FT                   /db_xref="InterPro:IPR036413"
FT                   /db_xref="InterPro:IPR036414"
FT                   /db_xref="InterPro:IPR040372"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C592"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93586.1"
FT                   /translation="MSILMTPIGRVQGGRTVPEDDDWGDSRARIVLDPARFDDEALMGL
FT                   DSFSHAEIVYVFDKVGDDQIVTGARHPRGNKDWPRIGIFAQRGKNRPNRIGVTVCEIVS
FT                   VAGRVLEVRGLDAIDGTPVLDIKPVMSGFAPRGEVREPDWAKAIMEQYW"
FT   gene            132435..132953
FT                   /locus_tag="CCNA_00120"
FT   CDS_pept        132435..132953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00120"
FT                   /product="putative acetyltransferase"
FT                   /note="CC_0121"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93587"
FT                   /db_xref="GOA:A0A0H3C608"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C608"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93587.1"
FT                   /translation="MSAGLVVSRAGADEAAIIANLMQFYLHDFSELWFDRAVEGELGPD
FT                   GRYSGYPGLETYWRDPVREAWLFRIGGLPVGFALVNDLAHSPTPIDRAVAEFFVVRKHR
FT                   RRGVGLAAAHALFGSAWGVWQAATVRRNTAARAFWRRVAETYPGVRDVVEEDRQDARWD
FT                   GAVLTFRVG"
FT   gene            complement(132950..133408)
FT                   /locus_tag="CCNA_00121"
FT   CDS_pept        complement(132950..133408)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00121"
FT                   /product="hypothetical protein"
FT                   /note="CC_0122"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93588"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2T4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93588.1"
FT                   /translation="MSLIAIGLAAALNLTTVPADAEDKAVLATTQAFFDGLEAADPAAM
FT                   RAAALPNIAMMALSTKPDGTVDVRRFAFEDSFGKKVAPGLKEWMWSPVVVRRGALATVT
FT                   GPFEITREGKTVHCGVNVFTLAKTEGAWKVASVSWTAEPDACPELRQR"
FT   gene            complement(133417..133827)
FT                   /locus_tag="CCNA_00122"
FT   CDS_pept        complement(133417..133827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00122"
FT                   /product="hypothetical protein"
FT                   /note="CC_0123"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93589"
FT                   /db_xref="InterPro:IPR010652"
FT                   /db_xref="InterPro:IPR016983"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3T9"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93589.1"
FT                   /translation="MSGDAKPSPDVNVNEVLDPAKALVPATVRVNEEKVREGFLPKIRK
FT                   VAAKIPFAADALSVWWAARDPETPIAAKGMMLAGLAYFVLPTDALPDVLPAIGFTDDAA
FT                   VIAALVAILGKTLKPRHKEAAQAFLARLSDDA"
FT   gene            133900..134682
FT                   /locus_tag="CCNA_00123"
FT   CDS_pept        133900..134682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00123"
FT                   /product="3-hydroxyacyl CoA dehydrogenase"
FT                   /EC_number="1.1.1.35"
FT                   /note="CC_0124"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93590"
FT                   /db_xref="GOA:A0A0H3C4J0"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4J0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93590.1"
FT                   /translation="MKLDNTVAAVVTGGASGLGEATARALAAQGVKVALFDMNEERGLQ
FT                   VAKEIGGVFCKVNVTSDADVDAGFEKARAAHGQERILVNCAGTGNAAKTASRDKATGET
FT                   KHFPLDAFDRIIQINLVGTFRCIAKSAKGMLDLEPLEDGERGAIVNTASVAAEDGQMGQ
FT                   AAYSASKGGVVGMTLPIARDLMGEGIRVNTILPGIFNTPLMNNAPEAVKAGLAASVPFP
FT                   KRLGHPEEYAQLALTMITCGYFNGEDVRLDGGIRMAPR"
FT   gene            complement(134826..135413)
FT                   /locus_tag="CCNA_00124"
FT   CDS_pept        complement(134826..135413)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00124"
FT                   /product="hypothetical protein"
FT                   /note="CC_0125"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C597"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93591.2"
FT                   /translation="MSIKKVALAAALVVTAGLAACATPTPYQPRITSGAVTGGFSEQKL
FT                   ESDRYRISFAGNSLTSRETVERYLLYRSAELTVQQGYDWFETADHRTDRTSRTYVEADP
FT                   FSRPGFGWGPYGYWRPAWRYYGPAYGWRTWDPFWGDPFFADRAQIRTIEKFEAGAEIVM
FT                   HKGQKPQGEPRAYDAREIMANLASTIVRPEAK"
FT   gene            complement(135509..136177)
FT                   /locus_tag="CCNA_00125"
FT   CDS_pept        complement(135509..136177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00125"
FT                   /product="amino acid efflux permease"
FT                   /note="CC_0126"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93592"
FT                   /db_xref="GOA:A0A0H3C614"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C614"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93592.1"
FT                   /translation="MVVHGGAAYIRAMDHLPVDPARYGAFLVAMFVMAITPGPANLFAI
FT                   ATGMEKGKGAALAGVAGMNCATLIWFIGSALGLGALIIAFPQAFHLLALAGAAYLVWLG
FT                   LKSLWAGWKNAESHAVAAVRGGKSAFVDGFAVQIANPKALLFFTAVLPPFLDVDRPLVP
FT                   QLLMFACATIGMDLISMSAYGVGGAALSDRMNEPGFRRGFAILVGVLLITAAGLIVSRG
FT                   "
FT   gene            complement(136184..136591)
FT                   /locus_tag="CCNA_00126"
FT   CDS_pept        complement(136184..136591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00126"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="CC_0127"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93593"
FT                   /db_xref="GOA:A0A0H3C2U3"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2U3"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93593.1"
FT                   /translation="MQQSHALVAIVTLLSLLVYVWMIFRIGGARRRTGIDGPAMTGDPE
FT                   LERHLRVQANTVEWLVIYLPSLWLFALYWNDLFAAAAGVVWIIGRILYALGYAADARKR
FT                   ELGFIIQMLATAVLLFGALGKAIYVYAVIGA"
FT   gene            136811..137011
FT                   /locus_tag="CCNA_00127"
FT   CDS_pept        136811..137011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00127"
FT                   /product="KTSC domain protein"
FT                   /note="CC_0128"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93594"
FT                   /db_xref="InterPro:IPR025309"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3U1"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93594.1"
FT                   /translation="MRVESTAITDIAYTPEHGKLFVTFHDGDEYVYVGVPERISAAFYR
FT                   SRSKGRFFQRIIRDRYPYNRV"
FT   gene            complement(137246..138472)
FT                   /locus_tag="CCNA_00128"
FT   CDS_pept        complement(137246..138472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00128"
FT                   /product="argininosuccinate synthase"
FT                   /EC_number="6.3.4.5"
FT                   /note="CC_0129"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93595"
FT                   /db_xref="GOA:B8GXL9"
FT                   /db_xref="InterPro:IPR001518"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR018223"
FT                   /db_xref="InterPro:IPR023434"
FT                   /db_xref="InterPro:IPR024074"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXL9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93595.1"
FT                   /translation="MADKSVKKVVLAYSGGLDTSIILKWLQTEYGAEVITFTADLGQGE
FT                   EIEPARAKALAAGVKPENIFIEDVREEFVRDYVFPMFRANTVYEGQYLLGTSIARPLIA
FT                   KKQIEIARKMGADAVSHGATGKGNDQVRFELGYYGLEPDITVIAPWREWDFKSREALLD
FT                   FAEKHQIQITKDKRGEAPFSVDANLLHSSSEGKVLEDPAVEAPEFVHMRTIAPEDAPDA
FT                   PTIITIDFEKGDPVAIDGVAMSPATLLTKLNELGRDNGVGRLDLVENRFVGMKSRGVYE
FT                   TPGGTILLAAHRGIESITLDRGAMHLKDELMPKYASLVYNGFWFSPEREMLQAAIDYSQ
FT                   DKVTGRVRVKLYKGNVTVIGRESPYSLYDQDLVTFEEGKVAYDHRDAGGFIKLNALRLR
FT                   VLAKRDKRG"
FT   gene            complement(138555..138917)
FT                   /locus_tag="CCNA_00129"
FT   CDS_pept        complement(138555..138917)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00129"
FT                   /product="hypothetical protein"
FT                   /note="CC_0130"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93596"
FT                   /db_xref="GOA:A0A0H3C4J6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4J6"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93596.1"
FT                   /translation="METALRILGDGLSIAALTIIATTAHGAWKRIPAGTSVPIVWGREG
FT                   KPALRLTKAAGLLWIPVASMAIIFAFTLSGTTFRAQGLEAVMVFCVRATLGAVLAMAQL
FT                   FHLRSVIKTLQDEGQL"
FT   gene            complement(138921..140918)
FT                   /locus_tag="CCNA_00130"
FT   CDS_pept        complement(138921..140918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00130"
FT                   /product="Kup system potassium uptake protein"
FT                   /note="CC_0131"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93597"
FT                   /db_xref="GOA:B8GXM1"
FT                   /db_xref="InterPro:IPR003855"
FT                   /db_xref="InterPro:IPR023051"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXM1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93597.1"
FT                   /translation="MASEAPHASAPDCAPASSDIPQQDGGSTNGHGHDLKGHGFFALAL
FT                   GSVGVVFGDIGTSPLYAFKEALAAASHDGVTRSEIFGVVSLALWALILIVTIKYVVFIM
FT                   RADNKGEGGVLSLMALAQHAMGKRTTLVFVLGVAGAALFYGDAVITPAMSVLSAVEGLR
FT                   TIPALEHGVTNEVVLLIATVMLLGLFFIQSRGTASVGKLFGPVCAVWFGVMFSLGLMNL
FT                   AANPGILMAISPYYAVEFLAEHGLTGFIVLGAVFLTVTGVEALTADMGHFGRWPIQAAW
FT                   LFFVLPCLAMNYLGQGAFALTTLETAQAAGKAMPELNWFFEMAPEALRLPLVLLAGAAT
FT                   VIASQAVITGAFSLTQQAIQLGLLPRLDVRRTSETQSGQIFVPQLNTMLLLGVLAIMFT
FT                   FQTSSALAHAYGLAVTGTMIVTTCMAFIVMRKLWKWSMPMALLFLVPFLALDITFLSAN
FT                   ALRFFSGGWLPVLIGAALFTIMATWVRGSQILTDKTRRDSLPVADLMDILRARAPHRAP
FT                   GTAIFLTSDPDMTPVALMHNLKHNKVLHERNVILTVRTAETPRVSEEERVKIEKVNDDF
FT                   KKVVVNYGFMESPNIPKALAVCRKQGLKFDIMATSFFLGRRSIVPSANSGMPLWQDRLF
FT                   IYLMRNAANPTDFFKIPPGRVVELGAQVTV"
FT   gene            141119..141541
FT                   /locus_tag="CCNA_00131"
FT   CDS_pept        141119..141541
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00131"
FT                   /product="Rrf2 family protein"
FT                   /note="CC_0132"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93598"
FT                   /db_xref="InterPro:IPR000944"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5A0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93598.1"
FT                   /translation="MSDSQKFPVAAHALAYLAHKAAFSADRAVASAELAASVPTNPVVV
FT                   RRVTAMLGKAGLIGARAGANGGAWLLKPAETITLDVVLRAVNGCAHLGVAPKGVKGCPV
FT                   GEKIPDAVRAAILSADQAAAERLSQITVADLLVGLQ"
FT   gene            141633..142433
FT                   /gene="hetN"
FT                   /locus_tag="CCNA_00132"
FT   CDS_pept        141633..142433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hetN"
FT                   /locus_tag="CCNA_00132"
FT                   /product="ketoacyl reductase hetN"
FT                   /EC_number="1.3.1.-"
FT                   /note="CC_0133"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93599"
FT                   /db_xref="GOA:A0A0H3C620"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C620"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93599.1"
FT                   /translation="MARRLALITGASAGIGAASARIYASHGYDVALTARRVDRLEGLAA
FT                   EIKLRSGVEAYAIPADLAEPGGVGAVLAAIAEQGREVDALINNAGYGLPGTYDATSWED
FT                   QAKFLQLMLTSVCEMTHKVLPGMVERRFGRIVNVASLAGLVPGAAGHTLYAATKGFLVK
FT                   FSQSLHLENLANGVHVSALCPGFTYSEFHDVNGTRAQVSQGVPEWMWLGADEVAAAGYE
FT                   AAEANRSICVPGAPNKAIAAIAKIVPDDWALALMASQGSRFRKV"
FT   gene            142680..143894
FT                   /locus_tag="CCNA_00133"
FT   CDS_pept        142680..143894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00133"
FT                   /product="radical SAM family enzyme"
FT                   /note="CC_0134"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93600"
FT                   /db_xref="GOA:B8GXM4"
FT                   /db_xref="InterPro:IPR004383"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR027492"
FT                   /db_xref="InterPro:IPR040072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXM4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93600.1"
FT                   /translation="MSVTLDLSRVSSDAAPATPVTKPLINLSGLTRPQLVAALVESGVV
FT                   EHGKAKMRATQIFRWMHHRGVTDFADMSDVAKETRARLAEAFTIARPEIVERQVSKDGT
FT                   RKWLIRMAPGIEVESVYIPGVGRAGALCVSSQVGCTLNCSFCHTGTQPLVRNLTAAEIV
FT                   AQVQVAKDDLAEWPSDKEDRQLSNIVFMGMGEPLYNLGQVADAIEIISDNEGIAISRRR
FT                   ITVSTSGVVPMLEKLGSTTQAMLAISLHATNDPLRDVLVPLNKKYPIAELMAGIRAYPG
FT                   LSNARRVTFEYVMLKGVNDSPEEARALVKLIKGIPAKINLIPFNPWPGSDYQCSDWATI
FT                   EAFAAILNKAGYSSPIRTPRGRDILAACGQLKSESEKVRASALRKLSLAAMAGVLSDDD
FT                   EDETA"
FT   gene            143989..144417
FT                   /locus_tag="CCNA_00134"
FT   CDS_pept        143989..144417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00134"
FT                   /product="surface protein"
FT                   /note="CC_0135"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93601"
FT                   /db_xref="GOA:A0A0H3C2U8"
FT                   /db_xref="InterPro:IPR007140"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2U8"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93601.1"
FT                   /translation="MPSQLQSPEVQAFATGFPITLLHASVTLVMLILGAALYALLTPHK
FT                   EITLIREGNSAAALSLGGVFVGLAIPLAVSLRASTSVTEIVIWGAATIAVQLLVFRITD
FT                   MLLKGLPERINEGEVAAAALLVGAKLGVALILAAAVGG"
FT   gene            144443..145276
FT                   /locus_tag="CCNA_00135"
FT   CDS_pept        144443..145276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00135"
FT                   /product="trypsin-like peptidase"
FT                   /EC_number="3.4.21.-"
FT                   /note="CC_0136"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93602"
FT                   /db_xref="GOA:A0A0H3C3U5"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3U5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93602.1"
FT                   /translation="MHFPKLPDWLVYAAAVSALVIVAVGRQERSDAPPPPPPVPGEEGL
FT                   PLGPSSPFDPSIVVQVPDKPSPGSGTAFSVGDDGVWLTARHVVDGCKQTAIVVADGRGV
FT                   AAKVHVDTRADAAVLTTEGGAPAVPMGLDQPLRRGARAYHPGFPQGHPGEAASRLLGRE
FT                   NLVVHGRGARTEPVLVWAEVGRTDTLKGTLSGLSGAPALDAAGRVIGVTVAEAPRRGRI
FT                   YTTAPETLKAVLGSHRRPAASEFAPSEPITTENYGRVADGLRRDLRVAQVVCLAV"
FT   gene            complement(145273..146952)
FT                   /locus_tag="CCNA_00136"
FT   CDS_pept        complement(145273..146952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00136"
FT                   /product="AmpG protein"
FT                   /note="CC_0137"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93603"
FT                   /db_xref="GOA:A0A0H3C4J9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4J9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93603.1"
FT                   /translation="MSEEAKAPEKKSLLQTLAFFGERRSLVMLGLGFASGLPFMLIFDT
FT                   LSLWLRDAGLSLAVIGFFSLATLSFSFKFLWAPLIDRTTVPVLHKLLGHRRAWMLVFQT
FT                   VMVLGLWAISTMNPLNQLGFLAAAAVTVGFATASHDIVIDAWRIEVADKEEQGPMVVAY
FT                   QWGYRVAMIVAGAGPLLLAERFGWNLSYAVMGLVVGLGVLATLCAPREAEHTIRPIPTD
FT                   DVKQPKALEVTEWLLRLAILLLGALALGSGLSGDATLLSKLVGGEALAEAWTAKPNGIW
FT                   LQLVGVITGLAIVVVAAWPIPKVRTKPGVYMSKAFGEPLGEFLTRFHGVAGLILAAICV
FT                   YRVSDFVLNIMNPFYRDMGFTLTEIAEIRKVFGIIASMAGVFLGGVIVARLGLIKALVI
FT                   GAFAQPISNLMFALLAMSGHNTGMLFASICLDNIAGGIAGTALIAYMSSLTSAGFTATQ
FT                   YALFSSLYALPGKLIASQSGRIVEASAKAAEAGGFTAPLKGLFTRLPPESFTAAGAKLG
FT                   VSAPALAAGYTAFFLYTALIGVVAIVLSFMVAARQGKTLAAS"
FT   gene            complement(146986..148530)
FT                   /gene="shkA"
FT                   /locus_tag="CCNA_00137"
FT   CDS_pept        complement(146986..148530)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="shkA"
FT                   /locus_tag="CCNA_00137"
FT                   /product="hybrid two-component histidine kinase/receiver
FT                   protein ShkA"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0138"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93604"
FT                   /db_xref="GOA:A0A0H3C5A3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5A3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93604.1"
FT                   /translation="MSDSRSDDRHPSVTPEQLATLSHEFRTPLNGVLGMARLLENTKLT
FT                   AEQRSYVTALRESGDHLLSLVNDVLHFARLGAAAIELSLAPVDIEGLLRQVAELMSPRA
FT                   HEKGIEIAWAVSSPLPTILADEGRLRQILLNFAGNAVKFTEAGGVLLTASAIDGGRVRF
FT                   SVADTGPGVAPDARARIFEAFVQTDVTHATQLGGAGLGLAIVSRLSAAMGGAVGVGGEL
FT                   GQGAEFWFEAPFATAAAPLRAAPLEGRNVAIASPNAIVRAATARQIEAAGGRAYAAVDI
FT                   ASALAGAPADAVLLIDAALSGPRGALKPPAGRRSVVLLTPEQRDRIDRLKAAGFSGYLI
FT                   KPLRAASLVAQVLQAVTADGVAEDEPAHDDRIAGAVASGARVLLAEDNPINALLARTLL
FT                   EREGCIVDRVADGEQAIAAASAGVYDLILMDLRMPGLTGIEAARALRAKGVATPIAALT
FT                   ADAFDEDRRTCLAAGMDDFLVKPLTQEALRDALKRWTTGGVSGGWTKPATRAKVAG"
FT   gene            148752..150944
FT                   /locus_tag="CCNA_00138"
FT   CDS_pept        148752..150944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00138"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0139"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93605"
FT                   /db_xref="GOA:A0A0H3C625"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C625"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93605.1"
FT                   /translation="MSIVIRSHRHAVRFGASLSVLALLGPAFGANAKEAAPLDAKADTE
FT                   ISEVLVLGRGAQRLRIAGSSHVVNEADLERSRVLTVNEALRQVPGVYARDEEGLGLRPN
FT                   IGIRGLAPTRSTKILQLEDGLPLSYAPYTDNASYSMPPFRRFVRIETLKSASQIRFGPN
FT                   TVGGVINFITPSAPETFGGDLFMAAGGRGYQELDLKIGGPVLGELAAIGHANRTRSNGV
FT                   RDNTALEIQDLWGKLEGRLSAHHAIALRVGHATEDSQVTYSGLTAAEYAADPRQNPFAN
FT                   DHFKIKRATAAITHGWTLSESLNLKTSAYSLWFDRDWWRQSSNSGQRPNDASDPACGGM
FT                   ANLNTTCGNEGRLREYNTYGLDTRLTWTGALVGAQAVIEAGARHQWERQNRLQLNGDRP
FT                   TARTAGTSVNGGVRENNLRYGEASAGFVSLSLTWDRLTVNPGLRVEQIDYRRVNRLNGT
FT                   TGETDLSEVIPGLGFAWAVKPGAYLYGGVHRGFAPPRAEDIVSGTGGVVDIEAEESVNS
FT                   EIGYRSAVRPGLFVDINAFRMDFENQVIPASVAGGVGATLTNGGKTRHQGVELSLKGSL
FT                   REMGMIRGDDVFFRSALTWLPDAAFVGTRRSSVSGFGGVSVSGNRLPYAPRWLASAAIG
FT                   YSFGVHTDVQLEVQHTGKMFTDDLNTVAQTADGQRGLIKSATVWNASLNTRPFGDRTTL
FT                   FLAVKNIGDKLYIADRSRGILPGAPRLAQIGLSQRF"
FT   gene            complement(150993..152600)
FT                   /gene="chlI"
FT                   /locus_tag="CCNA_00139"
FT   CDS_pept        complement(150993..152600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chlI"
FT                   /locus_tag="CCNA_00139"
FT                   /product="magnesium chelatase subunit ChlI-like ATPase"
FT                   /note="CC_0140"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93606"
FT                   /db_xref="InterPro:IPR000523"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004482"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR025158"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2V3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93606.1"
FT                   /translation="MAARVVTVAFEGVEARRVDVEVQLTTGQHAFVVVGLADKAVAESR
FT                   ERVRGAFAGLGLSLPGKRIVANLAPADLPKEGAHFDLPIALAVMAALGVIPLDALDGWA
FT                   AMGELSLDGRIVPAAGALPAAMAAGAMDLGLICPEASGPEAAWAGGTRILAPRSLVALI
FT                   NHFRGSQILSAPTPGPIIEGEVPKDLRDVKGQEHAKRALEIAAAGGHNLLFCGPPGSGK
FT                   SMLAQRLPSLLPPLTSAELLETSMVHSVAGLIARGTLTRARPFRAPHHSASMAALTGGG
FT                   HRAKPGEVSLAHNGVLFLDELPEFGVQALDSLRGPLETGEVMVARANAHVRYPAKVQLV
FT                   AAMNPCRCGHGGAGRGACGKAPRCQKDYQGRISGPLLDRIDLAVDMPAVTAADLALPPP
FT                   VEGSAEVAARVARARALQVDRAEALGAADGLNSRAEGAFLEKIAGLDTAGRDLLSRAAE
FT                   AGRISARGWTRVLRLSRTIADLEGVDSVKRLHVAEALAYRRTSAAGDEDVGSPPRRIEN
FT                   TSRAFSDEVDPVRRQKMR"
FT   gene            complement(152709..153662)
FT                   /locus_tag="CCNA_00140"
FT   CDS_pept        complement(152709..153662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00140"
FT                   /product="glutathione synthetase"
FT                   /EC_number="6.3.2.3"
FT                   /note="CC_0141"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93607"
FT                   /db_xref="GOA:A0A0H3C3V4"
FT                   /db_xref="InterPro:IPR004215"
FT                   /db_xref="InterPro:IPR004218"
FT                   /db_xref="InterPro:IPR006284"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3V4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93607.1"
FT                   /translation="MSLRVAVQMDPILGINIDTDTSFLMMMEAQSRGHKLWFYTPDKLS
FT                   QEDGRVFARAQPVEVFADKGAHARLGETVMLDMKDDIDVVLMRQDPPFDMAYITATHFL
FT                   EKVHPHTLVVNNPAEVRNAPEKLFVTDFPGVQPPTLITSDHEAIYDFRARHGDIVLKPL
FT                   YGGGGSGVARLLADDPNLDALLELHAMIGREQVIAQKFVPAVSKGDKRVLLVDGEPVGA
FT                   INRVPASGQVRSNLRVGGRAEAVELTARDLELCKIIAPELKRRGLLFVGIDVIGEYLTE
FT                   INVTSPTGAQQLKRFTGVNAAEVLWNRIEDIRANGG"
FT   gene            complement(153718..154533)
FT                   /locus_tag="CCNA_00141"
FT   CDS_pept        complement(153718..154533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00141"
FT                   /product="tetratricopeptide repeat family protein"
FT                   /note="CC_0142"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93608"
FT                   /db_xref="InterPro:IPR032698"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4K3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93608.1"
FT                   /translation="MTREEAEAILIKAGEGPDEGFPLFEAALACAVHDDPSRDTKAAVD
FT                   LARDAVERLRRRAESESPEEAVAETLAGDLRLTGDVITYDHPDNADVIAIAHRRRGLPV
FT                   ALGVFYLHAARAVGLELYGVDFPGHFLLRIETDEGPLALDPFSEGRVVLPSELSRRALR
FT                   TGLMPDVAARLELLMAPISDRAVLIRLQNNIFARAQQAKDWPRAERSALRRALLNPKDH
FT                   RPWLDVAAAREGQGALAGALQALSRAQILDGGAAIAARAARERVRLRLN"
FT   gene            complement(154535..154912)
FT                   /locus_tag="CCNA_00142"
FT   CDS_pept        complement(154535..154912)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00142"
FT                   /product="endonuclease"
FT                   /EC_number="3.1.-.-"
FT                   /note="CC_0143"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93609"
FT                   /db_xref="GOA:B8GXN3"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXN3"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93609.1"
FT                   /translation="MAAGVRQSRGTAARKVGRRAEVIAALWLMAKGYRILGFRLATPLG
FT                   EIDLLAQRGKVLAVVEVKQRTTIEDALDAVKPTQRERLRRAATHLAAHRAGLRDLLVRL
FT                   DLIAMAPGRPPRHLPDAWGGA"
FT   gene            complement(154912..155784)
FT                   /locus_tag="CCNA_00143"
FT   CDS_pept        complement(154912..155784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00143"
FT                   /product="ribosomal RNA small subunit methyltransferase I"
FT                   /note="CC_0144"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93610"
FT                   /db_xref="GOA:A0A0H3C5A7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5A7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93610.1"
FT                   /translation="MSRLLPPPALSDAPFAPGLYLVATPIGNLRDITLRALDVLAGCDV
FT                   LLAEDTRVTGKLLSAYGIRTRLERHDEHVAERSIPGILERLAAGERVALVSDAGTPMVS
FT                   DPGYRLAREAIAAGHDVIPIPGASAALAALTLAGLPTERFLFAGFPPPKSAARRTFFEE
FT                   FANTRATLIFYEGASRVADCLADMAAVFGADRPAAVCRELTKLYETCVRGPLSDLAADP
FT                   RFDAPKGEIVILVGPGAEKVASADDAEAALREAMARLPLGEAASEVAKALGLSRKDLYR
FT                   QALALKEQA"
FT   gene            complement(155819..156973)
FT                   /locus_tag="CCNA_00144"
FT   CDS_pept        complement(155819..156973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00144"
FT                   /product="oxygen-independent coproporphyrinogen-III
FT                   oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="CC_0145"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93611"
FT                   /db_xref="GOA:A0A0H3C631"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C631"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93611.1"
FT                   /translation="MTDPRAEAVGIYVHWPYCARICPYCDFNVVRDRGRTDEQRALADA
FT                   IVADLEAQRALTGERRLLSIFFGGGTPSLMDPAQVARVIETAKRLWSPADDLEISLEAN
FT                   PTDAETDRFAALAAAGVQRLSLGVQALDDASLKALGRNHDAGAARRAIAAAARAFPRLS
FT                   IDLIYARPGQTDAAWRAELSEAIALGPEHVSPYQLTIEPGTAFDRAVGRGTLVTPDEDL
FT                   AATLFETTQEIFEAAGFDAYEVSNHARGEAARARHNLVYWRGVDYVGVGPGAHGRLALP
FT                   EGRAATTAHRAIKDYIAAVGDHGVGFQSEILTPEDAALERLVLGMRIDAGVGFDEVAVL
FT                   GLDPDVAKVRDLVETGLLVEDRARLRATRAGRLVLDRLTGALAT"
FT   gene            complement(156966..157568)
FT                   /locus_tag="CCNA_00145"
FT   CDS_pept        complement(156966..157568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00145"
FT                   /product="xanthosine triphosphate pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="CC_0146"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93612"
FT                   /db_xref="GOA:A0A0H3C2V8"
FT                   /db_xref="InterPro:IPR002637"
FT                   /db_xref="InterPro:IPR020922"
FT                   /db_xref="InterPro:IPR029001"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2V8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93612.1"
FT                   /translation="MALKLEVGAKLVAATHNPGKVPEIAALLDGRFEIVTAGQLGLPEP
FT                   DETESTFVGNALLKARHAADLSGLPALADDSGLSVTALDGAPGIFSARWAGPGKDFALA
FT                   MKKVEERLEETASDDRTAWFTSALAVAWPNGPAVVVEGRVDGTLVFPGRGTRGFGYDPI
FT                   FVPEGHALTFGEMEPAAKDAMSHRARAFAKLKAALFD"
FT   gene            157593..158186
FT                   /locus_tag="CCNA_00146"
FT   CDS_pept        157593..158186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00146"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="CC_0147"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93613"
FT                   /db_xref="GOA:A0A0H3C3W1"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR034343"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3W1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93613.1"
FT                   /translation="MRLLYSPLSPFARKVRVLTMEKGLSEHLAFETIAPFQDESLRVLN
FT                   PLNKVPTLVLEGGEAVFDSAVIVDFLDGLSEPTLIPNAQPARRRALTLEAAADGLGDAA
FT                   LLIVRERMRPEAQHRQDLFDRQLRAVHAALDLFEAADLPSDRFEIAEIAIAVQLAYLDV
FT                   RQVVAWRPGRPALSAWYDAVSKRASMIATDPSTA"
FT   gene            158354..158470
FT                   /locus_tag="CCNA_00147"
FT   CDS_pept        158354..158470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00147"
FT                   /product="hypothetical protein"
FT                   /note="CC_0148"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93614"
FT                   /db_xref="GOA:A0A0H3C4K7"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4K7"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93614.2"
FT                   /translation="MSAARLFHIADKVVMTAITAALIVAVPVSAVAFLAQTL"
FT   gene            158546..159079
FT                   /locus_tag="CCNA_00148"
FT   CDS_pept        158546..159079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00148"
FT                   /product="hypothetical protein"
FT                   /note="CC_0149"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93615"
FT                   /db_xref="GOA:A0A0H3C5A9"
FT                   /db_xref="InterPro:IPR021354"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5A9"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93615.1"
FT                   /translation="MRALGPGSVSSFLKIILDVIYVGLWIFVSLLSLFTLIALLFSFNP
FT                   ELLAAMLPISDAVEAVSRNGPLFAGALAAWALLLGGWMVIVERLRKIFATLTAGDPFHP
FT                   DNVVRLRLIGLVLAGLEVGRYVFSGLARWLAPKAKVIDDSFTLTAWFSVLVVFVLAEVF
FT                   REGARLRREAELTI"
FT   gene            159096..159323
FT                   /locus_tag="CCNA_00149"
FT   CDS_pept        159096..159323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00149"
FT                   /product="Cro/CI-family transcriptional regulator"
FT                   /note="CC_0150"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93616"
FT                   /db_xref="GOA:A0A0H3C636"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C636"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93616.1"
FT                   /translation="MPVRVNLDRVLLERRMSLTELSDRVGVTIANLSILKTGKARAVRF
FT                   STLDALCRELECQPGDLLSFEYGPADANDD"
FT   gene            complement(159320..160297)
FT                   /locus_tag="CCNA_00150"
FT   CDS_pept        complement(159320..160297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00150"
FT                   /product="PDZ domain family protein"
FT                   /note="CC_0151"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93617"
FT                   /db_xref="GOA:A0A0H3C2W3"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2W3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93617.1"
FT                   /translation="MPTPFDGYEVEARLRPSAEAYRFDLDQALASMVALEAKVPADAYT
FT                   AAILGTERVGNGAVISPSGLVVTMAYLITEAEEVVLTRNDGRRVPAHVLGLDARSGLGL
FT                   VQALEPLDLPAITLGSARDLEPSSPIIAAGAGGRAHAVAGQVLTRIPFAGYWEYKLDDA
FT                   IITAPAHPHWSGAALIGPKGDLVGLGSLTLEGRDQNGEARPLNMFVPAELLPPILDDLA
FT                   RGRSPQPPRPWLGVFAQEMENHVVIVGVSPKGPAARAELRPGDLILAIDGKPVSDLSAF
FT                   YDALWDLGEAGVTVPLKILREGDAFEMEVRSMDRANLLKKRRLN"
FT   gene            complement(160464..161180)
FT                   /locus_tag="CCNA_00151"
FT   CDS_pept        complement(160464..161180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00151"
FT                   /product="ribonuclease PH"
FT                   /EC_number="2.7.7.56"
FT                   /note="CC_0152"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93618"
FT                   /db_xref="GOA:B8GXP2"
FT                   /db_xref="InterPro:IPR001247"
FT                   /db_xref="InterPro:IPR002381"
FT                   /db_xref="InterPro:IPR015847"
FT                   /db_xref="InterPro:IPR018336"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027408"
FT                   /db_xref="InterPro:IPR036345"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXP2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93618.1"
FT                   /translation="MRPSERAPDQLRAVTLETGVNRYAEGSCLIGFGHTKVLVTATVEE
FT                   NVPGWMRNKGAGWVTAEYGMLPRATHTRGRREAAAGKQTGRTQEIQRLIGRSLRAVVDL
FT                   KALGERQITLDCDVVQADGGTRTAAITGAWVALRLATKYLLDEGVLKTDPILGQVAAVS
FT                   CGVFNGVPVLDLDYEEDSNAEADSNFVLTGVGDIVEIQATGEKRGFTRAEFESLYGLAE
FT                   KGINELFALQRAAIGG"
FT   gene            161320..162396
FT                   /locus_tag="CCNA_00152"
FT   CDS_pept        161320..162396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00152"
FT                   /product="winged helix-turn-helix transcription repressor
FT                   HrcA"
FT                   /note="CC_0153"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93619"
FT                   /db_xref="GOA:B8GXP3"
FT                   /db_xref="InterPro:IPR002571"
FT                   /db_xref="InterPro:IPR021153"
FT                   /db_xref="InterPro:IPR023120"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXP3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93619.1"
FT                   /translation="MTQLFPGPIVRTPGLAELDARARDIFRRVVESYLETGEPVGSRTI
FT                   SKGGVALSPASIRNTMQDLAQLGLLDAPHTSAGRMPTHAGLRMFVDGFLEVGDVAEQEK
FT                   RAIEARLAVKGRSFEEALAEASSILSGLAGGAGIVVTPVREGGVKHVEFVPLGGGQVLA
FT                   VMVFEDGQVENRLMRQAPGVTPSALQEASNFLNARLRGRTLTEARTEMGGELDAARRQL
FT                   NETAARLVEDGLAAWSGGEGDARSLIVRGQANLLADARAREDIDRVRQLFDDLEQKGQL
FT                   IGLLDDVRDAEGVRIYIGAETRLFSLSGSSVIAAPYMTGRQKVLGAIGVIGPARLNYAR
FT                   VIPLVDYTARVLGRMMDG"
FT   gene            162409..163035
FT                   /gene="grpE"
FT                   /locus_tag="CCNA_00153"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        162409..163035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="grpE"
FT                   /locus_tag="CCNA_00153"
FT                   /product="adenine nucleotide exchange factor GrpE"
FT                   /note="CC_0154"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93620"
FT                   /db_xref="GOA:B8GXP4"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXP4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93620.1"
FT                   /translation="MTDEQTPAEEMPFEADDAAQEIEALKLEVAQLKEQALRYAAEAEN
FT                   TKRRAEREMNDARAYAIQKFARDLLGAADNLGRATAHSPKDSTDPAVKNFIIGVEMTEK
FT                   ELQSAFERNGLKKIDPAKGDKFDPHLHQAVTEQPSTEVAAGGVLMVMQAGYELMGRLVR
FT                   PAMVAVAAKGSTGPASPDAPAASANPYAGAAAEGDSTGGAFDAKA"
FT   gene            complement(162975..163235)
FT                   /locus_tag="CCNA_00154"
FT   CDS_pept        complement(162975..163235)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00154"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="CC_0155"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93621"
FT                   /db_xref="InterPro:IPR018638"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3W6"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93621.1"
FT                   /translation="MRLALKTLTYASMHLTVAVAVAYALTRDWRVALAVGLVEPMVQTV
FT                   AFNIHERLWSRADQRARDRSGDQALASNAPPVLSPSAAAPA"
FT   gene            163413..164531
FT                   /locus_tag="CCNA_00155"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        163413..164531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00155"
FT                   /product="DNA polymerase III, beta chain"
FT                   /EC_number="2.7.7.7"
FT                   /note="CC_0156"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00155"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93622"
FT                   /db_xref="GOA:B8GXP6"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXP6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93622.1"
FT                   /translation="MKLTIERAALLKALGHVQSVVERRNTIPILSNILLSAEGDRLSFS
FT                   ATDLDMEIIDEGFAQIDVPGQITAPAHTLYEIVRKLPDGADVSLSFSGDDPRLVIQAGR
FT                   SRFNLPVLPAGDFPVMSSDGLSSRIAVDTNELIRLIDKTRFAISTEETRYYLNGLYVHT
FT                   VNEGGETKLRAVATDGHRLALAEMPAPEGAVGIPGVIVPRKTIAEARRLMESAGETVDL
FT                   QVSPQKVRFEFGAAALTSKVIDGAFPDYMRVIPRDNAKILTLDNDLFAKAVDRVATISA
FT                   EKSRSVKLAVEPGRITLTVRNMEAGQAVEEVEVDYDGEPFEIGFNARYLLDVCGQIAGP
FT                   QAEFRFADPASPTLVVDPVDPGVKYVLMPLRV"
FT   gene            164664..164951
FT                   /locus_tag="CCNA_00156"
FT   CDS_pept        164664..164951
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00156"
FT                   /product="ArsR-family transcriptional regulator"
FT                   /note="CC_0157"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93623"
FT                   /db_xref="GOA:A0A0H3C4L0"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4L0"
FT                   /protein_id="ACL93623.3"
FT                   /translation="MAEQSETLDAVFQALADPTRRAILSRLGQGPASVGELAAPHDMAL
FT                   TSFMKHLKILERSGWIVSAKTGRVRTCAIVTDRFADVGAWVYGHRSLWEG"
FT   gene            165022..165393
FT                   /locus_tag="CCNA_00157"
FT   CDS_pept        165022..165393
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00157"
FT                   /product="glyoxalase family protein"
FT                   /note="CC_0158"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93624"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5B2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93624.1"
FT                   /translation="MAKLNYVTVGSNDLPKAKAFYDALLASAGFRPLFDHPSGGRLYRG
FT                   EGCMFGVLGPHDGNPACVGNGMMAGFAFDTPAEVDAFHAKALELGAVCDGPPGERMPKA
FT                   YFAYFRDLDGNKLCGYKLG"
FT   gene            165492..165575
FT                   /gene="chvR"
FT                   /locus_tag="CCNA_R0100"
FT   ncRNA           165492..165575
FT                   /gene="chvR"
FT                   /locus_tag="CCNA_R0100"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /experiment="expression of this small RNA is activated by
FT                   the ChvI-ChvG two-component system, and acts as a negative
FT                   regulator of the TonB-dependent receptor CCNA_03108 (ChvT)
FT                   according to Froehlich, et al. NAR (2018),
FT                   doi.org/10.1093/nar/gky765"
FT                   /ncRNA_class="other"
FT   gene            165621..166784
FT                   /gene="recF"
FT                   /locus_tag="CCNA_00158"
FT   CDS_pept        165621..166784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recF"
FT                   /locus_tag="CCNA_00158"
FT                   /product="DNA replication and repair protein recF"
FT                   /note="CC_0159"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93625"
FT                   /db_xref="GOA:B8GXP9"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXP9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93625.1"
FT                   /translation="MASAALLSLTLADFRSYERARLETGGRSVYLFGANGAGKTNLLEA
FT                   ISLLSPGKGLRGVSLAEVGRRLPGEAVGRAWAVAAEVQSGEDAPVRIGTGVEQGGAARR
FT                   TVRLEGETVPPGRLADHVRPIWLTPAQDRLFLEAASERRRFFDRLVFAGEPAHAANANG
FT                   YDKAQRERMRLLVDAAETGAPADAAWLTALEARLAEFGALLAQARARTLLALQAEIDGR
FT                   GDRPFPLARLGLTGEWERMALEGAPFAEIELKLAQALASARARDGAAGRALTGPHRGDL
FT                   AIFHVEKDRPAAECSTGEQKALILNLVLAQAARLSRAESAPNPVILLDEVAAHLDLTRR
FT                   AALADELTALKLQAFLTGTDESLFDHLKGRALGVRVGDAGLTTLEDE"
FT   gene            166781..169246
FT                   /gene="gyrB"
FT                   /locus_tag="CCNA_00159"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        166781..169246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrB"
FT                   /locus_tag="CCNA_00159"
FT                   /product="DNA gyrase subunit B"
FT                   /EC_number="5.99.1.3"
FT                   /note="CC_0160"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93626"
FT                   /db_xref="GOA:B8GXQ0"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GXQ0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93626.2"
FT                   /translation="MTENTEDQVPDLSTPEMTTEEAAAQYGADSIKVLKGLDAVRKRPG
FT                   MYIGDTDDGSGLHHMVYEVVDNAIDEALAGHATKVQVILNADGSVTVTDDGRGIPVDMH
FT                   EGEGVSAAEVIMTQLHAGGKFDQNSYKVSGGLHGVGVSVVNALSDWLELLIHRNGKVHQ
FT                   MRFERGDAVTSLKVTGDSPVRTEGPKAGETLTGTEVTFFPSKDTFAFIEFDRKTLEHRL
FT                   RELAFLNSGVTIWFKDHRDVEPWEEKLFYEGGIEAFVRHLDKAKTPLLKAPIAVKGVKD
FT                   KVEIDLALWWNDSYHEQMLCFTNNIPQRDGGTHLSAFRAALTRIITSYAESSGILKKEK
FT                   VSLGGEDSREGLTCVLSVKVPDPKFSSQTKDKLVSSEVRPAVEGLVSEGLSTWFEEHPN
FT                   EAKAIVTKIAEAAAAREAARKARELTRRKSALDITSLPGKLADCSERDPAKSEIFIVEG
FT                   DSAGGSAKQARNRDNQAVLPLRGKILNVERARFDKMLSSDQIGTLITALGAGIGRDDFN
FT                   PDKVRYHKIVLMTDADVDGAHIRTLLLTFFYRQMPELIERGYIYIAQPPLYKASKGKSS
FT                   RYLKDDAEMDAFLVDEGVDGAELDLASGERMTGQDLLALVQTCRSAKANIDRLAARAPA
FT                   TAIEQAALSGLLGESPNAAAAATRLDLYAEEGDGPWSGERGDTGFVFSRVRRGVSERVV
FT                   LDDVLLHAADARRLAERAVKLTEIFSGRAIFRRKDKSTTVRGPLDLVNAVLDAGRKGLT
FT                   IQRYKGLGEMNPDQLWETTLDAEARTLLQVRVNHADDADDMFSRLMGDLVEPRREFIQE
FT                   NALDAEVDV"
FT   gene            169387..170526
FT                   /locus_tag="CCNA_00160"
FT   CDS_pept        169387..170526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00160"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CC_0161"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93627"
FT                   /db_xref="GOA:A0A0H3C641"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C641"
FT                   /protein_id="ACL93627.1"
FT                   /translation="MTGASSCCSRIDSAKSFLWGALSMEQDASLRPERILDLSERLSSV
FT                   AGAKIGEIARVNRAAKMLAINALIVAARAGEAGKGFAIVAEEFKKISTEIDAVAAALES
FT                   QVRSDLDELSAIGGAILGHMRGQRLADLALNAIEIVDRNLYERTCDVRWWATDSAVVAC
FT                   LAQGDDPTARRYASERLGVILDAYTVYLDLWICDAQGRVIANGRPGRYPNVVGRSVADA
FT                   RWFQEGLRTATGDEFVACDIERCAVLGDAPVATYATAIRAGGEVTGKPLGVLGVHFDWR
FT                   PQAQAVVDGVRLTSEERERSRVMLLDQRGRVLAASDGQGVLTETFVLDTSAGPMGSYAD
FT                   GDVTVGYARTPGYETYQGLGWYGCLVQAKALAERTVAAA"
FT   gene            170951..171577
FT                   /locus_tag="CCNA_00161"
FT   CDS_pept        170951..171577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00161"
FT                   /product="hypothetical protein"
FT                   /note="CC_0162"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93628"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2W8"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93628.1"
FT                   /translation="MEGAVMASNRFRAVAISLAVAIAPVSAGHVLAQTAPAPAPAPAAE
FT                   PSPQALQSAIAAAAAEAASQPGFAALSPAAKLAAIQAAVASALAATGASPNAIGAALVQ
FT                   AVSSGVVSAGVAVQVAAAVAPQVATTVAQSPAVQTQLAQTNQTATVTTTAATTTGGAPS
FT                   VLVSLQGAASTSTGGDAAAGGAGGATPVTPAPFDPCAGVIAAYCG"
FT   gene            171649..172917
FT                   /locus_tag="CCNA_00162"
FT   CDS_pept        171649..172917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00162"
FT                   /product="beta-barrel porin type 2"
FT                   /note="CC_0163"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93629"
FT                   /db_xref="InterPro:IPR018759"
FT                   /db_xref="InterPro:IPR023614"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3X1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93629.1"
FT                   /translation="MRILTCSAIAACIAFSAPQLAQAQDLGSSFKRDKNTSVRERPRPD
FT                   YEAVGQKAGGFTVYPRVTVDLEHNDNIYAVAAGKTSDEIWRVKPELAVRSDWSRHALGF
FT                   FAGGNVIRYADNGSEDAEEFTVTANGRVDIERGSNLTGSVQTQRLVEPRTAPTSPVAAG
FT                   APVKYDLTSGSATLVKEFNRLRVTGRVDNRDFNYKDVANIAGTGVVDQDFRDRNELSYG
FT                   AKAEYAVSPDTAIYATATGNKKDYDTNVATQDRSSDGYVIGVGANFDVSEAMRGDVQIG
FT                   YMKQSYDRAAFKEISGFNANANVEWFPTQLTTVGVNASRSIQEAVALGSPGYIANTVGA
FT                   SIDHELMRNVLLSANYSYGKDAYKGVARDDKRNNFSATATYLLNRRVGLFLTYNYLKQD
FT                   SSGAQKGASFKDNKLVASVALQF"
FT   gene            172964..175183
FT                   /locus_tag="CCNA_00163"
FT   CDS_pept        172964..175183
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00163"
FT                   /product="exopolysaccharide transport family protein"
FT                   /note="CC_0164"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93630"
FT                   /db_xref="GOA:A0A0H3C4L4"
FT                   /db_xref="InterPro:IPR003856"
FT                   /db_xref="InterPro:IPR005702"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032807"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4L4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93630.1"
FT                   /translation="MDGSRFETSNAPVNDTGALSFDLNIAIATFRRRFRLFAAVAVVVF
FT                   AAVVLFTLQQTPKYTAIAQVMLDVRQEQVTDMSAVLSGLPADSSVVDTEVEVLKSRSLA
FT                   ARVVKELKLEQDPYFNPYLSNAEGAGAWLSTVRKAAAPLDNVDSVELQRRSERIVDSVL
FT                   GGLKVRRAGLTYLISIEYTHKDPKRASELANAFANLYLTEQLEAKFDATQKANEWLDTR
FT                   VGELREQVQAADAAVQQYKIQNNLLSAEGATLTEQEISSLNQQLALSRASQAETDARLN
FT                   IARQQLARGSTGEDVGESLNSPVVQQLRKQRSEKSAQVADLGGRYGDRHPELLKARREL
FT                   ADIDGQIQAEIRRIISNLEAQAQVARQRTGSVASSVAASKGTLAGNNRASIGLAELERK
FT                   AQSVKTLYETLLSRFKQTTTQEGIEQADARVVSPAKIPTRPSYPKPTLNLALGLVLALG
FT                   AGVAAVVLAEILMAGLFTEDEVERRLGLPYLGAVPSLGTTVDDSKTLKGMTPPDYLLVK
FT                   PLSSFAESLRKLRASILFSKVGETVQVIAVTSSLPGEGKTTTTFSLARTLATSGAKVIV
FT                   VDCDLRQSAISQFLKEPAPVGLLEVLNGVATLDQAIINDESGAHILPLAKSSYTPRDVL
FT                   GSSAMHRLLGELRGRYEIVLLDTAPLLAIADTRILAPHTDAVVMLVRWKKTPVKAVQSA
FT                   LALLQGTRAFIAGVALTQMDLKAQSRYGYGDSYYYYANYRKYYAD"
FT   gene            175173..177098
FT                   /locus_tag="CCNA_00164"
FT   CDS_pept        175173..177098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00164"
FT                   /product="O-antigen polymerase"
FT                   /note="CC_0165"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93631"
FT                   /db_xref="GOA:A0A0H3C5B6"
FT                   /db_xref="InterPro:IPR007016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5B6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93631.1"
FT                   /translation="MRTSKRLGAGSSSFGSSGSRRLKVSEGVAIGALLTLILAEIIAFG
FT                   ASELAVSSAFAALHALFPIVLLATCGWARNAARQGVSPTLWLPFAILMLVTAWALTPFG
FT                   PGGPHPVWLYVEPNGGAITVDRSSLILNLVRLGGLACLFLAAQIIGSSETRRRALFWSL
FT                   LVALGAYAILAILQHVGVRASERMTATLLSPNTLATLMGVGAVFAAMFVTQFIQRAGGR
FT                   LSLDKLPLDAGISLALLAVFAVALAFTGSRGGVFATVVALAIFLIWQVLAQGKRARVVV
FT                   MIGGAAVLLAAVGLAMRSADITAARLENLDGDVATRQTIFAAHWQAFKASPWFGYGLGS
FT                   FPAVNQMVMTSETLPALFDVRATHNLYLQWLEEAGLVGALSMLGLLGVLLWQVCAAANK
FT                   PGTSGALARAAIASTALVLLHGMSDFAVQAPALQALFAVGLGALVTSSPARRGRLPTFS
FT                   ATPTFAGVVLVSGLLVSAPLVAARFGGDLSALPTAPAEALASSVETGLAIGATDQATLD
FT                   RLDALSRREVAMRPGVGAAWLRKAAVDFKRGDFARANEALDRSYTVAPLHTSAFQARTR
FT                   LAYEHWSRLTPAVRKQVIYQVRVEYKRPGGDQRLTALANSIQDPSGRIGLALLIVAERM
FT                   TKTADQ"
FT   gene            complement(177092..177745)
FT                   /gene="pssY"
FT                   /locus_tag="CCNA_00165"
FT   CDS_pept        complement(177092..177745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pssY"
FT                   /locus_tag="CCNA_00165"
FT                   /product="polyisoprenylphosphate
FT                   hexose-1-phosphotransferase pssY"
FT                   /note="CC_0166"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93632"
FT                   /db_xref="GOA:A0A0H3C645"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="InterPro:IPR017475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C645"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93632.2"
FT                   /translation="MDLGPSTQLLTLRPGGPLPRVAVDLRKRVLDVVAAALLTALFAPL
FT                   LLLAALAIKLESPGPALFRQTRGGLGGAPFQILKLRTMHCREDGPDVAQAQRGDDRVTR
FT                   VGRILRAASIDELPQLLNVLRGDMSLVGPRPHATAHDDYYSARIPEYAARYQARPGLTG
FT                   LAQVRGLRGGTETVELMRQRIAADIDYIQTWSLWRDLKIVLRTVPSLLTTDNAY"
FT   gene            177944..178090
FT                   /locus_tag="CCNA_03915"
FT   CDS_pept        177944..178090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03915"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03915"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88517"
FT                   /db_xref="GOA:A0A0H3J406"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3J406"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88517.1"
FT                   /translation="MMIDAKLSFAPIESVSARRLPPLAGLALAAVLSAGLWALLAVAIA
FT                   QLV"
FT   gene            complement(178252..179070)
FT                   /gene="hvyA"
FT                   /locus_tag="CCNA_00166"
FT   CDS_pept        complement(178252..179070)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hvyA"
FT                   /locus_tag="CCNA_00166"
FT                   /product="transglutaminase-like cysteine proteinase HvyA"
FT                   /note="CC_0167"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93633"
FT                   /db_xref="InterPro:IPR010319"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2X3"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="gene influences capsular polysaccharide
FT                   composition and is required to render cells heavy according
FT                   to Ardissone, et al. eLife 2014;3:e03587 DOI:
FT                   10.7554/eLife.03587"
FT                   /protein_id="ACL93633.1"
FT                   /translation="MFKARNIVMGLLSAAALMTSAQAQAGGMPFMPRGHGVLAPAGFAD
FT                   LCRRDLETCGLPTTQLALLGPQSRQGMTPTSSVGLAPTRTFAPTESLNSDSDADVALVS
FT                   VEMIEAFTLGPVEDFVAAGQMRAFTPVGEPETVLTWFDRNERDQMKLLNRINQQVNRDV
FT                   KKANDSDLYGQEEYWALPRMVDGKLYGDCEDYVLEKRRQLIAAGVSESALSIAVAVTAR
FT                   GEGHAVLMVSLKSGDWVLDNLTPWATPWADLNYRWVERQVPGTALWTSIA"
FT   gene            179311..180120
FT                   /locus_tag="CCNA_00167"
FT   CDS_pept        179311..180120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00167"
FT                   /product="metallophosphatase family protein"
FT                   /note="CC_0168"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93634"
FT                   /db_xref="GOA:A0A0H3C3X6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3X6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93634.1"
FT                   /translation="MAYVASSMFKALFRSKQKERRAVSTGGRVLYAIGDVHGRLDLLDG
FT                   LIGRMTDDYRALGREDPPVLIMLGDYVDRGAHSSGVIDRLIALSQQAAEGRFEFRALMG
FT                   NHEETLLHFLDDPQAGPSWVEYGGGETMASYGVQRPVGRADLEVWEQTRVAFRAAFPPH
FT                   HEQFLRRLELMAVYGDYVFVHAGVRPGLPLERQVAADLLWIRNDFLDNAHGLKATVVHG
FT                   HTPVEEVFVGRQRINVDTGAYATGVLTAVRLDGGEPKIIQFSKPRAA"
FT   gene            180205..180801
FT                   /locus_tag="CCNA_00168"
FT   CDS_pept        180205..180801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00168"
FT                   /product="polysaccharide export protein"
FT                   /note="CC_0169"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93635"
FT                   /db_xref="GOA:A0A0H3C4L8"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4L8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93635.2"
FT                   /translation="MIGFSKLSRALAMLAAVVFMMVSTSNGVAHAQVGSEPAPFAGAAQ
FT                   AVDYLLGPGDKVRVTVYGEESLSGEFFVAGTGLMSLPLIGEIKVGGMTVGQFQTAVQDK
FT                   LKDGYLRDPRVSAEVLTFRPFYILGEVEKPGTYPYTSGLTVLNAVATAGGFTYRADKKI
FT                   VYIKRNGDASEIKGELKPSTLVSPGDTIRIGERFF"
FT   gene            181379..182917
FT                   /locus_tag="CCNA_00169"
FT   CDS_pept        181379..182917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00169"
FT                   /product="hypothetical protein"
FT                   /note="CC_0170"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93636"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5B8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93636.1"
FT                   /translation="MKLYRNLILMSCAAMALAGCGSDDISSPGTGGNVTINNPTTPTTP
FT                   TTPTTPAGVTPASGCPTIADPQQLKDDGTITGPTGTWRVCTLPSRVNRSITLPKIPGLL
FT                   YQLAGRVDVGTDGGFTRTAADTNVTLTIEPGVIVYGGTGVSWLAVNRGNRINAVGTATR
FT                   PIVFTSRDNILGLNTETSQGQWGGIVLLGRAKITDCSTGSTTANTCERQTEGAADPALF
FT                   GGSDDADNSGIMQYVQIRYSGYVLGANVELQSLTPSGIGSGTVLSHIQSYNSSDDGVEF
FT                   FGGIPQMKYFVSVGADDDSLDVDVGARANFQYGLMIQRDGAGDALMEIDSNGRETELPR
FT                   TDLRLSNFTMIQRQVSSNNEASNQASLLLRGNSDTTIANSIMLSPNNECLRMNGSGTTP
FT                   ATLTARSFVMSCNAAKYLGTGTYNATTVAAQFGSGANNNNDAFTSTLNAFVNGANELAV
FT                   AVFNATGLGAFFGATTYIGAVRDSNDTWYAGWTCNSGAANFGSTSTACTSLPTN"
FT   gene            182997..185663
FT                   /locus_tag="CCNA_00170"
FT   CDS_pept        182997..185663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00170"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0171"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93637"
FT                   /db_xref="GOA:A0A0H3C649"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C649"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93637.1"
FT                   /translation="MDMITRRLTSLLLLSTALSMPTWALAQTAPSAEEAAKPTAAAAQS
FT                   DFQQPEVSIPGMVDAVVITANRSGNVVRTGSQVVSVLSAAEIARTGEGNIAGALTRVTG
FT                   VTLVGNGYVYVRGLGDRYSLALLNGSPLPSPEPLKRVVPLDLFPSRVIASSLVQKSYSA
FT                   NFPGEFGGGVINLTTKSIPSEGFISIGGSVSGDTETTNQLGYDYYGSKSDWTGFDNGNR
FT                   DTPSALAAFFASGERISSGKVNTAAIASQLVNSRNGVVQKWNHLPANYSMDITAAKPFD
FT                   LDSMDLGVIGTIGFSNRWSTRDAQIQSSLNADLEDKESDFRRVSTDNRMVLNGLFGASL
FT                   GFGENKIRWTNLYVHDTIKNTRLAMGRRGGTNVDYMQQNTGWFERQLINTQLVGEFKPM
FT                   DKLNVDVRANYANTQREAPAELSLEYVRTNAAADPFGAHFVNRLNNGNGGDARISYSDL
FT                   DEDLWSGGVDATYKLAPGFAATVGYAYVHTDRDSSRRDFQFQASNTFPRGVDMLRPDLL
FT                   LAPAIIKNFNIALVDTNEGNPAFRAQLQNHAAYGKLNGTVFQDLDFDVGVRYETARLKV
FT                   SPTEVFKTPGASLASTRQNETYWLPSATATWHVKSDQQLRLSASKTIARPQFRELIYQF
FT                   YFDPDSNRMYRGNPLLTDSELTNAEGRYEWYFASDQRLTVAGFYKTIDRPIESFVSGSD
FT                   LSTSFANAPKAKLYGAEFEVQKYFDLADFKGDFWASRRLVAIANYTYSKSELQVSAGDT
FT                   VSVFAATSTKATDYFTDGAPLTGQSDHVVNLQLGLEDTERLSQQTLLINYASKRVTSRG
FT                   LVNSGQPDVEAYPGTRIDFVARQGLELWGREVELKFEARNLTGVGYEEYQKAGKNRVDV
FT                   NTYDVGRFFSIGASAKF"
FT   gene            185853..186290
FT                   /locus_tag="CCNA_00171"
FT   CDS_pept        185853..186290
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00171"
FT                   /product="type II secretion pathway protein C"
FT                   /note="CC_0172"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93638"
FT                   /db_xref="InterPro:IPR024961"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2Y0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93638.1"
FT                   /translation="MSFLDLHRSPGPRLILALEILVVLVLAAQAARLVWVFAAPVGAVS
FT                   SPAKAPRPPVDLSVLARFDAFGATGGSAGGSAIDGFRLFGVRSGGPGGGSAIIAGPDGV
FT                   QKSYAVGETIADGVTLASVAADHVELSRGGARATLSFPVSQ"
FT   gene            186287..188350
FT                   /gene="pulD"
FT                   /locus_tag="CCNA_00172"
FT   CDS_pept        186287..188350
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulD"
FT                   /locus_tag="CCNA_00172"
FT                   /product="type II secretion pathway protein D"
FT                   /note="CC_0173"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93639"
FT                   /db_xref="GOA:A0A0H3C3Y1"
FT                   /db_xref="InterPro:IPR001775"
FT                   /db_xref="InterPro:IPR004846"
FT                   /db_xref="InterPro:IPR005644"
FT                   /db_xref="InterPro:IPR013356"
FT                   /db_xref="InterPro:IPR038591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Y1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93639.1"
FT                   /translation="MTKVASSRSVLAAVAAALVMGGASLGPAPVLAQTQLLNVQDADIR
FT                   VFIQDVAKSTGTTFIIDPRVKGTVTVASNGPLNRRELFEVFLATLRANNFVATPAGNGA
FT                   YRIEPSENAARQPSAAGGQFATEVFRLRTLDAASAVEMLKPLVGPQGQVVANPRGAVVV
FT                   VADYADNVRRIRGLLAQVDQDRAMVHTVTLTHSSAREIAQVLNDMLATPGAEGKSGRGA
FT                   VTVVPVDSSNSVLLRGDSDAVQRLLPVIADLDRRAESSDDVRVVFLRHANAEQMLPVLQ
FT                   QLVGQATTSVTTSSSRGLSNARTATGASTATTAPSAPVAATPSANGPQATIARFPGANA
FT                   LIINAPPETQRTLAEVIRQLDVRREQVLVEAIVVEVTDGTAKQLGVQFLLGGTNGTIPF
FT                   VATNYTNATPSLLPLVGAAATTTSGADTEALKSLRDAAVSSLLTASGVTSGVVGRSGDA
FT                   LFGAIINAVKKDTGSNLLSTPSIMTLDNEEARILVGQEVPITTGEVLGDSNANPFRTIQ
FT                   RQNVGIQLEVKPQINAGGGITLFLRQEVSSVAGPVSVGSSELIINKREIETTALVDDGD
FT                   IVVLGGLLDQQETQSAQRTPGLGDVPGLGALFRSTARERKKTNLMVFIRPRIIRSSADA
FT                   RNLTAPRYDYMRNLPPMTTPDGDNSLDAVMRDYLNAARPVAAPTAAKPATTP"
FT   gene            188347..189822
FT                   /gene="pulE"
FT                   /locus_tag="CCNA_00173"
FT   CDS_pept        188347..189822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulE"
FT                   /locus_tag="CCNA_00173"
FT                   /product="type II secretion pathway protein E"
FT                   /note="CC_0174"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93640"
FT                   /db_xref="GOA:A0A0H3C4M2"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013369"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4M2"
FT                   /protein_id="ACL93640.1"
FT                   /translation="MTTPMLAYGFAKRNGVVLLSLGERAVIGVREGYDPMALVEIRRAV
FT                   GAPLAIEPMTAPVFDRKFSEVYAGAGLATASSADSLDLEGGLGLLLEDMPAAADLLDPQ
FT                   DDAPVIRLINGLIAEAVRLGASDIHIEPFEKALIVRLRIDGVLTEVLSLSPRIAAMLVS
FT                   RVKVMAKLDIAEKRVPQDGRISLALGGKSLDVRVSTLPARMGERVVMRILDKDQAGLRL
FT                   SDLGMSPDVLSALETAVREPHGIILVTGPTGSGKTTTLYAALAVLNDNSRNILTIEDPV
FT                   EYAVHGIGQTQVNTKVGMTFAAGLRAILRQDPDVVMVGEIRDSETAQIAVQASLTGHLV
FT                   LSTVHTNDAAGAVVRLRDMGVEPFLLASTLRLVIAQRLVRRLCEHCRTPEPADAATAAL
FT                   VGLPEGEILYRPVGCAHCGHTGYQGRIGVYEALRVDDHLRRLIGGNASEQEITEAGLDR
FT                   RLGQEARNYVLAGLTTVEEALRITGQGARDGDL"
FT   gene            189809..191020
FT                   /gene="pulF"
FT                   /locus_tag="CCNA_00174"
FT   CDS_pept        189809..191020
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulF"
FT                   /locus_tag="CCNA_00174"
FT                   /product="type II secretion pathway protein F"
FT                   /note="CC_0175"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93641"
FT                   /db_xref="GOA:A0A0H3C5C1"
FT                   /db_xref="InterPro:IPR001992"
FT                   /db_xref="InterPro:IPR003004"
FT                   /db_xref="InterPro:IPR011850"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="InterPro:IPR042094"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5C1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93641.1"
FT                   /translation="MATFDYVALDLSGRTRRGQLKAVDEAAAADQLQRKRLAPVKIMAS
FT                   VAKPARVGRFALGQGLSAKDRSMFTRQLATLTSVSTLEEALRTIALQADKPKLKQVIGE
FT                   VHAAVLEGYRLSDAMGRPAKAFPPLYRAMVAAGESSGALPAILDRLADLLEQQQQVRAK
FT                   ITTALVYPIVLAVVACLVVAALMVFVIPKVVEQFDSMGQTLPLLTRLVIGLSTGLQTFG
FT                   WLIVVSAVVAVFAFLRALRHRPFKLAVDRWLLRLPMIGRLIRDVHAARLARTLATMVAS
FT                   GLPVLEGLILTAGTVRNAVLQAALDDMIAAIREGGALSVAMRRAEVFPPVLVYMTASGE
FT                   SSGRVEAMLMRAADYLEREFETFTATLLSLLEPAIIVLLGGVVATIVLSILLPILQINN
FT                   LALT"
FT   gene            191032..191484
FT                   /locus_tag="CCNA_00175"
FT   CDS_pept        191032..191484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00175"
FT                   /product="type II secretion pathway protein G"
FT                   /note="CC_0176"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93642"
FT                   /db_xref="GOA:A0A0H3C653"
FT                   /db_xref="InterPro:IPR000983"
FT                   /db_xref="InterPro:IPR010054"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR013545"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C653"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93642.1"
FT                   /translation="MSTANAETKRRRARRAGFTLVEMMVVIVILGLLATVVAINVLPNQ
FT                   EKAMKGKARADVSVLEQALESYRLDIFAFPTTEQGLQALVAPPAGLTQVDRYREGGYIR
FT                   RLPKDPWGNDYQYRAPGAHGAIDVYSFGADGREGGEGKDADIGNWS"
FT   gene            191399..191956
FT                   /locus_tag="CCNA_00176"
FT   CDS_pept        191399..191956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00176"
FT                   /product="type II secretion pathway protein H"
FT                   /note="CC_0177"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93643"
FT                   /db_xref="GOA:A0A0H3C2Y5"
FT                   /db_xref="InterPro:IPR002416"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="InterPro:IPR022346"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2Y5"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93643.3"
FT                   /translation="MAPSMSIRSARTAARAAKARTPTLATGAEARHAKARRVAQAGFTL
FT                   VELMVVLMIMGLLATAVILTLPEGKMSLSQESARFAARLLRAREESLLVNRQVRVNVTS
FT                   ADYRFDIRDGRAWRALDTAPFVTTAWVEETRVSGRDGATVVVFEPTGQASGAEFTLGRG
FT                   GSGYVVSVDVAGNVAVHAAQAL"
FT   gene            191925..192308
FT                   /locus_tag="CCNA_00177"
FT   CDS_pept        191925..192308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00177"
FT                   /product="type II secretion pathway protein I"
FT                   /note="CC_0178"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93644"
FT                   /db_xref="GOA:A0A0H3C3Y6"
FT                   /db_xref="InterPro:IPR003413"
FT                   /db_xref="InterPro:IPR010052"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Y6"
FT                   /protein_id="ACL93644.3"
FT                   /translation="MLPSMPPKRSEAGFTLIELLVALAIFSLAVLALLNLAGENTRAGG
FT                   RLQDRILAEVVLDNRAIEAVTSVMPPALGRVSGAERVAGRPWLWTRQVSRTDDPSILRV
FT                   DIAVMSPNSRQPAAAATVFRAAR"
FT   gene            192305..192895
FT                   /locus_tag="CCNA_00178"
FT   CDS_pept        192305..192895
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00178"
FT                   /product="type II secretion pathway protein J"
FT                   /note="CC_0179"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93645"
FT                   /db_xref="GOA:A0A0H3C4M7"
FT                   /db_xref="InterPro:IPR010055"
FT                   /db_xref="InterPro:IPR012902"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4M7"
FT                   /protein_id="ACL93645.1"
FT                   /translation="MKGFTLIEMMVALLIFALITAAGVAVMSSTLNNQTAVRVRVERYA
FT                   ELQRMRAVVKADLSQAATRRTRGEDGLPSLTAFAGVSPWAAAGPLLAFTRRGYENPDQA
FT                   PRASLQYVEYALVEGRLERRARPALDGARLGPAQVLITDVESIQSAYLLDGVWRPTWRG
FT                   EPTSDIPSAVRLTMKLKDLGEIDQLFLTSGEGR"
FT   gene            192892..193866
FT                   /locus_tag="CCNA_00179"
FT   CDS_pept        192892..193866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00179"
FT                   /product="type II secretion pathway protein K"
FT                   /note="CC_0180"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93646"
FT                   /db_xref="GOA:A0A0H3C5C4"
FT                   /db_xref="InterPro:IPR005628"
FT                   /db_xref="InterPro:IPR038072"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5C4"
FT                   /protein_id="ACL93646.1"
FT                   /translation="MRREDEKGAALLTVMLMVAVISVIAVGVLDDIRFGVRRTLNARIA
FT                   SQAQWYALGAEQLARTRIAQLMDREPNKTTLEGGWNGRVISFPIEQGRMEAKLTDATGC
FT                   FNLNSVVEANQGEPFRRRELGVRQFTTLLSLVGVSNGPELAENLADWMDSNDVGRAEAE
FT                   DPGYAQLAQPYRTAGGPLAEVSELRAIRGFTPSVYAALRPYVCALPTTDLSPINVNTLP
FT                   PERALLLTALTEGRIGRETAARVLSGRPVNGWPDAQAFWGQQALVATPPGDVVRDQIKF
FT                   RTRFFALDSQIVFADMPVFMTALFETPSASKVILAARRWTPEE"
FT   gene            193848..194954
FT                   /locus_tag="CCNA_00180"
FT   CDS_pept        193848..194954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00180"
FT                   /product="type II secretion pathway protein L"
FT                   /note="CC_0181"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93647"
FT                   /db_xref="GOA:A0A0H3C657"
FT                   /db_xref="InterPro:IPR007812"
FT                   /db_xref="InterPro:IPR024230"
FT                   /db_xref="InterPro:IPR025691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C657"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93647.1"
FT                   /translation="MDPRRMTLLSLLILPAAPDEPAQLLQDYGLSVTRRTLAPDERLDE
FT                   VGAVILVAPGEEVVARWMDLPMGSAAQARSAAAFRLEDEVALGAEDLHIAVGEADAAGR
FT                   TLVVWTARDKLQAWLDMAQTHGLAPQAVIPDYLLLPEAEDGVLTVGRLGARLALREPSK
FT                   ALSADADLAALLFENREHRYLAGKELDAQLITGARAPVINLLQGRFAVRTTGGRGGLRR
FT                   LAILTAAAVLSPLLLMIAQIAHDQWTARALERQATKLAVSLAPQASRYEDAVGYALSRL
FT                   AASQSGQGFGDLSASYLSMVESTPGVTLDTLVYGEEGAIRSTIVYNNYSDMDQLRLGAK
FT                   RLGLELTEQSTASEGGRISSDLIIRRKP"
FT   gene            194951..195427
FT                   /locus_tag="CCNA_00181"
FT   CDS_pept        194951..195427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00181"
FT                   /product="type II secretion pathway protein M"
FT                   /note="CC_0182"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93648"
FT                   /db_xref="GOA:A0A0H3C2Y8"
FT                   /db_xref="InterPro:IPR007690"
FT                   /db_xref="InterPro:IPR023229"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2Y8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93648.1"
FT                   /translation="MNGRLEAARLWWTGRTGREQVLLAVMVAALVVVIGWYGVATPLWS
FT                   AAKTAQVRVDKAATQLATLRGLAAGASRATAGGAAPQAVVEAAASRVGLPIARHRQDAN
FT                   GRFTIWIAAIDSKILLPWTAGLEREGAVKVTDFTASRLDNGLIEAEITFARAAP"
FT   gene            195424..196140
FT                   /locus_tag="CCNA_00182"
FT   CDS_pept        195424..196140
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00182"
FT                   /product="type II secretion pathway protein N"
FT                   /note="CC_0183"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93649"
FT                   /db_xref="InterPro:IPR022792"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Z1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93649.1"
FT                   /translation="MSHRLLLVILVIATLVMTVVFAPMRLLTKDLAGSSAVGAAGVSGV
FT                   VWAGRLKDVTLAGAPIGSWKGGLDPLSLLTGHVRMGLRHDKTGSDQRAVLWLAGRDRGV
FT                   ERLNLRTGLDLAALGLPLSGDVAFRDATAVFRKGRCARAGGEIRLRLIGDGPLRGSVLS
FT                   GVSACRSDSWLATLSGKAGAADLTLVGRVEGDGRYQLEMSAATTDPDLIQALVAGGFTR
FT                   DATGARRTVAGRLTSR"
FT   gene            complement(196250..197011)
FT                   /gene="pulO"
FT                   /locus_tag="CCNA_00183"
FT   CDS_pept        complement(196250..197011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pulO"
FT                   /locus_tag="CCNA_00183"
FT                   /product="type II secretory pathway, prepilin signal
FT                   peptidase"
FT                   /note="CC_0184"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93650"
FT                   /db_xref="GOA:A0A0H3C4N1"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="InterPro:IPR010627"
FT                   /db_xref="InterPro:IPR014032"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4N1"
FT                   /protein_id="ACL93650.1"
FT                   /translation="MTIDHLWAVSALILAPFVGSFIGLLTLRLPADRPWAMSRSACDTC
FT                   KRRLGVVDLVPLVSFLVLRGRCRTCGTAIPRRYPLLEGGCLVIALWSVLAFSGGMILLT
FT                   ALMGWSLLLIATIDTEHLWLPDRLTLPFGALGVIATLAIGEVPVWTPLVGAAVGFGGLA
FT                   LIAWLYKTVRGFDGMGGGDPRLLGAIGAWVGWQGLPSVLVWACVAGLSVAIAQTLVRRR
FT                   FSGDQQLPFGAFLAIGAWLTWLWGPLHALLT"
FT   gene            complement(197070..197267)
FT                   /locus_tag="CCNA_00184"
FT   CDS_pept        complement(197070..197267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93651"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5C7"
FT                   /protein_id="ACL93651.1"
FT                   /translation="MEGSIQTRRLQAPGLPGIIGYRPGMGGARAQTHDPARPIGEHAHR
FT                   VSHRCVTPNPDATKTGPRIA"
FT   gene            complement(197285..199810)
FT                   /locus_tag="CCNA_00185"
FT   CDS_pept        complement(197285..199810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00185"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0185"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00185"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93652"
FT                   /db_xref="GOA:A0A0H3C662"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C662"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93652.1"
FT                   /translation="MAISSPGFLTRGLDMSFTQRNDATKALLLAALLCGGASGAYAGVT
FT                   EGSTVPGAVATASESAESDGSNVAGATVEALTITARRRSETVQSVPLAVSVVGGDRLDG
FT                   TGSFNVGRLQQLTPTLQFYSSNPRNTAVNIRGLGVPFGLTSDGFEQGVGIYVDDVYNSR
FT                   VATATFDFLDVDRIEVLRGPQGTLYGKNTTAGAINITTRQPTFDFEANAEVSLGNLDYK
FT                   QAKAAISGPLSDKLAARFAVSSTHRRGTIYNVTSRRYINEQDNLGLRGQLLFKPSEDLA
FT                   VTLAADYSAQDPEGFAQIYVRTGATQRALNRQYAALTSALGYAVPSTNAFDRVTDVDAE
FT                   LNAGNKVGGASAKVAWNVAGGTLTSVTAWRFWDWKPQNDRDFLGLSIVAKSQNPSQQDQ
FT                   YSQELRFNRSWDSHDLVVGAFAFHQRIDTQGTEQQGVNASRWNINPSNALSNDPTVLAG
FT                   LTALNTQWLKSTSFAVFGQLSWKVTDALTLTPGARLNYDEKSGFYERKVIDGQGVPVLL
FT                   TDTGARRAAQLAVYTPQVSAPSFDDWNFTYDLSASYQLDRDVLAYATYAKSFKTGGINQ
FT                   NGLPTDAAGKPIEAAGAIKPEDINHFEGGLKTQWLDRTLTANLAVFRSDIKNYQATVSN
FT                   GQLGVLRGYLANAGKVRTQGVELDSAYRPNARFSTYLNAAYTDAKYVRFVDAPCPPELS
FT                   GGTVATGTQVPRAAGVAGALSPANCDVSGQRLPGVSKWSVALGAEANVPGDFLGKTGEF
FT                   YVGYDGSYRSKFSSNPSPSIYTWVDGYTIANFRAGFRTPEGLNLYAWVRNAFDENYFEQ
FT                   LAVGPSNTGLIAGQPGDPRTWGVTLRAAF"
FT   gene            complement(200125..200201)
FT                   /locus_tag="CCNA_R0003"
FT   tRNA            complement(200125..200201)
FT                   /locus_tag="CCNA_R0003"
FT                   /product="tRNA-Arg"
FT                   /note="CC_t02"
FT                   /experiment="EXISTENCE:RNA-seq"
FT   gene            complement(200286..201602)
FT                   /locus_tag="CCNA_00186"
FT   CDS_pept        complement(200286..201602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00186"
FT                   /product="guanine-hypoxanthine permease"
FT                   /note="CC_0186"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93653"
FT                   /db_xref="GOA:A0A0H3C2Z3"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2Z3"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93653.1"
FT                   /translation="MIEKTFKLSAQGTTVRTEVLAGVTTFLTMAYIVIVNPAILGQAGM
FT                   PIAAVAAATCLAAGLGSILMGLIANYPIALAPGMGLNAYFTFTVVKGMGLPWETALGCV
FT                   FLSGVAFLILTVAGIRQLIVGAIPRPLFSAVAAGVGLFIAFIGLKEAGIIVADPATTVA
FT                   LGDLTKPTAVLAILGLLVMGALMAWRVKGAILIGILVAAGVAWALGLAKIAPGDYGLAA
FT                   LTATAFKLDVPAALHLNGAFGMALAEVIFVFLFVDLFDNVGTLVAVTKKAGLVQPDGSI
FT                   PRLNRILTADSIATIGGSLAGTSTVVSYIESASGVAEGGRTGLTAVVVGLLFLLTLFFA
FT                   PWVQAIPVAATAPALIVVGAMMVGALADVDWDDPGVAIPAFLTVIAIPLTFSIANGLAF
FT                   GITAYAGLTLLRGKAKPKDWLLFVLAGLFVLRFIYMGKA"
FT   gene            complement(201599..202681)
FT                   /locus_tag="CCNA_00187"
FT   CDS_pept        complement(201599..202681)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00187"
FT                   /product="NUP-family purine nucleoside permease"
FT                   /note="CC_0187"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93654"
FT                   /db_xref="GOA:A0A0H3C3Z4"
FT                   /db_xref="InterPro:IPR009486"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Z4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93654.2"
FT                   /translation="MRWGVRAMRLVGLILGLWLGLGAVAHAQPAKPIPVKVVVLTTFEI
FT                   GAVTGDRPGEFQPWVEGLPLTETIAVPGLRHPARYSPKDGVLGVMTDMRARARESVAAL
FT                   LLDKRFDFSKTYWLVAGIAGVDPKAASIGSAAWARYVVDADPIYEVDDREIPADWPYGL
FT                   YALETERPNVKGSAEGSSGMVWALNWRLVDWAYGLTAKVEIPDHPGLAALRAPYVGDPN
FT                   AQRPPFVLKGEALGATRFWHGAKRTQWAQDWVKLWTDGAGVFVMTDCEDQGILDVLDLY
FT                   AKAGRVDFQRVMVLRTASNYSRPPLGAPAFPRAFHDEGAVSAFDSAYRVGSVVVRELTA
FT                   RWDRYEANTPDMTAIGGTAK"
FT   gene            complement(202763..203725)
FT                   /locus_tag="CCNA_00188"
FT   CDS_pept        complement(202763..203725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00188"
FT                   /product="ABC transporter ATP-binding protein"
FT                   /note="CC_0188"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93655"
FT                   /db_xref="GOA:A0A0H3C4N4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4N4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93655.2"
FT                   /translation="MDLPAYAIEAEGLYKTYAGTKTSPEKRALNGIDLKIPRGSIFGLL
FT                   GPNGAGKSTFINILAGLVRKSSGTVRIWGRDIDQRPRDARAAIGVVPQELAADVFFTPR
FT                   ESLEVQAGFYGVPKSERRTDELLNALGLGDKAGAYVRQLSGGMKRRLMVAKAMVHQPPV
FT                   LILDEPTAGVDVELRRQLWQYVTSLNELGVTIVLTTHYLEEAQELCDEIAIINRGEVVA
FT                   CEPTAKLLSRMDSRNVVVTPESPVTAAPVLEGFDTKLRSGGAFSVSYRTGQSSVEQVLA
FT                   AVRASGLHIKDIATEDPDLEDVFVALTYGDPNAADPTKD"
FT   gene            203869..204135
FT                   /locus_tag="CCNA_00189"
FT   CDS_pept        203869..204135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00189"
FT                   /product="zinc-finger domain protein"
FT                   /note="CC_0189"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93656"
FT                   /db_xref="InterPro:IPR019401"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5C9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93656.1"
FT                   /translation="MAKTPAAAPTATDPVAIAGPAPETIAVHGHRIACDGVGGALGHPR
FT                   VWLEMGAAGFVDCPYCDRRFVAATDAGHDEHLAPGVYVDAAGH"
FT   gene            204137..204571
FT                   /locus_tag="CCNA_00190"
FT   CDS_pept        204137..204571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00190"
FT                   /product="acyl-CoA hydrolase"
FT                   /EC_number="3.1.2.20"
FT                   /note="CC_0190"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93657"
FT                   /db_xref="GOA:A0A0H3C666"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C666"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93657.2"
FT                   /translation="MDGDAIAANARAETLAEAWEKAEWPQEAPVLRAIAMPSDTNPEGD
FT                   IFGGWLLSQMDLAAASIAFHRAAGRCATIAIDGMTFLSPVFVGDEVSLFAKVVHTGRTS
FT                   LKVAVEAWRRRRDGEQANKVTEGVFTFVAIDENRKSRPLP"
FT   gene            204697..205173
FT                   /locus_tag="CCNA_00191"
FT   CDS_pept        204697..205173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00191"
FT                   /product="N-acetylglutamate synthase domain protein"
FT                   /note="CC_0191"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93658"
FT                   /db_xref="GOA:A0A0H3C2Z8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C2Z8"
FT                   /protein_id="ACL93658.1"
FT                   /translation="MITLRTTRPGDLGWIIQRHGELYAAEQGWDHRFEGVVAGVVADYV
FT                   KTHDPAREACWIAEHDGAPVGSIMLARETDTVGRLRLLLVEPSARGLGVGEALIAACIA
FT                   RAREAGYAEMVLWTQSILLPARRLYARFGFVLEDSWDYDGFADGLVSESWRLKL"
FT   gene            complement(205174..206793)
FT                   /locus_tag="CCNA_00192"
FT   CDS_pept        complement(205174..206793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00192"
FT                   /product="long-chain-fatty-acid--CoA ligase"
FT                   /EC_number="6.2.1.3"
FT                   /note="CC_0192"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93659"
FT                   /db_xref="GOA:A0A0H3C3Z8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Z8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93659.1"
FT                   /translation="MIPGLMQTTPLMISGILTYAAQAHGAREIVSRLIDEPLHRYDYAG
FT                   LAGRAAQAAHALRRLGIKAGDRVTSLAWNTHRHLELFYAAPGIGAVLHTANPRLFDEQI
FT                   VYTINHAESGVLFFERNFQALVERIAPQLTTVKTFVMLSDAERTVPGAVGAISYETLIE
FT                   GEPDVIAWPSFDENAGAFLCYTSGTTGDPKGVLYSHRAVVLHAMAGGLNSAFGFTPFDV
FT                   VMPCSSLYHATAWGLPFSAPICGAKLVLPADKMDGASLHQLIEGEGVTFTGGVPTIWTM
FT                   YLDWLDKNDRRPDSLKKVVIGGSAVPRAMAETFKRRYGVQTLQIWGMTETCPIGVVATP
FT                   TPALAALGEEAMDEAIWTRQGRLQFGIELKVETEDGQAAPWDGETSGALLVRGPWVVKR
FT                   YFRKDADAAREDGFFDTGDIATLDANGFMRITDRQKDVIKSGGEWISSIDLENVAVGCP
FT                   GVKIAAVIGVPHPKWEERPLLVIETHEGAEVTKAAVLDYLTPRIVKWWTPDDVVFATVP
FT                   LTATGKIDKKVLRQAWKDHLIG"
FT   gene            complement(206989..208041)
FT                   /gene="leuB"
FT                   /locus_tag="CCNA_00193"
FT   CDS_pept        complement(206989..208041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuB"
FT                   /locus_tag="CCNA_00193"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /EC_number="1.1.1.85"
FT                   /note="CC_0193"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93660"
FT                   /db_xref="GOA:A0A0H3C4N8"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4N8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93660.1"
FT                   /translation="MATLLLLPGDGIGPEVCAQVRRVAAALTPDLKVDEALYGGASYDT
FT                   HGTPLTDEVREQALASDAVLMGAVGGPKWADAPRHLRPEAGLLNLRKAMDVFANLRPAY
FT                   CFEALAGASSLKPELVSGLDIMFVRELVGGVYFGQPRGIEDLADGQKKGFDTQVYTTSE
FT                   IERVGRVAFELARGRTNKVHSAEKSNVMESGLLWKQVITELHAREYPDVQLEHILADNC
FT                   AMQLVRAPKQFDVIVTDNLFGDILSDAAAMLTGSLGMLPSAALGAPGKPGLYEPIHGSA
FT                   PDIAGKGLANPLAAILSFEMALRWSLKQTEAADALLAAVKAALDNGARTRDLGGSLTTT
FT                   QMGDAVLAAL"
FT   gene            complement(208043..208345)
FT                   /locus_tag="CCNA_00194"
FT   CDS_pept        complement(208043..208345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00194"
FT                   /product="Antibiotic biosynthesis monooxygenase family
FT                   protein"
FT                   /note="CC_0194"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93661"
FT                   /db_xref="GOA:A0A0H3C5D2"
FT                   /db_xref="InterPro:IPR007138"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5D2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93661.1"
FT                   /translation="MTLILAGSIRIAPERLAELRPHLAAQVEGSRGEPGCLAYALSEDP
FT                   LDLGLIRVFEHFTDAAALEFHRASPHMAAWRAACAALGVHERRMSSFDVSDYREI"
FT   gene            complement(208487..209095)
FT                   /gene="leuD"
FT                   /locus_tag="CCNA_00195"
FT   CDS_pept        complement(208487..209095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuD"
FT                   /locus_tag="CCNA_00195"
FT                   /product="3-isopropylmalate dehydratase small subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="CC_0195"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93662"
FT                   /db_xref="GOA:B8GY65"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GY65"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93662.1"
FT                   /translation="MKAFTRLDGRAAPLELANIDTDQIIPKQFLKTVEREGLAKGLFYD
FT                   FRFDADGNEISDFVLNKPEYKSASVLIAGDNFGCGSSREHAPWALMDFGIMCVISTSFA
FT                   DIFNNNCFNNGLLPVVVSPEDLALLMDEAKGGNHMVSVDLEAQTVISPSGKTIGFDIDP
FT                   VRKEKMLKGLDAIGETMMHGGDIDLFESKRAISQPWLEA"
FT   gene            complement(209092..210531)
FT                   /gene="leuC"
FT                   /locus_tag="CCNA_00196"
FT   CDS_pept        complement(209092..210531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="leuC"
FT                   /locus_tag="CCNA_00196"
FT                   /product="3-isopropylmalate dehydratase large subunit"
FT                   /EC_number="4.2.1.33"
FT                   /note="CC_0196"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93663"
FT                   /db_xref="GOA:B8GY66"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR004430"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GY66"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93663.1"
FT                   /translation="MSGKTLYDKIWDAHVVSEAGGEAILYIDLHLIHEVTTPQAFAGLR
FT                   AAGRKVRRPDRTLAVADHNIPTEGQALGVDAVADEEARLQLKTLARNVADNGIEFFPMG
FT                   DIRNGIVHVVGPEQGRTQPGMTIVCGDSHTSTHGAFGALAHGIGTSEVEHVLATQTLRQ
FT                   KKAKNMLVRVDGQLPPGVTGKDVALAVIGEIGTAGGTGYVIEFAGEAIAGLSMEGRMTL
FT                   CNLTIEGGAKAGLVAPDDKTFAYIQGKPAAPKGAAWDMALSHWKTFFTDEDAVFDRTVV
FT                   IDGSALVPMVTWGTSPEDVIPVTGNVPDPESFATPDKRAAAHRALDYMGLKAGQPISEA
FT                   RIDRVFIGSCTNSRIEDMRAAAAVVQEAFLHGRLVAPHVKAMVVPGSGLVKEQAEEEGL
FT                   DAIFKAAGFDWREPGCSMCLAMNPDKLAPQERCASTSNRNFEGRQGRAGRTHLVSPAMA
FT                   AAAAIAGHLVDVRTLFSETAQ"
FT   gene            complement(210637..210769)
FT                   /locus_tag="CCNA_R0004"
FT   ncRNA           complement(210637..210769)
FT                   /locus_tag="CCNA_R0004"
FT                   /product="cell cycle regulated sRNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /experiment="EXISTENCE:ncRNA mapped by tiling arrays
FT                   experiments of Landt, et al. (2008) Mol Micro. 68;3:600-14.
FT                   doi: 10.1111/j.1365-2958.2008.06172.x"
FT                   /ncRNA_class="other"
FT   gene            complement(211121..211522)
FT                   /gene="rplS"
FT                   /locus_tag="CCNA_00197"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(211121..211522)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplS"
FT                   /locus_tag="CCNA_00197"
FT                   /product="LSU ribosomal protein L19P"
FT                   /note="CC_0197"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93664"
FT                   /db_xref="GOA:A0A0H3C671"
FT                   /db_xref="InterPro:IPR001857"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR018257"
FT                   /db_xref="InterPro:IPR038657"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C671"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93664.1"
FT                   /translation="MIMAINIIAQLEQEESARLLAARAIPDFRPGDTLRVNVKIKEGER
FT                   ERVQAYEGVCIARAGTGVHESFTVRKISFGEGVERLFPLLSPSIESIEVKRRGVVRRAK
FT                   LYYLRDRRGKSARIAERAGGPKASASTEA"
FT   gene            complement(211519..212256)
FT                   /gene="trmD"
FT                   /locus_tag="CCNA_00198"
FT   CDS_pept        complement(211519..212256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trmD"
FT                   /locus_tag="CCNA_00198"
FT                   /product="tRNA (guanine-N1)-methyltransferase"
FT                   /EC_number="2.1.1.221"
FT                   /note="CC_0198"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93665"
FT                   /db_xref="GOA:A0A0H3C302"
FT                   /db_xref="InterPro:IPR002649"
FT                   /db_xref="InterPro:IPR016009"
FT                   /db_xref="InterPro:IPR023148"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C302"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93665.1"
FT                   /translation="MPFTATVLTMFPEAFPGPLGVSMIGTAWKEQDLWRLETLDIRAFS
FT                   KDKRGFLDDTPAGGGAGAVLKADVIASALDSLERDGRPLLYMSARGRPLTQARVREWSK
FT                   APGIVVLCGRFEGVDQRVLDARGFEEVSVGDAVLAGGEAAAMVVIEACVRLAPGVLGNI
FT                   ESTLEESFEDGLLEHPQYTRPRTFEELDIPEVLLSGDHKKIDQWRKRMREETTRERRPD
FT                   LWEAHLANQQAKGDPKPGKPKET"
FT   mobile_element  complement(212306..213021)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            212387..214267
FT                   /gene="cpaL"
FT                   /locus_tag="CCNA_00199"
FT   CDS_pept        212387..214267
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cpaL"
FT                   /locus_tag="CCNA_00199"
FT                   /product="TadG/vWA-family protein CpaL"
FT                   /note="CC_0199"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93666"
FT                   /db_xref="GOA:A0A0H3C404"
FT                   /db_xref="InterPro:IPR028087"
FT                   /db_xref="InterPro:IPR032418"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="InterPro:IPR042302"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C404"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93666.1"
FT                   /translation="MPTKSRFLRRLSEGVAAFARRLRRDDRGAIAIQFALLALPLSILL
FT                   FGLLDVGRLSLQRRQMQDALDAATLMAARSTATSSADLDTTGDAAFLAEIAGMNLGLTA
FT                   SSSTFSAGTNNRVIGTATATLRPIIANLWQSGNFTVTASSEVVRASKNLEIALVLDITG
FT                   SMGNGTRIADLKVAAADLVDVLVRDTQTPFYSKMALVPYSAGVNVGATYADAVRGPVPV
FT                   KTITGAAWASGSARSITGITRANPAVVTASGHGLSTGDYVYITGVRGMTSVNDKIYRVT
FT                   RSDPDKVSLNSTNTSSASNYTNGGTIQKCLTSTCQVVITTSTSHGFTTGDEIRFAGMSG
FT                   LTSLNGTTRTITVLTNTTFDSSLTGPGSSTYSSGGTATCEESTVPGCEKIRFTNVDGYE
FT                   RVNSQSTCATERIGSQAYTDAAPSTAYVGSHYPTAGSSSSTVCPTATITPLSTDKTALK
FT                   AQINGLTVGGATAGQIGLAWGWYMVAPNFGYLWPNASQRPAAYKARDLMKVVILMTDGG
FT                   FNMTYCNSVVARNIGSGTNIGDDERINCDATNGSSFDQAAELCDSIKASANDITLYTVG
FT                   FTVGNDQTARNFLTNCASSTDKAYFPATGSELKASFQAIAQEISNLRIAR"
FT   gene            complement(214320..215255)
FT                   /locus_tag="CCNA_00200"
FT   CDS_pept        complement(214320..215255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00200"
FT                   /product="2OG-Fe(II) oxygenase superfamily protein"
FT                   /note="CC_0200"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93667"
FT                   /db_xref="GOA:A0A0H3C4P2"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR026992"
FT                   /db_xref="InterPro:IPR027443"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4P2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93667.1"
FT                   /translation="MSTSAIDPVSFSLYAKDFTRFAQELGASFERYGFAVLSDYDLDQA
FT                   RIDAAVDSAKAFFALPVETKKQYAGVKGGARGYIPFGVETAKGADHYDLKEFWHMGRDL
FT                   PPGHRFRAHMADNVWPAEIPAFKHDVSWLYNSLDGMGGKVLEAIATYLKLERDFFKPTV
FT                   QDGNSVLRLLHYPPIPKDATGVRAGAHGDINTITLLLGAEEGGLEVLDRDGQWLPINPP
FT                   PGCLVINIGDMLERLTNNVLPSTVHRVVNPPPERRGVPRYSTPFFLHFASDYEIKTLQN
FT                   CVTAENPDRYPESITADEFLQQRLREIKLA"
FT   gene            215418..216098
FT                   /locus_tag="CCNA_00201"
FT   CDS_pept        215418..216098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00201"
FT                   /product="outer membrane protein"
FT                   /note="CC_0201"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93668"
FT                   /db_xref="GOA:A0A0H3C5D4"
FT                   /db_xref="InterPro:IPR006664"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR006690"
FT                   /db_xref="InterPro:IPR027367"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5D4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93668.1"
FT                   /translation="MPKFARKMTLAVVLMSAGALAACTTTDPYTGMPVRNNTGTGALTG
FT                   AGVGAVLGYLTNTNKGEQGRKNALIGAGIGALAGGAIGNYMDRQQADFRRSLEGSGVMI
FT                   RRNGDQIVLVMPSDVTFAVDRSDVQPPFTRVLDDVARTLNAYPQTTIDVVGHADSSGPD
FT                   DYNQTLSERRASAVAGYLTGPGGVLVDRVFVAGMGERAPIADNATADGRAQNRRVEIIL
FT                   RPLT"
FT   gene            216215..217270
FT                   /locus_tag="CCNA_00202"
FT   CDS_pept        216215..217270
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00202"
FT                   /product="DesA-family fatty acid desaturase"
FT                   /note="CC_0202"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93669"
FT                   /db_xref="GOA:A0A0H3C677"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C677"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93669.1"
FT                   /translation="MAKTASDISLTRQAMSLTEDLMTPNAAIYWADLTISAAVMWGGFL
FT                   IAATTSSLALGLGAALLSMLALYRGLSFIHELTHIRDDEAPGFRVGWNVLVGVPLMTPS
FT                   LMYEGVHNIHHIKDRFGTRLDPEYLPLSRFTPLKLAGFLFIALLAPLGVILRSAILIPL
FT                   SFLVPSLRRYLKTKLSALIINPDFVREDLGRWRKAWVIQDVACWLWSWAVIAGLGLGVV
FT                   PVRVVLTGLAIFSLATFLNQARTLVAHHWDNDGDKMTLEEQFLDSVNVPPPNLASALWA
FT                   PVGLRYHALHHLLPRLPYHNMAKAHARLVEALGADSLYHRASEPGLFEALGDLFRRVRQ
FT                   KNAEARNQPAH"
FT   gene            217328..218332
FT                   /locus_tag="CCNA_00203"
FT   CDS_pept        217328..218332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00203"
FT                   /product="sterol desaturase family protein"
FT                   /note="CC_0203"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93670"
FT                   /db_xref="GOA:A0A0H3C307"
FT                   /db_xref="InterPro:IPR006694"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C307"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93670.2"
FT                   /translation="MSIAQPGFDFAAAGHRLAAPLLDTLLPLGSTFSLVSLICALLIAA
FT                   GHVVLSRRARGRRTSARLLARALFPRKVWLNASSRLDLVFFVFNVWCAGLLLGAALLSG
FT                   QAITKVLSGWLGANLGEGPLAATPWPIVAVVGTLAGFLAYELSYWVDHWLSHKVKFLWA
FT                   FHKVHHTAEVLTPLTVYRVHPIESLKFANIAALATGGTGGVLAWAFGPAWHQPLIFGQN
FT                   AIFLVFAMSVIHLQHSHAWMTFRPFGKWLLSPAHHQIHHSADPAHFGKNLGSCLAVWDR
FT                   LFGTLHVPDKRPASLTFGAVATDPHSLTGGFATPFVEAFKGEPIPRAVPLPAE"
FT   gene            complement(218336..220237)
FT                   /gene="kefB"
FT                   /locus_tag="CCNA_00204"
FT   CDS_pept        complement(218336..220237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="kefB"
FT                   /locus_tag="CCNA_00204"
FT                   /product="glutathione-regulated potassium-efflux system
FT                   protein kefB"
FT                   /note="CC_0204"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93671"
FT                   /db_xref="GOA:A0A0H3C409"
FT                   /db_xref="InterPro:IPR003148"
FT                   /db_xref="InterPro:IPR004771"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C409"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93671.1"
FT                   /translation="MENILTQTLVYLGAAVVSVPIAKRLGLGSVLGYLIAGVLIGPFAL
FT                   SLVGDQADVMKFAEFGVVILLFLIGLEVQPSTLWDMRKAIFGLGGAQVVGTALAIAAVA
FT                   LGLGLPWQTALAVGLVLAMSSTAIVLQTLDEKGLRQGPVGRAAFGVLLLQDLAVIPLFA
FT                   LLPLLAISAPQHAAEAGGHGGSLVATLPVWAQTLSVFAAVAAVVGGGRYLVRPLFRFIA
FT                   KARLREIFTASALLIVVAVASLMQTVGLSPALGAFLAGVVLAESEFRRELETDIEPFRG
FT                   LLLGLFFMTVGAGVDLPLVARQPLTLVGLVLGLMVLKFLVMYGIARLFGAQKRGALAVA
FT                   TALAQGGEFAFVLLTFTVGAGVIGAQLAALLTAAIAVSMALTPVAMILYERVAALMDAA
FT                   IPDVTPDTGDFDEGEPDIIIAGFGRFGQVTGRLLAANGFKSTVLDTDIEQIELLRRFGR
FT                   RVHYGDATRLDLLRQAGADRARMLIVALDDREKTVELVETARKAFPNLTILARAWDRRH
FT                   AYDLLSNGADAVERETFESALTLGATALQKLGFRAHRAHRAAAFFRRHDRRVFEELRPM
FT                   WGQEEAYILASRDAAKTMDRLLDADLHRMRPGDVGGAWDTASLDEELRERAQQEGAN"
FT   gene            complement(220241..220822)
FT                   /locus_tag="CCNA_00205"
FT   CDS_pept        complement(220241..220822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00205"
FT                   /product="NAD(P)H-quinone reductase"
FT                   /EC_number="1.6.99.-"
FT                   /note="CC_0205"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93672"
FT                   /db_xref="GOA:A0A0H3C4P7"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4P7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93672.2"
FT                   /translation="MTNASTGQMTPATSGVLLVLAHPALERSRANRALAKAAKGLSGVT
FT                   FKDLYEIYPDFVIDIESEQAALSAHDVVALQFPLYWYSTPALMKEWLDLVWLHGFAYGE
FT                   GGEALKGKKLFVACTTGAGAKAYHAHGYNRFSMDEFLRPLEQTAHLCGMVWEAPFVVHG
FT                   AAVKDDAALKAEAERYRARVASLLPAKTEA"
FT   gene            complement(220822..221085)
FT                   /locus_tag="CCNA_03916"
FT   CDS_pept        complement(220822..221085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03916"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03916"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88518"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IWA5"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88518.1"
FT                   /translation="MTVRSLVPASRIAAIRFSGMPQRPNPPAMMVMPSNKSPARASTAS
FT                   FFTLSTMVSPCSQTYTSGAGRSVSPEPRINSTLDELFSRRAA"
FT   gene            220931..221641
FT                   /locus_tag="CCNA_00206"
FT   CDS_pept        220931..221641
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00206"
FT                   /product="succinyl-CoA:3-ketoacid-coenzyme A transferase
FT                   subunit A"
FT                   /EC_number="2.8.3.5"
FT                   /note="CC_0206"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93673"
FT                   /db_xref="GOA:A0A0H3C5D7"
FT                   /db_xref="InterPro:IPR004163"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012792"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5D7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93673.1"
FT                   /translation="MVDKVKKDAVEALAGLLFDGMTIMAGGFGLCGIPENLIAAIREAG
FT                   TKDLTVISNNCGVDGFGLGILLENRQIKKMVSSYVGENKLFEQLYLSGELELEFNPQGT
FT                   LAERIRAGGAGIPAFFTRTGYGTLVAEGKETREFDGEMYVMERGLTADLSIVKAWKADA
FT                   EGNLIYRKTARNFNPMMATAGKKTVVEVEELVAIGELDKDAIHTPGIYVDRLIKGAKFE
FT                   KRIERVTTRQKETA"
FT   gene            221641..222282
FT                   /locus_tag="CCNA_00207"
FT   CDS_pept        221641..222282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00207"
FT                   /product="succinyl-CoA:3-ketoacid-coenzyme A transferase
FT                   subunit B"
FT                   /EC_number="2.8.3.5"
FT                   /note="CC_0207"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93674"
FT                   /db_xref="GOA:A0A0H3C682"
FT                   /db_xref="InterPro:IPR004165"
FT                   /db_xref="InterPro:IPR012791"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C682"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93674.1"
FT                   /translation="MAWTRDEVAARAAKELQDGFYVNLGIGIPTLVANHIPEGMHVTLQ
FT                   SENGMLGMGPFPYEGEEDADLINAGKQTITELDSSSYFSSADSFAMIRGGHIALSILGG
FT                   MQVSENGDLANWMVPGKMVKGMGGAMDLVAGVKRVVVVMDHCEKSGAPKLLKQCSLPLT
FT                   GAGVVDLLITELGVFEINRGKTPVKLIELAPGVTVDEVKAKTEAAFEVAV"
FT   gene            complement(222283..223272)
FT                   /locus_tag="CCNA_00208"
FT   CDS_pept        complement(222283..223272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00208"
FT                   /product="type 1 glutamine amidotransferase (GATase1)-like
FT                   domain protein"
FT                   /note="CC_0208"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93675"
FT                   /db_xref="GOA:A0A0H3C312"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C312"
FT                   /protein_id="ACL93675.1"
FT                   /translation="MFRLFVFLLALLAATPGVAKPLVVILADQRGVETTDLIAPYAVLA
FT                   ESGAVDVRVVAPTLAPVRLMPGQAWVRPQTTYAALTRRPDVVIVPFLMPAYDPSRDAWL
FT                   RAQAQAGARIVSICAGAETLARAGLLDGREATTHWYELNRLAKAFPKVRWRRDQRWIVD
FT                   GPVTTTAGVTASIPASLALLRDLAGDEVMRETATRLNLPLPVQAHDGAAFRVGTDAAMS
FT                   GLAGWLNAWRAEKVSVRIADGFDDLAFATALDAWSRTNRSEAFASRSATSRHGLTIIAP
FT                   AKPPRAARTIDPKDGDPTTALKAIAAAYGKATARYVALTLEHPYWLGQ"
FT   gene            complement(223353..224927)
FT                   /locus_tag="CCNA_00209"
FT   CDS_pept        complement(223353..224927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00209"
FT                   /product="undecaprenyl-phosphomannose:protein
FT                   mannosyltransferase"
FT                   /EC_number="2.4.1.-"
FT                   /note="CC_0209"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93676"
FT                   /db_xref="GOA:A0A0H3C413"
FT                   /db_xref="InterPro:IPR038731"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C413"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93676.1"
FT                   /translation="MQTAPDASSPPIENRAWRLTLLMIGGLTIVRLAALFLTPLELYPD
FT                   EAQYWLWSRELAFGYFSKPPMIAWLIWATTQIGDTEAWVRLSAPFLHGATALVIHRIAR
FT                   RLYGGWAGLAAAAIYSLMPGVVLSSGLIATDAPLLFFLSLTVWAYVSLPDASARRRYAL
FT                   AAGMGAALGLAFLSKYAAVYALGSVALHFAISSEARRRWSPALVGLFIVAFALVLAPNL
FT                   LWNAANQFSTVKHTAANANWNAHQLFNVRELIEFVGSQFGVFGPVPFAVLIGGAIWLGV
FT                   KRKLQSPDLLLLCFALPPLIVVAGEAFVSRANANWAGAAFVSGSVIVAGWLLRWNARRW
FT                   LIGGLVLQAAFAAFFVACMVNPKVADAAGLSNGFKRVRGWDQTVEAVIARVREEQALRG
FT                   PLSAVAMDDRFVYNAAAYYGRDYFGQPGAPPLRMWVHEAYPQNQAETETPLDADYGRRA
FT                   LIVSLEGGYRPEIEQDFKAVSGLQIARVRLDKTRSRRVDLFIAEGFAPLPRDPITGLPP
FT                   KPKTAAR"
FT   gene            225115..227526
FT                   /locus_tag="CCNA_00210"
FT   CDS_pept        225115..227526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00210"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0210"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93677"
FT                   /db_xref="GOA:A0A0H3C4Q2"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010917"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Q2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93677.2"
FT                   /translation="MNMKHFALATTALVGALSASGAAMAQSTGTEVVEQVIVTASTVRN
FT                   QNGAIVAQSVPKARSSITQDFISRQIPGQTILDSLNMLPGVNFTNNDAFGSAGGDINIR
FT                   GFDSQRVALLQDGIPLNDSGNYAIYPNQQMDSELIAKVDVNQGTTDVDSPTAAAAGGTM
FT                   NYVTRKPYNDFGVTVEGQYGEENFRRFFAVVDTGKVGPWGTSAWFSYANAKNDIFNGPG
FT                   KIYKRQYNARIYQPIGDNGDFISLIANYNQNRNNFINRMSLAAFQSNTGVGFREDTCAR
FT                   PTPGAGAQIETNPGNCYKYNINPSNTGNLRGQSLFHIGENIIITADPYFQYTLANGGGR
FT                   ALFREDGSNTGSGLVRGSALTGGLDLNGDGDTLDTVLVYGPNTTNTRRYGVTSSLIWKF
FT                   SDSQSVRAAYTYDDAHHRQTGEYTRFSQDMQPTNVFGGKDGYGEPIKTADGGIMRRRDR
FT                   VSQATLNQFSAEYRGRFMEDKVLVNVGVRAPFFKRDLNNFCYQADTFNAYCSTQAPTAV
FT                   AGSDDGAGQTLVTLPGQGTTQYGRPRKFQRKYDDVLPNVGVSYELAKYQTVYISYAETI
FT                   SVPRTDDLYDRKLTRPEPETTQAYDLGYRYQSPTILFAASLYTNKFQNRIERAFNEQDN
FT                   IAFSINVGDVVYKGFDAQLGYKPEQYLSFYASFSYIDTELKANIPGTTLGSVLPTKGKE
FT                   VYETPKYQGGVGVNWDITEALSLGVNAKIVGERWTNLTNTEKAPGYSLVNMDVRYELDG
FT                   LGLKDTYLQINARNLFNERYLGDLAVNPSGTGLGQPGAPRTFVATIHARF"
FT   gene            227686..228693
FT                   /locus_tag="CCNA_00211"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        227686..228693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00211"
FT                   /product="Porphyromonas-type peptidyl-arginine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="CC_0211"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93678"
FT                   /db_xref="GOA:A0A0H3C5E1"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5E1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93678.2"
FT                   /translation="MTVTVPAEWAPHRAMWVGFPSHAELWQEDLEQAQQEVADLARALA
FT                   GPGAERVRLMVVGDEAEAAARALLSDTTVEIVRGQFGDIWLRDTGPIFVDDAGKAVAAG
FT                   FKFNGWGGKYSLEGDDIVAEQIAAASGAPLVRNDFILEGGALDHDGNGTILTTRQCLLN
FT                   DNRNPGWDEATANAALTEALGAKKVLWLGKGLKNDHTDGHVDNLARFVAPGVVACPMGY
FT                   GLDDPNADIYGDTAKMLAGMTDSRGSPLQVVRIPSPGKLLDEDGEPIPASHMNFLIANE
FT                   AVIVPIYAEESGAFAVEVIKGLFPERQVIGLPSTAILTGGGSFHCISQQEPETA"
FT   gene            228693..229571
FT                   /locus_tag="CCNA_00212"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        228693..229571
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00212"
FT                   /product="N-carbamoylputrescine amidase"
FT                   /EC_number="3.5.1.53"
FT                   /note="CC_0212"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93679"
FT                   /db_xref="GOA:A0A0H3C689"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR017755"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C689"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93679.1"
FT                   /translation="MARTLSVAAIQTSYGMDLQANIKKTEGFIREAASKGAQVILPSEL
FT                   FQGPYFCVAQEERWFAQAHPWREHPVVKAIAPLAGELGVVIPISIFEREGPHYFNSLVM
FT                   ADADGSLMGVYRKSHIPDGPGYMEKYYFRPGDTGFKVWDTRFGRIGVGICWDQWYPECA
FT                   RAMALMGAEALFYPTAIGSEPHDASLDTALPWRRAMQGHAVSNVIPVIGANRIGFEPWD
FT                   GYPNGGQTFYGSSFVADHRGDLVSELGRADEGLVSATFDLDFLTTHRAAWGFFRDRRPE
FT                   LYTALSSGRPA"
FT   gene            229568..230116
FT                   /locus_tag="CCNA_00213"
FT   CDS_pept        229568..230116
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00213"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.267"
FT                   /note="CC_0213"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93680"
FT                   /db_xref="GOA:A0A0H3C318"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C318"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93680.1"
FT                   /translation="MIETDRLVLRPAVDADRDAIADLNARPEVGAWLGGVRSRAESDAF
FT                   VDRVMAHEAQNGFGFWVVERKADVRLVGMTGVWWVPPAMNMPDTTEIGWRFLPEVWGQG
FT                   YATEAATAALAYGFDVLRLPEIIAFTARSNLASQAVMRRIGMTPAPARDFLHPRLAEGD
FT                   PLRPHVTFEAHPQAGRDGD"
FT   gene            230262..232307
FT                   /locus_tag="CCNA_00214"
FT   CDS_pept        230262..232307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00214"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0214"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93681"
FT                   /db_xref="GOA:A0A0H3C421"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C421"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93681.2"
FT                   /translation="MIRRVALSAASLLVLAAATAAHAKDAAAPPASAQDAEVSKVIVTA
FT                   APYGVSADALTASVAVLDRTDLDLAAPKGLGDALAGLPGVRSTTFGAGASRPVVRGLAG
FT                   PRVQVLTNGVGQIDASALSPDHQVATDPGEAERIEVLRGPAALAYGGSAIGGVVNIIDD
FT                   RISTQQPIDGMSGRLLASRGTGDDSYALSGAVHATVGPMVLTLDALKRESKDYKIPVYP
FT                   ESARQLALEGETAEGGAGRLENSAVDLETFGAGLSYVGDKGFVGMSIKRTDSTYGVPGH
FT                   AHEHEGEAEAGHEEESAVTIGLKQTRIDLRGEYDADLGPFAKVRFSGGHADYTHTEFEG
FT                   DAVGTKFTSDGYEGRLELVQTERGGWKGAVGVQALRRNFDAIGDEAYVPKTKITEFGAF
FT                   TQQRLELDGYGYEGGLRIDTRELDSLKGKADFTNLSGSVGAFWRPTTESFVGLALSRSS
FT                   RAPTESELFAEGPHAATRGFEIGDADLKEETATSLEATLHYGGERVSGDLHLYIARYDG
FT                   FIDLRPTGDEEDGLAVYRYVQTDAEFRGFEAELAYRVWTDGQRSVNLHAGADFVRGSSD
FT                   LGPPARIPPYSVSLKASYQAPMWSGDVEVRRTGGQERVAQMELPTDGYTVLNATLAWKP
FT                   AGNARVRLFLDGRNLTNEEVREHVSFLKDIAPSPGRQVRAGIALRF"
FT   gene            232420..232497
FT                   /locus_tag="CCNA_R0101"
FT   ncRNA           232420..232497
FT                   /locus_tag="CCNA_R0101"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            232614..233402
FT                   /locus_tag="CCNA_00215"
FT   CDS_pept        232614..233402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00215"
FT                   /product="SapC surface layer protein"
FT                   /note="CC_0215"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93682"
FT                   /db_xref="InterPro:IPR010836"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Q7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93682.1"
FT                   /translation="MTTTQSAGEITGNVLFYNAPEPLNREQHAKLALVHKDKPYAFAAA
FT                   GTAVPLTVSEFAPAALTFPVIFAGDDRVPLAVMGLNQQENLFIGADGSIEANVYIPAYI
FT                   RRYPFVLANDDTQDRLIVCIDRGSDLLSEQGQTPLFDAKGEPTEYTQNCIKFCDDFEVE
FT                   RRRTDSFVQILKDNDLFELKKATFQPTDEVGAPVGEPVTVAEYFGVSEEKLNGLSAEKL
FT                   KELQENGALAQIYAHLVSLLGWDRLINKTMMKQAEAANLN"
FT   gene            complement(233470..233862)
FT                   /locus_tag="CCNA_00216"
FT   CDS_pept        complement(233470..233862)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00216"
FT                   /product="hot dog superfamily protein"
FT                   /note="CC_0216"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5E6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93683.1"
FT                   /translation="MPAAFDDIEIGQVVSLGTRAVDAKALDAFIAAFSPGWPVDSGAPD
FT                   AMIFAIWTRLDSEASAAWPQTKRLGVDALRWMRNPPVGELLRGRMTVMGKDPVGEGKGI
FT                   VIAQHDLLDEAGRLVFSCLTRSIFAR"
FT   gene            233977..236127
FT                   /locus_tag="CCNA_00217"
FT   CDS_pept        233977..236127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00217"
FT                   /product="thiol:disulfide interchange protein DsbD"
FT                   /note="CC_0217"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00217"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93684"
FT                   /db_xref="GOA:A0A0H3C693"
FT                   /db_xref="InterPro:IPR003834"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR028250"
FT                   /db_xref="InterPro:IPR035671"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C693"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93684.3"
FT                   /translation="MFLKKAVLALQALVMGAMLGGHALAGPVVNSGHVESELVAQEAGI
FT                   APGGTIYVALRQKIAPGWHTYWRNPGDAGEPTKITWTLPEGWSAGDMVWPTPVKTRLGP
FT                   LLDYAYKGEVLIPVPITAAANAQPGTTLSLTADVFYLVCEQVCIPEQAKLSLLLPVVAG
FT                   TPAPDPKWGAVIGKVLADAPKPAGLKAVFKLEGQALKLAVTGGPLKGADMAGAYFFPYS
FT                   SKVIEHAAEQAIERGAEGLTLTLKPGYDFVGGSTPPAELVGVLATKAGAWEVTATAGEA
FT                   LAGASGLGPPPAEAAPGGALAGGLAGALLFAFLGGLILNLMPCVFPVLSMKAASLAGHA
FT                   HEAPKARLQGLAFLLGVVATFLALAGALLAVRAGGAAVGWGFQLQSPLVIAGLALLMLL
FT                   VALNMSGIFEIGTSVQGVGAGASAKGGVSGAFFTGALAVVVAAPCTAPFMAGALGYALT
FT                   QPPVIALGVFLALALGFAAPFVAVTFIPGALKLLPRPGDWMEVLKKGLAFPMYGAALWL
FT                   VWVFAQQAGPIALGQLLVAGVLAAFGAWLYGLAQARRAVGKGSAVSMILGLLAVVGALA
FT                   LAAASALSAKPPVAAAEASTPSGPGLTAEAWSPEKVQALQAEGRPILVDFTAAWCVTCQ
FT                   VNEKVALSGPKVAEAFKAQNAVLLKADWTNRDPVIAKALADFGRVGVPLYLVYPKNGGE
FT                   PVILPQLLTEGMVIEAIERAGS"
FT   gene            complement(236131..236877)
FT                   /locus_tag="CCNA_00218"
FT   CDS_pept        complement(236131..236877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00218"
FT                   /product="hypothetical protein"
FT                   /note="CC_0218"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93685"
FT                   /db_xref="InterPro:IPR010767"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C324"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93685.2"
FT                   /translation="MSQAPMSRSRTAPALIGAALLLSACATQTSTTVFVPVVTPTPPSS
FT                   LTPQPIMLFNQTKDGRKLFTLDAEFPYCDVETGKVIVVPRWYVTDFASVPWYGQAFIDP
FT                   QGPTARAAIIHDWLYTIGEPGKREEADQIFLRAMLKYGVQPFQANVAFKAVRLGGEKGY
FT                   GLPTDWRFIDPKRQDFTQPAPFAKPRAGMVRYLPRCQGFNALIQTGWRAYPIKTAPVNV
FT                   PPPVVVTKTPLDQVKEKLPFGGDKKR"
FT   gene            237030..237635
FT                   /locus_tag="CCNA_00220"
FT   CDS_pept        237030..237635
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00220"
FT                   /product="thiol-disulfide isomerase and thioredoxin"
FT                   /note="CC_0220"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93687"
FT                   /db_xref="GOA:A0A0H3C425"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C425"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93687.1"
FT                   /translation="MSITRRLVAAALPLAAFVPAVAHARPAPDFTAIDADGKTRSLSEF
FT                   RGKTVVLEWTNEGCPYVRKHYSGNMQGLQQAARADGVVWLTIASSAPGKQGHFADGAAA
FT                   KAWMNARGAKPTALLLDADNKVATLYKAKTTPHMFVIDKTGAVVYEGAIDDKPTNKVED
FT                   IQGSKNLVAAALGDLKAGRKVATPFVTPYGCSVKYKDA"
FT   gene            complement(237642..238136)
FT                   /locus_tag="CCNA_00221"
FT   CDS_pept        complement(237642..238136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00221"
FT                   /product="hypothetical protein"
FT                   /note="CC_0221"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93688"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4R2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93688.2"
FT                   /translation="MSCDAVAFSAMLWMASFNPEQTTGPALAVAQAPAAPASVADEPLF
FT                   IDIVKRARQLKAQTEAYRAHLAKTDQAAAASPLKGFDAFAGRIGDLAALDMKGHVTLKE
FT                   RGAVDDLKCILRGISQDLPEKLAAVRAATTIKAQDLALRDMVYLLNDNVEVITAPPQPA
FT                   A"
FT   gene            238241..239860
FT                   /locus_tag="CCNA_00222"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        238241..239860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00222"
FT                   /product="glucose-6-phosphate isomerase/glucose-6 phosphate
FT                   1-epimerase"
FT                   /EC_number="5.3.1.9"
FT                   /note="CC_0222"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93689"
FT                   /db_xref="GOA:B8GY92"
FT                   /db_xref="InterPro:IPR001672"
FT                   /db_xref="InterPro:IPR018189"
FT                   /db_xref="InterPro:IPR023096"
FT                   /db_xref="InterPro:IPR035476"
FT                   /db_xref="InterPro:IPR035482"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GY92"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93689.1"
FT                   /translation="MADLDAAWTRLEAAAKAAGDKRIVEFFDAEPGRLDALTLDVAGLH
FT                   LDLSKQAWDEAGLEAALDLAHAADVEGARARMFDGEAINSSEGRAVLHTALRAPAGADV
FT                   KALGQPVMAEVDAVRQRMKAFAQAVRSGAIKGATGKPFKAILHIGIGGSDLGPRLLWDA
FT                   LRPVKPSIDLRFVANVDGAEFALTTADMDPEETLVMVVSKTFTTQETMANAGAARAWLV
FT                   AALGEQGANQHLAAISTALDKTAAFGVPDDRVFGFWDWVGGRYSLWSSVSLSVAVAAGW
FT                   DAFQGFLDGGAAMDEHFRTAPLEQNAPVLVALAQIFNRNGLDRRARSVVPYSHRLRRLA
FT                   AFLQQLEMESNGKSVGPDGQPAKRGTATVVFGDEGTNVQHAYFQCMHQGTDITPMELIG
FT                   VAKSDEGPAGMHEKLLSNLLAQAEAFMVGRTTDDVVAELTAKGVSDAEIATLAPQRTFA
FT                   GNRPSTLVLLDRLTPQTFGALIALYEHKTFVEGVIWGINSFDQWGVELGKVMANRILPE
FT                   LESGASGQHDPSTAGLIQRLKR"
FT   gene            239869..240651
FT                   /locus_tag="CCNA_00223"
FT   CDS_pept        239869..240651
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00223"
FT                   /product="esterase lipase Family protein"
FT                   /EC_number="3.1.1.-"
FT                   /note="CC_0223"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93690"
FT                   /db_xref="GOA:A0A0H3C5F0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5F0"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93690.1"
FT                   /translation="MRGLTISGVFAVLVLTASLAQAGEVTVDGRKVAYREWGGGERTLV
FT                   MVSGLGDGAETFETVGPRLAQGWRVIAYDRAGYGGSADDPRVHDAERAEAELKGLLAAL
FT                   KVRKPVLLGHSLGGVFAAHFAARNPGEVTGLVLEETRPTGFTAACKAKRMRGCAFPPLL
FT                   KYAFPPGGRREVEALDRIERQEAETPGGATPTLILTRANTGQGGFDGLWLEQQAKLVQR
FT                   WPAARLVAAPKGGHYIHRDARDWFVAEVSGFLAGFPTR"
FT   gene            complement(240648..242693)
FT                   /locus_tag="CCNA_00224"
FT   CDS_pept        complement(240648..242693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00224"
FT                   /product="TonB-dependent receptor protein"
FT                   /note="CC_0224"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93691"
FT                   /db_xref="GOA:A0A0H3C698"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039426"
FT                   /db_xref="InterPro:IPR041700"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C698"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93691.1"
FT                   /translation="MMTKTMLLASAAAILLASAAQAADLTPEQVAAQAEAAQRGVLIFQ
FT                   PDFFAAQRPNTALEMVQRVPGFSVQDGSGARGFEGAVGNILINGARPASKNDTGSNVLS
FT                   RTQANRVERIELIRGGAPGVDMQGYSVVVNVILKKGANRQSIVSWNTSQFDGGRDLYGG
FT                   SYQFTATDGDKSWGVTLSDGIGSSDSNGPGTNIRRDSTGKIIRDEKYLNDSWGGGRSIR
FT                   GNYSAPLAGGKIEATARFGVNDWNQWQTLTSAIAERRSNYVDDEQSGELGLTYTRPLAP
FT                   NWALETRAIHSFENFESASTSDETLNGVKAAQQRFTAEGDSGESIFRAQLRHDWSKAIT
FT                   VETGGEVAYNMLDVKQAYSVGGAAVPLPSASVKVEELRGEAFSKATWRVNPRLTLEGGL
FT                   RLETSTIKQSGDAQNEKSFFYAKPRFLATWTPAANNQLRFRFERQLGQLDFDDFAASSD
FT                   LEDGNVYGGNVELKPEQRWITEIGYERRFWGEGIFAITYRHDEIIGVIDRLPLPGNLSA
FT                   VGNIGDATLDRLSLNIVVPTDKLGITGGRFTFKNDWNETHVKDPTTGKDRPISGVRPTQ
FT                   ANIGFQQDLLKYKTQWGINWLPLLGQGTYDVDQTSVWRGAQYYEAFAEYKPTPTLAIRA
FT                   QLNLWDDFSIRRTVFANRGPNRAIAFVEDRAINPRTFWQLRIRQTF"
FT   gene            243024..243056
FT                   /locus_tag="CCNA_00225"
FT   CDS_pept        243024..243056
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00225"
FT                   /product="hypothetical protein"
FT                   /note="CC_0225"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93692"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C329"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93692.2"
FT                   /translation="MSEIVREARA"
FT   gene            243157..243432
FT                   /locus_tag="CCNA_00226"
FT   CDS_pept        243157..243432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00226"
FT                   /product="hypothetical protein"
FT                   /note="CC_0226"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93693"
FT                   /db_xref="InterPro:IPR018654"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GY96"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93693.1"
FT                   /translation="MNISKPQQRTLHALAQGGRIELERDDNGRIISADCLTRDGWALTD
FT                   CTVAVFQSLKRKRLIASQDGGPYRITRLGLANLRAQLDNRVGAKAW"
FT   gene            complement(243490..244056)
FT                   /locus_tag="CCNA_00227"
FT   CDS_pept        complement(243490..244056)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00227"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="CC_0227"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93694"
FT                   /db_xref="GOA:A0A0H3C429"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004398"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C429"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93694.1"
FT                   /translation="MRIVSGQFRGKAIAAPPGDATRPTSDRARQAVFNILEHAAWAPEL
FT                   HGARVIDVFAGSGALGLEALSRGASFCLFVETDDAARGAIRENIDAMHLFGVTRVHRRD
FT                   ATDLGPRPASAGAPFDIVFLDPPYAKGLGEKAVAELRTHGWLAPGAILMFERGRGEVDP
FT                   ALDGFEQIDARDYGAARVLFFKLTG"
FT   gene            complement(244056..244670)
FT                   /locus_tag="CCNA_00228"
FT   CDS_pept        complement(244056..244670)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00228"
FT                   /product="putative membrane spanning protein"
FT                   /note="CC_0228"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93695"
FT                   /db_xref="GOA:A0A0H3C4R7"
FT                   /db_xref="InterPro:IPR010617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4R7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93695.1"
FT                   /translation="MSEQDSAAGHLHRLVLFSDAVFAIAITLLAIEIHPPHHWDGISDL
FT                   FAKMGVKLGAYAISFAVVGIYWISHRRIFQRLRAANGVLDVLNFIVLGLVALLPLGTEL
FT                   LWEQHAGQALPVYVGLVALIGVAIAVLWSYAAFIGDLTHPTPRPEAIYIALRVALLPGM
FT                   MCALSFISLVYPWGWAVMAGIIAGLHLLNKRIARTAQIKTA"
FT   gene            244790..245764
FT                   /locus_tag="CCNA_00229"
FT   CDS_pept        244790..245764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00229"
FT                   /product="CAAX amino terminal protease family protein"
FT                   /note="CC_0229"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93696"
FT                   /db_xref="GOA:A0A0H3C5F9"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5F9"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93696.1"
FT                   /translation="MRMGGLMETVRRSRFLADLSPHDRDPRRTALVIPVGILAGAVTGL
FT                   LGALAAVLAFMLVVGGLDGAAAATDLFQVFSKPDLAAPTGPQSLFILACLAGMNLGAAI
FT                   GFVMAAAAIQRRPFSDYINDGQPLRWRLVLGGLVLVGVVMAVVIGVVAVVSGHVFEPVV
FT                   LKVSPNLVGRSLYAIIAIVLLILASAAEELLFRGWLLKQSAAYIRNPIALMALNGLLFA
FT                   AIHLDPNLDAFLFRAAMGAGLTWMALRLGGIELGIGVHAANNAAIVLLLRPITLQPDAA
FT                   REFQPGLVASAVVMLAGFIGIAELWMRWPALRRWTGLSAPATA"
FT   gene            complement(245765..247003)
FT                   /locus_tag="CCNA_00230"
FT   CDS_pept        complement(245765..247003)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00230"
FT                   /product="ribosomal large subunit pseudouridine synthase B"
FT                   /EC_number="4.2.1.70"
FT                   /note="CC_0230"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93697"
FT                   /db_xref="GOA:A0A0H3C6A3"
FT                   /db_xref="InterPro:IPR000748"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR018496"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="InterPro:IPR042092"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6A3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93697.2"
FT                   /translation="MTKPHDPLYEPHLDGQDGDLDGGPGERVAKALARAGVASRREVER
FT                   LIEAGRVAINGKVLTTPAVKVAPGDFLTVDGQLVAEREPTRIFRYHKPTGLMTTHNDPK
FT                   GRPTVFGALPKDLPRLISVGRLDLNSEGLLLLTNDGELSRALETPSNAWVRRYRARAFG
FT                   DTTQAKLDKLKDGVTIEGVTYGAIEAKLDKAHEKAGGGKNVWITVSLSEGKNREVRKVL
FT                   ESIGLKVNRLIRLSYGPFALGTLAAGQIEEVGPRVIRELLEGVVSPENMPTGDRPKFAG
FT                   IANPTKAPGTEGGGELQRRGAPRADRAVILDTPEKPEKPVYKPGWAKPKKKASPHGPPK
FT                   GAGKGPAKGPAKAKRPAKSIESKFIDIGKPAARGKPAAPRPGAKPADGAARRLSERPGK
FT                   PTTRSGPPRGPKR"
FT   gene            247055..247540
FT                   /locus_tag="CCNA_00231"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        247055..247540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00231"
FT                   /product="tRNA-specific adenosine deaminase"
FT                   /EC_number="3.5.4.-"
FT                   /note="CC_0231"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93698"
FT                   /db_xref="GOA:A0A0H3C334"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR028883"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C334"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93698.2"
FT                   /translation="MRTDESEDQDHRMMRLALDAARAAAEAGETPVGAVILDPSTGEVI
FT                   ATAGNGPIAAHDPTAHAEIAAMRAAAAKLGNYRLTDLTLVVTLEPCAMCAGAISHARIG
FT                   RVVFGADDPKGGAVVHGPKFFAQPTCHWRPEVTGGVLADESADLLRGFFRARRKAKI"
FT   gene            complement(247537..247953)
FT                   /locus_tag="CCNA_00232"
FT   CDS_pept        complement(247537..247953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00232"
FT                   /product="hypothetical protein"
FT                   /note="CC_0232"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93699"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C433"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93699.1"
FT                   /translation="MRRDRLLSLALLAVLSTAPLLAPTPALAGKGKDDKKEQVTYFALA
FT                   PINAVILRRDGRRGVMTVETGLEIKDAKLMERAQASTPRLRAAFAQTLMVYAAGLRGGA
FT                   PPDIDHVGRELQKTADQVLGKPGSKVLLTSAMVN"
FT   gene            248082..249119
FT                   /locus_tag="CCNA_00233"
FT   CDS_pept        248082..249119
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00233"
FT                   /product="UDP-N-acetylglucosamine 4,6-dehydratase"
FT                   /EC_number="4.2.1.-"
FT                   /note="CC_0233"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93700"
FT                   /db_xref="GOA:A0A0H3C4S3"
FT                   /db_xref="InterPro:IPR003869"
FT                   /db_xref="InterPro:IPR020025"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4S3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93700.1"
FT                   /translation="MGRFSPKSLDLDGKVILVTGGTGSFGRRFIETVLRRYDPRKVIVY
FT                   SRDELKQSDMQIELREQFDEATVAKMRFFLGDVRDRERLTLALRGVDIVIHAAALKQVP
FT                   AAEYNPSECIHTNVLGAENVVWASLANAVKQVVALSTDKACNPTNLYGATKLASDKTFV
FT                   AANNLSGDIGTRFCVVRYGNVVGSRGSVVPLYRRLLSQGATELPVTDPRMTRFWITLNE
FT                   GVDFVLSSLTMMRGGEIFVPKIPSMAMPDLVKAMSSTAAMKVIGIRPGEKLHEIMISAD
FT                   DARSTVEFDDRYAIEPNFAEFGREPYAASDGAKPVAEDFSYSSDNNHDWLSPEGLLAML
FT                   EEKAT"
FT   gene            249116..250276
FT                   /locus_tag="CCNA_00234"
FT   CDS_pept        249116..250276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00234"
FT                   /product="WecE-family cell wall biogenesis enzyme"
FT                   /note="CC_0234"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93701"
FT                   /db_xref="GOA:A0A0H3C5G4"
FT                   /db_xref="InterPro:IPR000653"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020026"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5G4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93701.1"
FT                   /translation="MTGGFLPYGRQTIEEDDIAAVAEALRGDFLTTGPTVEAFETAFAA
FT                   KVGADHAIAVSNGTATLHLAMMALGIGEGDVCVAPSVTFLATANCARYVGAEVVFADVD
FT                   PDSGLMTPDTLARALAGARDKRVKAVLPVHLRGDVCDLPALKAMASASGAVLVEDAPHA
FT                   LGSIATFDGVAHPVGDGAYSSFASFSFHPVKTLATGEGGMLTTNDPALAAKARLLRSHG
FT                   MVRQPGGDPWWYEMPELGFNYRIPDVLCALGLSQLAKLDRFVARRRDLTALYARLLAER
FT                   APRARLATSPDHSDAALHLLTVLIDFEAEGISRRTVVESLKTQGVGTQVHYIPVHRQPY
FT                   YAQRYGVADLPGADAWYARCLTLPLYPAMTNGDVERVVGALATVLG"
FT   gene            complement(250273..250548)
FT                   /locus_tag="CCNA_00235"
FT   CDS_pept        complement(250273..250548)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00235"
FT                   /product="hypothetical protein"
FT                   /note="CC_0235"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93702"
FT                   /db_xref="GOA:A0A0H3C6B0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6B0"
FT                   /protein_id="ACL93702.1"
FT                   /translation="MTQRPRQDERAKDVWFEYVLTAGRFSAWPIRWQGWLATALLIVGP
FT                   ITGMMAIAKLAPGVPPFVLVLGAMTVCFGTVFPLAYFKGRPAKSRG"
FT   gene            complement(250611..252308)
FT                   /locus_tag="CCNA_00236"
FT   CDS_pept        complement(250611..252308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00236"
FT                   /product="hypothetical protein"
FT                   /note="CC_0236"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93703"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C339"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93703.1"
FT                   /translation="MGQVHYELFVRRKVGAQWTLEIATENRAHALQVAEDVLTQNRAVA
FT                   SRVTKETLDPSTGEYKSISIFTKGLVDGGKPKKEVENRDPLCVQPADLYTAHARDRIGR
FT                   LLEGWLSRHKATPFELLHRPDLVEKLEASGTDLQHALQKIAIPEAEARGQSVHEVMRHF
FT                   HGLVERTIANLMKAFKKGALPDLDKEGFARAAERLVADPDRAFLLGAGVAASIAPATNW
FT                   SDKIARLLDLADAAPAEARARVAALQAIETPLAEIIGSRAGMADLLDTKDDLGATLAAM
FT                   TRLTGGAAVEALIKIEPGVRACMPDLSGTARRLSEWLAEDHFPSVRKAIAQRVLTELNG
FT                   VRRLKPQDAEAEIEYLRALAMGLTAAAGRILQGEDIQVAFTTRSKTLLNGDFIEALLGR
FT                   DRSAHEEIKMLIRLAENVMGAVNKRNASRWLNANISAMRFEKEMRQGPDSPVAKLSHLA
FT                   ALQRSLSRSGLVREDYEPLCAKLGEIGGLIEGDTRLLTMLVRAPAPLPHRLQLLAKLAM
FT                   GEAGPTGPVADKARFEALKLAKDPSSREQLTNSPQTMDLIKSLLSHAA"
FT   gene            252525..253232
FT                   /gene="chvI"
FT                   /locus_tag="CCNA_00237"
FT   CDS_pept        252525..253232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvI"
FT                   /locus_tag="CCNA_00237"
FT                   /product="two-component response regulator chvI"
FT                   /note="CC_0237"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93704"
FT                   /db_xref="GOA:A0A0H3C437"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C437"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93704.1"
FT                   /translation="MAAITLIDDDENIVASVSLALESHGHTVKAYYDGASGLEAVEASP
FT                   PDLVILDVKMPRMDGMEVLRRLRQTSEIPVIMLTSKDDEIDEILGFNLGADDYMHKPFS
FT                   QRLLLERVKAVLRRARPEEEDAPSAGGAAGSKVMKRGKLTLDPARHDSLWDGRPVRLTV
FT                   TEFLLLQALAQRPGFVKSRDNLMDAAYDDQVYVDDRTIDSHIKRMRKKFRQVDPEFDSI
FT                   ETLYGVGYRYREA"
FT   gene            253207..254811
FT                   /gene="chvG"
FT                   /locus_tag="CCNA_00238"
FT   CDS_pept        253207..254811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="chvG"
FT                   /locus_tag="CCNA_00238"
FT                   /product="two-component sensor histidine kinase chvG"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0238"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93705"
FT                   /db_xref="GOA:A0A0H3C4S8"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR025908"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4S8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93705.1"
FT                   /translation="MATVIAKPEAIAPEPKRRFTWPRGSRLGRLIVVLNVVALAIVIVG
FT                   ALILNELRNGLVNARIDSLSTQGELIANVIDQSATVGEPEPALDPYTASQIFQLLFIPR
FT                   SQRARLFDAQGKALADSFVVADRVDWKVLPPARKPDQKDDDARTTPDRAAKAKRAQEAL
FT                   ANEIAQAMRGRTVAGTRIAENGERVVSVSIPIQHVKAVLGVLTLEASDVDEIIAAQRKA
FT                   LLPFIAVAMLAILTSSVLLHRLIAVPVLRLARAADHVRLQGARAISLPDLSERKDELGD
FT                   LSRSLEDMTHSLSERMDAIERFAADVAHEIKNPLTSIRSAIETLDLVTEPAARARLLAI
FT                   LQNDVNRLDRLVTDISNASRLDAELSREHPKALDLGRLLTEVVSLYENQWRPGDAPGSV
FT                   RVSLSLADPSQPAIILGRETPIGQVFRNLIDNARSFSPADGEVRVTLSRTRGGLIAAVE
FT                   DDGPGMPPENLETIFERFYTSRPKGRAFGGNSGLGLSIARQIVETHGGTVHAENRKDAN
FT                   GAVVGARFVVELPDARE"
FT   gene            254808..255242
FT                   /gene="hprK"
FT                   /locus_tag="CCNA_00239"
FT   CDS_pept        254808..255242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hprK"
FT                   /locus_tag="CCNA_00239"
FT                   /product="serine kinase/phosphatase HprK"
FT                   /EC_number="2.7.1.-"
FT                   /note="CC_0239"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93706"
FT                   /db_xref="GOA:A0A0H3C5G7"
FT                   /db_xref="InterPro:IPR003755"
FT                   /db_xref="InterPro:IPR011104"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5G7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93706.1"
FT                   /translation="MIRHGGLIALRHQGLWRGALIEGPSGAGKSDLALRALDQGFRLVA
FT                   DDRVVTFAAGGRLYGRAPETLAGLIEVRGLGVVTAAAVSFAEIALVIRCVDTPGRVERL
FT                   PEPRFERIAGVDVPVFDLWPPEPAAPAKIRRMMQSLGVQS"
FT   gene            255318..255725
FT                   /locus_tag="CCNA_00240"
FT   CDS_pept        255318..255725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00240"
FT                   /product="PTS system, IIA component"
FT                   /EC_number="2.7.1.191"
FT                   /note="CC_0240"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93707"
FT                   /db_xref="GOA:A0A0H3C6B5"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR033887"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6B5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93707.1"
FT                   /translation="MIGLVIVTHGRLAEEFVSAMEHVVGPQAAVKAICIGPEDDMERRR
FT                   ADILKACAAVDEGGDGVILLTDMFGGTPSNLAISVMEQTKAEVIAGLNLPMLIKLASVR
FT                   QRETLQACVAHAQEAGRKYISVASYVLAGEK"
FT   gene            255722..256000
FT                   /locus_tag="CCNA_00241"
FT   CDS_pept        255722..256000
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00241"
FT                   /product="phosphocarrier protein HPr"
FT                   /EC_number="2.7.1.191"
FT                   /note="CC_0241"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93708"
FT                   /db_xref="GOA:A0A0H3C344"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C344"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93708.1"
FT                   /translation="MTGMASRTVEIVNERGLHARASAKFVKMASGFDAEVTVSREGASV
FT                   DARSIMGLMMLAAGIGSTIDISAEGPEAEAAIEALCELVGNRFDEER"
FT   gene            complement(256240..256344)
FT                   /locus_tag="CCNA_03917"
FT   CDS_pept        complement(256240..256344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03917"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03917"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88519"
FT                   /db_xref="GOA:A0A0H3IZ98"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IZ98"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88519.1"
FT                   /translation="MRTPNKPLFKAYELVAIAVFVVAAAAVSSIGLVY"
FT   gene            complement(256412..256810)
FT                   /locus_tag="CCNA_00243"
FT   CDS_pept        complement(256412..256810)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00243"
FT                   /product="hypothetical protein"
FT                   /note="CC_0243"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C442"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93710.2"
FT                   /translation="MTVIRRLSILVLAAVSLAAAPAHAGSERGGHVDPRLSADVAGGGC
FT                   ETRRVTGPGGAYRWERVECGADRGWSDHDRWGYGHAPLAVETQDDRYGARESYAEDRYG
FT                   PSPGAYGPNYVAAGRDRIGYLIWPGKRP"
FT   gene            256953..257594
FT                   /locus_tag="CCNA_00244"
FT   CDS_pept        256953..257594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00244"
FT                   /product="HAD superfamily phophatase"
FT                   /note="CC_0244"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93711"
FT                   /db_xref="GOA:A0A0H3C4T3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR011945"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4T3"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93711.1"
FT                   /translation="MAVEAVIWDFGGVFTTSPFEAFRRYETERGLPKDFIRTVNATDPD
FT                   ANAWARFERAEIDAAAFDGLFRQEALRLGHDVRGADVLPLLYGDLRPSVMAALKTCKAQ
FT                   FKVGCITNNVPTGHGPGMAQSAEKALAVGEIMALFDAVIESSKAGVRKPDPRIYQMMCE
FT                   LLGVAPEACIYLDDLGINCKPAAALGMTAIKVSDERQLLDDLAKATGLAF"
FT   gene            257623..257907
FT                   /locus_tag="CCNA_00245"
FT   CDS_pept        257623..257907
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00245"
FT                   /product="pterin-4-alpha-carbinolamine dehydratase"
FT                   /EC_number="4.2.1.96"
FT                   /note="CC_0245"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93712"
FT                   /db_xref="GOA:B8GYB5"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYB5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93712.1"
FT                   /translation="MSRPRIGAAAAITQLEGWAIAPNHKDAIVKTFRFDDFNQAFGFMT
FT                   RVALMADKLDHHPEWFNVYNRVEVLLTTHDADGVTDLDLTLAKFMDSAA"
FT   gene            257952..258737
FT                   /locus_tag="CCNA_00246"
FT   CDS_pept        257952..258737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00246"
FT                   /product="cyclohexanol dehydrogenase"
FT                   /EC_number="1.1.1.245"
FT                   /note="CC_0246"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93713"
FT                   /db_xref="GOA:A0A0H3C5H2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5H2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93713.1"
FT                   /translation="MAQSTGRVAGKKAFITGGAQGLGAAAGRMLAKEGAKVALADINLA
FT                   GAQAVADEINAAHGAGTAFAFELDVTQEDQWIDVLEKATAAMGGLSVLVNNAGIGGDGP
FT                   IESLDFGLWKKVMSVNVDSVFLGAKHALTHMRAHQPGSIINLSSIAGLIANGNSPAYNA
FT                   SKAAVWLLSKNIALYCAKMKLDIRSNSIHPTFIDTPILDGFSARFGKEEAFAKLARQVP
FT                   LGRIGEPTDIANAVLYLASDESKFMTGAEIKVDGGISAM"
FT   gene            complement(258879..259436)
FT                   /gene="spdR"
FT                   /locus_tag="CCNA_00247"
FT   CDS_pept        complement(258879..259436)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="spdR"
FT                   /locus_tag="CCNA_00247"
FT                   /product="two-component receiver protein SpdR"
FT                   /note="CC_0247"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93714"
FT                   /db_xref="GOA:A0A0H3C6B9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6B9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93714.1"
FT                   /translation="MADIGELVAALPDKSLLLLDDDAPLRTRLGRALEQRGFEVTLAAS
FT                   VAEALTILRTQAPAHAVLDMRLEDGSGLKVVEAVRDARADAKVIMLTGYGNIATAVAAV
FT                   KAGVVDYLSKPADADDVARALLAAKDAAPAPPENPMSADRVRWEHIQRVYEMCGHNVSE
FT                   TARRLNMHRRTLQRILAKRAPR"
FT   gene            complement(259514..260914)
FT                   /locus_tag="CCNA_00248"
FT   CDS_pept        complement(259514..260914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00248"
FT                   /product="sensor histidine protein kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0248"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93715"
FT                   /db_xref="GOA:A0A0H3C350"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C350"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93715.1"
FT                   /translation="MADVSFARAPDDQRHKGLDKLADEPAQDDAWSWTAPGLRRGRLRV
FT                   RTLLAQRWAWVVGQTAVLTFAGLVLKLQVPWALCFTLIALSAWLNVLLGLASSGQRLAR
FT                   DGEATAQIAFDILQLSGLFYLTGGAQNPFSLLLIAPVTLAAATLPARYALTLGAMAILS
FT                   SILLALFHLPLPTVDGRPLPDLSNSNLLWSIVIARIFGIVFTGLYAWQAASESARMELA
FT                   LNVTETVLAREQRLSALGALAAAAAHELGTPLATISVVAREMARNAPNDEVREDAELMI
FT                   GQAARCREILQRLTEMPEATDAVHERMSLVQLVQDVIEPHLVHGIRVEAVVNGPSGETA
FT                   PDIWRRPEIIHAMTSIVENAVDFARSEVIVIARFDARHIVIEARDDGPGFSPEVLAKLG
FT                   EPYVTTRPGAEGSRTGHIGMGLGFFIAKTLLERTGATVDFRNGRRGGAVVSARWPRPAL
FT                   EAPGHTGA"
FT   gene            260971..261561
FT                   /locus_tag="CCNA_00249"
FT   CDS_pept        260971..261561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00249"
FT                   /product="SCO1/SenC family protein"
FT                   /note="CC_0249"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93716"
FT                   /db_xref="GOA:A0A0H3C446"
FT                   /db_xref="InterPro:IPR003782"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C446"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93716.1"
FT                   /translation="MPRHRLVLILACVVGLAVAVGLAWNVGVFRSEPAVTVGGPFELVD
FT                   QNGAPTSEKALKGKWSAVFFGFTYCPDVCPGTLQGLAAATDQLGPKAKDFQIVFISIDP
FT                   ARDTVKQMKAYLSAPYVPKATIGLTGTQAQVDAAAKAYRVYHAKVGDGVDYTMDHSTAI
FT                   YLMDPKGRFKTVIPYNLPPDEIARRIKDAVREG"
FT   gene            261642..262904
FT                   /locus_tag="CCNA_00250"
FT   CDS_pept        261642..262904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00250"
FT                   /product="poly(3-hydroxyalkanoate) depolymerase"
FT                   /EC_number="3.1.1.-"
FT                   /note="CC_0250"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93717"
FT                   /db_xref="GOA:A0A0H3C4T8"
FT                   /db_xref="InterPro:IPR009656"
FT                   /db_xref="InterPro:IPR010915"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4T8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93717.2"
FT                   /translation="MLYALHEAAYYASTPMRLAALAARDFWGSPLNPAADSAVGRRMHA
FT                   GADLFANVTRRYGKPKWNIDKVKVGQVDVRVRPTVVWESPWARLVQFDRDMADMRRAGK
FT                   FSLDPAVLIVAPLSGHYATLLRGTVEAFLPDHAVFIVDWVNAREVSVLEGRFDFHDYID
FT                   HVIQMLEVLGPRPNVVAVCQPGPPVLAAAALMAEQNHPSRPASMTFMGSPIDARLSPTV
FT                   TNQLAEEKPFTWFQSNMIYNVPPPYAGAGRRVYPGFVQLASFMSMNADRHQEAHRRYFN
FT                   HLVSGDGDSADKHLEFYDEYLSVLDLTEEFYLQTIDIVFQQYLLPKGELVHRGTRVKPE
FT                   VITDIGLMTVEGENDDISGIGQTQAAHGLCANIPEDMKLDYVQPSVGHYGVFNGRRFRE
FT                   EIYPRVRKFIRKCDPNFGEEV"
FT   gene            262953..263672
FT                   /locus_tag="CCNA_00251"
FT   CDS_pept        262953..263672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00251"
FT                   /product="zinc metalloprotease"
FT                   /EC_number="3.4.24.-"
FT                   /note="CC_0251"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93718"
FT                   /db_xref="GOA:A0A0H3C5H5"
FT                   /db_xref="InterPro:IPR002725"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5H5"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93718.1"
FT                   /translation="MFARSAQRFSDGDRLEVGGWPVRLKVDGRARRISLRVDRARSEIV
FT                   ALSPTPRRLNEAVAFAQEKAGWIAKQLAALPERMSLAPGGVLRLNDKPFRLEVGAGRAR
FT                   IDGDRIVAPDDANWGLKVIRLAKREALTVLTERTAIHAAALGRPVPSVAIADPKARWGS
FT                   CRPATSRAPAAIRYSWRLILAPAVVADYVAAHECAHLIEANHGPRFWALCEQLIGDPTP
FT                   HRAWLRAHAAELHAIGA"
FT   gene            complement(263784..265745)
FT                   /gene="pbpX"
FT                   /locus_tag="CCNA_00252"
FT   CDS_pept        complement(263784..265745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pbpX"
FT                   /locus_tag="CCNA_00252"
FT                   /product="multimodular transpeptidase-transglycosylase
FT                   PbpX"
FT                   /note="CC_0252"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93719"
FT                   /db_xref="GOA:A0A0H3C6C5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6C5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93719.1"
FT                   /translation="MANGPFGGNPPAKPQRTPLQALIYWGSVVGVWGLIFVVAFFAVFA
FT                   SDLPDTSKLYDVKRQPSINYLDRSGALLAVRGSQYAPPVDLDALPKYVPAAFIAIEDRQ
FT                   FYHHFGFNPWGIIRSAAWNLTHDGPQRGGSTITQQLARNLFLSPAQNYRRKAQELILAI
FT                   WLELKFSKKQILALYMNRVYFGAGAYGIEAASQRYFNKPANQLTIGEAALLAGMMKGPA
FT                   RYSPVSAKERAARRATIVLDEMVRIKAITAEERDEAFRTPVQVSATLANQRAQYFTDYI
FT                   DAQVRSLVGEPTEDLVVETTMDLPIQVAAERAVKLGVEGHIKQGVQQAALVAIDGEGRI
FT                   RAYVGGADYNDSQFDRATTARRQAGSAFKPFVFLTAMEAGRTPNVMVVDEPVKIGNWEP
FT                   KNYTNKYLGPITLQTALAQSINTVAARLANEVGTSNVAATARRLGITSKIQLDPSMALG
FT                   AVEVSPMEMAQAYAPFANGGFLAKGYGIERIRTASGKVLYDHSVDKQARAAVIGSPSLQ
FT                   YMNQMMREVVATGTGTRARVASYDIAGKTGTTSDYKDAWFVGYTGGFVTAVWTGKDDAT
FT                   PMKRVTGGGAPAEVWRVFMAAALPRLKATPIPGGFIEPPPVAPIDPIGDLVDAPPAPEG
FT                   PAAEAPAGEPPPADQLPY"
FT   gene            265999..267027
FT                   /locus_tag="CCNA_00253"
FT   CDS_pept        265999..267027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00253"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number="1.2.1.11"
FT                   /note="CC_0253"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93720"
FT                   /db_xref="GOA:A0A0H3C356"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C356"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93720.1"
FT                   /translation="MGYRVAVVGATGNVGREMFNILEEVKFPVDKMHAIASRKSIGVEV
FT                   SFGNEILKCEDLEQFDFSKVDLVLMSAGGSISKAWGEKIGAAGPIVIDNSSHFRMDPDV
FT                   PLVVPEVNPEAVNSIPKNIIANPNCSTAQLVVALKPLHDEAKIKRVVVSTYQSVSGAGK
FT                   EGMDELWDQTKGVYVLGAPPPKKFTKQIAFNVIPHIDVFMDDGFTKEEWKMAVETQKIL
FT                   DPAIKLTATCVRVPVMVGHSESVNVEFESPLDEDEAREILREADGIVVVDKREDGGYIT
FT                   PKESQGEFPVYISRIRKDPTVENGLAFWCVSDNLRKGAALNAVQIAQLLHDKGLLKRKV
FT                   LA"
FT   gene            267164..268066
FT                   /locus_tag="CCNA_00254"
FT   CDS_pept        267164..268066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00254"
FT                   /product="RarD family membrane permease"
FT                   /note="CC_0254"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93721"
FT                   /db_xref="GOA:A0A0H3C451"
FT                   /db_xref="InterPro:IPR004626"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C451"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93721.1"
FT                   /translation="MPPHSQTESRSAYAAGVGCYLLWGFLPLYFHLLAKLGVTSWEMIA
FT                   HRSLWSVLWALGLVLIARQVGQVAQVLRQPKTLGVLALTTLAIFSNWTIYVFAVNAGHV
FT                   IEASLGYYINPLMNMAAGALLFRERMSTEGKVAIGLAAVGVAIQTVALGHLPIVSLGLA
FT                   LTFCVYAILRKQVKADAQTGLFIECAYLALPGLAYVWFLQSSGQGHFGDGASVTTLLAL
FT                   AGPATVVPLALFAWSARRLPLSAVGFLQFIAPTIQFLLGVAFGEPFTPLRALSFVFIWL
FT                   GVATFAYGAWRKAKALSPA"
FT   gene            complement(268063..269187)
FT                   /locus_tag="CCNA_00255"
FT   CDS_pept        complement(268063..269187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00255"
FT                   /product="beta-lactamase class C family protein"
FT                   /EC_number="3.1.1.1"
FT                   /note="CC_0255"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93722"
FT                   /db_xref="GOA:A0A0H3C4U3"
FT                   /db_xref="InterPro:IPR001466"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4U3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93722.1"
FT                   /translation="MTDITGVCPDRFAAVREVFEQNFADGGELGARFAFAIEGEVVVDL
FT                   MGGFADRKRQVPFGPDTLTALFSTTKAVAALLIARLVDEGRLAYDQAVADVWPEFAQAG
FT                   KDAVTVEQALSHQAGLSGFPDETDPAIWFDWDATCAKLAAMAPLFPIGSASGYHPVTYG
FT                   YLAGEIFRRVDGRTMGTALREDICEPLGLDLWIGLPDSEHDRVADLMRPTAMPQFGEIN
FT                   PAVEAAFFKPWSSPGGKGAAEWRRVEIPSANGHATAPALARLMGALAHGGTLDGRSLIT
FT                   PAGIKAATAERLRGRDLVLPYEISWGAGFMRNEPNFYYGPTAEAFGHSGWGGSCAFADP
FT                   TRGVSGAYVMNKQGNALIGDPRSVRLIEAAYASL"
FT   gene            complement(269206..270057)
FT                   /locus_tag="CCNA_00256"
FT   CDS_pept        complement(269206..270057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00256"
FT                   /product="pyridoxine kinase"
FT                   /EC_number="2.7.1.35"
FT                   /note="CC_0256"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93723"
FT                   /db_xref="GOA:A0A0H3C5I0"
FT                   /db_xref="InterPro:IPR004625"
FT                   /db_xref="InterPro:IPR013749"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5I0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93723.1"
FT                   /translation="MPLALIISSHVAGSQVGATAQATALAQFKIDSMVVPTVLFGRHPG
FT                   WGIPGGAPVPIEVFEGMLDGIEANGLFGLVDLVITGYFATAAQVRAAARVIDAVRESPR
FT                   PNGAAMRRPTVIVDPTMGDAGKGLYIPAETADEIIADLIPRADVVACNSWELQKLTGTD
FT                   ARDPQSAMRAARLLGKTTLVSSVHRGAEIGAVLADKKEAWLAAHAKSDRSPNGTGDLLT
FT                   ALYAASILEGQTFSYGLARAVGGVAETVTAANIWNAPELPIVGMGARIKQTSPTVRIER
FT                   LA"
FT   gene            complement(270176..271567)
FT                   /locus_tag="CCNA_00257"
FT   CDS_pept        complement(270176..271567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00257"
FT                   /product="adenosylhomocysteinase"
FT                   /EC_number="3.3.1.1"
FT                   /note="CC_0257"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93724"
FT                   /db_xref="GOA:A0A0H3C6D1"
FT                   /db_xref="InterPro:IPR000043"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR020082"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR042172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6D1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93724.1"
FT                   /translation="MADYIVKDISLADFGRKEIAIAETEMPGLMATRAEYGPQQILKGA
FT                   RIAGSLHMTIQTAVLIETLTALGAEVRWASCNIFSTQDHAAAAIAAAGVPVFAFKGENL
FT                   VEYWEYAHKIFEWHDGGYPNLILDDGGDATLLCVLGPKAEKDPSILNNPQNEEEEALYA
FT                   VMKKYLAEKPGFYSAIRAAIGGVSEETTTGVHRLYQMAQKDELPFPAINVNDSVTKSKF
FT                   DNLYGCRESLVDAIRRGTDVMLSGKVAVVCGYGDVGKGSAASLRQGGARVIVTEVDPIC
FT                   ALQAAMEGYEVQTLNDVADKADIFVTATGNKDVITVDDMRKMKNNAIVCNIGHFDSEIQ
FT                   IAGLRNFKWDEIKPQVHHVEFPDGKKLIVLSEGRLVNLGNATGHPSFVMSASFTNQTLA
FT                   QIELWTNKAKYENQVYTLPKHLDEKVAFLHLEKLGAKLTTLRKDQADYIGVPEAGPFKP
FT                   DHYRY"
FT   gene            complement(271910..272620)
FT                   /locus_tag="CCNA_00259"
FT   CDS_pept        complement(271910..272620)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00259"
FT                   /product="hypothetical protein"
FT                   /note="CC_0258"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C362"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93726.1"
FT                   /translation="MRHSPELIEALEVAYRIFADVAAPRMLEASPLRDASAIHRALTSG
FT                   QLAAIANADIGPYAGWAVTTVGTGKDYQYFLPRILELAVSDSSWMGVSPAVIASRLEMA
FT                   DWRTWPESQQAAVKAVFAAAFSWTLANSTQDPDAWLAGIALIGGATEEARQKWRESESL
FT                   TAAQGLASFVIAWRSAEQDGELAPPYWTDVPYPERSQTRGWLLSEESSAKLRQSLSTFG
FT                   PEEAWLIPQALDLL"
FT   gene            complement(272872..273558)
FT                   /locus_tag="CCNA_00260"
FT   CDS_pept        complement(272872..273558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00260"
FT                   /product="glutathione S-transferase"
FT                   /EC_number="2.5.1.18"
FT                   /note="CC_0259"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93727"
FT                   /db_xref="GOA:A0A0H3C456"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C456"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93727.2"
FT                   /translation="MAAYRLFSALGSGGVPIEAAMTLIGLPYEIIEAPTWEGEVEQAKV
FT                   AAVNPLKQIPALVTPEGETLTESAAILIWLADRYPQAKLGPAIDHPMRGQFLRWMTFIP
FT                   ASIYSLFWVRDEPSRLGGPDPEVQARIKAATADRIADCWAMMESQLAPLMDRHGGRYLL
FT                   GDELGVLDLYVAVVSRWGPRRVRFYEAAPRMSEAVRRADADPRLAAFWAERFPFFDGWE
FT                   RLGQQG"
FT   gene            273695..274738
FT                   /locus_tag="CCNA_00261"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        273695..274738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00261"
FT                   /product="ribonucleoside-diphosphate reductase beta chain"
FT                   /EC_number="1.17.4.1"
FT                   /note="CC_0260"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93728"
FT                   /db_xref="GOA:A0A0H3C4U9"
FT                   /db_xref="InterPro:IPR000358"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012348"
FT                   /db_xref="InterPro:IPR033909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4U9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93728.1"
FT                   /translation="MSAPSSLILPGLMTPSGGYKPFRYPWAYDFWKKQQQVHWMPEEVP
FT                   LGEDLKDWAVKLNDKERNLLTQIFRFFTQSDVEVQDNYMERYGRVFKPTEVKMMLASFA
FT                   NMETIHIAAYALLLETIGMPETEFSAFMEYEAMKAKHDYMQTFGVDSNADICRTLAMFG
FT                   GFTEGLQLFASFAMLMNFPRFNKMKGMGQIVSWSIRDESLHCDGIIKLYHAFNKETGAV
FT                   TKAVADDIVDCCKTVVGMEDNFIDLAFEAGDIQGMTPDDIKAYIRFVADWRLRQLHLPE
FT                   VYGVKENPLPWLQSLLSGVEHANFFEARATEYSKAATKGQWHGSDGVWTSFDEMMKKRS
FT                   AETIPAE"
FT   gene            274921..275793
FT                   /locus_tag="CCNA_00262"
FT   CDS_pept        274921..275793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00262"
FT                   /product="ketopantoate reductase panE/ApbA family protein"
FT                   /EC_number="1.1.1.169"
FT                   /note="CC_0261"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93729"
FT                   /db_xref="GOA:A0A0H3C5I7"
FT                   /db_xref="InterPro:IPR003710"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5I7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93729.1"
FT                   /translation="MTSIAVIGPGAVGGTLAAWLAQKPDHVVTVCVRTPFEALAVETPE
FT                   GAISATPRVATSPESLAPVDWVLVTTKTYDTDATWTWLDALVGPQTRVAILRNGVEHVA
FT                   PFVGKIAAERLVPAVVDIPAERSAPGRMLQRRNGWIKVPVGPAGEAFAALFAHTPIELH
FT                   VVEDFVTEAWKKLALNCAGAVNALVLKPAGIAHDEGAAQVMRSLVRECVAVGRAEGADL
FT                   SDDLPDQVIAGYRAADPGSVNSLHADRAAGRAMELDARNGVIVRRGAAHGIATPANAMV
FT                   VALLNAAAL"
FT   gene            complement(275815..276237)
FT                   /locus_tag="CCNA_00263"
FT   CDS_pept        complement(275815..276237)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00263"
FT                   /product="hypothetical protein"
FT                   /note="CC_0262"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93730"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6D7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93730.1"
FT                   /translation="MSKITPLAHAALIGLAIAGFSASIAMAQAPAEPSKAAKPARQCFY
FT                   LSDWRGWTAPDKNTLYMKVRGRDVYRVDLAYGSNQLTWPGTHLVSVVRGPDSVCHPLDL
FT                   DLRVSDGFGMPLPIRAKTITKLTPEEVQALPKKHRP"
FT   gene            complement(276384..277637)
FT                   /locus_tag="CCNA_00264"
FT   CDS_pept        complement(276384..277637)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00264"
FT                   /product="C4-dicarboxylate transport protein"
FT                   /note="CC_0263"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93731"
FT                   /db_xref="GOA:A0A0H3C369"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR033380"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C369"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93731.1"
FT                   /translation="MNKRFAYLIIASMILGVLVGWTCNQFLDPAGAKSAADNLSIITDI
FT                   FLRLIKMIIAPLVFTTLVAGVAHMEDAAAVGRIGAKTMTWFIGASAVSLVLGLLMVHLL
FT                   DPGAGLNMAHVDVAMKTTATTDAFTLKGFITHLVPTSIFDAMAKNEILQIVVFSLFVGT
FT                   AVAALDDKAPQILELVEQAAQIMLKVTGFVMKLAPLAIFAALASTIATQGLGMLATYGK
FT                   FVLGFYSAMGVLWALLFIAGLLVLGKRVIPLFGVIRDPVLLAFSTASSEAAYPRILDSL
FT                   PKVGVRRRIVSFVLPLGYSFNLDGSMLYCTFATMFIVQAHGVELTVQQQIFMLLLLMVT
FT                   SKGIAGVPRASLVVIMATLTYFGLPEAWIALVLGVDHLLDMGRSATNVVGNSVAAAVVA
FT                   KWEGELDDIPPEGEAAKA"
FT   gene            278017..279471
FT                   /locus_tag="CCNA_00265"
FT   CDS_pept        278017..279471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00265"
FT                   /product="AMP nucleosidase"
FT                   /EC_number="3.2.2.4"
FT                   /note="CC_0264"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93732"
FT                   /db_xref="GOA:A0A0H3C461"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011271"
FT                   /db_xref="InterPro:IPR018953"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="InterPro:IPR037109"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C461"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93732.1"
FT                   /translation="MSNQEKAIAVVERLNDEYERAVGALRDALRAYLEDGTRPDPAARF
FT                   DGTFAYPELRLTYDPEALPPKLARSYARVSRPGIYATTVTKPAQFRDYLVEQLTLLLDD
FT                   FDVEIEIDRSRQEIPYPYVLDATIDLNQADVRSEDIARFFPTTDLAFIGDEIADGLWNS
FT                   VLEDNHPLSLFDGLRTDFSLARLKHYTGAPAEDVQQFILFTNYNRYVDEFVRWGIEQLQ
FT                   QPDSPYTALSCAGGLTITANTVNPELAVAESTWRKHQMPAYHLMAPGGSGVTLVNIGVG
FT                   PSNAKTICDHLAVLRPQAWLMIGHCGGLRDTQTIGDYVLAHAYLRDDHVLDAVLPPEIP
FT                   VPSIAEVQRALYDAAKAISGDSGDQLKKRLRTGTVVTTDDRNWELRHSLSALRFNQSRA
FT                   VAIDMESATISAQGYRFRVPYGTLLCVSDKPLHGEIKLPGQANAFYERAISQHLQIGIL
FT                   ACKLLHAEGPNLHSRKLRAFDEPPFR"
FT   gene            complement(279599..280837)
FT                   /locus_tag="CCNA_00266"
FT   CDS_pept        complement(279599..280837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00266"
FT                   /product="3-ketoacyl-CoA thiolase"
FT                   /EC_number="2.3.1.9"
FT                   /note="CC_0265"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93733"
FT                   /db_xref="GOA:A0A0H3C4V4"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4V4"
FT                   /protein_id="ACL93733.1"
FT                   /translation="MAEAYIIDACRTPRGIGKVGKGALADFHPQHLAATVLKALAERNG
FT                   LNTAEVDDIIWGTSSQRGSQAGDLGRMAALDAGYDVRASGVTLDRFCGSGITTVNLAAA
FT                   SIMSGMEDLVIAGGTEMMSYTSATANVTSPPMLDSGNLRLRARHPQSHQGVCADAIATL
FT                   EGITRADVDALALESQRRADLAIQGGHFAKSLIPVLRDDGSVALDHEEFPRPQTTAEGL
FT                   ASLKASFAALAEIPVDEAGNTYGGLIRQVYPDLKIQHMHHAGNSSGVVDGAAAVLLASP
FT                   AYAQRHGLKPRAKVIAMANVGDSPTLMLNAPVPAARKALAKAGLTVDDIDLWEINEAFA
FT                   VVAEKFIRDLKLDRDKVNVNGGAMALGHPIGATGSILIGTILDELERRDLKRGLVTMCA
FT                   AGGMAPAIIIERI"
FT   gene            complement(280931..281872)
FT                   /locus_tag="CCNA_00267"
FT   CDS_pept        complement(280931..281872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00267"
FT                   /product="MutT-like protein"
FT                   /note="CC_0266"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93734"
FT                   /db_xref="GOA:A0A0H3C5J2"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015375"
FT                   /db_xref="InterPro:IPR015376"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5J2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93734.1"
FT                   /translation="MPLSIITNTFAGNPLDRDSERRGDEAFLAEKLADPESLAVALWNG
FT                   KPLVEDILGEDGKPTGVQIAYLRADMAQDLAGGSEKLLYMGLWKDIAVFAVDIEGAADP
FT                   AEGPLQGLGRFEELRGAAASMPPADAGILATAKSMFEWRRRHRWCSACGQKTEVSDGGW
FT                   KRVCPSCEAEHFPRTDPVAIMLAIHDGKCLLGRQAMWPQGMFSALAGFIEPGETIEEAC
FT                   ARELQEEAGLKATAVRYHSSQPWPWPSSLMMGLIAEVDSDEAAPDQTELEEVRWFTREE
FT                   ALQLIRGELDGLFAPPPLAIAHQLIKAWAEEA"
FT   gene            281946..282042
FT                   /locus_tag="CCNA_R0005"
FT   ncRNA           281946..282042
FT                   /locus_tag="CCNA_R0005"
FT                   /product="4.5S signal recognition particle RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /experiment="EXISTENCE:ncRNA mapped by tiling arrays
FT                   experiments of Landt, et al. (2008) Mol Micro. 68;3:600-14.
FT                   doi: 10.1111/j.1365-2958.2008.06172.x"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            282130..283956
FT                   /gene="dnaX"
FT                   /locus_tag="CCNA_00268"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        282130..283956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dnaX"
FT                   /locus_tag="CCNA_00268"
FT                   /product="DNA polymerase III subunit gamma/tau"
FT                   /EC_number="2.7.7.7"
FT                   /note="CC_0267"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93735"
FT                   /db_xref="GOA:A0A0H3C6E2"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022107"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6E2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93735.2"
FT                   /translation="MADHDDLSPDSAPPWDEAPAERDENTADIFGDAPAPAAEARPVVE
FT                   TPPEGEKGDAYTVLARKYRPRTFEDLIGQEAMVRTLANAFSTGRIAHAFMLTGVRGVGK
FT                   TTTARLLARALNYETDTVKGPSVDLTTEGYHCRSIIEGRHMDVLELDAASRTKVDEMRE
FT                   LLDGVRYAPVEARYKVYIIDEVHMLSTAAFNALLKTLEEPPPHAKFIFATTEIRKVPVT
FT                   ILSRCQRFDLRRVEPDVLVKHFDRISAKEGARIEMDALALIARAAEGSVRDGLSLLDQA
FT                   IVQTERGQTVTSTVVRDMLGLADRSQTIALYEHVMAGKTKDALEGFRALWGFGADPAVV
FT                   MLDVLDHCHASAVSKALGPDALSMPKEQAARLAAIGAHTSAGTLSRLWQMLLKAHDEVR
FT                   RAPDAMAAAEMALIRLCYAADLPGPEEALKALRDGAPVGGGGPGGGVAIGGGGAGGATA
FT                   SAQSPVMMAAPGAQAMPVLASFDDVMALIAAKRDIGLRLDVEQYVRPINFRPGAITFEA
FT                   APGAPGNLAGRLVRFLKEHTGQPWLVAAEGGGGAESLMERQKREEREALEAIKQDPFVA
FT                   SVLSAFPGAEIVEIRKILTPETAPLEPDEEEG"
FT   gene            284102..284431
FT                   /locus_tag="CCNA_00269"
FT   CDS_pept        284102..284431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00269"
FT                   /product="YbaB/EbfC-family DNA-binding protein"
FT                   /note="CC_0268"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93736"
FT                   /db_xref="GOA:B8GYD9"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYD9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93736.1"
FT                   /translation="MKDLGGLMKQAQAMQQKLADAQARLAETTVDGTSGGGMVTVTLMG
FT                   NGELVRVLMDESLVQPGEGEVIADLIIAAHADAKKKLDAKQAQMMQDAAGPMAGLMGGL
FT                   PGMKF"
FT   gene            284558..285160
FT                   /gene="recR"
FT                   /locus_tag="CCNA_00270"
FT   CDS_pept        284558..285160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recR"
FT                   /locus_tag="CCNA_00270"
FT                   /product="Recombination protein recR"
FT                   /note="CC_0269"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93737"
FT                   /db_xref="GOA:B8GYE0"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYE0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93737.1"
FT                   /translation="MAASAGPEIERLIALLSKLPGLGPRSGRRAALALLKKRDTLLAPL
FT                   ATAMAEAQAKVRTCGTCGSLDVTDPCAVCADGSRDGRLLCVVEEVGSVWAMERGGSFKG
FT                   RYHVLGGLLSALDGIGPEALRIGELVGRVADGSVAEVILALPATVDGQTTAHYIADRLA
FT                   KTNVPVTMLARGVPVGGDLDWLDDGTIAQALRARRPA"
FT   gene            285270..285422
FT                   /locus_tag="CCNA_00271"
FT   CDS_pept        285270..285422
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00271"
FT                   /product="hypothetical protein"
FT                   /note="CC_0270"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93738"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C372"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93738.1"
FT                   /translation="MSTPDDKVPEAEIETPHVAKVGVHDKGHNVTSFNEEPINGLIADI
FT                   ADGDE"
FT   gene            285476..286765
FT                   /locus_tag="CCNA_00272"
FT   CDS_pept        285476..286765
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00272"
FT                   /product="RmuC family protein"
FT                   /note="CC_0271"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93739"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C465"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93739.1"
FT                   /translation="MNFSDPYLILALVFALAAVALGLWAVAAQRRAAKAEAQAWLLTER
FT                   LAQAEERHRLLEDQSATQIELIKAQAAQSANAIAEQLIKRADENAKSRERLAEARLEAQ
FT                   LKPVAETLAKFEAQVTAVEKARAEETGGLKAQITALLEASTATQAEARKLSAALRRGAG
FT                   VQGRWGEQTLRNVLEAAGLNSRFDFQEQFSVDSEEGRRRPDVKVTLPGGGVFVIDAKCS
FT                   LNAFLEAQDATDEVLREAAMARHAQSVRTHMQGLSSKAYWDQFAGEGSPDFVAMFVPGD
FT                   GFLAAALDRLPELMAEAMDRRVVLVTPTTLFALCKAVAYGWRAEDQAKNAARIVEVGRE
FT                   LYKRVSVMGAHAGAMGKALESAVGKYNQFVGSLESQVLTQARRFEDLSVDHEGKEIPEP
FT                   PMVDQAVRPLTKLKAVGQSPTLTLGNDTPT"
FT   gene            286774..287295
FT                   /locus_tag="CCNA_00273"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        286774..287295
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00273"
FT                   /product="peptide deformylase"
FT                   /EC_number="3.5.1.88"
FT                   /note="CC_0272"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93740"
FT                   /db_xref="GOA:B8GYE3"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYE3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93740.1"
FT                   /translation="MAIRRILTVDNAADLATLKKISTPVEAVTDELRALMDDMLETMYD
FT                   APGIGLAAVQVGEPVRVIVMDLAREGEDKAPRYFVNPEILASSEDLQGYEEGCLSVPEY
FT                   YDEVERPSKVTLRYMNYQGETVVEEAEGLFAVCIQHEMDHLEGVLFIDHLSRLRRDRAM
FT                   AKVKKARRAA"
FT   gene            287636..287998
FT                   /locus_tag="CCNA_00274"
FT   CDS_pept        287636..287998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00274"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93741"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Y1"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93741.1"
FT                   /translation="MVFGWLKKWIARGKPPSWTIAVVDGAIAINDGQGAEHTVLVSDLR
FT                   RVVVATDDSGPWGEDVVFLLYSEAAEPAGIIPLEANGVQDFVAWLTTLPGYHDRELAKA
FT                   MSSTKVARFVVYEALA"
FT   mobile_element  complement(288024..289578)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            complement(288082..289527)
FT                   /locus_tag="CCNA_00275"
FT   CDS_pept        complement(288082..289527)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00275"
FT                   /product="transposase, DDE family"
FT                   /note="CC_0273"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93742"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5J7"
FT                   /protein_id="ACL93742.1"
FT                   /translation="MDLSRFVEGCDRRQPTLLPECLDDYVAEENPVRVVDVFVDDLDLG
FT                   TLGFEGLTPAVTGRPAYHPAMLLKLYVYGYLNKVQSSRRLEREARRNVELMWLTGRLAP
FT                   DHKTIADFRKDNGPAIQAACAQFVVLCRQIGLFGAALVAIDGSKFKAVNTRDKNFTANK
FT                   LKKRLEQVAEHIAGYLRDLDTADRQEGEAAETRSERLKEKVERLREQMRWLQTMEAKVA
FT                   ASPDGQVSLTDPDARSMATTGRGSGMVGYNVQSAVETEHHLIVAHDVVMTGSDRQQLSS
FT                   MAARTKDALGVETLDVLADRGYFSGEEILACEALGVTPYVPRPLTSGAKANGRFGKQDF
FT                   VYLPEQDVYRCPSGALLPRHMTNVENGMTLHRYWDHFSCQSCALKPQCTPSIARRVTRW
FT                   EHEAVIDAMQRRMDLTPGAMRQRRRTVEHPFGTIKAWMGSTHFLMKRLPNVKTEIGLHI
FT                   LAYNLKRVIAILGVGPLMKAIQA"
FT   gene            complement(289617..290096)
FT                   /locus_tag="CCNA_00276"
FT   CDS_pept        complement(289617..290096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00276"
FT                   /product="hypothetical protein"
FT                   /note="CC_0274"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93743"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6E8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93743.1"
FT                   /translation="MPKIDLAAAPTRIGTAYPAPFNQPCLQRHRTKLGDAAGLTQFGVN
FT                   LLRLAPGVWSSQRHWHTAEDEFTWVVEGEVVLVENDGETVLRAGDCAGFKAGVANGHCF
FT                   QNRSDRDVLLLEVGSRRPDADGCDYPDIDLVLREGESVYRHRDGTPYETEQGRKR"
FT   gene            290161..291321
FT                   /gene="dapE"
FT                   /locus_tag="CCNA_00277"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        290161..291321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="dapE"
FT                   /locus_tag="CCNA_00277"
FT                   /product="succinyl-diaminopimelate desuccinylase DapE"
FT                   /EC_number="3.5.1.18"
FT                   /note="CC_0275"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93744"
FT                   /db_xref="GOA:B8GYE7"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR005941"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYE7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93744.1"
FT                   /translation="MTSPAPVSVSIDPVELAQALIRRPSVTPADAGAMDTLQRQLEALG
FT                   FACRRMKFGEIENLYARRGTARPNLCFAGHTDVVPVGDDAAWTAGPFEAEIKEGVLYGR
FT                   GAVDMKSAIAAFVAAVANVPDHPGSISFLITGDEEGVAEDGTVKVVEALAAEGEIIDHC
FT                   IVGEPTSANLLGDMVKIGRRGSINAWITVEGRQGHVAYPHRAANPVPVLVDILSALKAR
FT                   VLDDGYTGFQPSNLEITTIDVGNTATNVIPAAAKARVNIRFNPAHKGKDLAAWIEGECA
FT                   KAAEGFDGAATALCKISGEAFLTEPGDFTDVIVAAVTDATGRAPELSTTGGTSDARFIR
FT                   ALCPVVEFGLVGSTMHQVDERVPVEEVRQLAGAYEALIRRYFAAFA"
FT   gene            291339..292259
FT                   /locus_tag="CCNA_00278"
FT   CDS_pept        291339..292259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00278"
FT                   /product="glutaminase"
FT                   /EC_number="3.5.1.2"
FT                   /note="CC_0276"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93745"
FT                   /db_xref="GOA:B8GYE8"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR015868"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYE8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93745.1"
FT                   /translation="MKALSIPDVLAEVAVLVRPHFGKGKPADYIPQLATVPGGKFGMAV
FT                   RMVDGDEHVIGDADEGFSVQSITKVFALGLALNRLGDEIWTRVGKEPSGTPFNHLSLLE
FT                   AEQGVPRNPFINAGALAVTDVLMDVTRDPAALVRDFGGFLCGERLEIDPAVATSELAHA
FT                   WQNRAIASLMRAKGTITHDPEAVVAAYCRQCALSMSCRQLARAFLPLAAGGFSPIAQET
FT                   VFPERLTRRLNALLLTCGIYDSVGSFAYRVGLPAKSGVGGGIVAVVPGKATVAVWSPEL
FT                   DRFGTSVVGTAALEAFSQITNCSVL"
FT   gene            292311..292901
FT                   /locus_tag="CCNA_00279"
FT   CDS_pept        292311..292901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00279"
FT                   /product="NAD(P)H-quinone reductase"
FT                   /EC_number="1.6.5.2"
FT                   /note="CC_0277"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93746"
FT                   /db_xref="GOA:A0A0H3C375"
FT                   /db_xref="InterPro:IPR003680"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C375"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93746.1"
FT                   /translation="MTTPSRRILILVGHPDPAPERFCRALAEAYAQGAMEGGHEVRRAD
FT                   IGSMDIALLESQAAFQVDDAPQSIRDLRADIVWAEHLVLVFPLWLGGAPAKLKAALEQV
FT                   CRGGFGFEVGPRGWSSKLAGRSARMVLTMGMPSAIFRLVFGSHGLKAVTQGIFMLAGVK
FT                   PRRASIIGGVEAIGAGGRSRWLKRMGHLGEAAR"
FT   gene            complement(292898..293641)
FT                   /locus_tag="CCNA_00280"
FT   CDS_pept        complement(292898..293641)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00280"
FT                   /product="tRNA pseudouridine synthase A"
FT                   /EC_number="5.4.99.12"
FT                   /note="CC_0278"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93747"
FT                   /db_xref="GOA:B8GYF0"
FT                   /db_xref="InterPro:IPR001406"
FT                   /db_xref="InterPro:IPR020095"
FT                   /db_xref="InterPro:IPR020097"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYF0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93747.1"
FT                   /translation="MPRYRLLVEYDGRPYAGFQAQATLPSVQGAIEAAVKAFCGQEVRI
FT                   AAAGRTDTGVHATGQVVHVDLDKDWPAQTVFNALNAHLTREAVSILSAEVAEEGWHARF
FT                   SANERRYLYRILNRRAPPALDKGRVWHMKKDLDHEAMHAAAQHLIGLHDFTTFRDMHCQ
FT                   SKSPVKTLDVARVRRVGEEIHLDFEARSFLHRQVRSMTGTLVEVGAGRWTVDDVKAALE
FT                   ARDRRECGPVAPADGLYLVGVGYGD"
FT   gene            complement(293641..294567)
FT                   /locus_tag="CCNA_00281"
FT   CDS_pept        complement(293641..294567)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00281"
FT                   /product="methionyl-tRNA formyltransferase"
FT                   /EC_number="2.1.2.9"
FT                   /note="CC_0279"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93748"
FT                   /db_xref="GOA:B8GYF1"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR005793"
FT                   /db_xref="InterPro:IPR005794"
FT                   /db_xref="InterPro:IPR011034"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="InterPro:IPR041711"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYF1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93748.1"
FT                   /translation="MRIAFLGTPDFAVTCLAELVASGHEIVCVYSQPPAPRGRGQDLKP
FT                   SPVHAFAEGLGLPVRTPVSMKTPEEIAAFQALDLDAAVVVAFGQILVKDVLEAPKHGCF
FT                   NLHASLLPRWRGAAPIQRAIMAGDAVTGVQVMRMSEGLDEGPILMSQQVAIADDDTAAS
FT                   LHDKLAAVGARLLPVALAAIEREVVQETPQAEDGVTYAKKIKSAEARIDWTRPAAEIDR
FT                   HIRGLSPFPGAWFEAPSEKGPVRVKALLSRVEAASGVAGTTLDDALLIACGEGSIRLLK
FT                   AQREGKGVQDAQTFTRGFPIATGTVLA"
FT   gene            294659..294991
FT                   /locus_tag="CCNA_00282"
FT   CDS_pept        294659..294991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00282"
FT                   /product="conserved cell surface protein"
FT                   /note="CC_0280"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93749"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C471"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93749.1"
FT                   /translation="MTMRSTLMLIAAGAAALSLAACSQEHAAEVKEGAKAAASDVKDAA
FT                   HEIANDPDVKEAGTAIKESVKETGADLKDAAGEAGQELKEAGKDLKHDAKEGAAESKKQ
FT                   LHEATK"
FT   gene            complement(295109..295969)
FT                   /locus_tag="CCNA_00283"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(295109..295969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00283"
FT                   /product="2,3,4,5-tetrahydropyridine-2-carboxylate
FT                   N-succinyltransferase"
FT                   /EC_number="2.3.1.117"
FT                   /note="CC_0281"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93750"
FT                   /db_xref="GOA:A0A0H3C4Y5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005664"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="InterPro:IPR023180"
FT                   /db_xref="InterPro:IPR037133"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Y5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93750.1"
FT                   /translation="MTAVSLPPVSLADLQTEIEAAWEARADISAATTGPVRTAVDEALR
FT                   LLDSGEARVAEKIDGEWFTHQWLKKAVLLSFRLNPNTVMRSGALGGGVGPWWDKVPNKF
FT                   DGWDAPQFEAGGFRAVPGAIVRRGAHIGKNVILMPSFVNIGGYVDEGTMVDTWVTVGSC
FT                   AQIGKNVHLSGGVGIGGVLEPLQANPTIIEDNCFIGARSEVVEGVVVGEGSVLSMGVFI
FT                   SASTKIVDRKTGAVHIGKVPPYSVVVPGNLPDPNGGPGLYCAVIVKTVDAQTRSKTSIN
FT                   DLLRD"
FT   gene            complement(295966..296631)
FT                   /locus_tag="CCNA_00284"
FT   CDS_pept        complement(295966..296631)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00284"
FT                   /product="pyrimidine 5'-nucleotidase family protein"
FT                   /note="CC_0282"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93751"
FT                   /db_xref="GOA:A0A0H3C5K2"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR010237"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5K2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93751.1"
FT                   /translation="MSADLSHVDTWLFDLDNTLYPIETQFMGLIEAKMTDFVARETGLP
FT                   RDEARALQHGYFTEHGTTLAGLMANHGIEPQRFLDEVHDVSLDCLTPDPALRAAIAALP
FT                   GRRLIFTNGSVGHAERVLVHLNLRDLFSELFAIETADYVPKPALATFDRICKLHDIDPP
FT                   MTAFFEDSEKNLVPASRLGMTTVLVGPHAAASTSEHVHFRTNDLAEFLSSARLQGSPA"
FT   gene            complement(296628..297542)
FT                   /locus_tag="CCNA_00285"
FT   CDS_pept        complement(296628..297542)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00285"
FT                   /product="acetylglutamate kinase"
FT                   /EC_number="2.7.2.8"
FT                   /note="CC_0283"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93752"
FT                   /db_xref="GOA:B8GYF5"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR004662"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR037528"
FT                   /db_xref="InterPro:IPR041727"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYF5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93752.1"
FT                   /translation="MTDVAEEAGWATAKTLAEALPYIQIYDRETVVIKYGGHAMGQEDV
FT                   AKVFAADAVLLKLLGVHPVVVHGGGPQISRMLDKAGVKSTFVDGLRVTDEATMEVAEMV
FT                   LSGAINKEIANWITLAGAEADVRGVGLSGKDARLITAEKVTRTKKDPDSNIEQAVDLGF
FT                   VGEPTKVDPQLIEALLTSEHDYIPVVAPIGVSPDGDTFNINADTVAGALAGALKAKRML
FT                   MLTDIKGVLDGNGELIREMTIEQARALIDTGVATGGMIPKLENAIHAIESGVEAVVILD
FT                   GRRPHAMLVELFSEYGAGTLIKR"
FT   gene            complement(297735..298193)
FT                   /gene="lovR"
FT                   /locus_tag="CCNA_00286"
FT   CDS_pept        complement(297735..298193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lovR"
FT                   /locus_tag="CCNA_00286"
FT                   /product="two-component receiver domain protein LovR"
FT                   /note="CC_0284"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93753"
FT                   /db_xref="GOA:A0A0H3C6F4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6F4"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93753.1"
FT                   /translation="MSRPALDVLIVEDEMLLAIELEHLIEEAGFHSLGCAMSSDEAVTL
FT                   ARQLNPDLALIDVHLSDGPTGVDVARRIAKDCGGVALFMTANVKRLPDDFAGACGVIGK
FT                   PYSGHGVKSALSYLAICLTVGHAPGPAPAGLTLAPAYADRWGVVDTLT"
FT   gene            complement(298212..299318)
FT                   /gene="lovK"
FT                   /locus_tag="CCNA_00287"
FT   CDS_pept        complement(298212..299318)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lovK"
FT                   /locus_tag="CCNA_00287"
FT                   /product="photosensory histidine protein kinase LovK"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0285"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93754"
FT                   /db_xref="GOA:A0A0H3C379"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C379"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93754.1"
FT                   /translation="MEDYSESRRAGERLAAGHGVDDPFAAAISATRMAMIVADATQPDI
FT                   PIIFANDAFLRLTGYARDEVIGRNCRFLQGPDTDPKAIQAVRDALAAGEDVAVDLLNYR
FT                   KDGSPFWNALNMSPVRNDAGQLVYFFGSQVDVTDKKVVELRARDHSDGLQQMVEERTRE
FT                   LTEALKQKTALLHEVDHRVKNNLQLISSLLLLQNRRVPDPAVKASLRGMLGRVNAIATV
FT                   HRRLFQSEDVERFDVSAFIRDMVADLMGSAMRDDIRVELDLERVEIPAAKAAPLALVVN
FT                   ELLTNALRHGFPEGRGGRIFVGLSRLNGDFRIEITDDGVGQDRETRASGFGLTIVQLLC
FT                   QQLKAKWETTDAEPGTRVVVLLPINGTQ"
FT   gene            complement(299485..300534)
FT                   /locus_tag="CCNA_00288"
FT   CDS_pept        complement(299485..300534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00288"
FT                   /product="ABC-type sulfate transport system, periplasmic
FT                   component"
FT                   /EC_number="3.6.3.25"
FT                   /note="CC_0286"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93755"
FT                   /db_xref="GOA:A0A0H3C475"
FT                   /db_xref="InterPro:IPR005669"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C475"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93755.1"
FT                   /translation="MARRSEKPTRRGVLGAATAGAGALAAPALLGGVAQAQSKSVTLLN
FT                   VSYDPTRELYRDINAAYATYWKTRVGQTLTINQSHGGSGKQARSVMDGLQADVVTLALA
FT                   YDIDEIATKAKLLPANWQSRLPNNSTPYSSTIVFLVRKGNPKKIRDWSDLIKPGVAVIT
FT                   PNPKTGGGARWNYLAAWAWALKQPGGNPAKAEAVVKALFRNVPVLDSGARGATTTFTQR
FT                   GIGDVLLTWENEAFLAQEELPGQYELVYPSLSILAEPPVALIDKNVDRRKTRIVAQGYL
FT                   NFLYSPLAQEFIAKHHYRPRNPQVAAKYANKFKTIPLVTIDNTFGGWKKAQVTHFDDGA
FT                   VFDRIYQPK"
FT   gene            complement(300549..300797)
FT                   /locus_tag="CCNA_00289"
FT   CDS_pept        complement(300549..300797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00289"
FT                   /product="hypothetical protein"
FT                   /note="CC_0287"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93756"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Z0"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93756.2"
FT                   /translation="MITKKTAFSAALIAGATLRGIAGAASAQPVSPHNAADRHLKIKRL
FT                   SADGMTFVAGSPQAAGAQVGQDLDSWSVRTQYAFQTS"
FT   gene            complement(301048..304305)
FT                   /locus_tag="CCNA_00290"
FT   CDS_pept        complement(301048..304305)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00290"
FT                   /product="autotransporter protein"
FT                   /note="CC_0288"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93757"
FT                   /db_xref="InterPro:IPR005546"
FT                   /db_xref="InterPro:IPR036709"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5K7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93757.2"
FT                   /translation="MSFVMQRKVLVATVAAAPLLAMGFAASAETPVSNARTTPIATSTA
FT                   TGTAADDIRITADGSIKPTTAGAIVTIDSNHKVTNLGTLSTTGVNNGVGVLIIGGRTGA
FT                   LTNSATISLLEDYTASDSDSDGDLDGVFAQGANRFGVRLTNAGTFTGNIINEATGVISI
FT                   EGNNSAGVLLEGPVVGNITNLGSISVTGDNAYGMRIAAPVTGKVTLGGQINVQGVNAVA
FT                   QAIDANVSGALVLQGATSATGYRYTSRPSTTDALGKLDADDLQQGGPAVRIGGDVSGGL
FT                   LLQGLNYSTKVNSDGTTTTTTISSSSSGTSSINVFGAAPALQIGSASQNVTLGAVGSGD
FT                   NAYGLIAKGAISAAGVYNGVSATGVSIGAGGGRTTTLVGGLRNDGQITATSYEANATGV
FT                   VLNSGATAASILNRGALTANAASFAGSGVTASARGLVIAAGASATSFGNSGSVSATRTG
FT                   ETGDAIAVLDQAGTLRTITNTGSIRATVAAPTFKADGTVASVTATGRTIALDLRANNLG
FT                   VNFTQSGPADFTSTSTFPSTDTTTSATSATTTVAPSTIGDVLFGAGADTLNLWSGTLLG
FT                   EMSFGAGQDRLSIDGGAIAVGKLYDTDGKLDLSIANGSLAIANSDTINVSSVNLGSKAK
FT                   LLFSADPTAGTNTKLVVSGATTIASGAELGIRMANLVKQPTTFTVIQGSNISVGTIGNS
FT                   LLAESPYLYVATSRTDANNVYIDVRRRTAAEIGFNRAESSAYDAVFSALGADSTLAATF
FT                   LNQNSRDGFRDLYDQMLPDQGEGLFAALQTVNQQVSAATMFRPDPGDRYGPDSVWVQEI
FT                   NSLTRRDTDQTLGSDTQAFGFVGGYEAMGDAGGALGLTLAYVSIEEHDTVAKVGEQTTA
FT                   SFVQSGAYWRRSVGGWRFNAGGGLGYAFFQGDRRFIAPDSNGDGVADLVLKNSADWNGV
FT                   TANAYAGMAYEQKFGRFFARPEGRFDYVWLREGKRAEKGGGDAFDLTVDKRTSSNLSGE
FT                   LGVVMGADFGKQVWWRPEVRVGYRQTLAGSVGDTVARFKGGNAFSLAAMDDKQGALTAG
FT                   FALRAGTPMSYLALEGGVEAAKKQKRYNLRLSGRAMF"
FT   gene            304469..305884
FT                   /gene="phoR"
FT                   /locus_tag="CCNA_00291"
FT   CDS_pept        304469..305884
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoR"
FT                   /locus_tag="CCNA_00291"
FT                   /product="phosphate regulon sensor protein phoR"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0289"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93758"
FT                   /db_xref="GOA:A0A0H3C6G0"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6G0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93758.1"
FT                   /translation="MPLANTPQTDPRRDPAGAPWSLWIGPGALLGLAVSGLAEPMPAVL
FT                   AALAVGGAGVFLNRRKAVAAGVAPNALAQPVAKPVEPPFAAILDRLPDPLMVIAAEEAD
FT                   DLTGRRFLFANAAARELFKIQHAGALLVTAVRHPRVLEAVDEALFGGIEGMAEFETGGV
FT                   QGRSWLAYARPLKETVGRSRLALLALRDETDARRSERTRADFLANASHELRTPLASLSG
FT                   FIETLRGHAKDDPGARDKFLAIMLAQAERMSRLIDDLMSLSRIELNEHIAPLGRVDLSM
FT                   AVIDVIDALGPQARDKALTFDPVLPPRGGAVVDGDRDQIIQVIQNLVDNAIKYTPSGGV
FT                   VRVEVFPSLAAEAAAAARDPSAPRMSLLTPDHDPVERYAMLRVIDRGPGLAREHLPRLT
FT                   ERFYRVEGQKSGDRSGTGLGLAIVKHIMNRHRGGLTVESVQGEGAAFAVYLPMAKGEAR
FT                   MSSTTPPAEAGSA"
FT   gene            306029..307462
FT                   /gene="pstC"
FT                   /locus_tag="CCNA_00292"
FT   CDS_pept        306029..307462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstC"
FT                   /locus_tag="CCNA_00292"
FT                   /product="phosphate transport system permease protein pstC"
FT                   /EC_number="3.6.3.27"
FT                   /note="CC_0290"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93759"
FT                   /db_xref="GOA:A0A0H3C383"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR022182"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C383"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93759.1"
FT                   /translation="MLTWLSLIVLALFSSVAFAAGRRRAKTAAAGRARVLHSLPDYYGA
FT                   YVALWAGIPAALLLLLGVMFGGRVEDAILQSTRPAAVQALEPDRQAVFYSDVRAIAAKQ
FT                   APSEVVYEGEQKVALDAKVAEAQRIETLLNTGMLGGAGVLALAGFLLAFPRINPEFRAR
FT                   NRVEGWTSVLLIACSVAAVLTTLGIVMSLIWESWRFFQSVNPLSFLLGTEWSPQIAMRA
FT                   DQVASTGAFGAVPLFAGTFLIMLIAMLVAAPIGLYSAIYLSEYAGRTVRGVVKPLLEIL
FT                   AGVPTVVYGFFAALTVGPLFRSAFNAIGAALPPGPLATYLMEVQNQMALVAGVVMGIML
FT                   IPFVSSLSDDIINAVPQSLRDGSYAMGATKSETVKKVVLPAALPGIMAAMLLAVSRAVG
FT                   ETMIVTMAAGLQAKLTANPLDTVTTVTVQIVTLLTGDQEFDSPKTLSAFGLGLTLFVVT
FT                   LTLNIVALRIVQKYREQYD"
FT   gene            307455..308750
FT                   /gene="pstA"
FT                   /locus_tag="CCNA_00293"
FT   CDS_pept        307455..308750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstA"
FT                   /locus_tag="CCNA_00293"
FT                   /product="phosphate transport system permease protein pstA"
FT                   /note="CC_0291"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93760"
FT                   /db_xref="GOA:A0A0H3C480"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR024573"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C480"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93760.1"
FT                   /translation="MTDANLGAAAPRQTLSAAEARLKKRHRAERLFKAQGVAAIIIAMI
FT                   FLVVLVGRIVTQGYSTFQTHTLSVAVYLNPERIDTSDLSGVNYDYIVAEAVMKKLGVQD
FT                   DDFGTISTKVQDLVSRDFGFQLLNKLKADQTLIGQTVTVTGPLKADADLYFKGQIERST
FT                   DEGDRKLDNQQLDWLDKLQKDGAITSGFNTGFFTHSDSTEPEQAGVLGAVVGSAMMLLI
FT                   TALISVPVGVLAAVYLEEFAPKNRWTDIIEVNINNLAAVPSIVYGLLGLALFINWLNVP
FT                   RGSPLVGGLVLALMALPTVIIATRSALKAVPPSIREAALGVGASKTQTVFHHVLPLAMP
FT                   GVMTGAILSLAHALGETAPLLMIGMVSFVPGVPEGFTSAATVLPVQVFIWENASERAFH
FT                   ERTAAAIIVLLVFMIVMNAAAVILRRRFERRW"
FT   gene            308810..309634
FT                   /gene="pstB"
FT                   /locus_tag="CCNA_00294"
FT   CDS_pept        308810..309634
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pstB"
FT                   /locus_tag="CCNA_00294"
FT                   /product="phosphate transport ATP-binding protein pstB"
FT                   /note="CC_0292"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93761"
FT                   /db_xref="GOA:B8GYG4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYG4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93761.2"
FT                   /translation="MTVQSPDDSTRAPATSTAAPATADPKIKARGVKVFYGDKQALFDV
FT                   DLDIPAKSVTAFIGPSGCGKSTFLRCINRMNDTIPSARVEGSILIDGADVNAKSVDPVV
FT                   LRSRVGMVFQKPNPFPKTIFENVAYGPRIHGLATGKAELEAIVESSLKKAGLWNEVADR
FT                   LHQPGTGLSGGQQQRLVIARAIAVSPEVILMDEPCSALDPIATAKIEELIDELRSQFCI
FT                   VIVTHSMAQAARVSQRTAFFHLGKLVESGPTEEMFTNPRDSRTQDYITGRFG"
FT   gene            309660..310352
FT                   /gene="phoU"
FT                   /locus_tag="CCNA_00295"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        309660..310352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoU"
FT                   /locus_tag="CCNA_00295"
FT                   /product="phosphate transport system protein phoU"
FT                   /note="CC_0293"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93762"
FT                   /db_xref="GOA:B8GYG5"
FT                   /db_xref="InterPro:IPR026022"
FT                   /db_xref="InterPro:IPR028366"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYG5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93762.1"
FT                   /translation="MTEHTVKSYGEELAHLTAEVTRMGGIAESQVADCIAAIARRDGPL
FT                   AQAVVAGDERLDTLQSEIERKAFRLIALRQPMAVDLRHAVAALKISMSLERCGDMAKNI
FT                   GKRALILTEADPMSALTRSIERMGKLVQGRLKDVLDAYTTSDLQRAIGVWSRDEEVDEH
FT                   YNAIFRELLTYMMGDPRTINACTHLLFVAKNLERIGDHATNIAEIIHFELTGEELTSQR
FT                   PKLDVLSQ"
FT   gene            310374..311066
FT                   /gene="phoB"
FT                   /locus_tag="CCNA_00296"
FT   CDS_pept        310374..311066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="phoB"
FT                   /locus_tag="CCNA_00296"
FT                   /product="phosphate regulon response regulator PhoB"
FT                   /note="CC_0294"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93763"
FT                   /db_xref="GOA:A0A0H3C4Z4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR011879"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Z4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93763.1"
FT                   /translation="MTPYVLVVEDEDALATLLHYNLDKEGYRVGVAGDGEEALIMANER
FT                   APDLVILDWMLPKVSGIEVCRRLRGRAETRNVPIIMLTARGEETDRIRGLDTGADDYVV
FT                   KPFSMVELTARVRAVLRRIRPGLADDRITVGDIIIDRVAHRVKRSGKEIHLGPTEFRLL
FT                   DYLMQHPGRVFSREQLLDAVWGSDVYVEARTVDVHIGRLRKALNGTTDADPIRTVRSAG
FT                   YSLDMDAA"
FT   gene            complement(311039..311896)
FT                   /locus_tag="CCNA_00297"
FT   CDS_pept        complement(311039..311896)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00297"
FT                   /product="two-component response regulator"
FT                   /note="CC_0295"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93764"
FT                   /db_xref="GOA:A0A0H3C5L0"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR012379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5L0"
FT                   /protein_id="ACL93764.1"
FT                   /translation="MRAAPTTAWVAGLTAYSWLATTICAAWFARRFALADGRVLSVEQS
FT                   LAWQGAIYAAWLPVIGIVWLVLRRFGAGLRGVLAAFATGLVIVPLEALVASLIDQTFAG
FT                   GGDLAERALGRAPVCILLHTAIVAVGLAAAHHRRAAEASARNTLLQAALAEARATSVLD
FT                   VAERLMVMAGARRVPVDITAVEWFGAADNYVVVHWDGREGLMRATLQSLEARLDPRLFA
FT                   RAHRSALVNLSKVSQAQPLSDGSWRLTLASGAEVVTSRTYRDALLKRLGRQASDSQAAS
FT                   MSSE"
FT   gene            complement(311893..312666)
FT                   /locus_tag="CCNA_00298"
FT   CDS_pept        complement(311893..312666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00298"
FT                   /product="hypothetical protein"
FT                   /note="CC_0296"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93765"
FT                   /db_xref="GOA:A0A0H3C6G5"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6G5"
FT                   /protein_id="ACL93765.1"
FT                   /translation="MTCDRHRVKRALAPAGRHWPHRAGDDVGRPQKRPMDALFSPALAL
FT                   HISCGLILVGVGLLPLCTTKGSQWHRRAGRVFVVLMGLMLAAAWVMTALRFNAYFAALS
FT                   STATLTVFSGVRVLRRKRPDLDPHQRATRLDWTATLAVIAVGAWVLGLLLSGRTDSPKA
FT                   TTIALVYACFLYGGWDLWRFIQPTAWPFSPDLWTYEHLVKMLSAYGAVLSAFSGNFLTF
FT                   LPTPWSQLWPTLLFQPVAIIWVAALVVRRKRLSPA"
FT   gene            312678..313961
FT                   /locus_tag="CCNA_00299"
FT   CDS_pept        312678..313961
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00299"
FT                   /product="phosphoribosylamine--glycine ligase"
FT                   /EC_number="6.3.4.13"
FT                   /note="CC_0297"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93766"
FT                   /db_xref="GOA:A0A0H3C388"
FT                   /db_xref="InterPro:IPR000115"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="InterPro:IPR020559"
FT                   /db_xref="InterPro:IPR020560"
FT                   /db_xref="InterPro:IPR020561"
FT                   /db_xref="InterPro:IPR020562"
FT                   /db_xref="InterPro:IPR037123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C388"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93766.1"
FT                   /translation="MEKLTILLVGSGGREHALAWKIAQSPLCGRLVAAPGNPGIEAVAE
FT                   LRAVKATDADGLVALAQEIGADLVVVGPESALEVGLADKLAAVGIPCFGGSQRAAQLET
FT                   SKAFTKDFCQRHGLPTAAYGVFEDAASAGAFLDTLEAPFVIKADGLAAGKGVVIAPDRA
FT                   AADAAVVDMLGGRFGSAGARVVIEEFMHGEEASLFAVCDGKTAVLFGAAQDHKRAYDGD
FT                   EGPNTGGMGTYSPPPVLTDALIDQAWRELIVPTVEGMAAEGNPYVGVLYAGLMLTPTGP
FT                   KLVEYNARFGDPECQTLMLRLDSDIVPILLAAAKGELANAEPPKWREEAAICVVLAAEG
FT                   YPDAPKTGGRIQGADADFGDDVVVFHAGTTREFEGRLVASGGRVLNVCALGATLSEARE
FT                   AAYGALETISLEGGFYRTDIGWRALQQR"
FT   gene            complement(313978..314385)
FT                   /locus_tag="CCNA_00300"
FT   CDS_pept        complement(313978..314385)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00300"
FT                   /product="glyoxalase superfamily protein"
FT                   /note="CC_0298"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93767"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C485"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93767.2"
FT                   /translation="MLSKPPCAAPLIKESAMRLNHLDLPVPDIAATRDFFETWLGFTHE
FT                   KTLGQNGLSILRDSAGLVLVLSHLQSEGAQTWPYPFHIGFHLETEEAVSDLHRRMTEGG
FT                   VVAGEACVQRGAFSFYVTAPGEILVEVAHRT"
FT   gene            314615..315697
FT                   /locus_tag="CCNA_00301"
FT   CDS_pept        314615..315697
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00301"
FT                   /product="phosphotransferase family protein"
FT                   /note="CC_0299"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93768"
FT                   /db_xref="GOA:A0A0H3C4Z9"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR041726"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Z9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93768.1"
FT                   /translation="MAEAAEQSAQNLNSGTKPVDPRHAVDEAKLAAWLEANVEGYAGPL
FT                   EVRQFKGGQSNPTYQLVTPARKYVLRRKPPGKLLPSAHAVDREYKVISGLNKADFPVAK
FT                   AYALCMDEDVIGTIFYVMENVEGRILWDGTLPDYQPAERRAIYEAQIDTLAALHNVDYA
FT                   AVGLADYGKPGNYFARQIDRWTKQYKASETKTIEEMDRLMEWLPSTVPSDDQTSIVHGD
FT                   YRLDNMILHPTESRVIAVLDWELSTLGNPLADFSYFLMNWVMPSDQRGGLSGVDDLAAY
FT                   GIPTIPEAVARYCKATGRDGLPELDWYFSYNLFRLAGICQGIVGRVRDGTAASAHAQLM
FT                   EARVPVLAKGAWDFARKAGA"
FT   gene            315702..316991
FT                   /locus_tag="CCNA_00302"
FT   CDS_pept        315702..316991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00302"
FT                   /product="imidazolonepropionase-related amidohydrolase"
FT                   /EC_number="3.1.8.1"
FT                   /note="CC_0300"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93769"
FT                   /db_xref="GOA:A0A0H3C5L3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5L3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93769.1"
FT                   /translation="MMRKLMAGACALVVTSALAGAANAQATFVQAGRLLADPATGKVEI
FT                   AKTLVLENGKVTRILDGYVAEPGGKVVDLKDSFVLPGLIDSHVHLTGQQNPNGRLQAVT
FT                   QSPSDSAMVGAGFARKTLMAGFTTVANLGANSQAIFALREGVKRGDVAGPRILASGSSI
FT                   SVHGGHGDINGYSEDVMHALRPESVCSGADDCRRAVREQIWLGADLIKITATGGVLSNT
FT                   AAGLAKQFSDAELAAIVESAHSMGRKVTAHAHGGDGINAFLKAGGDSIEHGTYLDNEGI
FT                   ALMKKSGAYLVPTLMAGDFVYRIASGPNNYFTPAQTAKALEAGPKMLDMVRRAHADGVK
FT                   VAFGTDSGVSAHGDNAGEFALLVKAGMTPLEAIQTATVNAADHFSLSNEIGSLTPGKAA
FT                   DLIAVKGDPLKDVTELQRVTSVIKGGVVYK"
FT   gene            complement(317027..318034)
FT                   /gene="lpxK"
FT                   /locus_tag="CCNA_00303"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(317027..318034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="lpxK"
FT                   /locus_tag="CCNA_00303"
FT                   /product="tetraacyldisaccharide-1-P 4'-kinase"
FT                   /EC_number="2.7.1.130"
FT                   /note="CC_0301"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93770"
FT                   /db_xref="GOA:B8GYH3"
FT                   /db_xref="InterPro:IPR003758"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYH3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93770.1"
FT                   /translation="MKLGTPRWWYVKSGAPAPVTRALLTPLSWLWADTTRRRIARATPA
FT                   IVGAPVICVGNVTMGGAGKTPIVRELLLTLTQRGVAAHGLSRGYGGKLKGPVRVDTIRH
FT                   TAADVGDEPLMLAQDFPMWIAADRVAGAKAAVRAGASAIVMDDGHQNPSVKKALSLVVV
FT                   DGETRGGEWPFGDGRVFPAGPMREPLKVGLSRADAVIVLLPVDVEQPDFDLLVAFGDMP
FT                   VLVARLEAAAPVPKGPQVGFAGIAKPWKVEKALTAAGCQLVDFAPFPDHGAYSESTLKM
FT                   LADRAEVYEAGLVTTEKDWVRLPPAWRERVTPWPVRARFEDPAALEALLKGIGL"
FT   gene            complement(318031..319308)
FT                   /locus_tag="CCNA_00304"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(318031..319308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00304"
FT                   /product="3-deoxy-D-manno-octulosonic-acid transferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="CC_0302"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93771"
FT                   /db_xref="GOA:A0A0H3C6H2"
FT                   /db_xref="InterPro:IPR007507"
FT                   /db_xref="InterPro:IPR038107"
FT                   /db_xref="InterPro:IPR039901"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6H2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93771.3"
FT                   /translation="MSPGPGGRRVIRPDALNLYRAATGLLEPVAPALLAHRARKGKEDP
FT                   ARLAERLARADTPRPEGPLVWLHGASVGESLSILPLVERLRAEKPEVTVLVTSGTTTSA
FT                   ALLAKRLPPGAIHQYAPVDAPGAARRFIAQWKPDLAVFVESELWPNLLLEAKAAGTRLA
FT                   LVSAKLSDRSFASWSTRPQAAYRLLSVFDLILAQDARAHQRFERLGGKVAGEADLKFGA
FT                   TPLPVDAAALAIERERFPTAPFLIASTHPGEDEIVLDAIVALPHRPPVILAPRHVERGP
FT                   AITALAEARGLSASLRSRAPGQPAEVVVADTLGEMGLWFRLAGGCVIAGSLVPDIGGHN
FT                   PLEAARLDCPAISGPFVENWTSAYAGLETAGGVVMADPSTLADAIAADLADPAARQARA
FT                   ARARSFVDARDREARDGLSRILELVP"
FT   gene            complement(319278..320303)
FT                   /gene="czcD"
FT                   /locus_tag="CCNA_00305"
FT   CDS_pept        complement(319278..320303)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="czcD"
FT                   /locus_tag="CCNA_00305"
FT                   /product="cobalt-zinc-cadmium resistance protein czcD"
FT                   /note="CC_0303"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93772"
FT                   /db_xref="GOA:A0A0H3C394"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C394"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93772.1"
FT                   /translation="MPHDAHGHAHDHGHGHGHHGHDHAHGHGHGHGHGHHHHGHGHHGH
FT                   HHHAPKDFGRAFAIGTALNLGFVIVEATAGILTHSLALLADAGHNLSDVLGLLLAWGAT
FT                   VLAKRAPSARRTYGLRKGTILASLGNAALLLVAVGAIAWEGVRRFAAPEPVQTGPVMIV
FT                   AAIGIVINTATALMFMKGSKEDLNVRGAFLHMAADAAVSAGVVIAALAMTFTGWMWLDP
FT                   VVSLVIVAVIVLGTWGLLRDSLDLALDATPRGIDTQKVRDWLAARPGVSEVHDLHIWAM
FT                   STTETALTAHVVRQLDADHDQFLHDACAELASRFNIGHVTIQVESGHGAHACRLAPADV
FT                   V"
FT   gene            complement(320335..321048)
FT                   /locus_tag="CCNA_00306"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(320335..321048)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00306"
FT                   /product="lysophospholipid acyltransferase"
FT                   /note="CC_0304"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93773"
FT                   /db_xref="GOA:A0A0H3C491"
FT                   /db_xref="InterPro:IPR007172"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C491"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93773.1"
FT                   /translation="MKPLRSPWVMRALARFFSGYIALTYKTLRWTREGQAIADRVQAEA
FT                   LASGGGAILALWHSRVPVGPATWPQGPDKPEIRVLVSQSRDGEFIARVIARLGLPSIRG
FT                   SSLKKTDTAKNKGGEQAFRDMVKWVKDGGAMAITPDGPRGPVEVMQKGAVALARVSGAP
FT                   VLFVGVAVNPCIRLKTWDRTIIPLPFAKAAMVWDGPVHAGRDDDPDAVVEAWGARLSAV
FT                   SRRAEAIVGETPPKD"
FT   gene            complement(321045..322868)
FT                   /locus_tag="CCNA_00307"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(321045..322868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00307"
FT                   /product="phospholipid-lipopolysaccharide ABC transporter"
FT                   /note="CC_0305"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93774"
FT                   /db_xref="GOA:A0A0H3C504"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C504"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93774.1"
FT                   /translation="MTAQDRPQPSNRALMGRMWREFLQPRWKGFLVSMISAVIVARLTV
FT                   MLGEYVEPAVDKLIAHPQPGALIWVPLTIAALAVGRGVFQVIQASLINRIGNGVVGDMQ
FT                   TRLFGRLIRADLARLRGAHSGSYVASVLYDAGLIREAATTGVVNYVREALIVAITLWAL
FT                   FNSDPILAAGVLIIVPGVSGVIRHFAKRTTKAAKGAMGETSNLSTAIMESLDGVKIVKM
FT                   ENREAYEEARVAAVVERRQRHLIKGSNARAMAAPATELFSQLVIAAVFAYAGWRAITGA
FT                   LVVGPFTLPPITPGGFLKFVILLGIAAQSLRQVANLQTVFSEGLTAARRLFEALDVAPT
FT                   IVDPADAKALPPGESMIALADVTFSYGADIPALSSVNLQARKGETVALVGPSGGGKSSI
FT                   LNLIPRFYDVNAGAVTIDGHDVRSVTIASLRDRIALVTQEPFLFDDTIRANIAYARPGA
FT                   SQLEIEAASRQAAAHEFIQALPEGYDTAVGEGGARLSGGQRQRIAIARAFLKDAPILLL
FT                   DEATSALDTESEAQVQAALERLMAGRTTILIAHRLSTVKNADRIYVIDKGRVVETGSHA
FT                   ELVRAGGLYARLAKAQDLDHPAPDQDGEITA"
FT   gene            323024..323689
FT                   /gene="ctpA"
FT                   /locus_tag="CCNA_00308"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        323024..323689
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ctpA"
FT                   /locus_tag="CCNA_00308"
FT                   /product="protein tyrosine phosphatase CtpA"
FT                   /note="CC_0306"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93775"
FT                   /db_xref="InterPro:IPR029021"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5L5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93775.1"
FT                   /translation="MAKFDLTTPWGRFKTYLHYLWNDHAYLRLGFSNAHWISPELVRAN
FT                   QPWPFQLAWWKKRGIKTIVNLRGGFDGSFYALEKDACERLGLNFVDFVITSREVPIRER
FT                   VRGAKELFERIEYPALMHCKSGADRAGIMSVFYAHYRLGQPIREAMQQLGPRYLHIKHG
FT                   NTGVLDYVFEQYLEKGEPKGLTFSDWVESDDYDPVEMKKTFRAGMLGKVLTDKILRRE"
FT   gene            complement(323716..323778)
FT                   /locus_tag="CCNA_R0102"
FT   ncRNA           complement(323716..323778)
FT                   /locus_tag="CCNA_R0102"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(323812..324045)
FT                   /locus_tag="CCNA_00309"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(323812..324045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00309"
FT                   /product="hypothetical protein"
FT                   /note="CC_0307"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93776"
FT                   /db_xref="InterPro:IPR025226"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6H7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93776.1"
FT                   /translation="MLKMPDKQLLHIVVGGELKDVAGVEFRDLSKVEFVGAYPSYDEAH
FT                   KAWKAKAQATVDNAHARYFIIHAHKLLDPSEG"
FT   gene            complement(324066..324845)
FT                   /locus_tag="CCNA_00310"
FT   CDS_pept        complement(324066..324845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00310"
FT                   /product="3'-phosphoadenosine-5'-phosphosulfate (PAPS)
FT                   3'-phosphatase family protein"
FT                   /EC_number="3.1.3.25"
FT                   /note="CC_0308"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93777"
FT                   /db_xref="GOA:A0A0H3C399"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C399"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93777.1"
FT                   /translation="MNDLDLIIAAAREAGELALGARESGLTIWSKEGGSPVTDADLAVD
FT                   TLLRTELRAERPDYGWLSEETADDPARLATGRQFVVDPIDGTVAFMKGKPWFAVSIAVV
FT                   EDGQPIAAVVHAPALDETYAATLQGPATLNGAPIAPSDTDALEGAAMLGDAKMFAHPAW
FT                   REPWPTMRIETRNSIAYRACLVAAGAFDAAVALSPKSEWDVAAADLICQRAGAALSDHK
FT                   GRPYAYNRPVPQVPSLVCANRALAPLILNRVGHIELP"
FT   gene            complement(324842..326173)
FT                   /locus_tag="CCNA_00311"
FT   CDS_pept        complement(324842..326173)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00311"
FT                   /product="Zn-dependent protease family protein"
FT                   /note="CC_0309"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93778"
FT                   /db_xref="GOA:A0A0H3C495"
FT                   /db_xref="InterPro:IPR002510"
FT                   /db_xref="InterPro:IPR035068"
FT                   /db_xref="InterPro:IPR036059"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C495"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93778.1"
FT                   /translation="MDDNLLHDVVAAARKAGADAAEAVFAERQSLSVSVRLGELEEVER
FT                   EEARDLGLRVFIGQRSATVSGSDISSEARAKLVERAVAMARLAPEDPYASLAPQDRLAH
FT                   GPFPDLDLIDAYEPSAQTLETQARIAEEHARAVKGVTNSDGGSATWSSSRWALVTSDGF
FT                   HGAHAATGHSISASAIAGEGAGMERGGEGRSTRHFGDLPAAGDIGMEAGRQAVARLNPR
FT                   KIASTTAPVIFENRLAMSLIGPLLGAISGPSIARGTSFLKDKLGQAIFAKGVNLLEDPH
FT                   RVRGLGSAPFDDEGVATQARALIEDGVLTTWLLNTSAAKQLGLATTGHASRGLAGPSGV
FT                   SAHNLTLQPGAQDLKGLMQDAGTGLVVTSMFGPSLNGNTGDWSVGCSGYWFENGESTGP
FT                   VTEITVAGNLIDIYARLVPGSDLEFRGASNSPSLLVDALAIAGK"
FT   gene            complement(326229..326630)
FT                   /locus_tag="CCNA_00312"
FT   CDS_pept        complement(326229..326630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00312"
FT                   /product="putative membrane spanning protein"
FT                   /note="CC_0310"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93779"
FT                   /db_xref="GOA:A0A0H3C508"
FT                   /db_xref="InterPro:IPR001129"
FT                   /db_xref="InterPro:IPR023352"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C508"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93779.1"
FT                   /translation="MDTIVSGHAAALWAGLNLFLLLILSLLVVRLRQKHKVALGDEGIP
FT                   ELARAIRAFGNASEYIPSGIAALAVLAVAGAAPLAIHVVGFILFAGRVVHAIGLSNSGG
FT                   ASIPRAVGMVATWLAYIFAGVALLLSAIG"
FT   gene            complement(326715..328544)
FT                   /locus_tag="CCNA_00313"
FT   CDS_pept        complement(326715..328544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00313"
FT                   /product="peptidase, M14 family"
FT                   /note="CC_0311"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93780"
FT                   /db_xref="GOA:A0A0H3C5L8"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5L8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93780.1"
FT                   /translation="MRTTALLATALLALGAPVMAQTTPPKAPWDEAFLPPAPHWQGASQ
FT                   ALIRDKADPWVTPFEADAEHNVSPTYADTRAWFQKLDKASPLIRVEDFGVSPQGREIFA
FT                   VIASKDGDKLDPKKPLLLVQAGIHPGEIDGKDAGMMLLRDMAFHDKDSLLDKVNLVLIP
FT                   ILSVDGHERASAYSRPNQRGPRIQGWRNTATNQNLNRDFMKLDQPEMRALKRLQAKYKA
FT                   DLYVDVHVTDGMDYQYDVTYGFNGENGVWNRSPAIAKWLDGVLKPVMNKSLEAEGHIPG
FT                   ELVFGVDEHNPKAGFSDGGLGERFSSGWGAAAHVPTILIENHSLKPHAQRVLGTYVFIE
FT                   TALKLLAEKGGDLRQAIAADSALRPAEIPANFVADPKPAYTRAFKGIRYEYYDSPASGR
FT                   KEVRWLGEVDPEIWNVPFYGSKPSLTLKRPAAYYVPSHRPDIIERLKLHGVALEALPAD
FT                   KTLKVEMIRLVEPKIAPRANEGHVQISVDKVTTETRDWTFPKGSVRVPTDQPLGDLVVL
FT                   LLEPQSSESLFAWGMVPEVLSRVEYIEPYAIAPLAEKMMAADPALKAEFEAKLAAEPKF
FT                   AADPAARLAWFYKRTPFYDDHHLLYPIAREIAR"
FT   gene            complement(328587..329198)
FT                   /locus_tag="CCNA_00314"
FT   CDS_pept        complement(328587..329198)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00314"
FT                   /product="hypothetical protein"
FT                   /note="CC_0312"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93781"
FT                   /db_xref="GOA:A0A0H3C6I1"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6I1"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93781.1"
FT                   /translation="MDAFEFFFSFYGLLLGFSVAELVGGFARLLDGRRQVKFGLLTPML
FT                   ALFVAIDIASFWNQAWVIFRPAPYNYALLILGLVVASTFYVAATQVFPRELKSGESLDD
FT                   HFWAHRKLVLLSVLAANLLIVLVFLGLVTINGEIGRLNLGPVFWAGTTLFTILTLVAAV
FT                   APGRWISPIALAILLAYQGWQIVRSAEALVSRGGWSLIGG"
FT   gene            complement(329224..330753)
FT                   /locus_tag="CCNA_00315"
FT   CDS_pept        complement(329224..330753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00315"
FT                   /product="3-polyprenyl-4-hydroxybenzoate decarboxylase"
FT                   /EC_number="4.1.1.-"
FT                   /note="CC_0313"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93782"
FT                   /db_xref="GOA:A0A0H3C3A6"
FT                   /db_xref="InterPro:IPR002830"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3A6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93782.1"
FT                   /translation="MAYRSLREFIDVLEAKGELVRVKEPVSSVLEMTEIQTRLLATGGP
FT                   AVLFEHVLLPDGSRSEMPALANLFGTVKRVAMGVTLGGEPRETAGELREVGELLAFLRQ
FT                   PQPPKGLKDALDMLPLAKTVMSMRPGTVKKAPVQEVVLTGDQIDLSKLPVQTCWPGEPA
FT                   PLITWPLVVTKGPSKDREDDFNLGIYRMQVLSKDKCIMRWLAHRGGAQHYARHKKAGSK
FT                   EPLPACAVLGADPGTILAAVTPVPDTLSEYQFAGLLRGAKVDLVPAKTVPLMVPAHAEI
FT                   VIEGHVLLDEYADEGPYGDHTGYYNSVEKFPVFQVTAITMRKDPIYLTTFTGRPPDEPS
FT                   VLGEALNEVFIPLIRQQFPEIVDFWLPPEGCSYRIAVVSMKKAYPGHAKRVMLGVWSYL
FT                   RQFMYTKWVIVVDHDINARDWKDVMWAISTKMDPARDITVIEHTPIDYLDFASPESGLG
FT                   SKIGLDATDKWPPETKREWGEEIRMDQAVVDKVSDMWGRLGLPGDGKPIWK"
FT   gene            complement(330777..331910)
FT                   /locus_tag="CCNA_00316"
FT   CDS_pept        complement(330777..331910)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00316"
FT                   /product="glutamate 5-kinase"
FT                   /EC_number="2.7.2.11"
FT                   /note="CC_0314"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93783"
FT                   /db_xref="GOA:B8GYI6"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001057"
FT                   /db_xref="InterPro:IPR002478"
FT                   /db_xref="InterPro:IPR005715"
FT                   /db_xref="InterPro:IPR011529"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR019797"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR036974"
FT                   /db_xref="InterPro:IPR041739"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYI6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93783.1"
FT                   /translation="MTSGSQGAFEAARRIVFKVGSALLVDAETGAANRAWLEAFCADAA
FT                   DLRAAGKQVLVVSSGAVALGRRRLGLTGRKTTLPEKQAAAAAGQSLLMRAWEEAFEPHG
FT                   IGVAQILLTRDDTEMRRRWLNARATTETLMGLGVVPVVNENDTVVTEEIRYGDNDRLAA
FT                   RVAQMAGADLLVLLSDIDGLYTADPRKNPKAQHIPRVSEITPEIAGMAEGANAAAGVGT
FT                   GGMATKIAAARIARAAGCATLITLGSRPRPLAAIAAGEKATLIEAGASPAAAYKAWIAG
FT                   SLAPQGWVTVDAGAASALLAGKSLLPAGVRAVEGPFDKGDAVRVRDENGREVARGLVRY
FT                   DSADAQRIAGLRSDAIEAELGFTEGPMIHADDLAVAH"
FT   gene            complement(331907..332971)
FT                   /gene="cgtA"
FT                   /locus_tag="CCNA_00317"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(331907..332971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cgtA"
FT                   /locus_tag="CCNA_00317"
FT                   /product="GTP-binding protein CgtA"
FT                   /note="CC_0315"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93784"
FT                   /db_xref="GOA:B8GYI7"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR006074"
FT                   /db_xref="InterPro:IPR006169"
FT                   /db_xref="InterPro:IPR014100"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR035101"
FT                   /db_xref="InterPro:IPR036726"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYI7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93784.1"
FT                   /translation="MKFLDQCKIYIRSGNGGGGSVSFRREKYIEYGGPDGGDGGRGGDV
FT                   WIEAVEGLNTLIDYRYQQHFKAGTGVHGMGRARHGAAGEDVVLKVPVGTEVLEEDKETL
FT                   IADLDHAGMRLLLAKGGNGGWGNLHFKGPVNQAPKYANPGQEGEERWIWLRLKLIADVG
FT                   LVGLPNAGKSTFLAAASAAKPKIADYPFTTLTPNLGVVDLSSSERFVLADIPGLIEGAS
FT                   EGAGLGTRFLGHVERSATLIHLIDATQDDVAGAYETIRGELEAYGDELADKAEILALNK
FT                   IDALDEETLAEKVAELEAVSGIKPRLVSGVSGQGVTELLRAAYKQVRIRRGDLEEEIDD
FT                   DEDHVDETPGGWTP"
FT   gene            333179..334138
FT                   /locus_tag="CCNA_00318"
FT   CDS_pept        333179..334138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00318"
FT                   /product="hypothetical protein"
FT                   /note="CC_0316"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C499"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93785.2"
FT                   /translation="MASEEEVVALLAKDLRDLSTQELHRKYSAEASTHRNILIGRGTGV
FT                   APQWRDFKTFLGEVGPRPSTDHSLVLLNRYERTYGPGRARWMTAEEQAAHEAEFDRLRA
FT                   EQMREEQLLLHKAAATRRASTPGAPSFGQWTPMGGKLVTYPDVAKKLAIPVNALSKTMP
FT                   PGSTADELVKRAATAADLINENATWLPPDPVRKAGFFEAYRIWHLQVQPQFGRAATPTF
FT                   LFLYIALPVMKQCRDELMDLDLWNPLGQRALNARDNHPAWKKYTEFMPRAQVAMMEIPI
FT                   YATYSLLSDLDALCERIVTAEKRFREGPQKVIHTHRAA"
FT   gene            complement(334224..334757)
FT                   /locus_tag="CCNA_00319"
FT   CDS_pept        complement(334224..334757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00319"
FT                   /product="acetyltransferase, GNAT family"
FT                   /note="CC_0317"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93786"
FT                   /db_xref="GOA:A0A0H3C512"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C512"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93786.1"
FT                   /translation="MCVIEESPVIETRRLTLRAPAKADVERVAAFCVDHDVARMTTRMP
FT                   SPYTRGHAEEFVARCGTQDRTRDNTFAIDLANEGLIGVVGLFTNPGGPVELGYWIGRPY
FT                   WGRGYATEAARGALDWTRSIWRKRRVTAGHFADNEASGRVLVKAGFLYTGVVEHKPSIA
FT                   RGEPAATRMMVWLA"
FT   gene            complement(334940..335209)
FT                   /locus_tag="CCNA_00320"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(334940..335209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00320"
FT                   /product="LSU ribosomal protein L27P"
FT                   /note="CC_0318"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93787"
FT                   /db_xref="GOA:B8GYX1"
FT                   /db_xref="InterPro:IPR001684"
FT                   /db_xref="InterPro:IPR018261"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYX1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93787.1"
FT                   /translation="MAHKKSGGSSSNGRDSESKRLGVKKFGGEKVLAGNILVRQRGTKF
FT                   YPGSGVGIGKDHTLFALVQGAVGFVTKKHNRTYVTVTPAAQPAE"
FT   gene            complement(335240..335755)
FT                   /locus_tag="CCNA_00321"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(335240..335755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00321"
FT                   /product="LSU ribosomal protein L21P"
FT                   /note="CC_0319"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93788"
FT                   /db_xref="GOA:A0A0H3C5M1"
FT                   /db_xref="InterPro:IPR001787"
FT                   /db_xref="InterPro:IPR028909"
FT                   /db_xref="InterPro:IPR036164"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5M1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93788.1"
FT                   /translation="MYAVIKTGGKQYRVQAGDLLVVEKLEGEPGAAVAFGEVLMLGEGE
FT                   AVTVGAPTVDGAVVSGTLLETRKGEKVKIFKKIRRQGYRRTRGHRQFESVVRVTSVAGA
FT                   GKEAKWEGTIDLTPKVILDARARGLGDAAVPATIPAPVEAAPAKAEAAPKKKAAPKKAA
FT                   AKTEEGEA"
FT   gene            335959..336588
FT                   /locus_tag="CCNA_00322"
FT   CDS_pept        335959..336588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00322"
FT                   /product="hypothetical protein"
FT                   /note="CC_0320"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93789"
FT                   /db_xref="GOA:A0A0H3C6I5"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6I5"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93789.1"
FT                   /translation="MTSPFFASIAVTAFAVAFLHAALPTHWLPFVLVGRAQKWSTGRTL
FT                   GVTLLAGIGHVGLTIALGLALVLAGMALQPSLGGLFHWIVGGLMIAVGVFYMVRGRHNH
FT                   ALPEASRRIYASDRAAIAALVTLLTLSPCEAFLPYYLAGMEHGWVAFLVLSAILTAATA
FT                   AGMLIFTGLSLAGFKRLGLQWVERYEETILGVALVLVGLAVAFLKT"
FT   gene            336631..337728
FT                   /locus_tag="CCNA_00323"
FT   CDS_pept        336631..337728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00323"
FT                   /product="low-affinity zinc transport protein"
FT                   /note="CC_0321"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93790"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR011629"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036627"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3B1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93790.1"
FT                   /translation="MTQTVPTSGKIPVTVLTGYLGAGKTTLLNRILTEEHGKRYAVIVN
FT                   EFGEVGIDNDLVVGADEEVFEMNNGCVCCTVRGDLIRVLQGLMKRKGGFDAIIVETTGL
FT                   ADPGPVAQTFFVDDDVKARTALDSVTAVVDAKHILLRLSDSKEAVEQIAFADQIVLNKT
FT                   DLVSEDDLRHVEARIRRINPLAPIHRAQRSNVPLDAILGKHSFDLERITDLEPDFLNPA
FT                   HGEPGHVHDEHCDHHHHHDHDHVHDEHCGHDHHHHHHDHKSDVHDDGVKGISLTLDKPV
FT                   DGQKITAWLNDLLARRGPDILRAKGIIDVKGEDKRLVFQAVHMILEGDFQRPWTDKDKR
FT                   YSRMVFIGRDLDEAELRAGFEATAA"
FT   gene            complement(337932..338390)
FT                   /locus_tag="CCNA_00324"
FT   CDS_pept        complement(337932..338390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00324"
FT                   /product="ExbD-family protein"
FT                   /note="CC_0322"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93791"
FT                   /db_xref="GOA:A0A0H3C4A4"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4A4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93791.1"
FT                   /translation="MQAMAAKLAGGGGGRYDLGQNSEINVTPFVDILLVLLIIFMVAVP
FT                   MAVTSIKIDLPPAVPPPPNAPKPKEPVFISIQKSGAIFIADKQSSLDNLEIDLNAKFAA
FT                   TGQAGPKDDQRIMIRADADVLYADFMGVLNQLQTSGWFKVGLINEDIR"
FT   gene            338634..339665
FT                   /locus_tag="CCNA_00326"
FT   CDS_pept        338634..339665
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00326"
FT                   /product="vegetatible incompatibility protein HET-E-1"
FT                   /note="CC_0323"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93793"
FT                   /db_xref="InterPro:IPR001680"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR017986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C517"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93793.1"
FT                   /translation="MIFSFDAFVTNALFDRSGRAMFALGDGTVRLQTDEGFVTVEAHGG
FT                   PLGGAVLAAAVHPSGAGIVTGGDDGRVVWSRIEGGEVVATLIAEVKNKWIEHVAASAAS
FT                   GLIAFTVGKEVHVRDAADPAFARTFPHEKTVSGLAFEPKGRRLASATYGGAYLWYARIA
FT                   DQKPTVLKWAGSHIAVEFSPDGKFLISSMQENQLHGWRLSDGKDMRMGGYPSKIKSVAF
FT                   FDKGNLLATAGASGAVIWPFAGANGPMGKEAAEIGFSRDSMVVRVAGIDPQPVCIAGQD
FT                   SGKIWAAHMRNGRIETLKAEKGAPISALSVSADGKRLAWGDESGEAGVLEIPDLSGPRQ
FT                   FVG"
FT   gene            339708..339810
FT                   /locus_tag="CCNA_R0103"
FT   ncRNA           339708..339810
FT                   /locus_tag="CCNA_R0103"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(339828..340490)
FT                   /locus_tag="CCNA_00327"
FT   CDS_pept        complement(339828..340490)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00327"
FT                   /product="FMN-binding nitroreductase family enzyme"
FT                   /EC_number="1.6.6.-"
FT                   /note="CC_0324"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93794"
FT                   /db_xref="GOA:A0A0H3C5M4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5M4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93794.1"
FT                   /translation="MDVIDAVNRRMSVRAFKPDPVDAGLIRDLLEAAARAPSGGNLQPW
FT                   RVQVVGGAPLEALKAAMLQRVASPDPTEYDVYPANLWEPLRSRRFQVGEDMYGALGIPR
FT                   EDKLQRLQWFANNGQGFGAPVQLFFSIDRRCGPPQWSDVGMLMQTFMLLAVERGLDTCP
FT                   QEFWSHYNKLVDEHVGLPEGHMLFSGMALGYRDADAPVNNFRSRRAPFEEWAELKGF"
FT   gene            340575..341264
FT                   /gene="mtgA"
FT                   /locus_tag="CCNA_00328"
FT   CDS_pept        340575..341264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtgA"
FT                   /locus_tag="CCNA_00328"
FT                   /product="monofunctional biosynthetic peptidoglycan
FT                   transglycosylase MtgA"
FT                   /EC_number="2.4.2.-"
FT                   /note="CC_0325"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93795"
FT                   /db_xref="GOA:B8GYX9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR011812"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYX9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93795.1"
FT                   /translation="MGRFVRRLLRNLLLALFLVLVAGPVVAVILYRFIPPPVTPLMVIR
FT                   AVEGRGLDHRWRPMDKISPALPRVLIAAEDAKFCEHRGFDFEALQKAYENNESGRKIRG
FT                   GSTISQQTAKNVFLWPGRSYVRKGLEAWFTVLIETFWGKKRIMEVYMNSIEYGSGIYGA
FT                   EAAAQRYFGVSAAKLTQAQSARLAAILPSPLKWKVIKPGKYVAKRTKKIGKATGAVRRD
FT                   GLADCVA"
FT   gene            341277..341825
FT                   /locus_tag="CCNA_00329"
FT   CDS_pept        341277..341825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00329"
FT                   /product="ribosomal-protein-alanine acetyltransferase"
FT                   /EC_number="2.3.1.267"
FT                   /note="CC_0326"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93796"
FT                   /db_xref="GOA:A0A0H3C6J1"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6J1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93796.1"
FT                   /translation="MRVAPGPTLETERLILRPPADVDLDRWAQMMADPVAARFIGGQQP
FT                   RATAWRFMATMAGSWALNGFGMFSVIEKASGQWLGRIGPWRPEGWPGTEVGWGLHPDAW
FT                   GRGYAVEAASATIDWVVDHLGWTDIIHCIDPENTPSQAVADRLGSVNRGLGRLPPPFED
FT                   HVVEIWGQTADQWRARRKR"
FT   gene            complement(341832..342602)
FT                   /gene="mopB"
FT                   /locus_tag="CCNA_00330"
FT   CDS_pept        complement(341832..342602)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mopB"
FT                   /locus_tag="CCNA_00330"
FT                   /product="molybdenum-pterin binding protein mopB"
FT                   /note="CC_0327"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93797"
FT                   /db_xref="GOA:A0A0H3C3B5"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR003725"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR016462"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3B5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93797.1"
FT                   /translation="MSSDADFRASLILKRGGLARVGLERIALLEAVARHGSISAAAKEA
FT                   GLSYKGAWDGVQALNNLFEAPLVSAAPGGRAGGAAQVTARGHAVIRAFRAAEREVSAAF
FT                   ARLEADLSSDAELLWSLGLRTSARNALRGVVTMVSEDEVTATVTLDIGEGLGLIARVTR
FT                   RSVEDLGLAPGRPAIALIKSSFIRLDGAATENRLEGRILDREGGQAAAEVTIGLSAGKS
FT                   LVATVGADAPGWDLAPGDAVVVSIAAADIILAVD"
FT   gene            342674..343432
FT                   /locus_tag="CCNA_00331"
FT   CDS_pept        342674..343432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00331"
FT                   /product="molybdate-binding protein"
FT                   /EC_number="3.6.3.29"
FT                   /note="CC_0328"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93798"
FT                   /db_xref="GOA:A0A0H3C4A9"
FT                   /db_xref="InterPro:IPR005950"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4A9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93798.1"
FT                   /translation="MIARRPTLIAFLTGLWSLAVVGAALAGETKVAVAANFTEPAKAIA
FT                   ARFKARTGHDAVLSFGSSGQFYTQIANGAPYEVFLSADVERPQKAEATGLTVPGTRFTY
FT                   ATGRLVLFSRTPGLVDGQGAVLASGRFAKLAIADPKAAPYGQAAIETLNKLKRYDALKP
FT                   KIVMGASITQAFQFVQTGAAELGFVALSQVVDDKGGSRWIVPAANHTPIEQQAVLLKTG
FT                   ANSDVAKAFLTFLKSAEAKAIIRRYGYEAR"
FT   gene            343435..344109
FT                   /locus_tag="CCNA_00332"
FT   CDS_pept        343435..344109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00332"
FT                   /product="molybdenum transport system permease protein
FT                   modB"
FT                   /EC_number="3.6.3.29"
FT                   /note="CC_0329"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93799"
FT                   /db_xref="GOA:A0A0H3C521"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011867"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C521"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93799.1"
FT                   /translation="MGEVLWLTAKLAGITTLLLLLLATPLSWWLARGRSPLRTPVTAIV
FT                   ALPIVLPPTVLGFYLLIALGPNSPLMALLQPFGVRTLAFTFEGLVIGSLIYSLPFAVQP
FT                   LRNAFLAIGDEPLEAAASLGASRAETFWRVALPLALPGYVAAAILTFAHTVGEFGVVMM
FT                   LGGNIPGETTVLSTEIYRLVEALEWGEAHRLSLLLLAFAFLVLFVLLALEARSKILLRT
FT                   RA"
FT   gene            complement(344130..344957)
FT                   /locus_tag="CCNA_00333"
FT   CDS_pept        complement(344130..344957)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00333"
FT                   /product="LytTr DNA-binding domain protein"
FT                   /note="CC_0330"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93800"
FT                   /db_xref="GOA:A0A0H3C5M7"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR012362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5M7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93800.2"
FT                   /translation="MVGSVPQSSLRQSPASFRERLAGAVHASRMAMATRQSLRGFAVSA
FT                   AAGVFLALIGAFGSDAAPMGVRLAYWVGLCLAGAVVGTAVTHLIGHEGRADAHPWLYGA
FT                   LTAIGITLPFTAVVWLVSELTFHGPPRPQTLSLYVGPVFIVTTGMTALNFLVQRRPVET
FT                   HAAPVGAAAPRFLERLPVKLRGAELHAVEAQDHYLRLHTSRGQDLILMRLSDAVAELEG
FT                   IEGAQTHRSWWVAKSAVEDARRADGRATLRLKGGLEAPVSRAYAKALREAGWF"
FT   gene            345020..345580
FT                   /locus_tag="CCNA_00334"
FT   CDS_pept        345020..345580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00334"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="CC_0331"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93801"
FT                   /db_xref="GOA:A0A0H3C6J9"
FT                   /db_xref="InterPro:IPR018750"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6J9"
FT                   /protein_id="ACL93801.1"
FT                   /translation="MDPHGKSISQASDRWSGLRNAALGVGAATLIVALTAPGAFTDLGA
FT                   FAQQVRFQPHAPDFSRIAAAPAVVQVHLFSALTALAIGVVLMMRVKGTTLHKLLGWTWV
FT                   LAMGSTAVSSLFIREINHGAFSFIHLLSGWTIIGLPGAVYAIKRGKVSAHRKAMTGMFV
FT                   GGLLVAGVFTFLPGRLLWTVFLG"
FT   gene            345618..346055
FT                   /locus_tag="CCNA_00335"
FT   CDS_pept        345618..346055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00335"
FT                   /product="putative secreted protein"
FT                   /note="CC_0332"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93802"
FT                   /db_xref="InterPro:IPR018673"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3C0"
FT                   /protein_id="ACL93802.1"
FT                   /translation="MTLVRTLALALAAASIIAPAARAQEALGDLTLTFPDLKAKQGQIL
FT                   IAVFDSPQGWASGKPVRFTNASAAKDPAAAKILALPPGSYAVRAFQDVDGDGKMATNPF
FT                   GIPTEPYGFSRDAQPNMGPPSFAAAAFEVKAGANAQSLRLN"
FT   gene            346066..347517
FT                   /locus_tag="CCNA_00336"
FT   CDS_pept        346066..347517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00336"
FT                   /product="lignostilbene-alpha,beta-dioxygenase"
FT                   /EC_number="1.13.11.-"
FT                   /note="CC_0333"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93803"
FT                   /db_xref="GOA:A0A0H3C4B4"
FT                   /db_xref="InterPro:IPR004294"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4B4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93803.1"
FT                   /translation="MNRRDILRGAALTGAAAVLTPETLWAAAANDWTLGIADVEADIAP
FT                   TGLTRIHGRAPADLTGTLFRNGPAKFRRPGGAVGHWFDGDGMVRKFQMADGQARMTARF
FT                   VDTVKRRQDTAADAVITPGYGTASGPGARLGSADDANAANTSVMMAGGELWALWEGGSP
FT                   TAMDPVTLETRGFKALSPDMKGMPFLAHPRVEPDGTVWNLGLAGKRAVVWNLSADGALR
FT                   KAEVITLPRAGYMHDFTATERSLVIILQPWVQEGMSMPIATNMVWRPELGTKVLVLDKN
FT                   DLSKRRVFELPPFFFFHLGDAWEEADGTIRFDACIDKDPSGTAANGGAIVRGEFLKAPP
FT                   PRRAMITLRANGQAELAAEAVSAEFPRSDPRFAGLARRYSVHLTNERPDRPLFQSVAVR
FT                   DWKKDRDQVFDFGARHLVEEMVFALRPGSSAELDGWLVGTTLNLDARATELHVFDARHV
FT                   ERGPLVTWRASVALPVTFHGVFVGA"
FT   gene            347595..348305
FT                   /locus_tag="CCNA_00337"
FT   CDS_pept        347595..348305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00337"
FT                   /product="TetR-family transcriptional regulator"
FT                   /note="CC_0334"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93804"
FT                   /db_xref="GOA:A0A0H3C524"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041586"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C524"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93804.2"
FT                   /translation="MTATKSRARAGGRGRPSKAKGLDLKETILDAAEGLFARHGFYGVT
FT                   TRQVAAEAGVDTALIHYYFGAKRELFDAVFLRRAEILNQAREASMNAYVKANAGAMTVE
FT                   GVIEAFIDPLLRISQDGGRGWKSYFVLVAQVNNTPAWGGETMTRFFDPVVHQLVETLKT
FT                   VRPEAAYRDLYWCYQFLTGSMMLTLSETGRIDSLSEGECHSSDLESVRQRLFAYCAAGF
FT                   EAVIAKQNKALASG"
FT   gene            348479..350719
FT                   /locus_tag="CCNA_00338"
FT   CDS_pept        348479..350719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00338"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0335"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93805"
FT                   /db_xref="GOA:A0A0H3C5N1"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5N1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93805.2"
FT                   /translation="MTSMWKAALLAGAAWSTIAGAASAQQAPAADNSVSVDEVTVTARR
FT                   REENLKDVPVAVSAFSAERLERAGGTDITVLSQTTPNITVQTARGSNSTLISYIRGVGQ
FT                   QDPLWGYEPGVGLYVDDVYIYRPQGAVLDIFDIERIEVLRGPQGTLYGRNTIGGAIKYV
FT                   TKRLGDEAGAKIRGTYGSYNQTDVLVSGQTPVGGGLSVGGSYALYKRDGYGSNLTTGAE
FT                   HYNKDVEAYRISAEYQPTEDLFFRLAYDKVVDDSNPRHGHRELPALVGGYKVLDIYDTQ
FT                   AGLGDKNHVMTKGVSLTAQWNASDTVTLKSITANRRGHTDTVIDFDGTPLPTLDVPATY
FT                   DDRSFSQELQAVYSDENVQGVFGLYYMNSQASGEFDTIAGNLGVAIANGGKVNTQSFAA
FT                   FFDFSANLTDKFKVSLGARATRDAKRANVYRFFYLGATRTPYQGGTPRPILQTRTNYNA
FT                   EKTFEQFTPRISASYDLNDDLTSYVSFSKGYKSGGWDMRGDAFITPQTVNGYKPEVVKT
FT                   YEAGLKGYMFERRVSFSSAAFLSKYTDQQVTTQVVVPSGIASSVDNAGASTLYGVEFEA
FT                   NAKLSANLSANVALGYIHAEYDTFSRFVPAGAPNPLNPSTTLATGQIVNVADLYGFQNT
FT                   PEWTGNVSLTWRGELAGGDLAITPMVSYRDAYQQFEQPLPLLDQKAFTLVDLTAQWTAP
FT                   SGRYKLALTGKNLTNEKYRIGGYNFGVPTYNNSVIGFYGPPRTVAASIEVAF"
FT   gene            350788..352104
FT                   /locus_tag="CCNA_00339"
FT   CDS_pept        350788..352104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00339"
FT                   /product="transporter, major facilitator superfamily"
FT                   /note="CC_0336"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93806"
FT                   /db_xref="GOA:A0A0H3C6K2"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6K2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93806.1"
FT                   /translation="MRRASMSEDVNKAETAGRGGRYRYVVLAMLILAYTFNFLDRQILG
FT                   ILAGSIKAELHLTDTQLGLMGGVAFAALYTTLGVPLAWLADRVSRTWIMTVALTVWSGF
FT                   TVVCGLAGGFWSLFLARMGVGVGEAGGVAPAYSLIADYFPKEQRARALAVYSFGIPLGT
FT                   ALGVLFGGLIAAYVDWRFAFIAVGLAGVAFAPIFKWVVKDPVRGGLDRAPGEVAPAEPP
FT                   KAPAFGQVLATVMPKPSFWLLSFGAACSSICGYGVAFWLPTFFQRSFGLSLTDRALYYS
FT                   ALSLFGGVAGIWLGGVLADRFGAKNKAAYALAPAICFLVALPCFLLAMNVQSMVVAFLL
FT                   FLIPTGLNLAWLGPVVAAVQHLAPPSMRTTTSALFLLINNLLGLAVGLWFFGYVSDLLT
FT                   PRYGAESMRYAIYYGLSFYVVAAVLLILASRRLSKDWAE"
FT   gene            352434..353633
FT                   /locus_tag="CCNA_00340"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        352434..353633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00340"
FT                   /product="succinyl-CoA synthetase beta chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="CC_0337"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93807"
FT                   /db_xref="GOA:B8GYZ1"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR017866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GYZ1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93807.1"
FT                   /translation="MNIHEHQAKAVLAEFGAPVPRGFAAFTPDEAAAAAEKLGGPVFVV
FT                   KSQIHAGGRGKGKFEGLGPDAKGGVRVVKSVEEVRSNAEEMLGRVLVTHQTGPKGKQVN
FT                   RLYIEEGAAIAKEFYLSLLVDRASSKVSVVASTEGGMDIEDVAHSTPEKIHTFTIDPAT
FT                   GVWPTHHRALAKALGLTGGLAKEAASLLNQLYTAFMAKDMAMLEINPLIVTADDHLRVL
FT                   DAKLSFDGNSLFRHPDIKALRDESEEDPKEIEASKYDLAYIALDGEIGCMVNGAGLAMA
FT                   TMDIIKLYGAEPANFLDVGGGASKEKVTAAFKIITADPAVKGILVNIFGGIMRCDIIAE
FT                   GVIAAVKEVGLQVPLVVRLEGTNVELGKKIISESGLNVIAANDLSDGAEKIVAAVKGAR
FT                   "
FT   gene            353634..354518
FT                   /gene="sucD"
FT                   /locus_tag="CCNA_00341"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        353634..354518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucD"
FT                   /locus_tag="CCNA_00341"
FT                   /product="succinyl-CoA synthetase alpha chain"
FT                   /EC_number="6.2.1.5"
FT                   /note="CC_0338"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93808"
FT                   /db_xref="GOA:A0A0H3C3C4"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR005810"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR033847"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3C4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93808.1"
FT                   /translation="MSVLIGSHTKVICQGITGAQGTFHTEQAIAYGTQMVGGVTPGKGG
FT                   QTHIGLPVFDTVAEAKDRTGADASVIYVPPPFAADSILEAIEAEIPLIVCITEGIPVLD
FT                   MVKVKKALQGSKSRLIGPNCPGVLTPKQCKIGIMPGSIFSEGSVGVVSRSGTLTYEAVF
FT                   QTTNAGLGQTTAVGIGGDPVKGTEFIDVLEMFLADEATKSIVMIGEIGGSAEEEAAQFL
FT                   KDEAKRGRKKPMVGFIAGRTAPPGRHMGHAGAIVSGGKGGAEDKIAAMEDAGIRVSPSP
FT                   AKLGETLLEVLKG"
FT   gene            354697..357660
FT                   /gene="sucA"
FT                   /locus_tag="CCNA_00342"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        354697..357660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucA"
FT                   /locus_tag="CCNA_00342"
FT                   /product="2-oxoglutarate dehydrogenase E1 component"
FT                   /EC_number="1.2.4.2"
FT                   /note="CC_0339"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93809"
FT                   /db_xref="GOA:A0A0H3C4B5"
FT                   /db_xref="InterPro:IPR001017"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR011603"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR031717"
FT                   /db_xref="InterPro:IPR032106"
FT                   /db_xref="InterPro:IPR042179"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4B5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93809.1"
FT                   /translation="MADDAGIINQVLTETSFLYGANAAFVEDLYAQWAENPGSVEPSWN
FT                   AFFASLQEQADQVKRAAQDPAWTPKKVATVRPDWLSALDGQWATVAPAVEAKVSKAIEA
FT                   KAPAASAEAVRAATLDSLRAIMMIRAYRMRGHLAANLDPLGLDPPKDASELDPASYGFS
FT                   EADYDRPIFLDFVLGLETATIREILSIVRRTYCGNVGVQYMHISDPAEKAWLQERIEGR
FT                   DKEITFSKEGKVAILKKLIEAEGFERFLHKRFPGTKRFGLDGGEAMVPALEQIIKRGGA
FT                   LGVKDIVLGMPHRGRLNVLAAVMGKPYHVIFHEFQGGSSVPSDVEGSGDVKYHMGASSD
FT                   REFDDNKVHLSLTANPSHLEIVNPVVIGKARAKQAFTLREQPDAGRGHVLPLLLHGDAA
FT                   FAGQGVVAECFTLSGLKGYRTGGTIHFIVNNQIGFTTSPRYSRSSPYPSDMALMVEAPI
FT                   FHVNGDDPEAVVFAAKVSTEYRQKFGKDVVIDMVCYRRFGHNEGDDPTMTSPLMYAKIK
FT                   GHPSTRELYSNRLIGEGVITQADCDSWVSEFEKFLDAEFDAGKIYKPNKADWLDGKWAG
FT                   LTLPGDEDRRGKTAFPKTRLLELGRLITAIPERIDAHKTVRRAIENRRDAFEKGEGIDW
FT                   GAAEHLAFATLLDEGIPVRLSGQDSVRGTFTQRHSDIIDQKTEEHYTPLNNIRAGQAHY
FT                   EVIDSALSEEAVLGFEYGFSLAEPNTLTLWEGQFGDFVNGAQVVIDQFISSGERKWLRM
FT                   SGLVMLLPHGYEGQGPEHSSARLERFLQSCAEDNMQVVNCTTPANYFHALRRQMHREFR
FT                   KPLIVMAPKSLLRHKRAVSNLSDFAEGSAFHRVMVDGAEAGCDVGGITLKSDDKIKRVI
FT                   VCSGKVYFDLVDQRAKLGRDDVYLLRLEQFYPWPMKSLMNVLSRFKNADLIWCQEEPRN
FT                   MGGWTFVDPWLELTLDKLDIKAKRAKYVGRPASASTAAGLMSRHLKELETFLNEAFA"
FT   gene            357720..358928
FT                   /gene="sucB"
FT                   /locus_tag="CCNA_00343"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        357720..358928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sucB"
FT                   /locus_tag="CCNA_00343"
FT                   /product="dihydrolipoamide succinyltransferase"
FT                   /EC_number="2.3.1.61"
FT                   /note="CC_0340"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93810"
FT                   /db_xref="GOA:A0A0H3C529"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001078"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR004167"
FT                   /db_xref="InterPro:IPR006255"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR036625"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C529"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93810.1"
FT                   /translation="MADINTPALGESVTEATVARWTKKVGEAVKKDEILVELETDKVSL
FT                   EVASPADGVLSAIGAAEGATVVPGTVLGVVAEGATASAAPAAAPAPKAEAPKPAPAAPA
FT                   PAAAPAAAPVSPAPARIAAESGLDLSKVAGTGKDGRVTKGDALAALEARASAPAPAAAA
FT                   AAPRALHEREERVKMTRLRQTIARRLKEAQNSAAMLTTFNEVDMSAVMALRAQYKDVFE
FT                   KQHGVKLGFMSFFVKAVVAALKAIPDVNAEIDGQDVIYKNHYDIGVAVGTDKGLVVPVV
FT                   RDADALNLAGIEKTIGDLGKRARNGQLAIEDMQGGTFTITNGGIYGSLMSTPILNAPQS
FT                   GILGMHAIKERPMVINGKIEIRPMMYLALSYDHRIVDGAGAVTFLVKVKEAIEDPQRLL
FT                   LEL"
FT   gene            358988..359335
FT                   /locus_tag="CCNA_00344"
FT   CDS_pept        358988..359335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00344"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93811"
FT                   /db_xref="InterPro:IPR021439"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5N4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93811.2"
FT                   /translation="MSKDMLYLLRAGFPDMDKVWICPDCAMMEGYLAYYPHLRNALDIV
FT                   YVDYPRPRADLFERLGEAHQNAPTLILAQAAEDAGPYGEIQSANGWSFLSDARPIIRYL
FT                   ADKHGVAPPHP"
FT   gene            complement(359343..360176)
FT                   /locus_tag="CCNA_00345"
FT   CDS_pept        complement(359343..360176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00345"
FT                   /product="alpha/beta family hydrolase"
FT                   /note="CC_0341"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93812"
FT                   /db_xref="GOA:A0A0H3C6K7"
FT                   /db_xref="InterPro:IPR000801"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6K7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93812.2"
FT                   /translation="MLKSTALAITLFCACTGPAMAYAPDETPIVIGRSTLLESKVLGQL
FT                   RRINVHTPADYATSGKTYPVLFLLDGGEREDFPHIAGLAQLGELSWTYREMIVVGIEGI
FT                   DRRHDLTHPSTVAQEQADFPTLGGSAAYRRFLSEELKPWVAARYRTNGESAIMGESLAG
FT                   LFVIETLLKQPTLFDAYIAASPSLWWSDQALARGAPADIARWPALGSRKLYLTIGDEGS
FT                   TMQEGVDKVMAAIGAAKPAGLTLVYDPMPHEQHSTIYHPAALKAFRTVWPGPRPD"
FT   gene            360419..361819
FT                   /locus_tag="CCNA_00346"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        360419..361819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00346"
FT                   /product="dihydrolipoamide dehydrogenase"
FT                   /EC_number="1.8.1.4"
FT                   /note="CC_0342"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93813"
FT                   /db_xref="GOA:A0A0H3C3C8"
FT                   /db_xref="InterPro:IPR001100"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3C8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93813.2"
FT                   /translation="MAQYDVVIIGGGPGGYNAAIRAGQLGLKVAIVEGRGKLGGTCLNV
FT                   GCMPSKALLHASELYAAATGPEFAKLGIEVKPKLNLSQMMAQKAESVEALTKGVEFLMK
FT                   KNKVEYVKGWGRIDGVGKVVVKAEDGSETTLETKNIVIATGSEPTPLPGVSVDNKRIID
FT                   STGALSLPEVPKRLVVVGAGVIGLELGSVWKRLGAEVTVVEYLDRILPGTDTEVANAFQ
FT                   KILVKQGFKFQLGAKVTGAEAGAKGVKLSFEPVAGGEAQTIEADYVLVAIGRRPYTQGL
FT                   GLETVGVTPDKRGMIANDHFKTGVAGVWVIGDVTSGPMLAHKAEDEGVACIEMIAGKAG
FT                   HVNYGIIPGVVYTSPEVATVGKTEDELKAEGVAYKVGKFPFLANSRAKINHETDGFVKI
FT                   LADAKTDRILGAHMIGPNVGDMIAEYCVAMEFGGASEDVARTCHPHPTRSEALRQAAMG
FT                   VEGWTMQA"
FT   gene            361909..362088
FT                   /locus_tag="CCNA_00347"
FT   CDS_pept        361909..362088
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00347"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93814"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4B9"
FT                   /protein_id="ACL93814.1"
FT                   /translation="MDPWGAVARPQKKLITLDVHASWRPPSPFDKLRVRTTVGLGSHKI
FT                   LILSLSKDEDFQSA"
FT   gene            complement(362113..362212)
FT                   /locus_tag="CCNA_R0104"
FT   ncRNA           complement(362113..362212)
FT                   /locus_tag="CCNA_R0104"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(362218..364221)
FT                   /locus_tag="CCNA_00348"
FT   CDS_pept        complement(362218..364221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00348"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CC_0343"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93815"
FT                   /db_xref="GOA:A0A0H3C535"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C535"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93815.1"
FT                   /translation="MKLDDLKISTKVALPAVALTIVSLALVGVSFVESRKAEAIRSMLI
FT                   NERAPAELEASEFNRRVVTIGYAAYRVVASQGTSKEANEASAELDAAYKTAKDKLRGIN
FT                   TVDPTAEKVTKDFGARLDKIYTSARQGADLGLQDVDEAGMMVMAVLDPEIVSLKTDVEK
FT                   YTTGHAAETEALVTRLDREVSQGRIISLVFGLLAIASALAFALWIGSRKIAAPLIATAK
FT                   TMDFLAQGSVDVDVRGAERKDEVGAMARSVQVFKDNAVALRTAEAAQQRANAEVEAERR
FT                   RNQELAEAAAKEQALVMEAIAGGLARLSDGDLTYRLDQQFPEAYKRLQSDFNGAIAQLE
FT                   EAMGTIVHAASSIGAGSDEIASAADDLSRRSEQQAASLEETAAALDEITATVRRSSAGA
FT                   QEASKVVGSTRSDAERSSVVVRNAVDAMNQIEKSSQSISQIIGVIDEIAFQTNLLALNA
FT                   GVEAARAGEAGRGFAVVAQEVRALAQRSADAAKEIKTLISTSSQQVNQGVAMVGQTGEA
FT                   LQTIVAKVGEIDALVSEIAASGQEQATGLNEVNAAVNQMDQTVQQNAAMVEQSTAASHA
FT                   LKSEAGNLMQMISRFRVQGSASAAATGGSKRASRSAAPPPAAHRPSAPVHVSPGPTLAS
FT                   AASRPGANPVAAAQAKLAKAVGASSSDDWEEF"
FT   gene            complement(364395..365309)
FT                   /locus_tag="CCNA_00349"
FT   CDS_pept        complement(364395..365309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00349"
FT                   /product="integrase/recombinase, XerC-CodV family"
FT                   /note="CC_0344"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93816"
FT                   /db_xref="GOA:A0A0H3C5N6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5N6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93816.1"
FT                   /translation="MSARQAYAAWLDHLTLERRASPRTVRAYGDNVLAYLNFLEAHRGE
FT                   ALSLSALAEISAADLRGYLAWRRQGEHALAPRSLSQALSSIRAFHRYLDQRHGVANAAV
FT                   DLVRGPRLKIGLPRPVSEDQARDLITQAAEDTERDPWETARDEAVLTLLWGCGLRISEA
FT                   LSLRMSDAPLAATLRITGKGGKTRIVPVLDAVRDAIEAYLDELPFNLAPDEALFRAKRG
FT                   GPLSPRHVQGLVQTLRGRLGLSDRVTPHAFRHAFATHLLGAGADLRAIQDLLGHASLST
FT                   TQRYTQVDAAGLLAAYQAAHPKG"
FT   gene            complement(365306..365986)
FT                   /locus_tag="CCNA_00350"
FT   CDS_pept        complement(365306..365986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00350"
FT                   /product="hypothetical protein"
FT                   /note="CC_0345"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93817"
FT                   /db_xref="InterPro:IPR007435"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6L2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93817.1"
FT                   /translation="MSDATRATRTMVVDPESVRDFLRTEPEFLRQDESLLGELGLRVDA
FT                   ANVVDFGPRALARAAAAHRREASVRQAIEANARANYSAQAQTHAAVIDMLDARNHSDLA
FT                   RRVDEMAQLRFGHAAGVIALEGPSRVPAGWRALAESQVDMLLGDAPIARMGFFAPALPL
FT                   FDDKAETIRSMAIVRMAIWEPRREALIAFGSTDPEGFTPDMGTELVNFLARVVERTAER
FT                   WPVL"
FT   gene            366112..368271
FT                   /locus_tag="CCNA_00351"
FT   CDS_pept        366112..368271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00351"
FT                   /product="primosomal protein N'"
FT                   /note="CC_0346"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93818"
FT                   /db_xref="GOA:A0A0H3C3D4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR005259"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041222"
FT                   /db_xref="InterPro:IPR041236"
FT                   /db_xref="InterPro:IPR042115"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3D4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93818.1"
FT                   /translation="MPRIASVLLPMPLPEAFDYAEPEGLALAVGDHVTVPLGPRVIRGV
FT                   VTALRDGTGGNRPLKPVLERVDDPPLPPGALAFVEWAARYSVDVPGWPLAMALRGLRHP
FT                   PPKPDKVLVLTGVQPARVTPARLKVMAAAEGTKLSGAALASAAGVSAGVVKGLVDEGVL
FT                   AVDFVEPERGLPQPDLSLPARALNPGQAACVDVLKDMLESGGFQAALLDGVTGSGKTEV
FT                   YLEAVAEALKDPETQVLVLLPEIALTQAVMARFEQRFGALPAEWHSGVSPPRRRQVWEA
FT                   VAGGNARIVVGARSALFLPFRKLRLIVVDEEHDSSFKQEEGFIYQARDLAVARAKIEGA
FT                   SVLLASATPSLESLYNAQTGRYRWLRLSARHGAAQLPDIGLVDMRQTPPEPGRWLSPPL
FT                   IKAMAVTLQRGEQAMLFLNRRGYAPLVLCKACGEKMKSPDTDSWLVEHRYTGRLVCHLT
FT                   GFSMKKPEACPHCGAKDSLVSIGPGVERVEEEARHIFPDARVAVFSSDTVMDAEGAKAL
FT                   VSSMAAGEIDILVATQAAAKGHNFPNLTLVGVVDADLSLRGGDLRAGERTFQLLAQAAG
FT                   RAGRHEKPGRALLQTYAPDHAVMRALAAQDRDAFVEAEMAMREDAGLPPFGRLAAVIAS
FT                   GPDGAALDAYVEALAAVIPNAEGVEVFGPADAPLALVRGRRRKRFLVRAERNVDLQGFM
FT                   AAWRARAKVPNSVRVVIDVDPYSFL"
FT   gene            complement(368358..369155)
FT                   /locus_tag="CCNA_00352"
FT   CDS_pept        complement(368358..369155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00352"
FT                   /product="integral membrane protein"
FT                   /note="CC_0347"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93819"
FT                   /db_xref="GOA:A0A0H3C4C4"
FT                   /db_xref="InterPro:IPR005496"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4C4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93819.1"
FT                   /translation="MNEILSLAVDPAAWAALITLIVMEVVLGIDNLIFISILSNKLPEE
FT                   HRQRVRRIGISLALIMRLVLLSTIAFIVGLTAPVFDLGISGPVGAHGEPGFETAFSWRD
FT                   LILIAGGVFLIWKATKEIHHAVDPAKSDDVLEKDKATVVINNVGSAIFQIILLDLVFSI
FT                   DSILTAVGMTEHLPIMVIAVLVAVTVMLLAADPLANFINNNPTVVMLALGFLLMIGTVL
FT                   IAEGFGGHVPKGYIYTAMAFSAGVEGLNMMARKRDAKKQEQQT"
FT   gene            369280..370374
FT                   /locus_tag="CCNA_00353"
FT   CDS_pept        369280..370374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00353"
FT                   /product="O-antigen acetylase"
FT                   /note="CC_0348"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93820"
FT                   /db_xref="GOA:A0A0H3C538"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C538"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93820.1"
FT                   /translation="MPDAAHVKPLTALRFFAAFWVVLYHYWPNLDVGFTPAIASKGYLG
FT                   VEAFFVLSGFILCHVYLAGFGEGRFRYGDFLWNRLARVYPLHLATLVGVGAMALAGAVA
FT                   GLAVDPNILSWPSLPANLLLVHAWGLAPVAGWNHASWSISAEWFAYLTFPVFAFAAWRL
FT                   RSRPLVAVLAALALIAVIYPVFEALAGFSLTEATIRWGALRIVPCFAYGCALHALWRSG
FT                   RFPTRLAGPGAAVLGLAILAAIQLGAPDLSIVMLLGGLIFMLASLASAGSRFATQKTFV
FT                   YLGEISYSTYMICIPWKILAINAATKVLNIEGDKLPLLIWILIVAALVPLSAISFHVIE
FT                   NPCRARMKAWAETWRERRLAAAGA"
FT   gene            370445..371152
FT                   /locus_tag="CCNA_00354"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        370445..371152
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00354"
FT                   /product="NlpC/P60 CHAP domain amidase protein"
FT                   /note="CC_0349"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93821"
FT                   /db_xref="InterPro:IPR007921"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5N9"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93821.1"
FT                   /translation="MTKRTRTLLGSLAAAAMISLVPMSGANADGYWQCVPFARLMSGIQ
FT                   IFGDARTWWSQAAGKYDTGSAPKIGSVLSFKPTARMNLGHVAFVSQVLTDRVIQVTHAN
FT                   WSVIEGDRGQIEKDVTVVDVSPNGDWTQVKVWYDPIRDLGTTVYPTNGFIYQDAQAMKI
FT                   AMATSKIAMAQNAVVSAAKSAANQVAASVRASPLDIITQAADSTDRIAALIEAATGGAS
FT                   PPSDPNNKPTAPR"
FT   gene            371323..372567
FT                   /locus_tag="CCNA_00355"
FT   CDS_pept        371323..372567
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00355"
FT                   /product="putative pentapeptide repeat protein"
FT                   /note="CC_0350"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93822"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6L8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93822.1"
FT                   /translation="MPSAKPSQASLIRNVHPSVVRELLEAHARYLKGLPKGRRAVLQYV
FT                   NLNNYELDGADLSEADLTGALLGGAALRGARLCRATLYGANLRDSDLRDADLSRSDMRG
FT                   ACLRGANLGGANLSNCDLREGVTAVQDEEKGLRILEHSKRPGELDYALLQGANLNGAQM
FT                   SGAFAQRADFTDADLSNVSLQGARLTNALMDGADLSGANLYNADLSKVSLRRAVLVGAD
FT                   LSGADLTGADLTQVLRAPPPIIYVDDLPLNEVLEAHELFCKSEGRDGTVARVSEVDFRP
FT                   LRRLKNRRLSGLSAPNAVFFGMDLEGAQLQGANLAGADLRGVKLRGADLRGARLVGAQL
FT                   SRADLSDAKLGPLRIAEDRVIRTDLTRAALRGANLRGASAPRARFIEADLSGARLEGAD
FT                   LSGAEMPADGASLNF"
FT   gene            complement(372505..372817)
FT                   /locus_tag="CCNA_R0105"
FT   ncRNA           complement(372505..372817)
FT                   /locus_tag="CCNA_R0105"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            372638..373402
FT                   /locus_tag="CCNA_00356"
FT   CDS_pept        372638..373402
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00356"
FT                   /product="outer membrane protein"
FT                   /note="CC_0351"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93823"
FT                   /db_xref="InterPro:IPR010583"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3D8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93823.1"
FT                   /translation="MISLRTHAARSLLALGALAAATSAAAQSGAPDRAVVGIAAVYTPG
FT                   YQGGDDYRLMPFPVIDVTYGRFFASGREGVGYTVLDGSAVKVSAGATFVPGYRRRDAPV
FT                   GVGRLDGGAGLRVAADMRLGEVLVSMSATKVVSGDVDGALVDASLAYPVRLSERLSLMP
FT                   SVSATWADSQYNRAYFGISAAQSAASKLPVYRPGGGVKDVSMSLSANYRLNDKVSLGAT
FT                   ASLSRLTGDARKSPIVVEATQPSAVLSVAYRF"
FT   gene            373511..374938
FT                   /locus_tag="CCNA_00357"
FT   CDS_pept        373511..374938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00357"
FT                   /product="secretory tripeptidyl aminopeptidase"
FT                   /EC_number="3.4.11.-"
FT                   /note="CC_0352"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93824"
FT                   /db_xref="GOA:A0A0H3C4C7"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR002410"
FT                   /db_xref="InterPro:IPR013595"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4C7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93824.1"
FT                   /translation="MMSRLSWIVAAGALALAGLGGAAHAAAPQFKPTACKGDYKDAARQ
FT                   VRCGTLVVDETRGDPKSRRITVAVAIVKASEPKAGQPPVVYLHGGPGGSAVGGLPRMLK
FT                   SKAALEYVAVDQDWIFIDQRGGGQSDPNLDCPGANLTDAGPPSDKDAQAIIACMKAFQA
FT                   KGVNLSRYNAVEVAKDVQDLRKLLKLPLIDLYGGSYGTRIEAAIQTHAAEGVRAVVQDS
FT                   PWPPEADWTVGGPAMVSSSIDIVMAKCAKVAECAKRYPDLKAKLAVVAERWLAGPQTIN
FT                   GKTYTADDLGGWLMDASYFTASVLPRDLWKIIEGDVSPVAEFVESRDYYSEGQFMTHLC
FT                   KEEIPFEARAAVADGTQKDPIARLMVASMQRIHDVCAAIDVGPINKVEQAPVKTAIPTL
FT                   FLAAEIDPGCPPELTRAAAKGYQGSQVVIVTNATHGVSRSSPCVRKMIRSFFQDPTKPV
FT                   DRSCLPAADTPMAFMYQ"
FT   gene            complement(374976..375836)
FT                   /locus_tag="CCNA_00358"
FT   CDS_pept        complement(374976..375836)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00358"
FT                   /product="delta 3,5-delta2,4-dienoyl-CoA isomerase
FT                   precursor"
FT                   /EC_number="5.3.3.-"
FT                   /note="CC_0353"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93825"
FT                   /db_xref="GOA:A0A0H3C541"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C541"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93825.1"
FT                   /translation="MSNQDQANYSCFKVEIEAGVAHIQLKRPEAMNTMTRPFWNELPAI
FT                   VKDIDDNARARCIVISSTGKHFSAGMDLSVFTDDEGVTARQDADRWVAAESFRRFVHHL
FT                   QDTFSCLDKARMPVIVAIQGGCIGGAVDFISACDIRYATTDAFFQIQEINIGMTADVGT
FT                   FPRLCKLIPEGWVRELAYAGRRLPAQRARDIGLVNEVFDTHEEVVAHALATAREIAEKS
FT                   PLAVAGSKVMINYARDHSIADALDYIATWQTGMFSGPHMAEAFTAKAQKREAVYPDLLP
FT                   LKKKM"
FT   gene            375919..376716
FT                   /locus_tag="CCNA_00359"
FT   CDS_pept        375919..376716
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00359"
FT                   /product="SH3 domain-containing cell surface protein"
FT                   /note="CC_0354"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93826"
FT                   /db_xref="GOA:A0A0H3C5P3"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR008816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5P3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93826.2"
FT                   /translation="MTTRKTPATALAIAAVLGASLTVAPAPVLAQQSKPLGGLFSCEGS
FT                   GKKQEGGALIGAAAGALLGSKLAKNEQTLGALVGAAAGAAAGAYIGCRMQSTDAALAEQ
FT                   ATKKALETGVSQTWSNSRTGNSGRINVVSSSYGPPIDGRTIRYAQGVQSLQSLAATPGA
FT                   YTAASTVNLRAGPSTKTAVVGKLAAGETFDAIGQAPTGGWVLVGRSGFGVGYAAASLVR
FT                   PTGQMAASCRVIDAAVSGGGQATSTQRYSACRDNRGEWQLTQA"
FT   gene            376916..377806
FT                   /locus_tag="CCNA_00360"
FT   CDS_pept        376916..377806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00360"
FT                   /product="alpha/beta hydrolase superfamily protein"
FT                   /note="CC_0355"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93827"
FT                   /db_xref="GOA:A0A0H3C6M5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6M5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93827.1"
FT                   /translation="MDAAVFREPRRRVVAVPGGEIAALEFGPEDRAIDIVFVHANGFNA
FT                   QTYRTLLSPLAAGLRVLAIDQRGHGATTLPADPKGRRSWRDLRDDLVGLLDVLDGPPAV
FT                   LAGHSMGGTVSLLTAAERPDRVKGLLLLDPVIMPWLANLYAKAPWTSGRGFLQLPIAQA
FT                   ALKRRAVFDNREAVFAGYKGRGAFKTWPETMLADYVAGGVVDAPDGKVRLACAPAWEAS
FT                   NYAAQAHDPWRAVRRVTAPVRILKAQKHSTCRAGDGFARRGRDVRIETIEGTSHFLPME
FT                   RPDLVRDALFEMATA"
FT   gene            complement(377803..378750)
FT                   /locus_tag="CCNA_00361"
FT   CDS_pept        complement(377803..378750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00361"
FT                   /product="hot dog superfamily thioesterase"
FT                   /note="CC_0356"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93828"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3E4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93828.1"
FT                   /translation="MTTAQPLPGVEIWRGGVNTWDCDEMGHMNVRHYVVRAQEGLIGMA
FT                   AELGLPHAFSPHANATLLVKEQHIRFLREAHAGAPLYMLGGVIEMGETEARILQLLIHP
FT                   TSGELAATFQTTVVHATPRDGQPFPWPRIARERAEALKVEIPERAQARSIDLSPFTPTA
FT                   SLARAEALNLSRIGLGGLLPSDCDVFGRMRTEQFIGRVSDGIGTFIHPFRDLVVEHADQ
FT                   KPQRMGGAVLEYRIVHLAWPRAGDRIEIRSGLLGTDARTMRIVHWMLDPATGEPWGTSE
FT                   AVAITFDLDARKVVPVTDAARAALAAHEVSGLAL"
FT   gene            complement(378802..379287)
FT                   /locus_tag="CCNA_00362"
FT   CDS_pept        complement(378802..379287)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00362"
FT                   /product="zinc uptake regulation protein"
FT                   /note="CC_0357"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93829"
FT                   /db_xref="GOA:A0A0H3C4D3"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4D3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93829.2"
FT                   /translation="MANAPSCGHDHHNHGVAGAALAAELDAAEARCAAADQRLTAPRRR
FT                   VLELLLEAGQPVKAYDLISSFGGSGPPAKPPTVYRALDFLEKQGFAHRIESLNAYVACR
FT                   KEADGHAAAFLICDCCGATREIEPKASAEIIAAGEAAGYALTGVTIEAHGLCADCRS"
FT   gene            complement(379324..380100)
FT                   /locus_tag="CCNA_00363"
FT   CDS_pept        complement(379324..380100)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00363"
FT                   /product="PAP2 bacterial acid phosphatase"
FT                   /EC_number="3.1.3.2"
FT                   /note="CC_0358"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93830"
FT                   /db_xref="GOA:A0A0H3C548"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR001011"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C548"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93830.1"
FT                   /translation="MRAVWLVTTAALMLTGCATLSGDAPSNRYLAKGVFDARDHLPPPP
FT                   AKGSEAALRDREIFRATRALKDTPRWSLAQEDNVEEKVLDGYACALGVTPSFERNPKLA
FT                   VTLLRMSRDVRSAVAGPKLKYRRPRPYFSEEGPICIKRSLGLALSPDYPSGHATWGWSV
FT                   GLVLAEVAPDRREAILARAQAYGESRVVCGVHNMSSVEAGRMNAENLLSALKSSDAFKA
FT                   DLAAARAELDAARAAGPAPAPARCEAEAAALSKPLL"
FT   gene            complement(380179..381273)
FT                   /locus_tag="CCNA_00364"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(380179..381273)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00364"
FT                   /product="deoxyhypusine synthase"
FT                   /EC_number="2.5.1.46"
FT                   /note="CC_0359"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93831"
FT                   /db_xref="GOA:A0A0H3C5P8"
FT                   /db_xref="InterPro:IPR002773"
FT                   /db_xref="InterPro:IPR023496"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR036982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5P8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93831.1"
FT                   /translation="MFQRRASKVRETEAMNAPVPNNQKAELLQKVVEHVDITSYDARPI
FT                   IDSMRKMSFSSRDTARAADIFNMALADKGCSTWLILAGSTSAGGCMHVYRDMVKNGMID
FT                   AVVATGASIVDMDFFEALGFKHYQAAGPVDDNVLRDNYIDRIYDTYIDEEELQACDHTI
FT                   LEICNKLEPRGYSSREFIWEMGKWLAEGNAKKEGSLIQTAYEEGVPIFCPAFVDSSAGF
FT                   GLVKHQKEKIAEKKPYLMIDAVADFRELTDVKIAAGTTGLFMVGGGVPKNFAQDTVVCA
FT                   EILGVEADMHKYAIQITVADVRDGACSSSTLKEAASWGKVSTTYEQMVFAEATTVVPLI
FT                   ASDAYWRKAWEGREKPRWNKLFGK"
FT   gene            complement(381396..382655)
FT                   /locus_tag="CCNA_00365"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(381396..382655)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00365"
FT                   /product="ornithine decarboxylase"
FT                   /EC_number="4.1.1.17"
FT                   /note="CC_0360"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93832"
FT                   /db_xref="GOA:A0A0H3C6N1"
FT                   /db_xref="InterPro:IPR000183"
FT                   /db_xref="InterPro:IPR002433"
FT                   /db_xref="InterPro:IPR009006"
FT                   /db_xref="InterPro:IPR022643"
FT                   /db_xref="InterPro:IPR022644"
FT                   /db_xref="InterPro:IPR022653"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6N1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93832.1"
FT                   /translation="MRTYHSPLDLVRERSPERPVALVRPDAVAVAARWFQSEFKGDVFY
FT                   AVKANPSPWVIRELAKAGVRSFDVASLNEVELVANEAPGSRMAFMHPVKSRAAISAAYF
FT                   DHGVKTFSFDTHEELAKILDATGQAKDLNLIVRMGVQAEGAAYSLSGKFGVEMHNAPDL
FT                   LLAARRATQDLMGVSFHVGSQCMRPTAFQAAMAQASRALVRAGVLADVVDVGGGFPSIY
FT                   PGMVPPDLSEYLAAIDRGFAEMMVHETTELWCEPGRALVAEASSLLVKVELKKGDALYL
FT                   NDGSYGSLFDAAHMKWPFPVKLYRKSGEVVEEGLKPFRFYGPTCDSVDHMPGPFYLPES
FT                   VDEGDYIEIGMLGAYGVAMNTRFNGFGETDTAQVQDAPMASMYGLAKRSIPVVRQETEE
FT                   RKIVRFSRPKGAAGKRKRRR"
FT   gene            383009..383803
FT                   /locus_tag="CCNA_00366"
FT   CDS_pept        383009..383803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00366"
FT                   /product="phosphonates transport ATP-binding protein phnC"
FT                   /EC_number="3.6.3.28"
FT                   /note="CC_0361"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93833"
FT                   /db_xref="GOA:A0A0H3C3F1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR012693"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3F1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93833.1"
FT                   /translation="MTSDPVLSIRAASKTFGSRRALDAVSLDVNRGEMIALIGPSGSGK
FT                   STLLRSIDGLQTIDEGEGAITAFGGPVQARGKVSDQVRKARVRIGFIAQQFNLVGRLSL
FT                   FSNVALGSLGRIPVVQGLLGWWPKETRDATMAALHRVGVSEYAAQRANTLSGGQQQRGA
FT                   IARALVQKAKIILADEPVASLDPVSARKVMEILRDLNQSDGLTVVVTLHQVDYALRYCD
FT                   RVVALKAGQKVYDGPASELKREKLIDIYGPEFEDVFWEGAPQ"
FT   gene            383800..384825
FT                   /locus_tag="CCNA_00367"
FT   CDS_pept        383800..384825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00367"
FT                   /product="phosphonates-binding protein"
FT                   /note="CC_0362"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93834"
FT                   /db_xref="GOA:A0A0H3C4D8"
FT                   /db_xref="InterPro:IPR005770"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017797"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4D8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93834.1"
FT                   /translation="MISRRSALVIAAGLSALALASCSGKSDAPAANNEVTFSILSTEST
FT                   QNMESYWTPILKDMEKQTGLKVKPFFSSNYSSLIVAMGAKQTDLGWFSNQSGLEAVRRS
FT                   NGEVFARTFDPSGTDGYKSVIIVPADSKIQSVQDLLKCDKSLDFGIGDKKSTSGTLAPM
FT                   TYVFIPANKKPETCFKTVISANHQANLFAVANGKLDASTNNSTAIGLSKARGEGVTDKI
FT                   RVIWESPTLPEDPLVWRKDIDPVVKEKLRQFFLTYAQGDTPEAEQQRGYLKRLSIGGFK
FT                   PADDTHLLVVREMEATEQLGLAREAGDQAKVAAAQKVLDGVKAERLAAEGKAGVVAQPA
FT                   N"
FT   gene            384831..385667
FT                   /locus_tag="CCNA_00368"
FT   CDS_pept        384831..385667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00368"
FT                   /product="phosphonates transport system permease protein
FT                   phnE"
FT                   /note="CC_0363"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93835"
FT                   /db_xref="GOA:A0A0H3C553"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005769"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C553"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93835.1"
FT                   /translation="MMSQAAKIEGAIPPPPKRSASALAFDTLLWGGVILLLIISFQPAE
FT                   IDKFPQLFTDTEKTQGFAQLFFKPFTDAQLFMSMDWSLFIGKMWQTIQMAMWGTALAII
FT                   VAIPLGLLGARNIAPVWVQQPVRRVLDLIRSIPDLVVALIFITAVGLGPFAGVMSIMFN
FT                   TGGVLAKLFAEAVESIDKGPVEGVRATGAVKLQEIVWGVIPQVAPLWTSYALYRFESSS
FT                   RAATVLGIIGAGGIGQILYDSINAFQFDQTGCIVLVIVVAVSMIDLLSQVIRTRLL"
FT   gene            385817..387130
FT                   /locus_tag="CCNA_00369"
FT   CDS_pept        385817..387130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00369"
FT                   /product="magnesium and cobalt efflux protein corC-like
FT                   protein"
FT                   /note="CC_0364"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93836"
FT                   /db_xref="GOA:A0A0H3C5Q3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Q3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93836.1"
FT                   /translation="MILVSLVVVLFLVLLNGVFSMSELAVVSARKARLQGFAERGDRGA
FT                   KLALEMSEHPTRFLSAVQVGITLIGIFAGAYGQATIAAALDAWLEASVPALAKYSEAIA
FT                   TTLVVIGLTYVSVILGELVPKRLALIFPDAIARRMAPFLAVVATVLRPFVTLLTVSTAA
FT                   VLRLMGVRDERNTSVTSEEVEAVLAEGADAGLIEPEERSMIQEVLRLGDRPVRVAMTPR
FT                   RDLFWVSLADDTETVLKEIRASAHSRIVVATEGDLDGDVGVLLKKDLLDACLSGEPLDL
FT                   KAHVQQPLAIPETMSLLKALQLFKSTSLHMALVVDEFGSLQGAITPLDLLEMIAGDFPE
FT                   DHDDDEKRIIRREDGGWLIDARLDIQELNDHLGENFEADGGYHTVAGLILDRLGRLPTE
FT                   GEHVEIGGFDLEIVDMDGSRIDKVILKPSKRRKEGQEG"
FT   gene            387425..387559
FT                   /locus_tag="CCNA_03918"
FT   CDS_pept        387425..387559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03918"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03918"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88520"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3J1G6"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88520.1"
FT                   /translation="MDVILATHPSSTFAMSAVRKPSLRPNAPPKRKGADLAIRALRLV"
FT   gene            complement(387576..388085)
FT                   /locus_tag="CCNA_00370"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(387576..388085)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00370"
FT                   /product="ATP synthase B chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="CC_0365"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93837"
FT                   /db_xref="GOA:A0A0H3C6N6"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6N6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93837.1"
FT                   /translation="MEHQSLFSFSNPEFWVLAALVIFFGLLVVLKVLPGALFGALDGYA
FT                   AKIKAELDEAQQLREEAQALLADVKAQREDAERQAAAMLEAAKADAKRLAEEAKEKLEE
FT                   QIKRRAEMAERKIAQAEAQAAADVKAAAVDLAAQAAETVLAARLAGAKGDTLVDAAIGQ
FT                   MGAKLQ"
FT   gene            complement(388096..388629)
FT                   /locus_tag="CCNA_00371"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(388096..388629)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00371"
FT                   /product="ATP synthase B' chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="CC_0366"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93838"
FT                   /db_xref="GOA:A0A0H3C3F7"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3F7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93838.1"
FT                   /translation="MATEHHGTTETTEAPKHESGGLPQLQFEHWGGQIVWLLIIFAVLY
FT                   AVLSKALLPRVSGAIDERGAKIAGDIADARRMKDEAEAQARAAAAEVAEARAKAQKTAA
FT                   DAKAKASAEAAERQAKEEAVLAEKLAAAEASIQTARDQAMSQVRVVAEETAGAIVEKLT
FT                   GKAASAAELKSALA"
FT   gene            complement(388756..388980)
FT                   /locus_tag="CCNA_00372"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(388756..388980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00372"
FT                   /product="ATP synthase C chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="CC_0367"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00372"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93839"
FT                   /db_xref="GOA:A0A0H3C4E3"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4E3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93839.1"
FT                   /translation="MDAAAAKYIGAGLAMLGMIGAGVGLGVMFGNYFQGALRNPTAAAQ
FT                   ERPMLFLGMALTEALGIFALVIAFLILFS"
FT   gene            complement(389030..389791)
FT                   /locus_tag="CCNA_00373"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(389030..389791)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00373"
FT                   /product="ATP synthase A chain"
FT                   /EC_number="3.6.3.14"
FT                   /note="CC_0368"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93840"
FT                   /db_xref="GOA:A0A0H3C557"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C557"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93840.1"
FT                   /translation="MADPMHQFQIQKIVELPTVTVPGLGAIDLSITNSVAAMMSAALLI
FT                   IGFYALSAKKAVVPGRLQSVGEMLYGLVDGLAESIIGHDGKKFLPFIFTLFAFVLFMNV
FT                   QGMFLVFTATSQLAVTLTLGLMVILTVVAVGFAKNGLKFFKLFAPSGVPWPLYFLLVPI
FT                   EILSFLIRPITLGLRLFGNMLGGHVVLKIFAGFVVALGGLGVLGWAGAALALTSVVALT
FT                   ALEFMVAFLQAFVFAVLACVYINDVVHLDSH"
FT   gene            complement(389797..390177)
FT                   /locus_tag="CCNA_00374"
FT   CDS_pept        complement(389797..390177)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00374"
FT                   /product="putative ATP synthase protein I"
FT                   /note="CC_0369"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93841"
FT                   /db_xref="GOA:A0A0H3C5Q8"
FT                   /db_xref="InterPro:IPR016989"
FT                   /db_xref="InterPro:IPR032820"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Q8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93841.1"
FT                   /translation="MPKADEPNDKAIESLDARLAAFEAKKAAEKPSKATSEKATQDGYR
FT                   LLADLIGGVLVGVGFGWLLDHYAHTSPWGMIGGLLIGLGLAIFSIVRKAMKLSAQASAP
FT                   SPSGNADEDTGGGSTAPKQKRD"
FT   gene            390599..390988
FT                   /locus_tag="CCNA_00375"
FT   CDS_pept        390599..390988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00375"
FT                   /product="hypothetical protein"
FT                   /note="CC_0371"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93842"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6P2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93842.1"
FT                   /translation="MSHLKNTGFADRISAQQEAKKAMLAKFKAKPTVQDPDFDKREEQR
FT                   AAELEAVRAARAEAKEKARLEALARQEEQMAVKRAERKERKAIEAAEQRMRKEEKAKER
FT                   DELRALGKPANSKASRAHQWASLLG"
FT   gene            391059..391838
FT                   /locus_tag="CCNA_00376"
FT   CDS_pept        391059..391838
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00376"
FT                   /product="putative membrane spanning protein"
FT                   /note="CC_0372"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93843"
FT                   /db_xref="GOA:A0A0H3C3G2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3G2"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93843.2"
FT                   /translation="MVSLDILASLFVVAALAGALDAIAGGGGLITLPALLLAGLSPVQA
FT                   LGTNKLQGAISALSSTSAFARRGLIDWKTALPVAGASALAGLGGALCASLLSPEFLRAV
FT                   VPLMLIAIALYFGLSRAIKAEDVTPRMALIPFACFVAPLIGFYDGIFGPGAGAFYMVAI
FT                   VTLLGYGALKATAHTKLANAASNLGSLVLFTLKGAVVWPVGLVMAAGAFIGAQVGSRLA
FT                   MRFGPKLIRPLLVVISCAMAVKLLADPANPLRMALGF"
FT   gene            complement(391953..395396)
FT                   /gene="smc"
FT                   /locus_tag="CCNA_00377"
FT   CDS_pept        complement(391953..395396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="smc"
FT                   /locus_tag="CCNA_00377"
FT                   /product="chromosome partition protein Smc"
FT                   /note="CC_0373"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93844"
FT                   /db_xref="GOA:B8GZ28"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR011890"
FT                   /db_xref="InterPro:IPR024704"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036277"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZ28"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93844.1"
FT                   /translation="MQFQRLRLSGFKSFVEPTEFRIEPGLTGIVGPNGCGKSNLLEALR
FT                   WVMGANSAKAMRAGGMDDVIFAGSGARPARNHADVTLTIDNADRTAPAQFNDDPILEVV
FT                   RRIDRGEGSTYRINGREVRARDVQLLFADASTGANSPALVRQGQISELIGAKPQNRRRI
FT                   LEEAAGVSGLHTRRHEAELRLRAAETNLSRLEDVARELETALNRLRREARQAEKYKRLS
FT                   SEIRAVQGAVLYARWTEARDHLERTTSEATAAARLVEETARASAAAQVAITEAEAAMPP
FT                   LREEATIAQAILGQLAIQKDRAEREAEAAAAEFERLSNDLSRIDADRAREAQAKDDAAA
FT                   ALARIAPELEEVRALVAAAPERGPELAAVAKAAEEARAAAEAAVEQLAARVAAEEAQGR
FT                   AAAARLSEAEARANRTNRALEQARAERAAVGPEVDPAAADARQRFANAEAALAAARAAL
FT                   EEAETARVKAAEQEAQARQLARSVEDQLGRLRTEARGLAQLTAPRSKSGHAPALDSVSP
FT                   DKGYGAALAAALGDDLDAALDPKAPSYWGGAEAPAPVWPEGAEPLAPLVKAPPALAARL
FT                   SHVAVVTRANGDRLQKELKPGMRLVSKDGDLWRWDGFVARADAPRPAAVRLEQRTRLAE
FT                   VEAEIDVMAPRAEATTIALKAAADRLRAAEDLLRDKRRGPPDAERLLTQAREQVAKFER
FT                   EQALRAARAQSLDDTIGRFEAEKVEADAALGEAREAHAAAQTSGDLQPQLAEARQAAAQ
FT                   AREAAGAARTALDVETRERAGRQRRLESLERDRADWSKRAEAAAKRAESLEGDRVKAAA
FT                   ALEAAREAPAALQEKLVALLDEFAAAEARRAKASDALETAETTRLNADRAARAAEQAAG
FT                   EAREKRAALVAHLDGARQRFAEVASAIREQARMEPEELGRHVAGEAVAVPKDAAGVEAH
FT                   LFALERERDAIGPVNLRAEEEAQEYAGRLETMRSERADLSGAVTKLRAGIEELNAEGRE
FT                   RLLAAFDVINANFQTLFQALFGGGQAELKLIESDDPLEAGLEIFACPPGKRMASMSLMS
FT                   GGEQALTASALIFGVFLANPAPICVLDEVDAPLDDANVDRYCNMLDEMRRRTQTRFIAI
FT                   THNPVTMSRMDRLFGVTMAERGVSQLVSVDLSTAEKLVAA"
FT   gene            complement(395418..396026)
FT                   /locus_tag="CCNA_00378"
FT   CDS_pept        complement(395418..396026)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00378"
FT                   /product="thiol:disulfide interchange protein dsbA"
FT                   /note="CC_0374"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93845"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4F0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93845.1"
FT                   /translation="MTLDRRILIASGLALTAGPSVARARSLPPAPGDMVLGAATAPVQF
FT                   VVYASPSCGHCAHWWTTELPAIRKTFIDTGKVRLVFREFLTPPNEFAAAGFLLARRVPG
FT                   KYFEVLTTVFQKRETIFESGRLWEGLQAIAQQYGLTEAQFTTAMNDTKALDGVNTRFRR
FT                   AIGEDQVEVTPTFFVNGAPYEGEADLAALSKIFALAAKG"
FT   gene            complement(396026..396640)
FT                   /locus_tag="CCNA_00379"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(396026..396640)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00379"
FT                   /product="thiol:disulfide interchange protein dsbA"
FT                   /note="CC_0375"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93846"
FT                   /db_xref="GOA:A0A0H3C562"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C562"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93846.1"
FT                   /translation="MRSLLSRVTIVAALAASLAACSPKSAEVTAEDMVLGDPNAKVTVI
FT                   EYASVACPHCATWNAEVFPAFKAKYIDTGKVKYVHRDALTGEPRLANAGAMLARCAGKD
FT                   KYFQVTEALYRAQTNIFTSGDIRGELLTIAQAAGMNEAQFNSCLSDENAAKSAERIEKM
FT                   MTDNNIRGTPTFEVNGKRLGGEEGGEQTLAQLDAAIAEASK"
FT   gene            complement(396704..396827)
FT                   /locus_tag="CCNA_R0106"
FT   ncRNA           complement(396704..396827)
FT                   /locus_tag="CCNA_R0106"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(396879..397418)
FT                   /locus_tag="CCNA_00380"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(396879..397418)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00380"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="CC_0376"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93847"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="InterPro:IPR010593"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5R2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93847.1"
FT                   /translation="MRRPLPTPEEAIAILRSKRTKPQRRPPPPAGKNLAPLLKDLEDRF
FT                   GKGPAALQARWKEIVGDTLARRTEPVRIIKGRNGEGGALELRVDGPVASLIQHQAPQIT
FT                   ARLDMLLGKGVVTRLRIVQGPVKAPAAAPSTRLRRKPPLDAALEKQLADSLAEQPDGAL
FT                   KQALLKLGRGVLSSER"
FT   gene            397466..398515
FT                   /locus_tag="CCNA_00381"
FT   CDS_pept        397466..398515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00381"
FT                   /product="A/G-specific adenine DNA glycosylase"
FT                   /EC_number="3.2.2.-"
FT                   /note="CC_0377"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93848"
FT                   /db_xref="GOA:A0A0H3C6P6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR005760"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="InterPro:IPR029119"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6P6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93848.1"
FT                   /translation="MKDRDALRSALLAWYDAQARDLAWRVGPAERRAGVRSDPYRVWLS
FT                   EVMLQQTTVPHATPYFLSFTQRWPTVLDLAAVEDGDLMAAWAGLGYYARARNLLACARA
FT                   VANDHGGVFPGTEEGLRALPGVGAYTAAAVAAIAFDRAANVVDGNVERVMSRLFAVEAP
FT                   MPDSKPELKALAGDLVTDDRPGDWAQALMDLGATVCKPKGPLCDRCPVSLWCAAYVGGA
FT                   PETYPRKTKKADRPRRHGVAYVLTRGDEVALVRRPPKGLLGGMLGLPTSDWRTASYDDA
FT                   EAVAAAPLAAAWRDLGAVEHVFTHFSLTLRVFAADGANDGDFVWTPREGLGALPSVFLK
FT                   AAMAAQRLL"
FT   gene            complement(398637..399713)
FT                   /gene="ccrM"
FT                   /locus_tag="CCNA_00382"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(398637..399713)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ccrM"
FT                   /locus_tag="CCNA_00382"
FT                   /product="adenine-specific methyltransferase ccrM"
FT                   /EC_number="2.1.1.72"
FT                   /note="CC_0378"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93849"
FT                   /db_xref="GOA:B8GZ33"
FT                   /db_xref="InterPro:IPR001091"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR002941"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040843"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZ33"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93849.1"
FT                   /translation="MKFGPETIIHGDCIEQMNALPEKSVDLIFADPPYNLQLGGDLLRP
FT                   DNSKVDAVDDHWDQFESFAAYDKFTREWLKAARRVLKDDGAIWVIGSYHNIFRVGVAVQ
FT                   DLGFWILNDIVWRKSNPMPNFKGTRFANAHETLIWASKSQNAKRYTFNYDALKMANDEV
FT                   QMRSDWTIPLCTGEERIKGADGQKAHPTQKPEALLYRVILSTTKPGDVILDPFFGVGTT
FT                   GAAAKRLGRKFIGIEREAEYLEHAKARIAKVVPIAPEDLDVMGSKRAEPRVPFGTIVEA
FT                   GLLSPGDTLYCSKGTHVAKVRPDGSITVGDLSGSIHKIGALVQSAPACNGWTYWHFKTD
FT                   AGLAPIDVLRAQVRAGMN"
FT   gene            complement(399852..400487)
FT                   /locus_tag="CCNA_00383"
FT   CDS_pept        complement(399852..400487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00383"
FT                   /product="ribonuclease HII"
FT                   /EC_number="3.1.26.4"
FT                   /note="CC_0379"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93850"
FT                   /db_xref="GOA:B8GZ34"
FT                   /db_xref="InterPro:IPR001352"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR022898"
FT                   /db_xref="InterPro:IPR024567"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZ34"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93850.1"
FT                   /translation="MPPGPDMTLELACGQAPVCGVDEAGRGPWAGPVSAGAVILDPDRI
FT                   PKGLNDSKKLSAKARAALEEEIKDVAISWCVGLASIEEIAQLNILHAAGLAMRRAVEGL
FT                   AVTPAFALVDGNYAFKLPCPVKTVIKGDSLSCSIAAASILAKEARDRIMIEADALYPGY
FT                   GFAGHKGYHAKVHVEGLRRLGPSPIHRLGWAPVKAALAAAAVNGELDL"
FT   gene            400574..401479
FT                   /locus_tag="CCNA_00384"
FT   CDS_pept        400574..401479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00384"
FT                   /product="glucan endo-1,3-beta-glucosidase"
FT                   /EC_number="3.2.1.39"
FT                   /note="CC_0380"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93851"
FT                   /db_xref="GOA:A0A0H3C3G8"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3G8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93851.1"
FT                   /translation="MSRPLAVLAVCSALLAAGPVHARDDWKLVWSDEFNGTALDETKWT
FT                   PAIDCGGGGNDERQCYADSPETLSVQDGALRLTAIKRKTWGVVNPWAGPTGPLKAGDYA
FT                   SGKIVTQGKFSWRYGRVEARARVPGGQGAWPAIWMMPELSTYGGWPRSGEIDILETVNL
FT                   GAPCPPVGEACADGRENRVFGTIHFAGDATGAHKQVSASTPLPASPDGFHVYAVEWSPE
FT                   AIVWFLDGREYARAKPQDWKRDDQPASAAPFDQPFHLIINLAFGGRWPESVNAKGIDEA
FT                   ALPATMEVDWVRVSQLASQD"
FT   gene            401527..402861
FT                   /locus_tag="CCNA_00385"
FT   CDS_pept        401527..402861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00385"
FT                   /product="multidrug resistance protein"
FT                   /note="CC_0381"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93852"
FT                   /db_xref="GOA:A0A0H3C4F6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4F6"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93852.1"
FT                   /translation="METRFVTPFHHLLVNNLVANITNFTIWFALTFYVYLETKSVFATG
FT                   MIAGVYLVLTAACGIWFGSLVDHHRKKLAMAGSSLASLLLYALALAVLLLAPKGAIADV
FT                   GRPWLWALIGLSMLGVIAGNIRTIALPTLVTLLIPEDRRDKANGLVGMVSGVGFLTTSV
FT                   ISGFLVAWGGMLAALTFALGFTVAALVHLLTVPVDEPRVEAEHGAPVAPRRIDLAGTIK
FT                   VVAAVPGLFALILFATFNNFLGGIFMALLDAYGLSMVSVQAWGLLFGFLSVAFIISGLA
FT                   ISKTGLGKNPLRTLLLVNLISWAVCCVFPLKSSIVMLAMGCFVWMLLGPYAEAAEQTTL
FT                   QKVVPFERQGRVFGFAQSVEQAASPLTAFLIGPLTQFIVIPFMTHGAGAAAIGDWFGRG
FT                   PDRGMALVFTLAGVVGLIVTLLAFGSKAYRQLSAAYAQGEPAPAA"
FT   gene            complement(402858..403445)
FT                   /locus_tag="CCNA_00386"
FT   CDS_pept        complement(402858..403445)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00386"
FT                   /product="DNA-3-methyladenine glycosylase"
FT                   /EC_number="3.2.2.20"
FT                   /note="CC_0382"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93853"
FT                   /db_xref="GOA:A0A0H3C566"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C566"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93853.1"
FT                   /translation="MNYIARCTWKGMNGDPFYEAYHDTEWGVPEWDSRALWEKLVLDGF
FT                   QAGLSWITILRKREAFRAAFANFDPEKVARFDETDRARLMADAGIIRSNGKIDATIAGA
FT                   RLYLDMRERGEDFGQFLWDMVGGAPIQNQWEAGQVPAQTPLAVEMSKALKAKGFKFCGP
FT                   VIVYAFMQATGLVNDHLVSCFRHEDCKALGRH"
FT   gene            403575..403997
FT                   /locus_tag="CCNA_00387"
FT   CDS_pept        403575..403997
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00387"
FT                   /product="hypothetical protein"
FT                   /note="CC_0383"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93854"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5R7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93854.2"
FT                   /translation="MKRLKTFAMLALATTALATTPALALYRDRDHNPPGPRGGPGTNWE
FT                   NPPGWRGGPGVSPDRRYYRWNGQRVEFRYRDGYYYNHAYGYYRPGFGWWNQAGKCWFDN
FT                   DRNPPGPRGGSGTNWENPPGWRGGPGASPDRYGRCR"
FT   mobile_element  complement(403995..404111)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            complement(404125..405006)
FT                   /locus_tag="CCNA_00388"
FT   CDS_pept        complement(404125..405006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00388"
FT                   /product="esterase lipase Family protein"
FT                   /EC_number="3.1.1.-"
FT                   /note="CC_0384"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93855"
FT                   /db_xref="GOA:A0A0H3C6Q2"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6Q2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93855.1"
FT                   /translation="MNRRKILGAGALLAVAAMAGPVLAASADRFSVKVRGKGPDVILIP
FT                   GLSSSPEIWESTAQALEGRYRVHLVHVAGFAGAPTAGNADGKVAAGVAEGLAGYIQAKG
FT                   LKSPAVMGHSMGGTIGMMLAARSPGLVGKLMVVDMFPNLAVAYFGPGQSPESVAQRAAG
FT                   FRAQIADAPAEAFKAMQEQVMVGMVRTESARAAIVKHSLDSDRQVAGRAMEELLTTDLT
FT                   PELAKITAPTTVVWAWNSSMPAPAAMFSGWYQGAYGPLKGAKVVRIDDAAHFIMIDQPA
FT                   KFMAEVESFLAG"
FT   gene            complement(405104..405895)
FT                   /locus_tag="CCNA_00389"
FT   CDS_pept        complement(405104..405895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00389"
FT                   /product="aminomethyltransferase family protein"
FT                   /note="CC_0385"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93856"
FT                   /db_xref="GOA:A0A0H3C3H4"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR017703"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3H4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93856.2"
FT                   /translation="MTAPCLARLASRAVIAVSGPDWRSFLQGLLTQDVETLAVGELRFA
FT                   GLLTPQGKLLYDLFVAGAEDGALLDVAAAHRDAILTRLSMYRLRAKVELVASDRPVIAV
FT                   FGGATSGEGLYADPRLPALGARAYDDRATNADEDVYEAHRLALGVPGPTDWGSEATYPI
FT                   EANFDLLAGIDFKKGCFVGQETTSRMKRRGTIKNRMLPITFDGPPPPFGAEVLAGELRA
FT                   GEVLSGRDGQAMALLRLDRIEGVALTVEGRPVRVERPDWVA"
FT   gene            405999..407213
FT                   /locus_tag="CCNA_00390"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        405999..407213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00390"
FT                   /product="ADP-heptose--LPS heptosyltransferase"
FT                   /EC_number="2.-.-.-"
FT                   /note="CC_0386"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93857"
FT                   /db_xref="GOA:A0A0H3C4G4"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4G4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93857.1"
FT                   /translation="MTQRAFPILFITATRIGDAVLSSGLIKMLADQIPNARFTIVAGPL
FT                   AAPLFAHVPGLDRVIVMEKGKGKGHWFKLWRQVRHKKWSLIVDLRGSATALFLRRDKRA
FT                   IWKKVPGEVVHKVVDAARTLKLEGDPPPPYLYITPEVQALADELLGLTEGGETGPILAV
FT                   GPAANWIGKVWPIERFTQTAAQLLDKDGPMAGGRLLILGGPEDTRMVEELRMASARGRT
FT                   IDLTGKVDLLTAYACLKRASLFIGNDSGLMHIAAAAGTPTVGLFGPSDERRYAPWGEHA
FT                   VAVRGPRSFDQFLTIDPELSQAIRHMSDLPVTTVFKAAKDLLAKVSGTVPSIVSDAVSE
FT                   AEIVGSTPPAEPEAMAQTTVDPIEAAPTDALSDPADEGEAKRPIEDAVEPLKTQRRAAR
FT                   PRKAR"
FT   gene            407210..407767
FT                   /locus_tag="CCNA_00391"
FT   CDS_pept        407210..407767
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00391"
FT                   /product="hypothetical protein"
FT                   /note="CC_0387"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93858"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C573"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93858.1"
FT                   /translation="MKAVVALCALIVLAPGAAFAGAPGEQFFERLSALCGKTFVGQVAA
FT                   GDAADEAFRKAELVMTVAHCDARQIRIPFRVGEDRSRTWIITRLDDGRLRLKHDHRHPD
FT                   GVEDELSRYGGDTVAPGSADLQRFPVDEESKALFTRLNRTVSNTNVWALGLTDSAFTYE
FT                   LSRPNRLFRVAFDLTRPAPSGP"
FT   gene            407848..409182
FT                   /locus_tag="CCNA_00392"
FT   CDS_pept        407848..409182
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00392"
FT                   /product="dihydroorotase"
FT                   /EC_number="3.5.2.3"
FT                   /note="CC_0388"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93859"
FT                   /db_xref="GOA:A0A0H3C5S1"
FT                   /db_xref="InterPro:IPR002195"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5S1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93859.1"
FT                   /translation="MTQTFDLIVRGGEVVNHAGRDFTDIGVRGGKIVAIGDLSQASAGE
FT                   VFDATGLTVLPGVIDSQVHFREPGLEWKEDLESGSRGAALGGVTAVFEMPNTEPTTTDP
FT                   DALADKLARAKNRMHTDHAFYVGGTHANATFLGELERLPGCCGIKVFMGASTGSLLVHD
FT                   DEGVENVLRHVNRRAAFHSEDEYRLAERRGLARPGDWTSHPEVRDAQAALQSTHRLVRI
FT                   AKGLGKRIHVLHVTTKEEIDFLAQNKDVASVEVTPQHLTLVAPEAYERLKGFAQMNPPI
FT                   READHVAGIWRGIDTGVADVIGSDHAPHTREEKARPYPASPSGMPGVQTLVPIMLTHVV
FT                   DGKLTLERFVDLTSHGVNRIFGLADKGRIAEGFDADFTIVDMKARRVITHDWMATRSGW
FT                   TPFDGFEAKAWPVATIVRGIVVMRDDEIIAEGKGEPVRFLETLAG"
FT   gene            complement(409326..410552)
FT                   /locus_tag="CCNA_00393"
FT   CDS_pept        complement(409326..410552)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00393"
FT                   /product="RNA polymerase sigma factor"
FT                   /note="CC_0389"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93860"
FT                   /db_xref="GOA:A0A0H3C6Q7"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6Q7"
FT                   /protein_id="ACL93860.1"
FT                   /translation="MSPLDQTARRDGGRIVAALAAAFRDLDLAEEAYAEACARAAAVWP
FT                   AAPPLDPAAWLYATARRCALDMFRRRNVRRRATLERPEPQPSAEDVLTSDDRLIPDERL
FT                   RLIFVCCHPAVAPESRAALTLRLVCGLSVAEIARAFLVAEPAMFQRLTRAKKKIAEAGV
FT                   SFEVPGPQAWPERMAAVLSTLEVAYARAHEDAAGSGPHAGYAREMLDLTSVLADLLPGE
FT                   PEALAFAALVRFAEARRPARLDADGAMIPLAEQDPKRWNRALISDGDMLLRRAARLNRP
FT                   GPRQLRAALHGAWALRRSLAEPPPWETLLALYDLLLDAGDDPFVRLNRAVVLAEVAGPA
FT                   AALAEVEALDADRLEGFQPYHAVRADLLARLGRVEEASSAYDRALEMAPGAAERLWLIR
FT                   RRSFMASAN"
FT   gene            complement(410549..410899)
FT                   /locus_tag="CCNA_00394"
FT   CDS_pept        complement(410549..410899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00394"
FT                   /product="YCII-related domain protein"
FT                   /note="CC_0390"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93861"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3I1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93861.2"
FT                   /translation="MQYALLLYENEAVYAEEGAMSLEAIIAAHNAFAADLAQQGVLRGG
FT                   QGLKSSDTATTLRKSRGAETLHDGPYAEAREQLGGFYVIDVPDLDAALAIAKRIPFAGD
FT                   GAVEVRPIIDED"
FT   gene            411052..412842
FT                   /locus_tag="CCNA_00395"
FT   CDS_pept        411052..412842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00395"
FT                   /product="feruloyl-CoA synthetase"
FT                   /EC_number="6.2.1.34"
FT                   /note="CC_0391"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93862"
FT                   /db_xref="GOA:A0A0H3C4G9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4G9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93862.1"
FT                   /translation="MDGSTLDTAPFRDARYAPRALEVERQGQTLILRNPMPYSDAVRTT
FT                   TAPLARWAAQAPDRVWLAERDGEGWRTVTYADAKAQVEALAGGLQGLGLRRGQPLLILA
FT                   RNGVDHARIAYAAMSLGAPAAPVSPQYGLKGADLTRLQHAVERLKPAAVYADDAEAFGD
FT                   ALAAPFLAGLPVVVSRNARPGDVAFEALLKSPPLAPQAQPDDVAKLLLTSGSTGKPKAV
FT                   VCTHANIALNAAQIEACYADPDPPVLVNSAPWSHSLGANAILHMVLHRGGTLYIDAGQP
FT                   VPGRFGETVRNLSEVATTYHNMVPAGWAMFVGELERDEALAARFFEKVRVLQYGGASMA
FT                   QSILDRVQAVAVRTVGERITFAAGYGATETGPTACNIHWLNARSGMVGLPTPGTAVKLV
FT                   PAGEGGKFEIRVKGPQVSPGYLDQPEATAQAFDEDGFYRLGDAARLADPEDPAAGLVFD
FT                   GRLVENFKLASGTFVAAGALRVAAVSAIGGVVSDAVVCGEGQEGVGLMLFLDAKAVERL
FT                   GSPEAVRAAIVEALSRMNAAAKGGGGRIARALILDGAPDAASGELTDKGYINQALARDR
FT                   RPKELERLFAETPDEGVMVF"
FT   gene            complement(412933..413610)
FT                   /locus_tag="CCNA_00396"
FT   CDS_pept        complement(412933..413610)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00396"
FT                   /product="hypothetical protein"
FT                   /note="CC_0392"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93863"
FT                   /db_xref="GOA:A0A0H3C580"
FT                   /db_xref="InterPro:IPR012506"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C580"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93863.1"
FT                   /translation="MSGMSAAARWTLIASVIAGVSYVASWGLTLPPGVETAWKGAGVGL
FT                   LAIHAALRARSLDGWLLAAVMALGTGGDVLLETHGLTVGAISFLLGHVVASGLYLRHRN
FT                   AVSLAPLALIPVVVAVSFLLPTDRAGAPGIALYSLFLAVMAAMALMSRFPFKTVGLGAL
FT                   MFVVSDLLIFGRLGPLPDNLATGLGVWGLYYFGQLLICLGVAGALAHPSTDLPGEGRGP
FT                   DSA"
FT   gene            413741..415279
FT                   /locus_tag="CCNA_00397"
FT   CDS_pept        413741..415279
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00397"
FT                   /product="acetolactate synthase"
FT                   /EC_number="2.2.1.6"
FT                   /note="CC_0393"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93864"
FT                   /db_xref="GOA:A0A0H3C5S6"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5S6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93864.1"
FT                   /translation="MNGADALITTLADNGVTACFANPGTSEMQFVSALDREPRMRSVLC
FT                   LFEGVATGAADGYGRMAGKPACTLLHLGPGYANGAANLHNARRAFTPVVNVIGDHATYH
FT                   RDFDAPLNSDIAALAAPNSVWVKSAETADSVGPLAAEAIIAAYGTPGGNACLVLPADAA
FT                   WNEATVKGPMVTPPAFAAPDAASVEAVAKALGGATKPVLLLGSGACGEAALAAAGRLAA
FT                   HGVRVLTDTFTARQARGEGRFRPDKLPYFGELALKDLDGVDLIVLVATQTPVAFFAYPD
FT                   RPSVLVPEGCSVETLCGREVDAAAALNALADALGAPAAGPVETYAAPDAPAGRLDAWAI
FT                   GAAIARHMPTDTIISDDAVTAGLPIFTQTKAARAHDWLSLTGGAIGQGIPLAIGAAVAC
FT                   PDRKVLALTGDGAGMYTVQGLWTVVREKLDVTVVVFANHAYRILGIELGRTGAGNPGPA
FT                   AAKLLDLGDPRIDWVKLAEGLGMAAERVATAEAFEEAFARAMATPGPRLIEAAM"
FT   gene            complement(415406..416764)
FT                   /locus_tag="CCNA_00398"
FT   CDS_pept        complement(415406..416764)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00398"
FT                   /product="hypothetical protein"
FT                   /note="CC_0394"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93865"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6R0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93865.2"
FT                   /translation="MYPMRPFAIGLTAALAVAVLVPSAVISAQKEQKGKPAIDAKAREA
FT                   GMKEAPAIMQASGASCTVSDARYIGEDKKAGAKYFEVACNEGMGFALVAKKDTAPQVYS
FT                   CLESSQPGPDGKVGGLACILPGNANPGAGLDAYVKKGGASCEIENTRAIGTGAKNSYFE
FT                   VACKGGAGYVVQTTAPMNIGGEVAVNSCLLYEEGGNVSCKLTNRQTQLQIVDTLNTAAA
FT                   AAGTKCAIKDKRYVLSTKADNYFEVACDDGKGYIYQQTSATGAFNRAIPCAQAGFVGGG
FT                   CTMTDAVAAQTEQAGFYSKLAGKAGFTCDVEKYGLLPTNDPKKEIVELKCKGSDVGGIA
FT                   VFTATDGKVFDCLTAEMNGFRCSFTKKDTQYARLTKDLIGFNKASCQVSDARIIGSTDT
FT                   EGFIEVACSDGLPGWVLGYPIGVAKPAAKEFLSCTQAKGIGGGCKLPTNKPKA"
FT   gene            416919..418016
FT                   /locus_tag="CCNA_00399"
FT   CDS_pept        416919..418016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00399"
FT                   /product="zinc metallohydrolase, glyoxalase II family"
FT                   /note="CC_0395"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93866"
FT                   /db_xref="GOA:A0A0H3C3I8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3I8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93866.2"
FT                   /translation="MRDGFEDDTTESVSEPKKAGRLVYPFETAPEQGSGQAVEVAPGVL
FT                   WLRMPLGGSLQFINVWAIEDGEGWAVVDTGVQTRETSQAWRAAFAEALGGKPITRVIVT
FT                   HLHPDHIGLAGWMTRKFDCRLWMTRLEYFQCRMLVADTGREAPEDGVRFFRAAGWDEDA
FT                   IENYKARFGGFGKAIYALPDSYRRLSDGEDFDIGGRTWRVVTGQGHSPDHACLWCPELN
FT                   LLISGDQVLPRISSNVSVFPTEPDADPLSDWLRSLAKVKATVPDEVIVLPAHNDPFEGL
FT                   HTRIDALISGHERGLARLEKKLSERKRVVDTFGALFARPIGPDLLGMATGEALAHLNCL
FT                   IRRGRVKREVDGDGVAWYAANSSEA"
FT   gene            418061..418504
FT                   /locus_tag="CCNA_00400"
FT   CDS_pept        418061..418504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00400"
FT                   /product="MarR/EmrR-family transcriptional regulator"
FT                   /note="CC_0396"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93867"
FT                   /db_xref="GOA:A0A0H3C4H6"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4H6"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93867.1"
FT                   /translation="MSTPPNRRLVFLLNAGHRRVQRWIEGRMAAEGGLTAAQSGVLFFL
FT                   GERDGALIGEAADALDLAPSAMTGLIDRMARAELVERRADAKDGRAMHLHLTDKGRAAR
FT                   DTAKAGLRGVNAQLTEGFTDEEISVVSRWLASLQTKFPKGDPQ"
FT   gene            418501..419271
FT                   /locus_tag="CCNA_00401"
FT   CDS_pept        418501..419271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00401"
FT                   /product="enoyl-CoA hydratase"
FT                   /EC_number="5.3.3.8"
FT                   /note="CC_0397"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93868"
FT                   /db_xref="GOA:A0A0H3C585"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C585"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93868.1"
FT                   /translation="MTDHVTVQIDAGVMTLTLARPEKKNALSNAMYGVLADSLEAAEKD
FT                   PTIRVVVFQGDGDSFTAGNDLQDFAAQATGAFSGERHVTRFLKALANATRPLVAAVQGQ
FT                   AVGVGTTMLLHCDLVFVSPDARLTTPFVNLALVPEAASSWLLPARVGHARAYAMFALGE
FT                   AVDGATAVAWGLANALVEQGDLRARARAAADQLAKRPLGALTVTKRLMRDAEKIAQLMD
FT                   TEGAEFAARLQTAEAREAFMAFAERRAPDFSKAG"
FT   gene            419275..419691
FT                   /locus_tag="CCNA_00402"
FT   CDS_pept        419275..419691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00402"
FT                   /product="conserved hypothetical membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93869"
FT                   /db_xref="GOA:A0A0H3C5T1"
FT                   /db_xref="InterPro:IPR025058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5T1"
FT                   /protein_id="ACL93869.1"
FT                   /translation="MLLTLLLTGVFFLLAGVHLYWAFGGRWPGHDEASLVEHVVGRTRD
FT                   MKAPSLLACVAVALALLAGGALVLASVWPPTPLEPWLDAGRWALFAVFAARGAATYVPR
FT                   IFRYAEGTPFWRLNRRAYGPLCLAIALGICAIQM"
FT   gene            419728..420699
FT                   /locus_tag="CCNA_00403"
FT   CDS_pept        419728..420699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00403"
FT                   /product="short chain dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="CC_0398"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93870"
FT                   /db_xref="GOA:A0A0H3C6R5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6R5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93870.1"
FT                   /translation="MSGRITSAFGAKSTAREVVAGHDLSGRVAIVTGAATGIGVETARA
FT                   LALAGAEVIIAARKPELGEEVANAINEEAGSKRVSFGMLDLSSLEAIRHFVNVWGDRRI
FT                   DILINNAAVMASPLMRTADGFEMQFGTNHLGHFLLSVLLAPNLIAGAKASGKPSRLVSL
FT                   SSIGHRRSGIHFDDPNYTTRPYEKWEAYGQAKTANSLFAVGFDKRFKDQGVHANAVMPG
FT                   GILTPLQRHLPIEEQRALGWLDENDQPREGFKTTEQGAATSVWAAVGSELEGVGGLYLE
FT                   DCNQALPWSKENPWTGVMPHALDPEAADRLWDLSVDIVGAGA"
FT   gene            420699..421214
FT                   /locus_tag="CCNA_00404"
FT   CDS_pept        420699..421214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00404"
FT                   /product="hypothetical protein"
FT                   /note="CC_0399"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93871"
FT                   /db_xref="GOA:A0A0H3C3J4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3J4"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93871.1"
FT                   /translation="MERATTLRLAGVAVLLGVAIDVVAPFLIYPRLVEPQPHLVYTLID
FT                   LLLLIGMLGARALTARATGPLGLAGFVLAILGVLLVRTSPAEVFGEASYMIASAIWSIG
FT                   MVVWAMDLLRARVLRLAAGLWIAALVVGLVGLALKDHGPVAHMAKMAFLLGFAVVGVQL
FT                   FKTRGDPA"
FT   gene            421211..422068
FT                   /locus_tag="CCNA_00405"
FT   CDS_pept        421211..422068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00405"
FT                   /product="short chain dehydrogenase"
FT                   /EC_number="1.-.-.-"
FT                   /note="CC_0400"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93872"
FT                   /db_xref="GOA:A0A0H3C4I2"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4I2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93872.1"
FT                   /translation="MSLKNKTLFVTGASRGIGLAIAVRAARDGANVVIAAKTAEAHPKL
FT                   PGTIYTAAKEIEDAGGKALPLVVDVREESSVQEAVDKAVAQFGGIDICVNNASAISLTP
FT                   TLMTDMKRYDLMHQINTRGTFLTSKACIPHLKNAENPHVLMLSPPLDMSPRWFGSHVAY
FT                   TMAKFGMSMCVLGMAEEFKPDGIAFNALWPRTGIATAAIQFALTGEEGLRHCRTPEIMA
FT                   DAAYGIFNKPSRDFSGNFLIDDTFLYGEGVRDFDHYKVDPTASLMPDFFVPESSEPPPG
FT                   VKIG"
FT   gene            422074..422176
FT                   /locus_tag="CCNA_R0107"
FT   ncRNA           422074..422176
FT                   /locus_tag="CCNA_R0107"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            complement(422170..422538)
FT                   /gene="tfoX"
FT                   /locus_tag="CCNA_00406"
FT   CDS_pept        complement(422170..422538)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tfoX"
FT                   /locus_tag="CCNA_00406"
FT                   /product="DNA transformation protein tfoX"
FT                   /note="CC_0401"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93873"
FT                   /db_xref="InterPro:IPR007076"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C591"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93873.2"
FT                   /translation="MTVMAVSNDYRDFVLELLAPLGQVSARRMFGGVGIYANGLFFALI
FT                   ADDVLYLKGDEDLKVAFEAVGSQAFAPFEDGKTMAYWTAPAEALDDQDLLLDWARKSLA
FT                   VAARKQKPSPKGRGRGPR"
FT   gene            422528..423007
FT                   /locus_tag="CCNA_00407"
FT   CDS_pept        422528..423007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00407"
FT                   /product="acetyltransferase"
FT                   /EC_number="2.3.1.57"
FT                   /note="CC_0402"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93874"
FT                   /db_xref="GOA:A0A0H3C5T4"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5T4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93874.2"
FT                   /translation="MTVTVRPATPADAGLIHQFILDLAEYEKLLDTVQATPADTAAALF
FT                   GEKARAFADIAEIDGQPMGFALWFYNYSTFVGRHGIYLEDLFVRPSARGSGAGKALLAN
FT                   LAKRCLDEGLGRLEWTVLDWNAPSIAFYDSLDAAAMDEWIIRRMTGEALRKLAGV"
FT   gene            complement(423040..424308)
FT                   /locus_tag="CCNA_00408"
FT   CDS_pept        complement(423040..424308)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00408"
FT                   /product="antiporter protein"
FT                   /note="CC_0403"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93875"
FT                   /db_xref="GOA:A0A0H3C6S0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6S0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93875.2"
FT                   /translation="MSDTAAPPSEPALENPTRALLRERDFLLFWAARFVSTLGVQIQSV
FT                   ALGWQVYAIARMTKSVGESAFLVSMIGLAQFLPLFLLTLVAGETADRRTRKLIVAATLA
FT                   LDAISAGVLLVLALMGSHQLWPIFAISVLFGASRAFLSPASSAMGPMLVPRPLLPRAIA
FT                   WNSLSWQAGSIGGPALGGLLLIHSPALAFGASFGLYLVAALLALSIRKPTKPEPQPGSR
FT                   VELIKEGLSYVWNNKIVFGSISLDLFAVILGGATALLPVFAKDVLHIGPGGFGLLRAAP
FT                   AIGACLVGLYLAANPIRRHAGKIMFAGVAVFGLATVVFGLSKLVWLSVAALAVLGGADM
FT                   LSVYVRQTLVQIVTPDAMRGRVAAVSGVFISASNELGEVESGAAAWLLGPIGAAVFGGV
FT                   GAMAVTAIWAFLFPELRKADRLE"
FT   gene            424406..424450
FT                   /locus_tag="CCNA_00409"
FT   CDS_pept        424406..424450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00409"
FT                   /product="hypothetical protein"
FT                   /note="CC_0404"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93876"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3K0"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93876.2"
FT                   /translation="MRRLRRMKRERATI"
FT   gene            424513..425043
FT                   /locus_tag="CCNA_00410"
FT   CDS_pept        424513..425043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00410"
FT                   /product="acetyltransferase"
FT                   /EC_number="2.3.1.-"
FT                   /note="CC_0405"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93877"
FT                   /db_xref="GOA:A0A0H3C4I8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4I8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93877.1"
FT                   /translation="MTSVQKSVSPEPYPPLVIETPAMEAAVTALIDRVFGPGRFAKSSE
FT                   RLREGNTLLADCSFVSLRDGAPVGCVRMWPVTIGGEPVAFLGPLAVDPDERSAGLGQAL
FT                   VEAACEAARAAGWRAVLLVGDGPYFGRVGFTNAHTAGVIMPGPVDQRRVLLLPLRDGGD
FT                   QGLSGPVAVDPRA"
FT   gene            425076..425639
FT                   /locus_tag="CCNA_00411"
FT   CDS_pept        425076..425639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00411"
FT                   /product="hypothetical protein"
FT                   /note="CC_0406"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93878"
FT                   /db_xref="InterPro:IPR010707"
FT                   /db_xref="InterPro:IPR023361"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C596"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93878.1"
FT                   /translation="MTDTPFKSGLDGVAQSVKAAGERGLPPVHLWNPPHCGEIDIRIRK
FT                   DGVWFHEGTPIGREALVRLFSTVLRLDPDGYHLVTPVEKMKITVEDAPFIAVRVDREGE
FT                   DLVFQTNVGDTVTAGADNPIRVTIDQETGEPRPYVHVRRGLEALIARSVFYELAETAVE
FT                   EDGVWGVRSGGAFFPIAAPGKGLA"
FT   gene            425636..426286
FT                   /locus_tag="CCNA_00412"
FT   CDS_pept        425636..426286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00412"
FT                   /product="CoA pyrophosphatase"
FT                   /EC_number="3.6.1.-"
FT                   /note="CC_0407"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93879"
FT                   /db_xref="GOA:A0A0H3C5T9"
FT                   /db_xref="InterPro:IPR000059"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5T9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93879.1"
FT                   /translation="MTREERRAWITSRLHPIAGYDPSLANPLRSDFDLNPGLKVDNPHA
FT                   LRPAAVLVGLVEHDDGPTILLTRRADTLRSHTGQIAFPGGRCDPGETPWGTALREAQEE
FT                   VGLDPALVTVAGLLHGYQTVTGFHVTPVVGFIDPKATFTPSPEEVADVFETPFDFLMDP
FT                   ANHQRQHREVPGGPRRHFYAMPWNDRFIWGATAGMLRSLYEALHDETGLAPSE"
FT   gene            426379..427632
FT                   /locus_tag="CCNA_00413"
FT   CDS_pept        426379..427632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00413"
FT                   /product="poly(A) polymerase/tRNA-nucleotidyltransferase"
FT                   /EC_number="2.7.7.19"
FT                   /note="CC_0408"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93880"
FT                   /db_xref="GOA:A0A0H3C6S6"
FT                   /db_xref="InterPro:IPR002646"
FT                   /db_xref="InterPro:IPR032828"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6S6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93880.2"
FT                   /translation="MSSEMIGNAPWIALPETKAVIAALEARGYAGCARFVGGCVRNTLM
FT                   GKPVDDIDIATTLTPDLVIDALEQAGLRAIPTGVDHGTITAVSGGRPYEITTLRKDVST
FT                   DGRRAVVAFTQDWNQDAERRDFRFNALYADTDGRVYDPTGEGIRDAHEGRVVFVGDPMT
FT                   RIREDYLRILRFFRFQAWYGRGEPDQKGLAACKALKGMVSGRAAERTQKELMKMLAADD
FT                   PRPAFRLMAATSVLSSILPSVKSLARFEALVGIETEQLFENDPDLRLAALIPDDPKVAE
FT                   QLAERLRLPNNVRDRLVEAVGKNPRVVSWMSPREARRAVYGLGTRTFCDRIKLAWAGSG
FT                   RDSTAPQWRALLALAETWNPPAFPLSGEEVMKAGVPKGPMVGEVMREIELWWIDQDFIE
FT                   DKFSAIERLKAVAQGMVY"
FT   gene            427653..428354
FT                   /locus_tag="CCNA_00414"
FT   CDS_pept        427653..428354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00414"
FT                   /product="type 1 glutamine amidotransferase (GATase1)
FT                   domain protein"
FT                   /EC_number="6.3.5.2"
FT                   /note="CC_0409"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93881"
FT                   /db_xref="GOA:A0A0H3C3K7"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3K7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93881.1"
FT                   /translation="MKIGLLETGEPPGPLKATYGGYGSMFETLLGDGHAYRAYDVQRGE
FT                   LPAHPAENDAYVITGSSAGVYDPLPWIEPLKAFLRSARGETPLVGVCFGHQIMAEAFGG
FT                   KVEKSPKGWGVGLQAYAVAERAVWMDDAAEVAVPGSHQDQVVDLPPTARVLAGSAFTPY
FT                   GILAYDDAPAISMQFHPEFAPDYAKALIEARRGTRYTDPQADAAIASLDSPNDRARMAD
FT                   WIRRFLAQASS"
FT   gene            complement(428613..429584)
FT                   /locus_tag="CCNA_00415"
FT   CDS_pept        complement(428613..429584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00415"
FT                   /product="hypothetical protein"
FT                   /note="CC_0410"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93882"
FT                   /db_xref="GOA:A0A0H3C4J4"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4J4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93882.2"
FT                   /translation="MGDAMLARLVGIILGLILASSGYVVAGWGSLGTWATTLDLGPFEP
FT                   HRPAVGVAAAIVGGVLIVAALLPRPKRKPRKTAPATLGLELPDEAAPSASLVAAAAAPA
FT                   APVATPVSHTAPAAPAAAPVAPPRTFAEMRARLITLSREDSWGECARLLAAMKRAAHTD
FT                   EELAIVHRDLGDFARAQGQLDEAGEAYETAVAYARQVRQTRPTDASTDLLAGALSGVGD
FT                   VAEAEGRLDAALSAFEEALALRRSRGAREANDPNAQRALSVNLERLADLREDRGHRMRA
FT                   LDLYRESYDIAGRLAAADPARFGPDLAATRARLSELEARIST"
FT   gene            complement(429725..430123)
FT                   /locus_tag="CCNA_00416"
FT   CDS_pept        complement(429725..430123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00416"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="CC_0411"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93883"
FT                   /db_xref="GOA:A0A0H3C5A2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5A2"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93883.1"
FT                   /translation="MSDTAVAPRAEEDKILPAVVYGLYLLGFTNGLTFFVGLIVAYVNR
FT                   DAAGPINASHYTFAIRTFWLAIAWFLIGLLLTIFGAPLSLLLVGIPVLLAGIAIMGAVG
FT                   VWFVVRCVLGIYYLVRGEAYPRPRSWLI"
FT   gene            complement(430127..430498)
FT                   /locus_tag="CCNA_00417"
FT   CDS_pept        complement(430127..430498)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00417"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="CC_0412"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93884"
FT                   /db_xref="GOA:A0A0H3C5U4"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5U4"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93884.2"
FT                   /translation="MTDPTPDTAVPPTLQDDKALPIAIYALHIGGAVTGGFTCLIAAIL
FT                   AYISRKGAPDWLASHYEFQIRTFWLALLFSLISLLLTAVGIGVVMLVAVGLWVIVRAVV
FT                   GLSHLLKGQPYPTPKNWML"
FT   gene            430733..431269
FT                   /locus_tag="CCNA_00419"
FT   CDS_pept        430733..431269
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00419"
FT                   /product="fasciclin domain cell surface protein"
FT                   /note="CC_0414"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93886"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6U7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93886.1"
FT                   /translation="MMRSMQRRAAVLALAAAAVAGPALAEHHGAKQNIVGVAAGNADFS
FT                   TLVTAVTAADLVGTLSGAGPFTVFAPTNAAFAKLPPGTVQTLVKPENKATLSKILTCHV
FT                   VAGKVTAKTLTDAIQKHGGSYTINTVGGCQFKAAISGGKVVITDEKGGKSAVTATDVAA
FT                   SNGVIHVIDSVLMPR"
FT   gene            complement(431334..431885)
FT                   /locus_tag="CCNA_00420"
FT   CDS_pept        complement(431334..431885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00420"
FT                   /product="hypothetical protein"
FT                   /note="CC_0415"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93887"
FT                   /db_xref="GOA:A0A0H3C3P2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3P2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93887.1"
FT                   /translation="MTMITFSARLAPFQPETVWTLEAGTLIETRGRIERRFPLSSLTRY
FT                   SLSLAPDGRRRVLLVVFGRRRLLIPSQSYVGPGRFEDRLAAFSVLARALAAVGADLSPR
FT                   ARFGLARLEARTALTFVMGLLAFGAASTLLFSLTAGMVAVGVDLAARMAFVLILMVAAL
FT                   PWLARPADFDPRDPPADLLP"
FT   gene            complement(431882..432286)
FT                   /locus_tag="CCNA_00421"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(431882..432286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00421"
FT                   /product="dihydroneopterin aldolase"
FT                   /EC_number="4.1.2.25"
FT                   /note="CC_0416"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93888"
FT                   /db_xref="GOA:A0A0H3C4M3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4M3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93888.2"
FT                   /translation="MAASPLADPAPAADTARIIVTKVFVRGLKVDAQIGVYDHEHGRLQ
FT                   PLVVDVELDVAASHCERLGDTVNYEMVGEAARALVAEGHIDLVETFAERLAQACFADPR
FT                   VTRARVRVEKPLALAPHAAAAGVEITAVRA"
FT   gene            complement(432336..433088)
FT                   /locus_tag="CCNA_00422"
FT   CDS_pept        complement(432336..433088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00422"
FT                   /product="SDR pteridine reductase"
FT                   /EC_number="1.1.1.100"
FT                   /note="CC_0417"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93889"
FT                   /db_xref="GOA:A0A0H3C5D6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5D6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93889.1"
FT                   /translation="MTSRGAALVTGAGRRIGQVLALEAARAGYDVAIHYRASADEAEET
FT                   ARAVRDLDRRALLVRADLSDEDETRSLVAQAAPLGPLTLLINNASAFEDDRVGGLSRAS
FT                   WDRHLETNLRAPIVLAEAMAAALPADRQGLVVNLIDQRVWRPNPQFFSYTLSKAGLWWA
FT                   TQTLAQALAPRIRVNAIGPGPTLPSVHQAPGEFEAEAAGVLLQRRASPEEVAAALRYLI
FT                   DASSVTGQMIAVDGGQHLGWKTPDIVAP"
FT   gene            complement(433090..433170)
FT                   /locus_tag="CCNA_03919"
FT   CDS_pept        complement(433090..433170)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03919"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03919"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88521"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IXL7"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88521.1"
FT                   /translation="MIAIGIIALFLAVIMGLNLTEFGRID"
FT   gene            433404..433874
FT                   /locus_tag="CCNA_00423"
FT   CDS_pept        433404..433874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00423"
FT                   /product="phosphohydrolase, MutT-nudix family"
FT                   /note="CC_0418"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93890"
FT                   /db_xref="GOA:A0A0H3C5V5"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="InterPro:IPR020476"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5V5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93890.1"
FT                   /translation="MLWRRRIEPFTRPLVYAWFRLARGLTLGVRAVVTDADGKVLLIQH
FT                   TYVKGWYLPGGGVERGETAETAVIRELAEEAGVRALSRPRLVSAHSNEVLHPGDHVLLY
FT                   RVDAWELCASNAAGEIHAVGWFDPHDLPEETTRATRKRIAEALHGDETDPMW"
FT   gene            434121..435560
FT                   /locus_tag="CCNA_00424"
FT   CDS_pept        434121..435560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00424"
FT                   /product="aldehyde dehydrogenase"
FT                   /EC_number="1.2.1.3"
FT                   /note="CC_0419"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93891"
FT                   /db_xref="GOA:A0A0H3C6U9"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6U9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93891.1"
FT                   /translation="MREYTKFYIDGAWVDPAAPNTLDVINPATEEVCGVISMGSEADVD
FT                   KAVRAARKAFASFSQTSREERIDILERIIAEYQKRFEDMAKAITEEMGAPAWLAQRAQA
FT                   AMGIGHVQTAAAVLKGYKFEEDRGTTRIVKEPIGVCAFITPWNWPVNQIACKVGPAIAT
FT                   GCTMVLKPSEIAPFSGYIWTEIMHAAGVPAGVFNLVNGDGPTVGAALSRHPEVDMVSFT
FT                   GSTRAGIEVAKNAAPTVKRVHQELGGKSPNIILDDADFSRAVAGGVASVMMNSGQSCNA
FT                   PTRMLVPGARMDEVIAIAKAAAESHTVGDPNGNHKMGPVVSETQWNKIQGLIQKGIDEG
FT                   ATLVTGGVGRPEGLDKGYYVKPTVFANVTNEMTIAKEEIFGPVVSILGYDTVDEAVTVG
FT                   NDTEYGLAAYVSGGDQDEVRKVASRLRAGQVTLNGAGPDLMAPFGGYKMSGNGREWGDH
FT                   AFGEFLETKAILGYSAKVAAE"
FT   gene            complement(435633..436094)
FT                   /locus_tag="CCNA_00425"
FT   CDS_pept        complement(435633..436094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00425"
FT                   /product="hypothetical protein"
FT                   /note="CC_0420"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93892"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3P6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93892.1"
FT                   /translation="MHKNSEIMSLIHENFWTIISFMTAKPVIIDIMNNNFQGEWKTLRN
FT                   TIHDQAEVKADRALLEMATQLRILDDVEGINDLFIAMDAPSLGTVNQSDGKNTELYFRD
FT                   MTNKIIHAAQYHWNHEERKITCQAKKHDKWIEAEIDMVRLMYIVGKIST"
FT   gene            436545..436889
FT                   /locus_tag="CCNA_00426"
FT   CDS_pept        436545..436889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00426"
FT                   /product="very-short-patch-repair endonuclease"
FT                   /note="CC_0421"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93893"
FT                   /db_xref="GOA:A0A0H3C4M6"
FT                   /db_xref="InterPro:IPR007569"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4M6"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93893.1"
FT                   /translation="MDATANARRLRQSQTLAEKTLWTLVRAHRLGGFKFRRQTPIGGYF
FT                   ADFVCEQARLIVELDGAAHEGREDYDARRTEALERFGYAVLRFRNERVLADPGGTADDI
FT                   LAALRDARGG"
FT   gene            436958..437146
FT                   /locus_tag="CCNA_00427"
FT   CDS_pept        436958..437146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00427"
FT                   /product="hypothetical protein"
FT                   /note="CC_0422"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00427"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93894"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5D8"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93894.1"
FT                   /translation="MTTAPPDEAPPEALLDETPIQRALRLKQAALDARPKPPRGGKFQR
FT                   QQAAGIAAGNSKPWMTR"
FT   gene            437146..437328
FT                   /locus_tag="CCNA_00428"
FT   CDS_pept        437146..437328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00428"
FT                   /product="hypothetical protein"
FT                   /note="CC_0423"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93895"
FT                   /db_xref="InterPro:IPR022037"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5V9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93895.1"
FT                   /translation="MAGLKDKRGFIDKDRLDLTERQAVEYWMKRWGVTRDQITAAHRKV
FT                   GRMTKDIAAELGKKR"
FT   gene            437383..437550
FT                   /locus_tag="CCNA_00429"
FT   CDS_pept        437383..437550
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00429"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93896"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6V2"
FT                   /protein_id="ACL93896.1"
FT                   /translation="MSSRPQRAARSAGTQGVTKRGALATPGSRVGFAAREDMSLRGLGG
FT                   VNARNWRGRA"
FT   mobile_element  complement(437490..438131)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            complement(437556..437741)
FT                   /locus_tag="CCNA_00430"
FT   CDS_pept        complement(437556..437741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93897"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Q1"
FT                   /protein_id="ACL93897.1"
FT                   /translation="MNPASSAPDRSSIPLEPHPAQPPPAAANGRWPRALSSRRGGTSMG
FT                   RVETPGTNRRVKATSG"
FT   gene            437761..437883
FT                   /locus_tag="CCNA_00431"
FT   CDS_pept        437761..437883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00431"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93898"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4N0"
FT                   /protein_id="ACL93898.1"
FT                   /translation="MRAKGCVLACIGSSSSIAGASGNRSAQVPVRPEQGHLTGR"
FT   gene            complement(438156..438650)
FT                   /locus_tag="CCNA_00432"
FT   CDS_pept        complement(438156..438650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00432"
FT                   /product="AsnC-family transcriptional regulator"
FT                   /note="CC_0424"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93899"
FT                   /db_xref="GOA:A0A0H3C5E2"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR019885"
FT                   /db_xref="InterPro:IPR019887"
FT                   /db_xref="InterPro:IPR019888"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5E2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93899.1"
FT                   /translation="MFSLKADFEMIDLDQIDRRLLAILQEDATVPIAELAERVGLSQTP
FT                   CWKRVRRLQDAGVITARVALLDREALDLGLTVFVAVKTGHHDEGWLTQFAAGASALPEV
FT                   VEFYRMSGDVDYLLKVVVKDIAAYDRFYKRLIATAPLTDVSSSFAMEQIKFTTALPIAP
FT                   T"
FT   gene            438748..439005
FT                   /locus_tag="CCNA_00433"
FT   CDS_pept        438748..439005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00433"
FT                   /product="type 1 capsular polysaccharide biosynthesis
FT                   protein J"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93900"
FT                   /db_xref="GOA:A0A0H3C5W2"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5W2"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93900.1"
FT                   /translation="MDLSFTRHPKSVGETYAQHMGVAWSFGFTLLGAGLACLIHGVLPF
FT                   AFERTGSQTVRRLHERLSNRCAKADAPFAAAPISGDTVRG"
FT   gene            439068..440003
FT                   /locus_tag="CCNA_00434"
FT   CDS_pept        439068..440003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00434"
FT                   /product="conserved membrane-spanning protein"
FT                   /note="CC_0425"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93901"
FT                   /db_xref="GOA:A0A0H3C6V3"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6V3"
FT                   /protein_id="ACL93901.1"
FT                   /translation="MAVLAKLLSQSLHAPAPLLAVVLGMMLGALGLQGQLGAGLDVFAK
FT                   PGLRLGVAMMGAQISWSEFAALGGPAVLASGAVVLGGLGIGALAGAALGLPLAEALIAA
FT                   AACSICGASAALAASQAAPSSPENQRTTALVIVGVNLLSTVAMLAYPPIANALGLTAHQ
FT                   AGVFFGLSIHDVAQVAGAGASVSPEVAGTAALAKLSRILWLGPAVVLIGLMLTRTAQGG
FT                   RISGLQAPPLFVWGFAALAAARGLNLIPPALVSALGACSGFLLLAGVGAISAKLGPKAL
FT                   LEVKPRLAILLVTLTVAVAILAYALTRIFF"
FT   gene            440156..441607
FT                   /locus_tag="CCNA_00435"
FT   CDS_pept        440156..441607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00435"
FT                   /product="amino acid transporter"
FT                   /note="CC_0426"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93902"
FT                   /db_xref="GOA:A0A0H3C3Q5"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Q5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93902.2"
FT                   /translation="MVGGTPKVSFWTRRKAIDTITAGHADSHQLKKTLSWPHLVALGVG
FT                   AIVGTGIYTLTGVGAGLAGPGVILSFLIAGAVCACAALCYAELSTMIPASGSAYTYSYA
FT                   AMGEPVAWFVGWSLILEYTLVCAAVAVGWSAHAHGLFKMIGFPDALLAGPHQGGLINMP
FT                   AVFISMAVAGLLALGTRESATVNMVLVFVKIIALIVFVVLCLPAFNLAHFTPFMPNGFQ
FT                   AHVPEGAAADAAKVGVMAAASLIFFAFYGFDAVSTAAEETKNPKRDLTIGIVGSMAVCT
FT                   AIYMIVAAVSIGASRTEVFSKSEAPLVFILESLNHGKIAQLVALAAVIALPTVILAFMY
FT                   GQSRIFFVMARDGLLPRALSKVNAKTGTPVMMTLLTGVLAAVISGLLSLKDIAELANAG
FT                   TLWAFIAVGASVILLRLREPNRPRVFSTPLWPIVAPAGILGCLYLFLSLPGKTQLYFLY
FT                   AHLIGAVVYLAYGMRKSVLAQQERA"
FT   gene            441717..442865
FT                   /locus_tag="CCNA_00436"
FT   CDS_pept        441717..442865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00436"
FT                   /product="acyl-CoA dehydrogenase, short-chain specific"
FT                   /EC_number="1.3.8.1"
FT                   /note="CC_0427"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93903"
FT                   /db_xref="GOA:A0A0H3C4N6"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4N6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93903.1"
FT                   /translation="MALDLETREQLIDTVARFVAERLRPIEAQVAENDAVPDDVIEEMK
FT                   GLGLFGLTIPEEFGGLGLTMEEEALVAIELGRASPAFRSVFGTNVGIGSQGLVMFGNDE
FT                   QKAKWLPGIASGAVITSFALTEPEAGSDSAAVQTRATRDGDDYILNGSKRYITNAGKAS
FT                   LFTVMARTNPDAKGGAGVSAFLVPRDLPGLTVGKPEKKMGQQGAHIHDVTFDNVRVPAW
FT                   NRLGAEGEGFKVAMQVLDRGRLHIAAVCVGVAERLIADCVAYASERKQFGQPIASFQLI
FT                   QAMIADSKTEALAAKALVLETARKRDAGVNVTLEAASSKLFASEMVGRVADRAVQVFGG
FT                   AGYVADYGIERLYRDVRIFRIYEGTSQVQQLIIARETLKRGG"
FT   mobile_element  complement(441785..442842)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            443064..444677
FT                   /locus_tag="CCNA_00437"
FT   CDS_pept        443064..444677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00437"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CC_0428"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93904"
FT                   /db_xref="GOA:A0A0H3C5E5"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR009050"
FT                   /db_xref="InterPro:IPR012292"
FT                   /db_xref="InterPro:IPR039379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5E5"
FT                   /protein_id="ACL93904.1"
FT                   /translation="MGTAMNQDYAIGERTAFMGIDDKARSALRDLRPVIRAEIGKALDN
FT                   FYGKVRATPETRKFFSDDRHMNAASSRQQAHWGVIAEGQFSDDYVQAVRAIGQTHARIG
FT                   LEPRWYIGGYAVVGDHLVRAVIDSMWPRGLLAKGGSDRAGEAVAALMKAIFLDMDFAIS
FT                   IYLETLENERQRLEAEQKATRARQEHVVTLLAEALDRLAAGDLLARIDGEVCSEFEKLK
FT                   ADFNHAVELLDQAMCGVGGATEGIRSSTEEISVAADDLSRRTEQQAASLEQTAAALDEI
FT                   TATVRRSAAGAKQAQEVVAGAKTEAERSGSVVNQAVAAMGEIETSSREIGNIIGVIDEI
FT                   AFQTNLLALNAGVEAARAGEAGRGFAVVAQEVRALAQRSADAAKEIKALINTSTKQVEA
FT                   GVALVGQTGDALRGIVSKVAEIDELIAQISVSAQEQSGGLHEVNTAVNQMDQVTQQNAA
FT                   MVEQTTAATHSLKSQTGELVRQVETFRTSEGRRSSAAASPAPVQMAQPARSPRPQSRPG
FT                   GPPISRGATAVAVKEEWEEF"
FT   mobile_element  complement(444822..445157)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            complement(444889..445200)
FT                   /locus_tag="CCNA_00438"
FT   CDS_pept        complement(444889..445200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00438"
FT                   /product="hypothetical protein"
FT                   /note="CC_0429"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93905"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5W5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93905.2"
FT                   /translation="MKYPIAIAAGIAGSFFVAQAASAGGGFEDQMARCLQQHANTRDAA
FT                   QVMLECNADGGKLSDCKVVDNSASGKGFDKAAMCIAEKLPMGAKTGTVKVPFRFPGGA"
FT   gene            445497..447518
FT                   /locus_tag="CCNA_00439"
FT   CDS_pept        445497..447518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00439"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CC_0430"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93906"
FT                   /db_xref="GOA:A0A0H3C6V6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6V6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93906.1"
FT                   /translation="MLAIRGHGALVGGDLAMKRIRLVDLPLIIKIGFAPAFALLMLAVM
FT                   AGGAILVQKSQSAALKQVVERDMRQNLEIQRISKRISNINGELFVVMTHKAGNIDVDKN
FT                   DARMAAVLVETDAVKKDLLALKSKLPAEEQPKIAELIKSLEECRSAIDTVSGMISVDFN
FT                   MAAGFIAPFEEQYVKMTGQLDQVVAAANQRIESESAKRQAQATAAMSVTIIMSLLTLGA
FT                   VGALAFLTVMTTRKSINDIAAATDKLSKGDNSIDLEKMTRGDELGGIVTALKVFRDNQV
FT                   HLEQLRADQEKSAALTADERRSKEAAAAAAAQEASLVVSNLAEGLEKLASGDLTFRVTA
FT                   DFPGDYRKLKDDFNAAMGSLQETMKVIAASTDGLSTGADEIAHASDDLSRRTEQQAASL
FT                   EETAAALDELTATVRRTAAGARQASDVVSTTRGEATHSGQVVHQAVSAMGEIEKSSGQI
FT                   SQIIGVIDEIAFQTNLLALNAGVEAARAGEAGRGFAVVAQEVRALAQRSAEAAKEIKAL
FT                   ISSSTQQVSQGVSLVGQTGEALQRIVTKVGEIDALVTEIAASAAEQATGLNEVNTAVNQ
FT                   MDQVTQQNAAMVEQSTAATHSLKGETAELVRLMARFQVGSGSSSYARPAVADAGHHAPA
FT                   RNPVAEQQARLNTFARPGRSSGSAALAQAPASDGWEEF"
FT   gene            447518..447805
FT                   /locus_tag="CCNA_00440"
FT   CDS_pept        447518..447805
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00440"
FT                   /product="STAS domain protein"
FT                   /note="CC_0431"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93907"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3R0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93907.2"
FT                   /translation="MVAAISLPENLDLKTAAPLKAAFLERRGAEIIVEADQVRRLGGLC
FT                   LQVLLAARKAWEQDGHPFSIKGPSEAFVETTRLFGAAGALLPTEFQGAES"
FT   gene            447802..448167
FT                   /gene="cheYI"
FT                   /locus_tag="CCNA_00441"
FT   CDS_pept        447802..448167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheYI"
FT                   /locus_tag="CCNA_00441"
FT                   /product="chemotaxis receiver domain protein cheYI"
FT                   /note="CC_0432"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93908"
FT                   /db_xref="GOA:A0A0H3C4N9"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4N9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93908.1"
FT                   /translation="MTRTVLTVDDSRTMRDMLRMALAGAGFNVVEAVDGEHGLEVLSAH
FT                   RPDVIITDINMPKLDGFGFIEAVRVDDDYRAIPILVLTTESDPAKKQRAREAGATGWIV
FT                   KPFNPEKLVDAIRRVAA"
FT   gene            448237..450525
FT                   /gene="cheAI"
FT                   /locus_tag="CCNA_00442"
FT   CDS_pept        448237..450525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheAI"
FT                   /locus_tag="CCNA_00442"
FT                   /product="chemotaxis histidine kinase protein cheAI"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0433"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93909"
FT                   /db_xref="GOA:A0A0H3C5E9"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004105"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5E9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93909.1"
FT                   /translation="MDELEAIKVTFFQECEELLADLEGGLLAMEEGAGDLETVNAVFRA
FT                   VHSIKGGAGAFGLEPLVRFAHVFETLLDAVRAGSVPNTVELAAVLLRASDILADHVSAA
FT                   RGLGDVDMAASAAMAAELEQWTDPNATPTAPAPVAAPTVAEEPAPAPALIGADDDAMDG
FT                   DDLGFVFVPQTITVEAQAADAELIPSNVWTVSIRPKSDLYRKANETALLLRELSRLGPI
FT                   KATLDDSALPLLQNLDPEAAFITWSVRLETDQDETAIREVFEFVDGDCDLEITRGEGSV
FT                   EASIAALTAPAEPVAAVEPIAPAPEPVEVAPPIAPPAAAPVAEVAPAVEAAKPAAAAPA
FT                   AAAAAAPKATPVEVPGPGQSVIRVDPERIDRLIDLVGELVINQAMLAQRVGEYGIAPSS
FT                   NLAMGLDELEQLTREIQDSVMAIRAQPVKSVFQRMPRLVREVANMTGKQARLVMDGENT
FT                   EVDKTVIERLSDPITHMLRNAIDHGLESPEERKAAGKNPEGVVRLAALHRSGRIVIEVS
FT                   DDGKGINRERVFGIAVKKGLIAPDLQLTDEEIDNLIFLPGFSTAEKISDVSGRGVGMDV
FT                   VKRSVQALGGRISISSRPGQGSTFTLSLPLTLAVLDGMVVDVAGETLVVPLAAIVESLR
FT                   PKPEEVRPLGPVGSVLAVRDSFVPLIDVGLTLGYREESPHPTDGVVLLVEGEDGSRAAL
FT                   VADAIHGQRQVVIKSLEQNYQQVEGVAAATILGDGRVALILDVDATINLRRREGGAPRP
FT                   PEPSLIAAE"
FT   gene            450529..450996
FT                   /locus_tag="CCNA_00443"
FT   CDS_pept        450529..450996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00443"
FT                   /product="chemotaxis protein cheW"
FT                   /note="CC_0434"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93910"
FT                   /db_xref="GOA:A0A0H3C5X0"
FT                   /db_xref="InterPro:IPR002545"
FT                   /db_xref="InterPro:IPR036061"
FT                   /db_xref="InterPro:IPR039315"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5X0"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93910.1"
FT                   /translation="MTDQAAATSADRRELISFRVGEQEYCVDIMAVREIRGWSPATTLP
FT                   QSPGYMRGVINLRGAVLPIMDLACRLGMPVIEPTVRSVFIVVKAGDRTVGLLVDAVSDI
FT                   LSINDDMIQPTPDVACDAVRSFVRGIISIEGRMISEISLDRILPEREAMAA"
FT   gene            450996..451877
FT                   /locus_tag="CCNA_00444"
FT   CDS_pept        450996..451877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00444"
FT                   /product="chemotaxis protein methyltransferase"
FT                   /EC_number="2.1.1.80"
FT                   /note="CC_0435"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93911"
FT                   /db_xref="GOA:A0A0H3C6W0"
FT                   /db_xref="InterPro:IPR000780"
FT                   /db_xref="InterPro:IPR022641"
FT                   /db_xref="InterPro:IPR022642"
FT                   /db_xref="InterPro:IPR026024"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR036804"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6W0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93911.1"
FT                   /translation="MSTVTAPSSDRREAIVDGEFAFTNQDFKRIAALLYDLAGISLPDS
FT                   KATLVYSRLAKRLRALGLRSFNEYCSFVASDKGHDESQEMLRALTTNVTRFFREPHHFD
FT                   DLRANVLEPVADKVRAGGRLRLWSAASSSGQEPYSMAFTVLSVWPNAADLDIRILGTDI
FT                   DTNVLATGRAAVYDESLLEGIPTAARGQYFERDTSDRRGWRVCEAARSLVAFRELNLNG
FT                   PSWPMKGPFDAIFCRNVVIYFDEPTQERVWNRFAPLVAPGGRLYVGHSERVGTSVTAFE
FT                   SCGLTAYRKVGR"
FT   gene            451877..452911
FT                   /locus_tag="CCNA_00445"
FT   CDS_pept        451877..452911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00445"
FT                   /product="receiver domain-glutamate methylesterase cheBI"
FT                   /EC_number="3.1.1.61"
FT                   /note="CC_0436"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93912"
FT                   /db_xref="GOA:A0A0H3C3R5"
FT                   /db_xref="InterPro:IPR000673"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR008248"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR035909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3R5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93912.1"
FT                   /translation="MAKIRVLVVDDSATMRSLISAALNRDPDIEVVGGAGDPFEARGMI
FT                   KALNPDVVTLDIEMPNMNGIDFLEKIMRLRPMPVVMVSTLTQAGAEMTLRALELGAVDC
FT                   VGKPADATGTQEALAEIVAKVKIAARASVRTNAGAAPTSAPTRRKDFMPSGDIVAIGSS
FT                   TGGVEALLSILQLFPETCPPTVITQHMPATFTASFAARLDRSSGAKVQEASDGALLEPG
FT                   KVYVAPGGATHLEVVRSAGLRCRLVAGDPVSGHRPSVDVLFNSVAHAVGDKAVGVILTG
FT                   MGRDGAQGLLTMRKAGAKTLGQDEASCVVYGMPRSAFEIGAVERQVSLSSMGQSILDLA
FT                   SARR"
FT   gene            452915..453304
FT                   /locus_tag="CCNA_00446"
FT   CDS_pept        452915..453304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00446"
FT                   /product="chemotaxis receiver domain protein cheYII"
FT                   /note="CC_0437"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93913"
FT                   /db_xref="GOA:A0A0H3C4P3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4P3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93913.1"
FT                   /translation="MPQASTISVLVVDDQLTMRALIRNALQQIGFKDIREAPDGEEALK
FT                   NLLAKPANLVISDFNMPKMDGLALLRAVRSHPPIRQTAFVMLTGRADRELVQRAVQFGV
FT                   NNYCVKPFTVQGLKEKIEQVFGQLT"
FT   gene            453301..453864
FT                   /gene="cheD"
FT                   /locus_tag="CCNA_00447"
FT   CDS_pept        453301..453864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheD"
FT                   /locus_tag="CCNA_00447"
FT                   /product="chemotaxis protein cheD"
FT                   /note="CC_0438"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93914"
FT                   /db_xref="GOA:B8GZ98"
FT                   /db_xref="InterPro:IPR005659"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038592"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZ98"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93914.1"
FT                   /translation="MTSFHHDDPERAVKVHVTQGESHVTADPNVVMTTVLGSCIAACIR
FT                   DPQSGVGGMNHFLLPDSGDGRRDGDAVRYGAYAMEVLINDLLKRGARRERLEAKIFGGA
FT                   KLFDGLSDVGASNAAFAERFLRDEGIPIVSSSTGGVSARRVEFWPASGRVRQRLVAVDN
FT                   APQDVRRPTPPPMPAVASGDVDLF"
FT   gene            453868..454251
FT                   /gene="cheU"
FT                   /locus_tag="CCNA_00448"
FT   CDS_pept        453868..454251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheU"
FT                   /locus_tag="CCNA_00448"
FT                   /product="cheU protein"
FT                   /note="CC_0439"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93915"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5F3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93915.1"
FT                   /translation="MAAKPLQAGAIATPEELLPVGELSRRLAAELASAAAICQDCEHLV
FT                   GDLAEGGAALPNLTRLQALDELSQRLHGLSAVLQRIGQHASGEWSMSIEPLLEGLGLSD
FT                   LVVRLRASEEAEWKAEAGELDFF"
FT   gene            454259..454861
FT                   /gene="cleA"
FT                   /locus_tag="CCNA_00449"
FT   CDS_pept        454259..454861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cleA"
FT                   /locus_tag="CCNA_00449"
FT                   /product="single domain receiver protein CleA"
FT                   /note="CC_0440"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93916"
FT                   /db_xref="GOA:A0A0H3C5X2"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5X2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="single domain response regulator protein that
FT                   binds cyclic-di-GMP and controls flagellum motor function
FT                   according to Nesper, et al. (2017) eLife 6:e28842 DOI:
FT                   10.7554/eLife.28842"
FT                   /protein_id="ACL93916.1"
FT                   /translation="MTDALLPSTRINLERATVLVLDDNGPSLDILSQVVSGFGVKQLHR
FT                   AESVADAQSLIKTKTFDLIISDVQMPVTDGIEFIEWLRREGGDANRFIPVILVTGHTRT
FT                   SQIVKIRDAGANYVVAKPITPKVLLERIFWVAREDRAFIECPTFVGPDRRFKHMGPPPG
FT                   TDGRRKDDLPAEVGEAQTPNLSDDEISNMMRPAKVQI"
FT   gene            454858..455328
FT                   /gene="cheE"
FT                   /locus_tag="CCNA_00450"
FT   CDS_pept        454858..455328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cheE"
FT                   /locus_tag="CCNA_00450"
FT                   /product="cheE protein"
FT                   /note="CC_0441"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93917"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6W4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93917.1"
FT                   /translation="MTVRKFKPPNRLSKMIKERGGLLAQDAIAAAEAGVESLREASLTA
FT                   LDETLAEIETRFGKGAENRESESFEALYVLASRIIDVSAFVAGTGLDRAAMSLCGLADN
FT                   CAEVGAWRWDAVDVHLNALKLLRSVGGSLPTAQRDSMLQGLYKVSHFRPEEA"
FT   gene            455598..458639
FT                   /locus_tag="CCNA_00451"
FT   CDS_pept        455598..458639
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00451"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0442"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93918"
FT                   /db_xref="GOA:A0A0H3C3S0"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3S0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93918.1"
FT                   /translation="MSKNTTGRVRGLQYGVSGGALALAMAFAGAASAQTAPAPASDEIE
FT                   AVVVTGFRASLANALDVKRRENDLVDVIKAQDIADFPDLNLAESLQRVPGVSIDRDGGE
FT                   GRTITVRGLGPDFTVVRLNGLEALATTGGKDGSGGANRGRQFDFSIFASELFNSVTVRK
FT                   STSAMNEEGSLGAIVDLQAGRPFDFSKFTMSASAKVGYNDLSRKNDPRYTFLVSNRWDT
FT                   GIGEIGALLSVAYATRAQREEGSSTGRWENPSVRFNSATAFPCFGAAYNPVTAGAATGG
FT                   ATAATSAACSTIGTVTGGTAPTVTAAAGTANNLWHPRIPRYGRLDYDQERLGVTGSLQW
FT                   RPTDRSTLTLDMMLAKFQNNRDETYLEIISFARSGAGLPQTDVVNFTADSKGTLIKGTF
FT                   DDVDVRTEYRHDTLKTEFNQFALTYDTRFGEGGNLKVGYGQSRSIQDNPDQTTFSFERY
FT                   DSDNYSYDYSANDKLPSFNYGFDATNPANYVYSSSNTLGDASLLRMRPSKAVNTFKTIF
FT                   ADVDYQILDGFKLRYGAKYKEYGFTSWEKRLNSRVLAGNPATTFTSEAAFGLPPGVTVA
FT                   DVSRVISGFGRGLDIPAGVPTSWLAPDLDKLRQKLGYDCNCVNANGDFRLSVQNQLGAM
FT                   RAITEKDTAFYIQGDFDYDIFNIPVRGNFGVRYVKTEQEATGNYSTGFTTQTVTTLGGT
FT                   FSQRVPIAMSQTVKRQYTNTLPSLNISAQPFDSFFVRFAAAKVMTRPQLPNLSPGFSAM
FT                   SQQAQTLTRGNPELNPMLANNMDLSFEWYPDKETLFSVGFFQKDIKSYIQTSSVAVPWA
FT                   DTELPDNLLANGNTADTLFTVTTQINTPGGKLKGFEVSLQRPFTFLPAPFDGFGGIVNY
FT                   THVQSDIQYVIANPVYAGTPRALVTPAVMLTQPLVNLSPDAYNATLYYEKNDFKARISA
FT                   SYRDPYLIQVAPSATNNNDVRIKEKTLNIDSQVSYNFKNFTVTLEMINLTDEKDSKLND
FT                   STRMISEEYVHYGRQYYLGVKWKF"
FT   gene            complement(458721..459857)
FT                   /locus_tag="CCNA_00452"
FT   CDS_pept        complement(458721..459857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00452"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="CC_0443"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93919"
FT                   /db_xref="GOA:A0A0H3C4P8"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4P8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93919.1"
FT                   /translation="MPAALINGRVLTESGVVEGKAVLVKDGLILDVIEAAQTPSDAKPR
FT                   DLKGGLLVPGFIDTQVNGGGGVLFNDAPTVETIATIGAAHRRFGTTGFLPTLISDDLRV
FT                   VDQAMRATEEAIARGVPGVLGLHIEGPFLNPKRKGIHDAGKFRVIDDEALALLTSLKRG
FT                   KTLVTLAPERTTPQIIRRLADAGVIVAAGHTNALYATMRQALEHGLTGFTHLFNAMSPL
FT                   TSREPGAVGAALESPDAWCGIIVDGRHVDPVVLKIALRTRALDRFMLVTDAMPTVGLPD
FT                   KRFNLQGRDIRVVDGVCVDDHGTLAGSDLDMIGAVRNAIDLLDLSLDDAVMMASHAPAS
FT                   FLGLGHGRGLIAPGYAADLCLLNDRLEVAATWIDGQEG"
FT   gene            complement(459857..460948)
FT                   /locus_tag="CCNA_00453"
FT   CDS_pept        complement(459857..460948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00453"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /note="CC_0444"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93920"
FT                   /db_xref="GOA:A0A0H3C5F8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5F8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93920.1"
FT                   /translation="MEATVLTRHETPAPTGASPPSLAPASTHMFREAGEAARVAAVQLT
FT                   ANAPKIQALAQRLRANPPRVVVTCARGSSDHAATFARYLIETKAGVLTSSAGPSVSSVY
FT                   DASPNLEGALYLAISQSGKSPDLLAAVKAAKAAGAHAVALVNVVDSPLAALADEVIPLH
FT                   AGPELSVAATKSYIAALVAVTQLIAAWTEDAELTAALQDLPTALAAAWTLDWSLAVERL
FT                   KTASNLYVLGRGVGFGVALEAALKFKETCGLHAEAFSAAEVLHGPMALVKDGFPALVFA
FT                   QNDESRASVDEMAAGLRARGASVLIAGGGGDAPDALPTLASHPVLEPILMIQSFYRMAN
FT                   ALSVARGYDPDSPPHLNKVTETI"
FT   gene            complement(460977..461789)
FT                   /locus_tag="CCNA_00454"
FT   CDS_pept        complement(460977..461789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00454"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="CC_0445"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93921"
FT                   /db_xref="GOA:A0A0H3C5X5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5X5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93921.1"
FT                   /translation="MLSERTGSAAQRRREAQGREGAAMTFAERIGRLDATGDHAPLYRQ
FT                   LQRALREAIQKKVLAPDDALPAERDMADEFNISRITVRKALDGLVSEGLLTRRQGAGTF
FT                   VAARVEKSFSKLSSFTEDMISRGRVPRSEWISRSEGQVTPEESLTLGLSPGTPVYRFAR
FT                   IRYADGAPMAVEYTTIAAFALPSTEVVGTSLYEALETTGHRPVRALQRLRAVLFQAEQA
FT                   DLLGVPVKDAGLLIERRGFLKDGRAVEVTQSYYRGDAYDFVAELNSLS"
FT   gene            complement(461800..461868)
FT                   /locus_tag="CCNA_03920"
FT   CDS_pept        complement(461800..461868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03920"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03920"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88522"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3J413"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88522.1"
FT                   /translation="MTEFSRMTRPKRNQLQTESLLV"
FT   gene            461992..464661
FT                   /gene="nagA"
FT                   /locus_tag="CCNA_00455"
FT   CDS_pept        461992..464661
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nagA"
FT                   /locus_tag="CCNA_00455"
FT                   /product="N-acetyl-glucosamine/N-acetyl-chitin
FT                   oligosaccharide outer membrane transporter nagA"
FT                   /note="CC_0446"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93922"
FT                   /db_xref="GOA:A0A0H3C6W8"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6W8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93922.1"
FT                   /translation="MKTIRKSVLAASASAMVVMIAAPAMAQSGGNEVEQVVITGIRASL
FT                   LQSIESKRKADAIVDVVTAEDVGKFPSTNVAEALTIVPGVTVDRAFGQGEKVSILGTDP
FT                   ALNRTLLNGQTVASADWFILDSPGRTFNYALLAPQIVGKVDVYKSPEARIDEGSIGGTV
FT                   IVNTRKPLDLKSGTIAGAVSYLYTDRSKKGDLQGSLLASWKNADSTFGASFSIQRAEDQ
FT                   LRRDGVETYGTIAANQWAGGNPDNPVDSRTKGCVGSCASTLTANLGARSPNAFGASYFE
FT                   QGRTRTTYTTALQYKPNDQLSLEFNWLKIDADYDNTNQSMYAFQGNTWNSLGALTGLTV
FT                   NNGVVSKASFNNALSVLDVQHREAGLKSDTFHLKGGYKGDGWDLNGEVGKSTADGGTKR
FT                   QVFLEFLNWASYTVDISGAPKSPGSLTYTTNVLGNPSAFATDPGWSGNLVSKPTSDEEK
FT                   YAQFDFGKDFDGVIQRVQVGYKRREHQTGQQYAGIAITGVAAPASSFNPSTVPSNYLKG
FT                   FDGVGTQMQNRFRIDGNAMVSYVESGKWLAAGATMPKPSIFAAAEFTAGNWNIQEDIDA
FT                   LYAQANFKADNVRGNFGVRYVKTSVDSAGYVCKPGAACNKAADWSWKSTKKSYDNVLPS
FT                   VNIIVDAREDLVLRFAAAQVIARPNYSDMTNYFWLSDGILTGGGGNPALEPYKSSNFNA
FT                   SAEWYFQPQAILSAEVFYKDISNYILQRTQPESYFNQSQGKVTTYQISRPFNAGSAEVK
FT                   GLAMAYQQTFGGGFGLLANYTYADASGQSGAPLPYSSKNQVNLSPFYENGPFSARATFT
FT                   WRSKYFTGVDRGDDMFVKAAKTLDATVGYAVTKNITMSLSGQNLLDSEYYAYANTTALP
FT                   RGVYRTGRKLQATLNVAF"
FT   gene            464754..464843
FT                   /locus_tag="CCNA_R0006"
FT   ncRNA           464754..464843
FT                   /locus_tag="CCNA_R0006"
FT                   /product="antisense sRNA"
FT                   /experiment="EXISTENCE:ncRNA mapped by tiling arrays
FT                   experiments of Landt, et al. (2008) Mol Micro. 68;3:600-14.
FT                   doi: 10.1111/j.1365-2958.2008.06172.x"
FT                   /ncRNA_class="antisense_RNA"
FT   gene            464819..467092
FT                   /locus_tag="CCNA_00456"
FT   CDS_pept        464819..467092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00456"
FT                   /product="beta-N-acetylhexosaminidase"
FT                   /EC_number="3.2.1.52"
FT                   /note="CC_0447"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00456"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93923"
FT                   /db_xref="GOA:A0A0H3C3S4"
FT                   /db_xref="InterPro:IPR015882"
FT                   /db_xref="InterPro:IPR015883"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR025705"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3S4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93923.1"
FT                   /translation="MTLTPLRIVAVSTFALTAALATGAFADSLTITPAPAKVVRAEGTF
FT                   TLSASTRIHVARGDIEAKGVALQLADLIQRSRGFRPKVVEGPPAADAIVLTREGPAGEA
FT                   YKLDINAKGATIAAAKRAGLFYGAMSLWQLATPDEAKGPVALLAASIEDAPRFAWRGLM
FT                   VDSARHYQSLDTLKAVIDAMAAHKLNTFHWHLVDDQGWRLEIKKYPKLTQVAAWRRNPG
FT                   AAVNYPKYGGFYTQDQARELVAYAAARNITVVPEIETPGHALAPIVAYPQLGTAPPDAS
FT                   KMGDWGIFPWLYNTDDATFAFLDDVLNEVMDIFPSTFIHVGGDEAIKDQWKASPKVQAK
FT                   IKELGLKDEHELQSWFIQRVGKSLEKRGRRLIGWDEILEGGLAPNATVMSWRGIDGAIA
FT                   AAKQGHDTVLSPHPVLYLDHRQSASAEEPTGRGHISSLKDVYAFDPAPVQLTPDERKHI
FT                   LGVQANVWTEHMQTDQRMQLMAFPRAVALAERAWSPEASADWDGFAKRLPAEMARLKVL
FT                   GVAANPVPFEPQPALSEAEGGKTRVALSTGLGVGQIRYTTDGKAPTATSSTYAGPIELP
FT                   TGAVLKAQTFVEGQPLGRERSWTMSADLLQTRTSGQLKLCTQQVPLTMIDDAPAALDQR
FT                   PMMMVDIFNPCWIWEGARLDKGAMLSARVTQIPFNFQVGKDRDKIPLHPPATPGGELEV
FT                   RLGCSGERIAAIPLGDAARNPGLSTITGRLPARAEKADLCLTFTSRSLDPFWVVERMTL
FT                   KPAN"
FT   gene            467106..469664
FT                   /locus_tag="CCNA_00457"
FT   CDS_pept        467106..469664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00457"
FT                   /product="phosphoenolpyruvate-protein
FT                   phosphotransferase/phosphocarrier protein HPr/PTS system,
FT                   glucose-specific IIA subunit"
FT                   /EC_number="2.7.3.9"
FT                   /note="CC_0448"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93924"
FT                   /db_xref="GOA:A0A0H3C4Q4"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Q4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93924.1"
FT                   /translation="MIVSNLVLTAPLQGWVSALEEAPDAVFAERMLGDGLAIDPLGSTL
FT                   HAPCDGSVVSVHRARHAVTLRATNGAEILMHVGLETVALNGEGFEVFVEEGQTVKAGDR
FT                   LIGLDLDLLAQRARSLITPVVITNGEAFQIVRRDQDRQIGVGQFLMELSPIAGASRAAA
FT                   SGAADQITRQIIVPLAHGIHARPAARIAQMAKTFASDLTLATGPRRANARSPVGLMSLA
FT                   IRHGDTIQLLASGPDAQAAVTALAELIEGGMGEGAPVAAKTSSTKTAPTKTEPSEPPPP
FT                   APLPRDGVLKGVPAAPGLAIGKAVRLSTAEIVVREAGEGVAHEEAALAVALETVRARIG
FT                   KAAETGDKARKAILAAHQAFLDDPELYAGAHRLIAEGKSAGFAWRRAVGGYVQALQALG
FT                   DRRMAERVDDLIDLERQVLRALSGEEETGAALAPGSILLADELLPSQLMGADPAALAGF
FT                   ATARGGPTSHVAILAAAMGVPALVAVGGALSKVKDGATLILDADAGTLRVAPDAKALEA
FT                   AQTALAQRQQRKAAAKAAAHEPAVTRDGVRIEVFANTGSVADAQAAVANGAEGSGLLRT
FT                   EFLFLDRETPPDEDEQARQYQAIAEALDGRPLIIRTLDVGGDKAAPYLPIPAEENPALG
FT                   LRGVRVSLWRPHLLKAQLRAILRVEPRGQCKIMVPMVASLDELRAVRAVLEEAKRELGI
FT                   TDRVQLGVMIETPAAAVTADLLAAEADFLSIGTNDLTQYVLAMDRGNPELAAGIDALHP
FT                   AVLRMIDQTCQGAARHHRWVGVCGGLASDLDATPILLGLGVAELSTTASIAPDVKARVR
FT                   ALSLEACRALAAQALEQTSPQAVRALVQGQTNTPLGGLNP"
FT   gene            469661..471415
FT                   /locus_tag="CCNA_00458"
FT   CDS_pept        469661..471415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00458"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /note="CC_0449"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93925"
FT                   /db_xref="GOA:A0A0H3C5G3"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5G3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93925.1"
FT                   /translation="MRSPLEILQPLGRALMLPIAVLPVAALLLRIGQPDLLGAPALAAA
FT                   THGMSLSVANTFGAAGGAIFASLGLIFAIGVAVGLARENHGAAGLAGVVCYVIATKGVE
FT                   ALLVAPPEVAAKAVEGAKDLAIAAWKAKEIGKLSIPVGILSGVISGALYNRYSTIQLPE
FT                   YLAFFGGRRFVPIVAGLAGVVLALLFGAFWSTLEAGVDGLSGLVTASGDLGLVVYGLLN
FT                   RLLIVTGLHHILNNVVWFILGDFNGVTGDLNRFAAGDKTAGAFMSGFFPVMMFGLPAAC
FT                   LAMLHTARPERRKAVAGMLGSLALTSFLTGVTEPIEFTFMFLAPVLFAIHALLTGLSMA
FT                   LMNMLDVKLGFGFSAGLFDYVLNFNKATRPLLLIPVGLVYGALYYGVFRFAILRFDLKT
FT                   PGREDEAPPSAQAVTTGGGRGADMLAALGGAANLVSVDACTTRLRLIVVDQGLVNEPAL
FT                   KALGARGVVRPSDKALQVVLGPIADTVAGEIRHAISAPPAPAPAPAPDVSQAAKALLAA
FT                   LGGADNLRDLSVHASRLRVVLNDPQRVDQAALHTAGVRGFVRVGEHAAHVVLGPEAQRI
FT                   GQAVRAMI"
FT   gene            471542..472783
FT                   /gene="nhaA"
FT                   /locus_tag="CCNA_00459"
FT   CDS_pept        471542..472783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="nhaA"
FT                   /locus_tag="CCNA_00459"
FT                   /product="Na+/H+ antiporter nhaA"
FT                   /note="CC_0450"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93926"
FT                   /db_xref="GOA:A0A0H3C5X8"
FT                   /db_xref="InterPro:IPR004670"
FT                   /db_xref="InterPro:IPR023171"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5X8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93926.1"
FT                   /translation="MLQRVRKLSLLRELLESGAAGGLLLMACAVLALFVANSPLAEGYF
FT                   HALHVPFAGLDLLHWINDGLMAIFFLFVGLEIKREFLDGQLSTWANRALPCIAAAGGVV
FT                   VPGLIYASLNAGSPETLRGWAIPTATDIAFALGVLSLLGSRVPTSLKIFLATLAIVDDL
FT                   VAVLIIAVFYTAELNTAALMGAALVTLVLLGFNRLKVKRLAPYLVMGVALWWLVLLSGV
FT                   HATIAGVVLAMTIPLHASKAAPDDATSPLHRLEHALSPWVAFLVVPIFGFANAGLSFAG
FT                   MTPSVLAEPVTLGVALGLFFGKQIGVFGAAWLAIRLGVARLPVAASWAQLYGVSLLCGI
FT                   GFTMSLFIGLLAFRDAALQNEVKVGVLVGSLSSALIGATLLSLTKRRLPAVDPSRDHQA
FT                   DATALDDLGREDAR"
FT   gene            472905..472973
FT                   /locus_tag="CCNA_R0108"
FT   ncRNA           472905..472973
FT                   /locus_tag="CCNA_R0108"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   misc_feature    complement(473055..499084)
FT                   /note="putative mobile genetic element"
FT   gene            473245..473400
FT                   /locus_tag="CCNA_00460"
FT   CDS_pept        473245..473400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00460"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93927"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6X1"
FT                   /protein_id="ACL93927.1"
FT                   /translation="MATRQPGDAPVLVSDNAKASPDAGLVSVARSGCDPVQRLAVALGA
FT                   AGRVVK"
FT   gene            474254..474409
FT                   /locus_tag="CCNA_03921"
FT   CDS_pept        474254..474409
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03921"
FT                   /product="UDP-glucose 6-dehydrogenase related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03921"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88523"
FT                   /db_xref="GOA:A0A0H3IWB0"
FT                   /db_xref="InterPro:IPR001732"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IWB0"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88523.1"
FT                   /translation="MRAAMIGTGYVGLVSGACFADFGHVVTCIDKDPPEDRAAGEGRNP
FT                   DLRAGP"
FT   gene            475532..476800
FT                   /locus_tag="CCNA_03998"
FT   CDS_pept        475532..476800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03998"
FT                   /product="GT1/WbuB-like N-acetyl-L-fucosamine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03998"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88524"
FT                   /db_xref="GOA:A0A0H3IZA3"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IZA3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88524.1"
FT                   /translation="MRDSPAKAHMPDKRIKLLIVGLNYAPDFIGIPKYTTELCEELVRR
FT                   GHDVSVVTAPPYYPAWEVPAAYRGAWRSEKLNNVRIIRAPLYVPKKPGGLTRLLHHLSF
FT                   AVTSLPSAILWALTKRPDVVLSVAPSLMSAPAALIAAKLSNARSWLHIQDFEVDAAFEL
FT                   GMLKGGGSRRWAERLERTLLLRFDRVSTISASMRRRLLRKGVKEESALEVRNWVDVDTV
FT                   TAWPSSNTSYRKALNIPADHSVALYSGNMAGKQGLETLAEVAMLLEARSAKVTLLLCGQ
FT                   GPLKSVLEAACAERANVRFMDLQPIEKLPELLATADIHLLPQRVEAADLVLPSKLTGML
FT                   ASGRPVVAMADAGTGLAVEVEGCGLIVPPGDATAMTDAVYRLSADETLRRHLSGAARER
FT                   AEQRWRRSAVIDGLEAELKRVCA"
FT   gene            477514..477678
FT                   /locus_tag="CCNA_00464"
FT   CDS_pept        477514..477678
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00464"
FT                   /product="Undecaprenyl-phosphate sugar
FT                   phosphotransferase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93929"
FT                   /db_xref="GOA:A0A0H3C3S8"
FT                   /db_xref="InterPro:IPR003362"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3S8"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93929.1"
FT                   /translation="MRIANCHLRLRARPGLTGLAQIKCLRDDTDAIESIARIDADKEYI
FT                   KRWTLSLEI"
FT   gene            477921..479033
FT                   /locus_tag="CCNA_00465"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        477921..479033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00465"
FT                   /product="UDP-galactopyranose mutase"
FT                   /EC_number="5.4.99.9"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93930"
FT                   /db_xref="GOA:A0A0H3C4Q9"
FT                   /db_xref="InterPro:IPR004379"
FT                   /db_xref="InterPro:IPR015899"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Q9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93930.3"
FT                   /translation="MGSVEMKDWLIVGAGFAGSVLAERIASQLNQSVLVIDRRPHIGGN
FT                   AYDELDEAGVLLHRYGPHIFHTNSKDIFEYLSKFTEWRPYEHRVLAQVRGKLVPIPINR
FT                   TTLNELYGVSLNSDQEAQEYLNGVAEPVANIRTSEDVVVNAVGRELYELFFQGYTRKQW
FT                   GLDPSELDKSVTARVPTRTNTDDRYFTDEFQAMPKDGYTKMFEKMLDHPNIEVRLGVEW
FT                   ADIKHSNKYNRIIFTGPIDEYYEFRFGKLPYRSLLFEHKSIHVKEFQSVGTVNYPSPDV
FT                   PYTRISEYKHLTGQDHSWTTITYEYPSAEGDPYYPIPRPENQELFKRYEELSLNETNVH
FT                   FVGRLATYRYYNMDQVVGQALAKFRRICPA"
FT   gene            479191..480435
FT                   /locus_tag="CCNA_00466"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        479191..480435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00466"
FT                   /product="glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93931"
FT                   /db_xref="GOA:A0A0H3C5G9"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5G9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93931.1"
FT                   /translation="MRIAVYCKDYFPMETGFSIAFRGFCESIVKYNPDIEITVITPAQV
FT                   DQAVNGGAGVDRLNVVRLKPYHVERQSKLDGDFFLRISNTVKTVQNRILWSRDITKIFL
FT                   QKKFDYILFESADDLLLMALLPKSILRRSVIRFHSTGDTETARYGTGLLRRIERRLIKF
FT                   RIAKNVKAILSTNEFHLNFVKAFYFENDPYRLANCYFGIVPNVVRDELDQNGDGSKSQY
FT                   IKPDLVNVVTLGRMDKQGVAQKGFEDLLFALSSMKPADREKLNIIIIGDGDCREDLSHL
FT                   AKSLNLSNVVFAGRMANSQVRNTLRDAEVVALLSRFEGLSMFAIEGMLSRSAVFFTRAG
FT                   ALVDLVQGNGWAVDVQSVDQMTSAFTAIALTDKSTLSEFGSRSYQMATERFSEEAVARI
FT                   GASHLYNCLQLLKRQ"
FT   gene            480439..481710
FT                   /locus_tag="CCNA_00467"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        480439..481710
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00467"
FT                   /product="oligosaccharide translocase/flippase"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93932"
FT                   /db_xref="GOA:A0A0H3C5Y2"
FT                   /db_xref="InterPro:IPR002797"
FT                   /db_xref="InterPro:IPR029303"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Y2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93932.1"
FT                   /translation="MKSIRANILALYVWQAAQYAIPILTIPVLAHSLGVAGFGDVAVAL
FT                   NFAMYFTVVTEWGFNLSATQQVARAADSREELRHIFWNTVLARVMLAAVCLIAAAILPI
FT                   VVPALGRVSTLIWIASIQVVGTAITTNWFLQGLEKMGTFSTISIIGRIVVIPLTFIFVR
FT                   GPDDAWVAVAIQTGSVLLIGACGFIISLNLRPLLPIHFAPRGALAKISEGVHLFSSQAA
FT                   VTMYAQTNVVILGILSGSAAAGIFNGGDRIRRAAQAAIGPISTALYPRVSVLALTDPAA
FT                   AFKLIRRALIAQGGLSLCVSIAIFVFADLVVNVLLGKEFGEAATILRILSPVPLLVGIN
FT                   NVLGTQILLPFGKAKTFSTIIIVCGLFNIVSLVALCPRLGAVGAASSIVMTEALVTGAM
FT                   AIFALSVALSVKGRRIPPPQAPGA"
FT   gene            complement(481820..481933)
FT                   /locus_tag="CCNA_00468"
FT   CDS_pept        complement(481820..481933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00468"
FT                   /product="UDP glucuronic acid epimerase-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93933"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6X5"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93933.1"
FT                   /translation="MQPGDITGAYHNIDKVHALCGYMSEVTLAEGLASLVA"
FT   gene            complement(482231..483454)
FT                   /locus_tag="CCNA_00469"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(482231..483454)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00469"
FT                   /product="GT1-family glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93934"
FT                   /db_xref="GOA:A0A0H3C3T2"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3T2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93934.2"
FT                   /translation="MNILQIGSYLDPDLVGGAEISAANYQKHLTASGYKTVSLTWCQTD
FT                   KGGRTKIVNVGEHKWIAASHRSMSPIDRGSLPQKITFYAQEFLTQVDRHSLQKLMEVES
FT                   IDLLLIHSFRGLGYDFITALAELNKPTIFILHDLALTCMNKSMSRKGKDCAFTCAQCRI
FT                   TQHIITNALNSIDNLMIIGPSMMILNTVRDELQLKKARFEYLPNANEYNSIVRVRGNAP
FT                   PPFKMGYFGRLEHDKGVDQLKFIVDAISQLYPVELHIAGDGSLKDLVTSWHGKDGIHFH
FT                   GFVPSDRMVLLYEKIDCLLLPSMWKENFPGVAVQAIMTGAPVIGFDSGGISEIIEDGKS
FT                   GFLAARGDFKGLACAVIKLIESPNLLNEMSKAALERSKQYDPKYLSAKMIEILSDFLKN
FT                   GNSKALHA"
FT   gene            483798..484859
FT                   /locus_tag="CCNA_03922"
FT   CDS_pept        483798..484859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03922"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03922"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88525"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3J1H3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88525.1"
FT                   /translation="MKLLWIGKAADGSDGGDEIYDRKLIAALPAGISVDRVGINRASVA
FT                   SQLGAISRGVPHPRFRFSSPDSIEEIRNQSARYDVAVISLEALESYADGLQCPALLILH
FT                   NIHSDGLGQIYSRSSFAAFLARWSRRWEKKIYGRKNLAIGVLSERDRTLLLGIAPAANV
FT                   VVVPPGSPPPASLAPNAHIVMEALISGSYSWAPKRRDVQRLARELSSSASNIRFLADRP
FT                   LPRVAASALQAEGYDSSSSDGNVRFGLIPDTFISGFKLKATYYIANNFICLTRCDIASE
FT                   FDGIPDAKRFVRYVPRGEDAAAIMEEYRAWGAEDLRARFGAFKEAVTDRFTWRRSAGVL
FT                   ADVAEQLKRGAAG"
FT   gene            complement(484789..486132)
FT                   /locus_tag="CCNA_00470"
FT   CDS_pept        complement(484789..486132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00470"
FT                   /product="O-antigen polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93935"
FT                   /db_xref="GOA:A0A0H3C4R6"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4R6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93935.1"
FT                   /translation="MEARGSGQIALGIAASLFLFGIYTNVGFLSGQSTFPAVSAVPGLL
FT                   LLIPFFYKELSKPKIFIALSLPFILLALTVFSPYTNGAYIKRLIAAGQTLFSLGLGLVL
FT                   YAYVSSHSREQISHFLKFAIPIYICLLALEVLTPLKNVVIAYMDIYQFTAYDYTVANRD
FT                   LGIAGGHRPKFFTSETSYVAMTLTFAIGLYTWTMKGRGKYITALLYSAAGLAIVRSPIL
FT                   MAAPLLVAVDYGAQAWKDMALRRFSLVTAPLVSIVVALSFSGVLNIAQPHFEARLRGIQ
FT                   SGKDYSTTYRTYGSYAAGIAVANEYPISGVGFGTQEIAAPIVQAVFVSYGVPIVAVAKD
FT                   WRISLANAFAYSLIIFGYAGSLLVLLLALLWTRNVVGTLDPVFLALVLILSLTYGAVYT
FT                   PKYVCHWMIFAGVGHAVAASRRQGGVNQRRPASVVRQHPPRPLPNVAT"
FT   gene            complement(486159..487127)
FT                   /gene="fcl"
FT                   /locus_tag="CCNA_00471"
FT   CDS_pept        complement(486159..487127)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="fcl"
FT                   /locus_tag="CCNA_00471"
FT                   /product="GDP-L-fucose synthase Fcl"
FT                   /EC_number="1.1.1.271"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93936"
FT                   /db_xref="GOA:A0A0H3C5H3"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR028614"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5H3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93936.1"
FT                   /translation="MSPGSSAAMPNDVIFPLEGKRVWVAGHRGMVGSAIVRRLASEGCE
FT                   ILTAGREVLDLERQSAVEAWIADNKPDAIFMAAAKVGGILANDTYPADFLYNNLVIETN
FT                   IVDAAWRNGVGKVLFLGSSCIYPKFAPQPIMEDALLTGPLEPTNEWYAIAKIAGIKLAQ
FT                   AYRKQHGCDFISAMPTNLYGIGDNFDLNSSHVMPALIRKAHEAKLAGADSITIWGTGTP
FT                   RREFLNADDCADACVFLMKNYSDFEHVNVGSGEDVTILQLAQLVCEVVGFKGEIITDTS
FT                   KPDGTPRKLMSADKLRGMGWRPQIELGPGITNTYAHFLSAQ"
FT   gene            complement(487093..488169)
FT                   /locus_tag="CCNA_00472"
FT   CDS_pept        complement(487093..488169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00472"
FT                   /product="GDP-mannose 4,6 dehydratase"
FT                   /EC_number="4.2.1.47"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93937"
FT                   /db_xref="GOA:A0A0H3C5Y5"
FT                   /db_xref="InterPro:IPR006368"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Y5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93937.1"
FT                   /translation="MTVESNGKVALITGVTGQDGAYLSELLLSKGYTVHGVKRRSSSFN
FT                   TGRIEHIYQDPHEPNPRFFLHYGDMTDSTNLIRIVQQTQPDEIYNLAAQSHVQVSFETP
FT                   EYTSNADATGTLRLLEAIRILGLEKKTKFYQASTSELYGLVQEVPQSEKTPFYPRSPYA
FT                   AAKLYGYWIVVNYREAYGIHASNGILFNHESPLRGETFVTRKITRAVAAIKQGFQDKLY
FT                   LGNLDAKRDWGHAREYVRGMWLMLQQETADDYVLATGETTLVRDFVTKAFSEVGITISW
FT                   SGAGVDEKGTCAESGKVLVEVDPRYFRPTEVELLIGDPTKAKEKLGWVHETKWEQLCAE
FT                   MVAADMINVAREQRRNAE"
FT   gene            complement(488274..488768)
FT                   /locus_tag="CCNA_00473"
FT   CDS_pept        complement(488274..488768)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00473"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93938"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6X9"
FT                   /protein_id="ACL93938.1"
FT                   /translation="MRHRRSGPCARWRWRGNRLVRPHADAGAGFEAPSPADWVGAHNDG
FT                   VAERQCIRLHIRARQGATTRLANKVTLRSRLTPICSPLPATIERNEAYEAAGQSTEPAG
FT                   PSPTTDQPINHLKGHRTNTNQKAKCSCNESIKNLVRAQYRAKGDIASVVTARSTYSLSD
FT                   P"
FT   gene            complement(488768..491578)
FT                   /gene="trwC"
FT                   /locus_tag="CCNA_00474"
FT   CDS_pept        complement(488768..491578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trwC"
FT                   /locus_tag="CCNA_00474"
FT                   /product="DNA relaxase/conjugal transfer nickase-helicase
FT                   trwC"
FT                   /EC_number="3.6.1.-"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93939"
FT                   /db_xref="GOA:A0A0H3C3T6"
FT                   /db_xref="InterPro:IPR014059"
FT                   /db_xref="InterPro:IPR014862"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3T6"
FT                   /protein_id="ACL93939.1"
FT                   /translation="MGRRQIPGCRARVQLERRRTGLMVASLSSLSSSAQASSYYEADDY
FT                   HAEGGAAPSRWQGSGAAALGLEGEVDPERFRQLLDGVLSDHVALGARRDEGRQHRPGWD
FT                   LTLSAPKSISIMALVAGDRRLHAAHAAAVEAALAFTERHAGGTRIRDGERVAHVRTGAL
FT                   AMATFQHETSRAQDPQLHTHAVILNMTRDLEGTWRSLDSRALYQLQKTIGEVYRQELAG
FT                   AVRALGYAIEVGKESMFEISDVPASVREAFSERARQVEAHLATKGLTRATATAEEKQAA
FT                   TLYTRASKKAADRAELSRAWRVEADGLGFSSEARRSLLTEALDRAEASKAIRDRGAVLA
FT                   QDAVRFAAEKLGERQAIFSRAELEREAGRKAIGLATRTEIMAAVDKRQQSHQLEARALR
FT                   SPIGLDLEGFTTDRAIAHEKRLLEIEREGRNALAPIVPPIEASRIINAASLAASERGLA
FT                   WSDDQRRATKAVLTSRSAVVGVQGFAGTAKTTTVLATLAKAAAEQGYQVKALAPSASAA
FT                   ITLGEALDLEGRTIARHLVERPNARPSARELWIVDEASLVSARDMARLLDEAQRRGART
FT                   LLVGDAHQLGSVGAGAAFRQLQDAGLETAHLTKIVRQSNTLTLEAVEATLAGHARRAFD
FT                   ALDRGGGQIIEAQSVEDRQALIAAHFAQLDSAQRRRTLIIDPSREGREQLTARIRAELI
FT                   AAGHLGKAAVTVTSLVAKDLTQAERKEAGSYAPGDIVTFARTLTGKAVAKDTAYEVQAV
FT                   DARRRTVTLSDGRDARIDWAPHRWGSAEAFEPVDRELRQGDRIEFTRNNMRLHQVNGLQ
FT                   GEIVSLDVEARKAQVRTDRGHIRTLDLNALQDRHFRHAYVQTAFAAQGRTTDHVLFHAE
FT                   SQRSNLIDQATLYVAISRARHGATIVTDDRAKVIRGVEARSGRRLTALGAEGSGREAGL
FT                   DQDAGL"
FT   gene            complement(491512..493329)
FT                   /gene="trwB"
FT                   /locus_tag="CCNA_00475"
FT   CDS_pept        complement(491512..493329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="trwB"
FT                   /locus_tag="CCNA_00475"
FT                   /product="bacterial conjugation protein, ATP binding domain
FT                   trwB"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93940"
FT                   /db_xref="GOA:A0A0H3C4S0"
FT                   /db_xref="InterPro:IPR019476"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4S0"
FT                   /protein_id="ACL93940.1"
FT                   /translation="MSSHHQNLSRGQALFAGALGSIVSRWRAYILTCLATATCGAYAGF
FT                   SQLPLSTQRAAQDYAHAKLMLELLVSVSDTTVERYTPTGPEPVSAQGLVSHAFYQAAAE
FT                   RGLDALQWGGLVGVLFGVTLCAIWAYLVIRWGETAAEDNARRGASVVTERTLARLTRKR
FT                   AGPDAIRLASIPLPTTLETRHIALIGTTGSGKTTTLRQMLDAIDKRGDTAIVYDTSGEF
FT                   ISHYYRPERGDIILNAFDARGAFWSPFDEIHHPADADHIARQLVASTGAAEQDIWLDAA
FT                   RILVADVLRKLHAEGRTDLSTLIETLGRLSRDQLKDWLADTSSARMFEQGAERASGSVL
FT                   FMLARCVQLLQYLRASPEDATVFSFRAHFEALDQRTGERPWIFVPRQEQYFAAMRPLLA
FT                   CFLECAATAILGLSPHPSRRIWLMLDELADLPKVDNLARLLPLGRKFGASVVVTFQALG
FT                   QMRERYGKDGAEALLANTNTKLFLQLADPDTRQWASQAVGTVETEIRGASENLDHQVGK
FT                   GRTSIGSSRQILPLLLESQFRLPPFHGYLQLPDAFPVARVTIRNDHIIARGRAKQQAFV
FT                   AIDLDKTLWGAARSPAVEPASNLSDGGPV"
FT   gene            complement(493326..493709)
FT                   /locus_tag="CCNA_00476"
FT   CDS_pept        complement(493326..493709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00476"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93941"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5H8"
FT                   /protein_id="ACL93941.1"
FT                   /translation="MNKVTLSLRIPSAMNAVLTDYAKAPGYCSRYQAAIRAFETGLGVL
FT                   VGSTQFSPGDEAVTDSLGELLARASRLEALVDRTLFTASAAYAYARRSIVRTEADHRMD
FT                   QLIAEAAQDAYRRQRDLARGAHQ"
FT   gene            complement(494090..494284)
FT                   /locus_tag="CCNA_00477"
FT   CDS_pept        complement(494090..494284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00477"
FT                   /product="excisionase"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93942"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Y8"
FT                   /protein_id="ACL93942.1"
FT                   /translation="MTEDPSDLPRMAMTVAEFCKTFSVGKSLFYEEVKAGRLSVRKVGG
FT                   RTLVPLAEARAWWASKASQ"
FT   gene            complement(494406..495143)
FT                   /locus_tag="CCNA_00478"
FT   CDS_pept        complement(494406..495143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00478"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6Y3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93943.1"
FT                   /translation="MSHESRDDQFEITHAMLMEDLLPELPWIRLSEALRFLWRCKELLE
FT                   PQDPQEALLSALRMGRVPSQCEDPSKHAGWLMAYRELRPAEWATAMHLNLLDDAISLHD
FT                   GTPATGVEVDKFALYSWIYDRSSEFPDWLFTDFGDYVEVAGGKVATSPEGQVTSIEKPL
FT                   ARKNKGGRPVTYDWSGAYLKVLIKHMYLEGRLSARSSQADVIAMLRDAFGTEDPDAGPQ
FT                   ETALKTHAQRILAELKAADDDTA"
FT   gene            495332..495655
FT                   /locus_tag="CCNA_00479"
FT   CDS_pept        495332..495655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00479"
FT                   /product="Helix-turn-helix DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93944"
FT                   /db_xref="GOA:A0A0H3C3U2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3U2"
FT                   /protein_id="ACL93944.1"
FT                   /translation="MIVNFVDMGVFITTPRDIGAAIKHRRRQRGLGQVELAARARVSRQ
FT                   WLIQVEGGKPGAALGPVLRLLNILGIRLALADLDQQAGHSDEILDLPDPSAILERYRNE
FT                   SSQ"
FT   gene            complement(495724..497022)
FT                   /locus_tag="CCNA_00480"
FT   CDS_pept        complement(495724..497022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00480"
FT                   /product="bacteriophage P4 integrase"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93945"
FT                   /db_xref="GOA:A0A0H3C4S6"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025166"
FT                   /db_xref="InterPro:IPR038488"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4S6"
FT                   /protein_id="ACL93945.2"
FT                   /translation="MARLIDRLTALEVKRLAKVGMHPDGRGLYLQVHNGGSKSWIYRYT
FT                   LKGRVRAMGLGPTHRVSLAEARAQAQAARLLRDQGLDPIAARAAATPPPEPPSPPKTRE
FT                   IAVAEAGLAFKDAAAAYIRTNSAAWRNAKHQAQWSATLATYAYPVFGDRPVSEIDTAMV
FT                   LSVLEPIWSTKAETASRLRGRIEAVLDWASVRGHRQGENPARWKGHLDKILPAKSKIAR
FT                   VEHHAALPFSTIPAFMRDLGTRPGAAARALEFAILTAARTGEVIGAQWSEIDFEARLWT
FT                   QPAERTKTRKEHRVPLCDAAMAILASMREAFLTGRREFLLLYNKPVPDDMPLEGFIFAG
FT                   MRRGKGLSNMAMLKTLERMGHPDLTTHGFRSTFRDWAAETTGYQNEVVEMALAHAIAGK
FT                   VEAAYRRGDLLEKRRDLMRDWAAYCASSTAEAA"
FT   gene            497352..497597
FT                   /locus_tag="CCNA_00481"
FT   CDS_pept        497352..497597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00481"
FT                   /product="HipB transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93946"
FT                   /db_xref="GOA:A0A0H3C5I2"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR017507"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5I2"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93946.3"
FT                   /translation="MTLLRQGLDAAALGAQVRRARRAMGLRQDELAAAAGVGLRFLVEL
FT                   ERGKPTVQLGKVLDVLAAAGLDLQLVSRAPVSGGDD"
FT   gene            497584..498855
FT                   /locus_tag="CCNA_00482"
FT   CDS_pept        497584..498855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00482"
FT                   /product="toxin protein module HipA"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93947"
FT                   /db_xref="InterPro:IPR012893"
FT                   /db_xref="InterPro:IPR017508"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Z1"
FT                   /protein_id="ACL93947.1"
FT                   /translation="MAMTRVLTVWWGDGVVGSLALDETGDIRFAYDAAWLADEACPAVS
FT                   VSLPKQPGAFSRRKTRSFFAGLLPDDLQRDNVARALGVSRQNDFGLLERLGGDVAGALT
FT                   LWPEGEAPPKRQGGRTAEPLNDKRLLAILDELPRRPFLAGEDGVRLSLAGAQEKLPVVL
FT                   VDGAVALPALGQPSTHILKPANARWPAMTENEALAMRLAAAVGLPTAGVEPRRIGERTF
FT                   LLVTRYDRVVSSDGAVRRLHQEDFCQALGVSPEHKYAAEGGPIFPDCFNLVRNVCQPSA
FT                   PAVLALLDAAIFNVIVGNADAHGKNYSLLHQAGAIVMAPLYDLMCTAAYPEVHAKLAMK
FT                   IAGRAQLEAFKADTWRDFGRDIGMGPAFVERRANAQARRVLDQVGPVADAIAACGFDRE
FT                   ALRGLRDLIAERARAVLKLGQGER"
FT   gene            complement(499085..499174)
FT                   /locus_tag="CCNA_R0007"
FT   tRNA            complement(499085..499174)
FT                   /locus_tag="CCNA_R0007"
FT                   /product="tRNA-Ser"
FT                   /note="CC_t03"
FT                   /experiment="EXISTENCE:RNA-seq"
FT   gene            complement(499379..500224)
FT                   /locus_tag="CCNA_00483"
FT   CDS_pept        complement(499379..500224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00483"
FT                   /product="Zn-dependent hydrolase, glyoxalase II family"
FT                   /note="CC_0451"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93948"
FT                   /db_xref="GOA:A0A0H3C6Y7"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6Y7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93948.1"
FT                   /translation="MMQPEITSYRHPATGTVSYLVVDPATFLCAIVDPVLDFDPVTEEI
FT                   DTRFVDAIIADIRAKDLGPTWILETGLHTGHLSAAGHLKYETGASVCIGAGVVESLKRL
FT                   APQFGETMVDLDGWDFDKLAQDGDTFPMGGLEITPIALTGRLPGAVAYRMADMVFTGDL
FT                   VLAPAEGSGRCDIPGADAGKAWDDARKILALPPETRIMPGVSATAACESTVADAKASNI
FT                   QLNDTIDQLDFIALRTAADAFLPDPELAAAALRVAIRAGRPPSPPESGPRFPAVDLSKL
FT                   "
FT   gene            complement(500314..501015)
FT                   /locus_tag="CCNA_00484"
FT   CDS_pept        complement(500314..501015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00484"
FT                   /product="hypothetical protein"
FT                   /note="CC_0452"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93949"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3U6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93949.2"
FT                   /translation="MRPYLATFALAAALAGSAQAATTLPGDDEVIATAHVKMSAKALTA
FT                   VAPDTPPSVSTTPPRPLTTQEQIAAFIAANAPAEDAPRGVLPAERDEDGKRKVHGSMGV
FT                   SVGTGGYRSAYASALFPVGESATIGVAVSKTDFGKHGGWYGGPGYDAYGPGYGYDYGYG
FT                   YGYAPGFGRGRGGERQSIALSVMTGGSNASGGVPDGCAPGFRSGGRYVEPLWVEGMRDG
FT                   AHPCVGATPSR"
FT   gene            complement(501114..502142)
FT                   /locus_tag="CCNA_00485"
FT   CDS_pept        complement(501114..502142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00485"
FT                   /product="ribosomal large subunit pseudouridine synthase D"
FT                   /EC_number="5.4.99.12"
FT                   /note="CC_0453"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93950"
FT                   /db_xref="GOA:A0A0H3C4T0"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4T0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93950.1"
FT                   /translation="MNDVDDIADDDLLDDVAPPDDSKGERLTADLPENLAGQRLDKVLA
FT                   PLFPDLSRARLQALIAEGRLTFDGETVADASRKARAGVYSLVVPPPAPADPEPEALPLS
FT                   ILYEDAHLIVVDKAAGMAVHPAPGTYNGTLVNALLHHCGASLSGVGGVARPGIVHRLDK
FT                   DTSGVMVAAKSDAAHRGLSTLFATHDIDRLYVALTRGAPNPPTGTIQTQIGRSPGDRKK
FT                   MAVLRAGGREAITHYRVEAAFGPADRPLAARVACRLETGRTHQIRVHMASKGSPCLGDP
FT                   VYGAAQPAAAVRERIEAAGLRRQALHAAVLGFVHPITGETLRFETPLPADMDALEVALA
FT                   TL"
FT   gene            502235..504724
FT                   /locus_tag="CCNA_00486"
FT   CDS_pept        502235..504724
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00486"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0454"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93951"
FT                   /db_xref="GOA:A0A0H3C5I6"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5I6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL93951.1"
FT                   /translation="MRAFRTTTLLSASALSLLVAAPALAAGQESAPASNNEPALLGELV
FT                   VTAQKRAQDPVDVPIAVTAYSGKFLEAIGVKAFDELSAFTPGFLVQNQSNNNSGFVMRG
FT                   ITSDSGSATDETRVSIYQDGVPISRSRGSYVELFDMERVEVAKGPQSTLFGRGALIGAV
FT                   NLVQNKANPGGFDWALRAEAGTRGYRVGEGMVNFAVGESSALRIAARLRQTDGYVKDAA
FT                   GGDPYDSTDSQAVRVGFHTEAGGLKFDLIGNYQVDDTTGTSFKSNTFNPSNPITGQALS
FT                   DTSVGGFATLAPGAGFEGGAPLGLDRKVYGLTALADYRINDSLTLSSITATRAFHSTEV
FT                   FDPDGSSLPILTFAEDAQGRQQSQELRLRYDAGGRFSGFVGANYFHETGSWRIPGQMDE
FT                   RLVLALLAGASPLGISRPTPQPQAVLTNPAYLAQVLQLGFGIPSSLATGFASNLKPIHR
FT                   EEFANYSENTTYDVYADGTLRLTDKLELTAGVRYTSEDREASYRSTVQNGRSILGVLLA
FT                   APTPTNLFLAAQPNAVNNAALPMLGLLNQPTANNGDTFSKSISDSGVTWRLVGRYAASE
FT                   DLSLYASFARGRRPDVISTSAPAAPLGQPRFGIVKAEVVDSYEAGAKGKLMDGRLYLSG
FT                   AVFRYDYDNFATTFRQGAQIVTLNAGKAKAYGFEGEARLQAGDFWTLFGTYGYNHARLE
FT                   SGLRKGNQFRLSPDHAVSVGALFSREGLGGKVTFTPTYTWRSKMFFDDNNDRADLQSAG
FT                   LFPDTRLDEFQDAYGLLNVRLGFGAVDDRWKIEAFVENLNDKRYLKDAGNTGDSFGIPT
FT                   FIAGKPRFMGIGITFRH"
FT   gene            504911..506605
FT                   /locus_tag="CCNA_00487"
FT   CDS_pept        504911..506605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00487"
FT                   /product="alkaline phosphatase"
FT                   /EC_number="3.1.3.1"
FT                   /note="CC_0455"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93952"
FT                   /db_xref="GOA:A0A0H3C5Z5"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008963"
FT                   /db_xref="InterPro:IPR018946"
FT                   /db_xref="InterPro:IPR032093"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Z5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93952.1"
FT                   /translation="MTIDRRRLLGLLGVSGAAAGEAAAQPISYFKGPVAFEHGVASGDP
FT                   GLTYVIFWTRVTPKQATTGDVDVDLEVAADPDFKTLVTASRGLRARASRDWTVKHDLDG
FT                   QGLKPGTEYWYRFKANGVTSPVGRTKTLVKGAAKDAVLAVVSCSLYPNGYFNAYDAIAK
FT                   LPRVDAVVHLGDYIYEYGGAPQDYGMNSPVAKSRTPEPPHEIVTLDDYRRRHAQYKTDP
FT                   ALQAAHARAPWIVAWDDHETANDSWVGGAENHDPDKGEGDWTARKAAALKAYYEWMPIR
FT                   EAALPEAAWRSFQFGDVASLLMVETRLTARTPELSYDRDMPIVDGKPDVAAFVAKWKDP
FT                   SRRMMGEGQEQWLAGQVGASVQAKTAWQVLGNQVVMARVASANLKATMGEAAYGDLQAK
FT                   LPEYARKRVDQSVAMSAFDVPSNLDAWDGYPADRQRVYDIFTAAKARPIVLAGDSHMFW
FT                   ANELWNDAGQKRVAVEFGTTSVTSPGYGDYLPGVPIGEAFVQRNKEVKYAHPSAKGFVL
FT                   LTLEHGKATSELMAVSTIMKPTYELAAMKRFVVTPSADGGVEALREA"
FT   gene            complement(506715..507341)
FT                   /locus_tag="CCNA_00488"
FT   CDS_pept        complement(506715..507341)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00488"
FT                   /product="amino acid efflux permease"
FT                   /note="CC_0456"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93953"
FT                   /db_xref="GOA:A0A0H3C6Z1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6Z1"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93953.1"
FT                   /translation="MTTPEALIAFTLAAGLLTLTPGLDTALVIRTAAAEGPRRAAGAAI
FT                   GIGLGCLIWGAAASFGVGALLTASQTAYTVLKWVGALYLAWTGLRMILKPREAFEPGET
FT                   RAVDAGPMAALRRGLLTNLLNPKVGIFYVSFLPQFMPVGVDPARFGLLLTTIHVVEGLL
FT                   WFALLIAATVPIAGLLRLPGVVRWLDRTTGLVFVAFGLRLALDRR"
FT   gene            complement(507328..507747)
FT                   /locus_tag="CCNA_00489"
FT   CDS_pept        complement(507328..507747)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00489"
FT                   /product="phosphoribosyl-AMP cyclohydrolase"
FT                   /EC_number="3.5.4.19"
FT                   /note="CC_0457"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93954"
FT                   /db_xref="GOA:B8GZS0"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZS0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93954.1"
FT                   /translation="MSTDLFPQAHSKHDLERGFALAPRFNADGLVVAVAQHADTGEILM
FT                   LAWMNAEALKLTVETQIAHYFSRSRNELWKKGDTSGQLQDVVELRVDCDQDAVLLKVRP
FT                   RGDGGACHVGFRSCFYRVLENGVLVEREAPLHDHA"
FT   gene            507838..508722
FT                   /locus_tag="CCNA_00490"
FT   CDS_pept        507838..508722
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00490"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="CC_0458"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93955"
FT                   /db_xref="GOA:A0A0H3C3V2"
FT                   /db_xref="InterPro:IPR008535"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3V2"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93955.2"
FT                   /translation="MNLKDRIKAGVATLDERARPWARKSRWNGYAYEFLLFGLKQAWAC
FT                   LFGGLMLALLVGTKLFWPEAAPIARYDFLVVAAIAIQASLLALKLERWDEALVIFMFHV
FT                   VGTIMELFKTAHGSWIYPEDSVLRIGGVPLFTGFMYACVGSYIARIWRLFDITFIRYPP
FT                   FWTTHILAVLIYANFFTHHYMIDIRVGLFALSVLLFGRTWFVFTPDQTARRMPMLMGAV
FT                   LVSLFIWFAENLGTFAGAWIYPNQADGWQMVPFEKMGAWYLLMLISFVLVTLVHPPVHA
FT                   CVARIRQGIWRAA"
FT   gene            complement(508870..509508)
FT                   /locus_tag="CCNA_00491"
FT   CDS_pept        complement(508870..509508)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00491"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="CC_0459"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93956"
FT                   /db_xref="GOA:A0A0H3C4T6"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4T6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93956.1"
FT                   /translation="MDALTRERTLIGSDDTTGLDLEPVQRPSKDEAMAAVRTLLAWAGD
FT                   NPEREGLIDTPKRVVEAFDEWFAGYHGDPAKELSRTFEDVQGYDDMVMLRGIDVQSHCE
FT                   HHMAPFLGKAWIAYMPTGKVVGLSKLARLVEIFAKRLQTQETMTMQIADAIEDHLSAAG
FT                   VAVLIDAEHQCMSTRGVHHHDVSTITTQFRGVFKTDKVLQQRFMDLVKK"
FT   gene            509704..511095
FT                   /locus_tag="CCNA_00492"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        509704..511095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00492"
FT                   /product="cysteinyl-tRNA synthetase"
FT                   /EC_number="6.1.1.16"
FT                   /note="CC_0460"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93957"
FT                   /db_xref="GOA:B8GZS3"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015273"
FT                   /db_xref="InterPro:IPR015803"
FT                   /db_xref="InterPro:IPR024909"
FT                   /db_xref="InterPro:IPR032678"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZS3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93957.1"
FT                   /translation="MTLKIHDTLTREKRDFVPADPQRVTMYVCGPTVYNYAHIGNFRPV
FT                   VVFDVLFRVLRHLYGEDAVVYARNVTDVDDKINQKAADEGVPISVITDRYLAAYHQDAD
FT                   ALGALRPTLEPKATEHIGAILEMIGQLVENGSAYAAEGHVLFDTQSFADYGQLSGRPLD
FT                   EMIAGARVEVAPYKRHPADFVLWKPSKENEPEWESPWGAGRPGWHIECSAMIDKALGQT
FT                   IDIHAGGIDLTFPHHENEVAQSRCAHKTSVLANYWMHNGFLDMSGEKMSKSLGNVIIPH
FT                   ELLETTPGEVIRWALLSAHYRQPLDWTPELLEQSKKSLDRLYGALRRAKDVAPDQAMEA
FT                   PAEVMSALMDDLNTPLATSAFFEVSSAIEKAVTAGDTVAIAANKARLLEAGALLGFLQA
FT                   DPDAWFEGDASDELKAQVEDLLAKRVAARAAKDWSAADAIRGELDALGVVVMDGPAGAT
FT                   WRMKD"
FT   gene            511098..511559
FT                   /locus_tag="CCNA_00493"
FT   CDS_pept        511098..511559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00493"
FT                   /product="putative polyketide cyclase-dehydrase/lipid
FT                   transport protein"
FT                   /note="CC_0461"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93958"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5J0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93958.1"
FT                   /translation="MQRAVEHRIGVQAPAEVIWEVVSDFEGWTHWNPLYRRAEGVMKVG
FT                   STLVLEQHLPGQAPMVIQPVVQDWVPYEQLHWRSNRLGGFVTAIRYLEIEAMGPANATF
FT                   SNGELFMGMLLRFVSRDERRRLKAAFTQMGEAVRDRAEAVWSERSSNPT"
FT   gene            511566..512027
FT                   /locus_tag="CCNA_00494"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        511566..512027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00494"
FT                   /product="transport protein"
FT                   /note="CC_0462"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93959"
FT                   /db_xref="GOA:A0A0H3C5Z9"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Z9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93959.1"
FT                   /translation="MIDDLYSAKILGLVANMPRAGRLAAPDASAEKTAKLCGSRITVDV
FT                   MVKDGKVIDYAQDVSACALGQAAAAILGAHVIGAELSDIELARDSLAAMLKTNGSPPAG
FT                   RFAELAVLEPVKDYPARHASTLLAFEATVEAVRKATGAGETRTSTAGAA"
FT   gene            512080..512334
FT                   /locus_tag="CCNA_00495"
FT   CDS_pept        512080..512334
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00495"
FT                   /product="putative membrane protein insertion efficiency
FT                   factor YidD"
FT                   /note="CC_0463"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93960"
FT                   /db_xref="GOA:B8GZS6"
FT                   /db_xref="InterPro:IPR002696"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZS6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93960.1"
FT                   /translation="MTFYERTVDLGLRAYKLTLSPLIGRQCRFTPSCSEYTAAALKDHG
FT                   PLKGSWLGLRRICRCNPFGGSGYDPPPPRHQPRKWKCEE"
FT   gene            512331..514298
FT                   /locus_tag="CCNA_00496"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        512331..514298
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00496"
FT                   /product="threonyl-tRNA synthetase"
FT                   /EC_number="6.1.1.3"
FT                   /note="CC_0464"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93961"
FT                   /db_xref="GOA:B8GZS7"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002320"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR012947"
FT                   /db_xref="InterPro:IPR018163"
FT                   /db_xref="InterPro:IPR033728"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZS7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93961.1"
FT                   /translation="MIDLVFPDGSSRQYPDGATGRDVAAAISKSLEKKALLIKLDGQVL
FT                   DLDRRLTPDLLTGERKFEILTREAPEALDTIRHDTAHVLAEAVQELFPGTQVTIGPNVE
FT                   DGFYYDFARDEPFSLDDLEKIEKRMKEIVDRDEKITREVWDRNEAIAHFDGIGEQYKAQ
FT                   IIRDLPDTDTITVYRQGNWKDLCRGPHLPSTKHVGKAFKLTKLAGAYWRGDQNNAQLQR
FT                   IYGTAWASEADLEAHLKRIEEAEKRDHRKLGKTMDLFHIQEEGKGMVFWHPKGWALYRV
FT                   LEDYMRRRLDAAGYKEVKTPQILDRSLWEKSGHAEKFGHAMFMCESAEGEVLAVKPMNC
FT                   PGHIQIFNVGQKSYRELPLRMAEFGACHRYEPSGAMHGIMRVRAFTQDDAHIFCREEQV
FT                   TEESARFIELLRSVYNDLGMTLADTKFSTRPELRAGTDETWDKAEAALAAAAEAAGETL
FT                   TLQPGEGAFYGPKLEFSLKDAIGRVWQCGTLQLDFVLPERLDAEYVSEDGSKKRPVMLH
FT                   RAILGSFERFIGILLENFAGALPVWLAPTQVVVATITSDADDYAREVVEKLTKLGMRAE
FT                   LDLRNEKINYKIREHSLAKVPVIAVVGRKEAETGQLALRRLGGEGQSVLSLEEALRVLK
FT                   SDATPPDVARALAVQEAVTA"
FT   gene            514298..515224
FT                   /locus_tag="CCNA_00497"
FT   CDS_pept        514298..515224
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00497"
FT                   /product="putative rhamnosyl transferase"
FT                   /note="CC_0465"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93962"
FT                   /db_xref="GOA:A0A0H3C6Z5"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C6Z5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93962.1"
FT                   /translation="MNSILPSVSTLAVGARPARPNVSVVMVVYRTGEALVESIRHVLAE
FT                   PLVDEFIIVDNGSSSRDEDMLRSLALTEPRVVLKQGHGNVGFARGANLGAVTAGGEYIV
FT                   FLNPDANLQPSCVASLVTAFKGQPVPTIVGARVLNTDGSEQRGGRRGDVTPISTVLSFG
FT                   QLTRRYPKLAGFEIHRENEPLPGAPVPMPTISGACFAMRRADFVALNGFDEGYFLHVED
FT                   IDLCWRARRAGGQVLFQPNAEVVHLGHTSLEHPVKVEFHKGVGLTRYFIKRADSLQLFA
FT                   AAVLLAPAIMLMSVCRPLLWKLTGRPI"
FT   gene            complement(515285..515404)
FT                   /locus_tag="CCNA_00498"
FT   CDS_pept        complement(515285..515404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00498"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93963"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3V9"
FT                   /protein_id="ACL93963.1"
FT                   /translation="MPGSRSNPLTLILSARTEGASSPAVLDESGPRHAPGRSV"
FT   gene            complement(515480..515845)
FT                   /locus_tag="CCNA_00499"
FT   CDS_pept        complement(515480..515845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00499"
FT                   /product="hypothetical protein"
FT                   /note="CC_0466"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93964"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4U1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93964.1"
FT                   /translation="MRSLALLLALGLSACVAAPVAGAGPARCDVTIKFGSYGAGIDHML
FT                   ADKVAAAIQVDRDIARSERKPWGREGEFDQCLTAKPGRDVKAMYERYRAMLPARNLKAP
FT                   TSIEGPDGLRFETIAPM"
FT   gene            complement(515842..516741)
FT                   /locus_tag="CCNA_00500"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(515842..516741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00500"
FT                   /product="hydroxymethylglutaryl-CoA lyase"
FT                   /EC_number="4.1.3.4"
FT                   /note="CC_0467"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93965"
FT                   /db_xref="GOA:A0A0H3C5J6"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5J6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93965.1"
FT                   /translation="MSRFIQIVEVGPRDGLQNEKTVLSVEEKLDLIAKLEAAGARRTEV
FT                   VSFVNPSRVPQMAGAEEIMAALPADLVHSRIGLVLNMRGWERCVSTGCDEANVVVCASD
FT                   GFATRNQGSTTQQQVETLAAIVERQAAEGGPPITATISVAFGCPFDGEVSQDQVVAIVR
FT                   EAAALGVPEIAIADTIGVADPWTVRRRIEAVRAAAPDTRLRMHFHDTRNTGLANAFASV
FT                   EAGVDVLDASVGGLGGCPFAPNATGNIGTEDLVYMLERAGFETGYDLAALIQIGRDISQ
FT                   RLGKAPASSLARAGGFPA"
FT   gene            complement(516738..518417)
FT                   /locus_tag="CCNA_00501"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(516738..518417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00501"
FT                   /product="glucosyltransferase"
FT                   /EC_number="2.4.-.-"
FT                   /note="CC_0468"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93966"
FT                   /db_xref="GOA:A0A0H3C602"
FT                   /db_xref="InterPro:IPR003342"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C602"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93966.1"
FT                   /translation="MTLESRLDAWSRGWRAPLFAALVALIAGLPGLFAMPPLDRDESRF
FT                   AQATSQMLETGDYVVIKFQDQPRFKKPVGIHWMQALSVTALSDAEARQIWAYRIPSLLG
FT                   AMLAAAACAWGAAALFDARTGLLAGSILGATFLLSSEAFIAKTDAALCGATTLAMAALA
FT                   RVYMGHLKGEPSSKWTKLAFWLGLALAALIKGPVGLLVALFALLMLAIWDRKAGWMKDL
FT                   GWTWGLILFAAITLPWAMMITVATDGAFWGAAVGADLAPKLAGGQEGHSGPFGYHTLLA
FT                   PLLSFPATLLLPAALVVGWSQRNEPGVRFALCWLIPTWLMFELLPTKLVHYELPAYGAL
FT                   AMLMAAAVRAPIGARSRWIGGGLSVLMGAVLAAVAIYGQTAFGGTGDLVWTIIAAGLAF
FT                   GAGLVGAVLLLRRQSVRALVFAGALGVGAHIALTAGLIPRLEPLFLSKDLAKALDSARL
FT                   SPRSGAPGPVAVTGYAEPSMIFQLGTTTELTDGAGAAQAVAEGRPAIVEAREEKPFQAA
FT                   LAKLGLTAKPAAVVEGLNYSDGDEERLTIYRGEPIAPQEAQP"
FT   gene            518474..519211
FT                   /locus_tag="CCNA_00502"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        518474..519211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00502"
FT                   /product="glycosyl transferase family protein"
FT                   /note="CC_0469"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00502"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93967"
FT                   /db_xref="GOA:A0A0H3C700"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C700"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93967.1"
FT                   /translation="MNVARASAPDFSVVVPVFDEGEAAPKLAREIAVAFAGENYEMIFV
FT                   DDASRDDTKARLIALKAEIPQLRVLGHRKNSGQSRAVRSGILAARGGIIVTLDGDGQND
FT                   PADAPRLAKTLAAGPETLALVGGERVKRQDSSAKRFASKVGNGVRKRLLKDTAKDTGCG
FT                   LKAFRREAFLRLPYFDHIHRYIPALMLREGYEVAFQPVNHRHRETGVSKYTNLGRLKAS
FT                   ISDLLGVMWLQSRARNPQGVDEV"
FT   gene            519310..519732
FT                   /locus_tag="CCNA_00503"
FT   CDS_pept        519310..519732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00503"
FT                   /product="hypothetical protein"
FT                   /note="CC_0470"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93968"
FT                   /db_xref="GOA:A0A0H3C3W3"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3W3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93968.2"
FT                   /translation="MFAAVPLLALPVIVYNLVALTLTGGFKATDATARMNEALFTIHMT
FT                   SRTDWAVSLGDLLMAASLVVLFVELLKSTTSRKIAIINHSLSMVLFILCLVEFLLAPAF
FT                   ATSTFFLITLMVLLDVLAGFIVTIVAARRDVDFGDN"
FT   gene            complement(519729..520193)
FT                   /locus_tag="CCNA_00504"
FT   CDS_pept        complement(519729..520193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00504"
FT                   /product="23S rRNA methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="CC_0471"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93969"
FT                   /db_xref="GOA:A0A0H3C4U6"
FT                   /db_xref="InterPro:IPR001537"
FT                   /db_xref="InterPro:IPR016914"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4U6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93969.1"
FT                   /translation="MRIALFQPGIPQNVGACIRLTACFGLGLDVIEPCSFPLNDKSLKR
FT                   AALDYGSLSHLTRHDSWETFLKAPERVDGRLLLFTTKGATPFHRFSFEPGDTLLFGNES
FT                   RGAPEEVHAAAHGRIVIPIRPEARSMNLATTAAMALGEALRQTGGFPEAG"
FT   gene            520398..520949
FT                   /locus_tag="CCNA_00505"
FT   CDS_pept        520398..520949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00505"
FT                   /product="ubiquinol-cytochrome c reductase iron-sulfur
FT                   subunit"
FT                   /EC_number="1.10.2.2"
FT                   /note="CC_0472"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93970"
FT                   /db_xref="GOA:A0A0H3C5K1"
FT                   /db_xref="InterPro:IPR005805"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR006317"
FT                   /db_xref="InterPro:IPR014349"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR019470"
FT                   /db_xref="InterPro:IPR019546"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5K1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93970.1"
FT                   /translation="MADTAVGATTEPEHGGDPSRRDFIHIAAIAAAAGGAATLAWPFID
FT                   QMNPSADTLAMASTEFDLTKVPEGQQVTLKWRGKPLFVRNRTKGEIDKAVADDTVSMKD
FT                   PQKDADRVKPGKAQWLVLIGSCTHLGCVPTFGGGDFGGWFCPCHGSHYDTSGRIRKGPA
FT                   PLNLAVPEYEFLSDTKVKIG"
FT   gene            520955..522235
FT                   /locus_tag="CCNA_00506"
FT   CDS_pept        520955..522235
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00506"
FT                   /product="cytochrome b"
FT                   /EC_number="1.10.2.2"
FT                   /note="CC_0473"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93971"
FT                   /db_xref="GOA:A0A0H3C607"
FT                   /db_xref="InterPro:IPR005797"
FT                   /db_xref="InterPro:IPR005798"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR027387"
FT                   /db_xref="InterPro:IPR030689"
FT                   /db_xref="InterPro:IPR036150"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C607"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93971.1"
FT                   /translation="MSGHSTYQPKTGFERWLDARLPIIRLGYDSFVDYPTPRNLNYWWT
FT                   FGGILSLCLASQLITGIILVMHYTPSADHAFASVEHIMRDVNYGWLIRYMHSNGASMFF
FT                   IAVYIHMMRGLYYGSYKAPREVLWLLGCVIYLLMMATAFMGYVLPWGQMSFHGAVVITN
FT                   LFGALPIVGESITTWLWGGFAVDNATLNRFFSLHYLLPFMIAGVVILHIWALHVVGQNN
FT                   PTGVEPKSKADTVPFTPYATVKDGFAMSVFMILFAYFVFFMPNALGHPDNYIEANPLVT
FT                   PAHIVPEWYFLPFYAILRAVPDKLMGVLAMFGAIGCLFALPWLDTSKVRSMRYRPTAKV
FT                   YFMIFVVACCILGLCGAKLPDDKVIPHLTTFKLIDADLNSFVWLSRVASLYYFAFFLVI
FT                   LPILGLKEKPLPVPESIASPALTEKKG"
FT   gene            522241..523086
FT                   /locus_tag="CCNA_00507"
FT   CDS_pept        522241..523086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00507"
FT                   /product="cytochrome c1"
FT                   /note="CC_0474"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93972"
FT                   /db_xref="GOA:A0A0H3C704"
FT                   /db_xref="InterPro:IPR002326"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C704"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93972.1"
FT                   /translation="MLRKLSIIAAVAGLAFAGQALAAGHPLPPKDVKWSFEGPFGKFDQ
FT                   VQLQRGYKVYREVCASCHSMKLVSFRNLGDKGGPFYNEKYKNSNDNPWVKAIAKEYEVA
FT                   DIDSETGDPIKRPATSADHFPAPFPNEIAARGANGGALPPDMSLLAKARANGPDYIYSL
FT                   LVGYVNPPAGLKIGPGQHYNPYMAGDLTAYWSGSHEKVPPGGFIAMAQPLKDGQVTFDD
FT                   GTKSTLDQQAKDVSAFLMWAAEPKLEQRKQTGFAVIIYLLLLSGLLYASYKRVWRNESH
FT                   "
FT   gene            complement(523154..523927)
FT                   /locus_tag="CCNA_00508"
FT   CDS_pept        complement(523154..523927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00508"
FT                   /product="aspartate protease"
FT                   /note="CC_0475"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93973"
FT                   /db_xref="GOA:A0A0H3C3W8"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3W8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93973.1"
FT                   /translation="MRSRVSFLIAFAALPWATLGVAHAGETRCWFENGAVIAPAAIGDM
FT                   AGDYVVDLSAPRTLLHNTKAQMAGITTEAVTLPVQIAGLKASAVTVTIADLDDRGAGFV
FT                   TPIAGVIGMDVLAGHSIEIDFSACQVRIDQPWRARRQVVLPVEVIDGLPTIAAAVSDGP
FT                   TARSGAFAIDTASRAMARLSTREGRVAGKLDVNARHKAPARLRALSIAGVLAENVPATL
FT                   AEDLPEGVSGTLGTALWARHRLRLSADARTLSIAP"
FT   gene            complement(523993..524526)
FT                   /locus_tag="CCNA_00509"
FT   CDS_pept        complement(523993..524526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00509"
FT                   /product="phosphoglycerate mutase family"
FT                   /note="CC_0476"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93974"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4V1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93974.1"
FT                   /translation="MNMIRRLTALTLSLMLAGGPALAQTVVIVRHGEKVSPNGDPDLSD
FT                   AGKARAQALAAALAGARVSTVLATPLKRTQQTAQPTADAAGLVIRTIALDGGVPAHAQR
FT                   VAEVARQAPKDATVLIVGHSNTVGEIARALGDAAPSPVTDCDYDQMTIISLDAPTARTL
FT                   HARYGAPTLPCPTN"
FT   gene            complement(524523..525200)
FT                   /locus_tag="CCNA_00510"
FT   CDS_pept        complement(524523..525200)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00510"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="CC_0477"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93975"
FT                   /db_xref="GOA:A0A0H3C5K6"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5K6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93975.1"
FT                   /translation="MGERIALATREGAPLAAYHAPPLEARRGGIVMLHAIWGVTPHLRQ
FT                   LSDSLAEQGYEVMLPSLMDAADAAFPVEDTTPSILDARMAMGERTGWGASTLPRVQACI
FT                   DALNGPVYAMGFCYGGTTAWLAACRCEGLSAVSAFYGGDIAAYRDETPKVPTILHFGKT
FT                   DTMIPLSAVDAVRDRHPDLPVYLYDAGHAFVAPSGHHPDSARLALLRTLQLFQRSSGTR
FT                   AEA"
FT   gene            complement(525200..525880)
FT                   /locus_tag="CCNA_00511"
FT   CDS_pept        complement(525200..525880)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00511"
FT                   /product="carboxymethylenebutenolidase"
FT                   /EC_number="3.1.1.45"
FT                   /note="CC_0478"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93976"
FT                   /db_xref="GOA:A0A0H3C611"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C611"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93976.2"
FT                   /translation="MAKTITLTAAHDGFTFTALHAEPEGPRKGGVIVIQEIFGLDQYVH
FT                   QDVARWTARGFEVIAPSMFDRQEKGFTALHDPAGFENGVKHALANGPDNAMGDIQACVD
FT                   FLKARGPVFVVGYCYGGTMTWLAASRCEGIAAGSSYYGGQVAGMAKFALKAPVIVHLGR
FT                   KDPHIPADEVKAAVQAAHPEVPVYIYESSGHGFNNDGRPDSDLADAELARQRTVDFFAA
FT                   HGAG"
FT   gene            complement(525945..527045)
FT                   /locus_tag="CCNA_00512"
FT   CDS_pept        complement(525945..527045)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00512"
FT                   /product="GTP-binding protein, probable translation factor"
FT                   /note="CC_0479"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93977"
FT                   /db_xref="GOA:A0A0H3C709"
FT                   /db_xref="InterPro:IPR004396"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR013029"
FT                   /db_xref="InterPro:IPR023192"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031167"
FT                   /db_xref="InterPro:IPR041706"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C709"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93977.1"
FT                   /translation="MALKVAIVGLPNVGKSTLFNALTQTASAQAANYPFCTIEPNTGDV
FT                   AVPEPRLNALAKIAGSKEIIPARINFVDVAGLVRGASKGEGLGNQFLANIRDCDAVAFV
FT                   ARCFEDSDITHVEGRIDPISDLEIIEMELMLADLESLEKRLPNVEKRAKSGGDKDMIQT
FT                   LRLINLALEQLRAGRPARAAQVDKEDAKAWAMLQLLTSLPALYVCNVEEASADKGNKFS
FT                   DLVAERAARDNAKSVVISAQIESEIALLDEEERTEFLETLGLAEPGLNRLIREAYSLLG
FT                   LQTYFTVGPKEARAWTIPVGATGPQAAGVIHTDFEKGFIRAETIAFDDYVKLGGENGAK
FT                   EAGKMRSEGKEYVVKDGDVMHFRFNV"
FT   gene            527284..527934
FT                   /locus_tag="CCNA_03885"
FT   CDS_pept        527284..527934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03885"
FT                   /product="Abi superfamily/CAAX amino terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03885"
FT                   /db_xref="EnsemblGenomes-Tr:AGJ94599"
FT                   /db_xref="GOA:A0A0H3IC28"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IC28"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AGJ94599.2"
FT                   /translation="MAMLGLALAAAYVLPLLLVAITYKQQGLSWLKPSMLWLFAAICVA
FT                   IILLAQSPGDTVRALGLVSITARSLVIALAIVFALAAGSAVVLFVQRRLGLPLGDKATY
FT                   TRIAEAPLSLRAFAVLTAGVVEELLYRGIGIGVGDLLIGDAALAAVLSVIAFTAAHFRW
FT                   QVAHLVQVAVAGAILSAAFLLTRDLWACVIAHLLVDALGFIVVPALRKRVAKA"
FT   gene            528078..528908
FT                   /locus_tag="CCNA_00514"
FT   CDS_pept        528078..528908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00514"
FT                   /product="pirin"
FT                   /note="CC_0481"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93979"
FT                   /db_xref="InterPro:IPR003829"
FT                   /db_xref="InterPro:IPR008778"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR012093"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3X4"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93979.1"
FT                   /translation="MPVRPVLKIVKGQPTSDGAGVRLTRMLGTPEAQMFDPFLMLDCFD
FT                   NDQASDYLGGFPDHPHRGFETVTYMLEGRMRHKDNTGREGVIGPGGIQWMRAGKGIVHS
FT                   EMPEQDQGRMRGFQLWVNLPARLKMSAPGYQEFETDSIPVEARDGGVTVKVISGATETG
FT                   TAGPIGGGAVDALYFDVALPAGTVFEEPVGDDRNAMLAVYEGKVRVAHDTVDALSGVFL
FT                   GRGDTVRVEAVTDARVLLLAGRPIGEPVFWHGPFVMDTREGLMQAFDDFQRGRF"
FT   gene            529324..531657
FT                   /locus_tag="CCNA_00515"
FT   CDS_pept        529324..531657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00515"
FT                   /product="5-methyltetrahydropteroyltriglutamate--homocysteine
FT                   methyltransferase"
FT                   /EC_number="2.1.1.14"
FT                   /note="CC_0482"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93980"
FT                   /db_xref="GOA:A0A0H3C4V6"
FT                   /db_xref="InterPro:IPR002629"
FT                   /db_xref="InterPro:IPR006276"
FT                   /db_xref="InterPro:IPR013215"
FT                   /db_xref="InterPro:IPR038071"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4V6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93980.1"
FT                   /translation="MTVTIATLGFPRIGPKRELKFALEAYWAGKTDADALLDTARDLRA
FT                   KTWTRQAALGVAHVPSNDFSLYDHVLDTAVMVGAIPAAYGWSGGTVDLATYFAMARGDQ
FT                   GRPAAEACGPGCGHAPGADGVPALEMTKWFDTNYHYLAPELSPGQAFALTSSKPVDEFL
FT                   EAKALGVHTRPVLLGPVTFLKLAKTKAEGFSPLSLLSALLPVYGQVLRGLAAAGADWVQ
FT                   IDEPCLALDLTDFERAELRRAYGALTHAAPGVRLMLTSYFGGYGENLATAVNLPVEGLH
FT                   LDLVRAPDELEAALAASRESLVLSLGVIDGRNVWRADLPALLDRLEPVVARRGSDRVVL
FT                   APSCSLLHTPIDLDLETALDPEIRQWLAFAVQKVEALAVLAQALNGGRASVAAALEASA
FT                   QAARARATSPRIHDPKVAERLAAVTPDMTRRRSPYDQRREAQRARLNLPPLPTTTIGSF
FT                   PQTTEVRQARAAFAKGQISDATYEAFLRQETARAVAWQETVGLDVLVHGEFERNDMVQY
FT                   FGEQLAGFAFTQSGWVQSYGSRCVRPPILFGDVSRPAPMTVDWWRYAQGLTRRPMKGML
FT                   TGPVTILNWSFVRDDLPRETACRQIALAIRDEVVDLEATGAAIIQIDEAALREGLPLRR
FT                   GDWDAYLDWAVESFRLAASGVADATQIHTHMCYSEFNDIIAAIGAMDADVISIETARSK
FT                   MELLDAFVGYAYPAQIGPGVYDIHSPRVPAVEEMTTLLAAARQRLAGEQLWVNPDCGLK
FT                   TRKWPETQAAIVNMVEAARRARAS"
FT   gene            complement(531683..532432)
FT                   /locus_tag="CCNA_00516"
FT   CDS_pept        complement(531683..532432)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00516"
FT                   /product="integral membrane protein"
FT                   /note="CC_0483"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93981"
FT                   /db_xref="GOA:A0A0H3C5M9"
FT                   /db_xref="InterPro:IPR011717"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR014562"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5M9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93981.1"
FT                   /translation="MFSLPLPLLGLSLLFSIALCVHVVRTHREMYWLWIILLFQPVGGV
FT                   VYLVAVILPELLRGRTAQKVGAAARQALDPQREYREAAKAVEDAPTVANRVRLAVAATE
FT                   LGRHAEAEALYAESLAGLYADDPQLLLGRANALIELDRPAEALPLLEKLGETPTAGRTP
FT                   HTMLALGRVYHALGREEQAETALRWAADHYPGFEGVARYTVFLASQGRQDEARAQLAEI
FT                   DKRLAKTHAHFRKEAKGWRDFAAGAVN"
FT   gene            complement(532435..533052)
FT                   /locus_tag="CCNA_00517"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(532435..533052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00517"
FT                   /product="peptidyl-tRNA hydrolase"
FT                   /EC_number="3.1.1.29"
FT                   /note="CC_0484"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93982"
FT                   /db_xref="GOA:B8GZU8"
FT                   /db_xref="InterPro:IPR001328"
FT                   /db_xref="InterPro:IPR018171"
FT                   /db_xref="InterPro:IPR036416"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZU8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93982.1"
FT                   /translation="MLILAGLGNPEPKYEKNRHNVGFMAVDALARKWGTAPWRARFQGL
FT                   ACEGQVSTPDGPVKLLLLKPKTYYNESGRAVGEAMKFFKLQPTDVIVFHDEIDMAPGRF
FT                   RMKSGGGAAGNNGIRSVTSQVGDAFRRGRIGVGHPGHKDAVMHYVLGDFHKVEHQWLDP
FT                   ILDAIADALPFAAVGDDERYQAEVMRLAPAPKADPRKPAKDD"
FT   gene            complement(533140..533733)
FT                   /locus_tag="CCNA_00518"
FT   CDS_pept        complement(533140..533733)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00518"
FT                   /product="LSU ribosomal protein L25P"
FT                   /note="CC_0485"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93983"
FT                   /db_xref="GOA:B8GZU9"
FT                   /db_xref="InterPro:IPR001021"
FT                   /db_xref="InterPro:IPR011035"
FT                   /db_xref="InterPro:IPR020056"
FT                   /db_xref="InterPro:IPR020057"
FT                   /db_xref="InterPro:IPR029751"
FT                   /db_xref="InterPro:IPR037121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZU9"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93983.1"
FT                   /translation="MAEIILNVEVRDGAGTGNARATRRAGKVPGVLYGGGKAPVNIAVK
FT                   ANEFRKSLYTGKLLGHLVTLQYGEEKQSVIAKAVQFHPVTDEPVHFDLYRVDEHQLIKI
FT                   EVPVHFKNHETSVGLKKGGTLEVIRHTVELACPADKIPEELVIDLAGHDIGDVIRISEV
FT                   KLPEGVKPAMDRDFVIANVKASSAAQSDAGDTTA"
FT   gene            complement(533891..534967)
FT                   /locus_tag="CCNA_00519"
FT   CDS_pept        complement(533891..534967)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00519"
FT                   /product="hypothetical protein"
FT                   /note="CC_0486"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93984"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C615"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93984.1"
FT                   /translation="MRSFSRTRVVLTTTAVALAAMVAACSSPPPPPPPPVVQAPPPPPP
FT                   ITLSASVVERASAFRGYMARASQVSPTFQNGEQIQASLKVGAAYETKSFMNGAVAYAAV
FT                   LALQDPTFVASVREVAANPAQRQEMVNNIFSNPSYATMFKGADSAAGLIIDTIGGDGLK
FT                   LFMAGKAVKQAAYDVQKSTWSKATVVDRDGRLASTKSLSTSPALAESADVAVLQQASTG
FT                   GQSLGLTPRAAEAPYSPVVVRGLAVAALAALGAAGDENLTSIDALSVDPATNSCLNMAK
FT                   LNLYQCLAVSKPHYEDIFCLGQHILIDTGACVIKAAGATVPPEPPRVLPVKESIATRGA
FT                   GSNSRKAKTPAKKPAKKG"
FT   gene            complement(535198..536136)
FT                   /locus_tag="CCNA_00520"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(535198..536136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00520"
FT                   /product="ribose-phosphate pyrophosphokinase"
FT                   /EC_number="2.7.6.1"
FT                   /note="CC_0487"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93985"
FT                   /db_xref="GOA:B8GZV1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR000842"
FT                   /db_xref="InterPro:IPR005946"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR029099"
FT                   /db_xref="InterPro:IPR037515"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZV1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93985.1"
FT                   /translation="MKLLSGNSNRPLSQAIAEYLDMPLTRAQVRRFADLEVFVTIDENV
FT                   RGEDVFVIQSTSYPANDNLMELLICIDALKRASGKRITAVIPYFGYARQDRKTGGRTPI
FT                   SAKLVANLITRSGADRVLTMDLHAGQIQGFFDIPTDNLLPSRLMAEDIRRHYPMGDDLM
FT                   VVSPDVGGVVRARALAKRLDDADLAIVDKRRSGPGQSEVMNIIGDVKDRRCILFDDIAD
FT                   SAGTLCNAAQALMAHGAKSVSAYITHGVLSGAAADRVANSVLTELVVTDSIEASDPAKA
FT                   CPKIRYVSCAPLIGEAIRRIANEESVSKLFD"
FT   gene            complement(536277..536528)
FT                   /locus_tag="CCNA_00521"
FT   CDS_pept        complement(536277..536528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00521"
FT                   /product="antitoxin protein"
FT                   /note="CC_0488"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93986"
FT                   /db_xref="GOA:A0A0H3C712"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR022148"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C712"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93986.1"
FT                   /translation="MTKAVPKLTTDDEAEAFLTQDLSDLNFSQFKPMRFELEKKEARVN
FT                   MRLPEPLLEAVKKRASARGIPYQRFIREALETALSEGN"
FT   gene            complement(536509..536805)
FT                   /gene="brnT"
FT                   /locus_tag="CCNA_00522"
FT   CDS_pept        complement(536509..536805)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="brnT"
FT                   /locus_tag="CCNA_00522"
FT                   /product="BrnT-related ribonuclease toxin"
FT                   /note="CC_0489"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93987"
FT                   /db_xref="InterPro:IPR007460"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Y0"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93987.1"
FT                   /translation="MLLAEDFDWDDGNREKCQKHGVSIAEIEAVLLGDPLVAPDLAHSD
FT                   VEDRRIAVGKTPEGRAMFIAFTLRTKDGKLHLRPVSARYMHAKEARRYDQSRS"
FT   gene            complement(536853..537638)
FT                   /locus_tag="CCNA_00523"
FT   CDS_pept        complement(536853..537638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00523"
FT                   /product="multicopper polyphenol oxidase"
FT                   /EC_number="1.10.3.2"
FT                   /note="CC_0490"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93988"
FT                   /db_xref="GOA:A0A0H3C4W1"
FT                   /db_xref="InterPro:IPR003730"
FT                   /db_xref="InterPro:IPR011324"
FT                   /db_xref="InterPro:IPR038371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4W1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93988.1"
FT                   /translation="MKTPALPTVQSPLLSSLPGVKHAFFTRQGGVSKGIYDSLNVGRGS
FT                   QDEPADVEENRARIARWFGGGPEDLNVCYQIHSTIAIVADGSWGDARPEGDAVVSKTPG
FT                   VICGAMAADCAPVLLVDPEARIVAAAHAGWRGALDGVVQSAVDRMVELGASPANITGVV
FT                   GPCIGPKSYEVGLEFLHRFEADCPGSGRFFKPGASEDKRFFDLPAFVLDRLATAGVERR
FT                   EWVGRDTRAEEEWFFSNRRAFLNNDGDYGRLLSAITLEA"
FT   gene            complement(537635..538759)
FT                   /locus_tag="CCNA_00524"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(537635..538759)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00524"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="CC_0491"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93989"
FT                   /db_xref="InterPro:IPR003788"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR038375"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5N5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93989.1"
FT                   /translation="MSLLDRLKAQIAQDGPIGVPEFFTRCLHDPRDGYYATRPDLGAGG
FT                   DFITAPLVSQMFGELIGLWVLETWTRMGRPAPFRLVEMGPGDGTLMSDLLRAGRLDPAF
FT                   LEAAQVWLVEVSEPLKARQAARLGEGPRWASRLDEVPGGAPMILVANELLDCLPARQFI
FT                   RTRTGWAERVIGLGEGGALAFGLRAINPPPRGRGPVGHAPSPSGPSDHLPRWGEELEAG
FT                   AVVESSPAQAALASDIAHRLVIDGGAALLIDYGRAELEPGDTLQAIQNHRKVDPLETAG
FT                   LADLTVWADFPSVITAARDTGAKAGPILTQGAFLVALGIIQRAEALAARQPERGDQIAR
FT                   QLDRLIGEAQMGELFKVACLCAPDLSPPLFEDAT"
FT   gene            complement(538746..539654)
FT                   /locus_tag="CCNA_00525"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        complement(538746..539654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00525"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /EC_number="2.4.99.-"
FT                   /note="CC_0492"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00525"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93990"
FT                   /db_xref="GOA:B8GZV6"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZV6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93990.1"
FT                   /translation="MIFPNIDPVVHIGPWALQFGPLALRWYALAYVAGILLGWRYALRL
FT                   TRTASVWGARTPTATALQIDDLVLWITLGIIVGGRLGYFVFYMLMNDDQRAWLAAHPMD
FT                   VFKIWEGGMSFHGGFLGVCAAIILFARQQKIDMLRLGDLIAPVAPIGIFFGRIANFING
FT                   ELWGRVTDGPFGIIFCNETIQANHPQRICPAGPLPRHPSQLYEAALEGLVLFLILAFAI
FT                   YRLKWLRRRGALVATFLLGYGLARLALENVRNPDVGMPEFPLGLTMGMMLSIPMILAGG
FT                   WLLWKSLKEPIRDDAEAHEPA"
FT   gene            539769..540026
FT                   /locus_tag="CCNA_00526"
FT   CDS_pept        539769..540026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00526"
FT                   /product="BMFP membrane fusogenic protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93991"
FT                   /db_xref="InterPro:IPR007475"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C618"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93991.1"
FT                   /translation="MHSQNPFLDEFAKLTQAAMGIAQTAGEEAKTAMRAQADRLAAEFD
FT                   LIRRDDFEALKAEVAALREEVAALKAAKKAPAKKTASSGE"
FT   gene            540157..540663
FT                   /locus_tag="CCNA_00527"
FT   CDS_pept        540157..540663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00527"
FT                   /product="hypothetical protein"
FT                   /note="CC_0493"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93992"
FT                   /db_xref="InterPro:IPR019660"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C716"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93992.1"
FT                   /translation="MDTQPEDDDVLMALDPLEVVEHVLSAENLTFDRTEDGDLAFALKG
FT                   DWKDYELWFAWRPEADCLQLCLSLDLRAPKSKRANAYELLALINQRVWLGHFEVWTEDG
FT                   EVVFRHALALPSGERPTMAQAASMIDAAVEAADRFFPAFEFLLQGAKTPDQAMAACMFE
FT                   TVGQA"
FT   gene            540844..541626
FT                   /locus_tag="CCNA_00528"
FT   CDS_pept        540844..541626
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00528"
FT                   /product="pyrroline-5-carboxylate reductase"
FT                   /EC_number="1.5.1.2"
FT                   /note="CC_0494"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93993"
FT                   /db_xref="GOA:A0A0H3C3Y5"
FT                   /db_xref="InterPro:IPR000304"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR028939"
FT                   /db_xref="InterPro:IPR029036"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Y5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93993.1"
FT                   /translation="MTPILLLGAGRMGGALIQGWQAAGAFDAADLIIRDPHVDAAAFAG
FT                   AVVNPPLETLGAAKTVLLAVKPQIWREAIADVVPHLAPDAVIVSIAAGVRAADISQAFG
FT                   GRRVARVMPTTAVAIGQGAASLYADDAEALARARALFAPLAAVAELASEDLMHAATAVS
FT                   GSAPAYLYAFIEALEAAGAAQGLDPAQSARLARATIIGAAALMAQSGEEPAELRKQVTS
FT                   PGGTTAAALSVLMGAGGFGDLLPKALDAAVARSKELGG"
FT   gene            541695..542231
FT                   /locus_tag="CCNA_00529"
FT   CDS_pept        541695..542231
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00529"
FT                   /product="hypothetical protein"
FT                   /note="CC_0495"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00529"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93994"
FT                   /db_xref="GOA:A0A0H3C4W5"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4W5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93994.1"
FT                   /translation="MTADILDRAAAAALALAADKPWPQVALRDIAVKADVSFAALYALA
FT                   DSKAAVLNHLSTRFDQAALGVDYPATAAVHDRLFDAAMARIEAMEPHRAALIAIASAEG
FT                   VLASAARFPRIARAILEAAGVEATVPRLAAMAAVWARVVQVWRDDEGALNRTMAELDKR
FT                   LKQMAAQLSKVGAGV"
FT   gene            542581..543099
FT                   /locus_tag="CCNA_00530"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        542581..543099
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00530"
FT                   /product="LSU ribosomal protein L10P"
FT                   /note="CC_0496"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93995"
FT                   /db_xref="GOA:B8GZW1"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZW1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93995.1"
FT                   /translation="MDRAQKQESIESLKSVFADAGAVVVTHYMGLTVAEMTDLRLRLRK
FT                   EGAAIKVVKNTLALKALDGKLGDKGDKLFTGPVAIAYGPDAVSAAKIAVQFAKENDKLK
FT                   IVGGVLDQTNVLDEAGVRALATLPSLDELRGKLIGLIQAPATKIAGVLQAPAAQLARVF
FT                   NAYATKDAA"
FT   gene            543145..543528
FT                   /locus_tag="CCNA_00531"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        543145..543528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00531"
FT                   /product="LSU ribosomal protein L12P (L7/L12)"
FT                   /note="CC_0497"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93996"
FT                   /db_xref="GOA:B8GZW2"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZW2"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL93996.1"
FT                   /translation="MSKLEKLVEELSTLSVLEAAELSKLLEEKWGVSAAAPVAVAAAGG
FT                   AAAAPAEAAEEQTEFTVVLVDGGDKKINVIKEVRGVRPDLGLKEAKDLVEGAPQNVVEN
FT                   VSKQQAEEISKKLTEAGAKIQIK"
FT   gene            543952..544842
FT                   /locus_tag="CCNA_00532"
FT   CDS_pept        543952..544842
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00532"
FT                   /product="hypothetical protein"
FT                   /note="CC_0498; RDD superfamily"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93997"
FT                   /db_xref="GOA:A0A0H3C5P1"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5P1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93997.1"
FT                   /translation="MSSRYWGYLGPTGEGGPVSTDELALFLRERLITVDTPVRPAEGMR
FT                   WEPLAYWLPELAPFAVRPDDTRVRPDPGPSNSPQPFADQPVEPRAPAALEELPFVLAPS
FT                   PGPAAPSSRRGWTDRAPHPWRRYGARLLDAAVLGYPTALLLGAIGGVVAPTQTQGVITF
FT                   LTTDLWGRVADIMLNVLLVIPAHAILLGLTGSTPGKWLFGIRIVRPDGRPIGVFTAFWR
FT                   ELRVWFQGLAMGIPFVSLFTLFAGFSWLKDDGHTPWDPPKRRVALHRPQGAAQVLLALL
FT                   GLALLIAVRVWEAQP"
FT   gene            complement(544865..546187)
FT                   /gene="hfsI"
FT                   /locus_tag="CCNA_00533"
FT   CDS_pept        complement(544865..546187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hfsI"
FT                   /locus_tag="CCNA_00533"
FT                   /product="secreted polysaccharide polymerase hfsI"
FT                   /note="CC_0499"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93998"
FT                   /db_xref="GOA:A0A0H3C622"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C622"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93998.1"
FT                   /translation="MTTPYRHPDQATAVPLDLVGGGDRPRIDITFWACVFATLIFSQFY
FT                   LLLLTGPGTGGASPQSSAANSQSAFLRLIFLPVYLIVLLVICARPLRFLAVLTRSWLLL
FT                   GLLSIAVCSVLWSLQPDVTIRRLVAVVFTTLTGVLLAERFEWPKTLEVLASTYAVVVTL
FT                   SFVFGLFMPAYGVMSIDFPGAWRGVYGFKNQLGWAMSLATPTFLACALANPQRRRLWLG
FT                   FAGAALLLIVLSTSKTALVSCLAGLAFMPLIALCRIGPALGTTALLAAVSVVALVGAVY
FT                   ALAPELVFELIGRDATFTGRTLIWDAISRQIEQRPLTGYGYGAVWDDLSGWGPVAWISN
FT                   DQGFKIFSAHNTVLGVWLELGLIGVTAWLMLLVGAWLKGLSRLATAPAYFFLPFLAIFT
FT                   LHSLTESDALIQNDLGWVIFSMTVTKLAMPFRPGGGERAQS"
FT   gene            546314..547336
FT                   /locus_tag="CCNA_00534"
FT   CDS_pept        546314..547336
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00534"
FT                   /product="hypothetical protein"
FT                   /note="CC_0500"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL93999"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C720"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL93999.2"
FT                   /translation="MIMALSSTTRRAVLVGGFAVIATPAAAGLIIPASVTDSELRGLSP
FT                   TGGKTWWASGSKGWIIRGRGAQQDALRIVGAEALDFRGLHAFHDQHVLAMSAGPGEASQ
FT                   LWRTRDGGQSWARIAANQDPEGFWDSLTFVDDKRGYILGDPTQGRFTVLFTDDAGETWT
FT                   RLDPKGVPLAAPNEGAFAASNGCVAIGPRGQVAFCTGGAGKARVYLSRGGGAFVALETP
FT                   ILADAPSKGAFAVTFAGDGTLWVCGGDYRSPQGEGVNLARRPPGSTRFEPVAAPPGYLS
FT                   GISARGGTVMATGLAGTIVSRDGGAFERVSAAPMNSVRLTSEKAAMLCGPKGAIGLWNG
FT                   "
FT   gene            547379..547537
FT                   /locus_tag="CCNA_00535"
FT   CDS_pept        547379..547537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00535"
FT                   /product="hypothetical protein"
FT                   /note="CC_0501"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00535"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94000"
FT                   /db_xref="GOA:A0A0H3C3Z0"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Z0"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94000.1"
FT                   /translation="MLKLAGVLLALMILFGILGFVVDVAGAITKIAFFICLIGLGVSLA
FT                   MKALRNG"
FT   gene            547831..551901
FT                   /locus_tag="CCNA_00536"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        547831..551901
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00536"
FT                   /product="DNA-directed RNA polymerase beta chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="CC_0502"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94001"
FT                   /db_xref="GOA:B8GZW7"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZW7"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94001.1"
FT                   /translation="MAQSFTGKKRIRKSFGRIPEAVQMPNLIEVQRSSYEQFLQRETRP
FT                   GLRRDEGVEAVFKSVFPIKDFNERAVLEYVSYEFEEPKYDVEECIQRDMTFAAPLKVKL
FT                   RLIVFETEEETGARSVKDIKEQDVYMGDIPLMTDKGTFIVNGTERVIVSQMHRSPGVFF
FT                   DHDKGKTHASGKLLFAARVIPYRGSWLDFEFDAKDIVYVRIDRRRKLPATTFLYALGMD
FT                   GEEILTTFYDVVPFEKRSGGWATPYKPERWRGVKPEFPLVDADTGEEVAPAGTKITARQ
FT                   AKKFADGGLKTLLLAPEALTGRYLARDAVNMATGEIYAEAGDELDVTSIQALADQGFST
FT                   IDVLDIDHVTVGAYMRNTLRVDKNAIREDALFDIYRVMRPGEPPTVEAAEAMFKSLFFD
FT                   AERYDLSSVGRVKMNMRLEQDVSDEVRILRKEDVLAVLKVLVGLRDGRGEIDDIDNLGN
FT                   RRVRSVGELLENQYRVGLLRMERAIKERMSSVDIDTVMPHDLINAKPAAAAVREFFGSS
FT                   QLSQFMDQTNPLSEITHKRRLSALGPGGLTRERAGFEVRDVHPTHYGRICPIETPEGPN
FT                   IGLINSLATHARVNKYGFIESPYRRVKDGKPQDEVVYMSAMEESKHVIAQSNIKVAEGE
FT                   IVEDLVPGRINGEPTLLQKETVDLMDVSPRQVVSVAAALIPFLENDDANRALMGSNMQR
FT                   QAVPLVQSDAPLVGTGMEAVVARDSGAVVIAKRTGVVEQIDGTRIVIRATEETDPARSG
FT                   VDIYRMSKFQRSNQSTCINQRPLVKVGDRIVAGDIIADGPSTELGELALGRNALVAFMP
FT                   WNGYNFEDSILISERIVRDDVFTSIHIEEFEVMARDTKLGPEEITRDIPNVGEEALRNL
FT                   DEAGIVAIGAEVQPGDILVGKVTPKGESPMTPEEKLLRAIFGEKASDVRDTSLRLPPGV
FT                   AGTIVDVRVFNRHGVDKDERALAIERAEIDRLGKDRDDEFAILNRNISGRLKELLIGKV
FT                   ALSGPKGLSRGEITAEGLAQVASGLWWQIALEDEKAMGELESLRRLFDENRKRLDRRFE
FT                   DKVDKLQRGDELPPGVMKMVKVFVAVKRKLQPGDKMAGRHGNKGVISRILPIEDMPFLA
FT                   DGTHVDVVLNPLGVPSRMNVGQIFETHLGWACANLGKQITNLLEDWQQGGQKQALVERL
FT                   TEIYGPDEELPDTEEGLVELARNLGKGVPIATPVFDGARMDDIEGHLEMAGVNKSGQSI
FT                   LFDGLTGEQFKRPVTVGYIYMLKLHHLVDDKIHARSIGPYSLVTQQPLGGKAQFGGQRF
FT                   GEMEVWALEAYGAAYTLQEMLTVKSDDVAGRTKVYESIVRGDDTFEAGIPESFNVLVKE
FT                   MRSLGLNVELENS"
FT   gene            552015..556205
FT                   /locus_tag="CCNA_00537"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        552015..556205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00537"
FT                   /product="DNA-directed RNA polymerase beta' chain"
FT                   /EC_number="2.7.7.6"
FT                   /note="CC_0503"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00537"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94002"
FT                   /db_xref="GOA:A0A0H3C4W8"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4W8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL94002.1"
FT                   /translation="MNQEVLNIFNPVQAAPTFDQIRISLASPEKIRSWSFGEIKKPETI
FT                   NYRTFKPERDGLFCARIFGPTKDYECLCGKYKRMKYKGIICEKCGVEVTLARVRRERMG
FT                   HIELASPVAHIWFLKSLPSRIAMMLDMPLKDIERVLYFEYYIVTEPGLTPLKQHQLLSE
FT                   DDYMRAQEEYGDDSFTAEIGAEAIQNLLKAIDLEKEAERLREELSGTVSDMKQKKFSKR
FT                   LKILEAFQESGNRPEWMVLTVVPVIPPELRPLVPLDGGRFATSDLNDLYRRVINRNNRL
FT                   KRLIELRAPDIIIRNEKRMLQESVDALFDNGRRGRVITGANKRPLKSLADMLKGKQGRF
FT                   RQNLLGKRVDYSGRSVIVVGPELKLHECGLPKKMALELFKPFIYARLDAKGLSGTVKQS
FT                   KRMVEREQPQVWDILEEVIREHPVLLNRAPTLHRLGIQAFEPKLIEGKAIQLHPLVCAA
FT                   FNADFDGDQMAVHVPLSLEAQLEARVLMMSTNNILSPANGRPIIVPSQDIVLGLYYLSV
FT                   ARDGEPGEGKIFADLGEIEAAMDAGVVSLHAKIKARHTEMTPEGVLLRKVIDTTPGRMK
FT                   IAALLPHHPQIGHRLIEKALTKKEIGNLIDIVYRHCGQKATVIFADKVMGLGFKEAAKA
FT                   GISFGKDDIIIPVRKTAIVEETRKLAEEYEQQYADGLITKGEKYNKVVDAWAKATDRVA
FT                   DEMMAELQMKHKDENGREKEINAIYMMAHSGARGSQAQMKQLGGMRGLMAKPSGEIIET
FT                   PIVSNFKEGLTVQEYFNSTHGARKGLADTALKTANSGYLTRRLVDVAQDCIIVEEDCGT
FT                   TKGITLRAVVEGGDVLVSLGSRVLGRFTAEDVKDPGTGELVVPADTYIDENIADAIEAA
FT                   VVQSVKVRSVLTCEAKIGVCGACYGRDLARGTPVNIGEAVGVIAAQSIGEPGTQLTMRT
FT                   FHIGGTAQVAEQSFFEASNEGTVRVIGPTVVGSDGALVIMSRNTSVSVLVDGKERETYK
FT                   PPYGARLRVKDGDLVKRGQRLGDWDPYTTPIITEVAGKIRAEDLVDGLSIREEVDEATG
FT                   IAQRVVADWRTSARGSDLRPAMGVLSEDGSYKRLSNGGEARYLLSAGAILSVADGDEVK
FT                   PGEVIARIPTEGAKTRDITGGLPRVAELFEARRPKDCAVIAEMDGRVEFGKDYKNKRRI
FT                   KITPDVDADGNQPEAVEFLIPKGKHIAVHDGDYITKGEYIIDGNPDPHDILRILGVEAL
FT                   ANFLVDEIQEVYRLQGVPINDKHIETIVRQMLQKVEILEPGDTGLIKGDHLDKPEFDKE
FT                   QEKAIARGGRPAVTQPVLLGITKASLQTKSFISAASFQETTRVLTEASVHGKTDTLEGL
FT                   KENVIVGRLIPAGTGSYLRSLQRVAAKRDEQLAQQREDAMEPLPAEIALSDAE"
FT   gene            complement(553414..553828)
FT                   /locus_tag="CCNA_R0109"
FT   ncRNA           complement(553414..553828)
FT                   /locus_tag="CCNA_R0109"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            556424..558220
FT                   /locus_tag="CCNA_00538"
FT   CDS_pept        556424..558220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00538"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CC_0504"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94003"
FT                   /db_xref="GOA:A0A0H3C5P6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5P6"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94003.1"
FT                   /translation="MRISGTLNLFAIVLIAAFALATGTATYALMTLRVGGPLSKQQMEV
FT                   DALVADIMPPPLFIVEALLTAHRGPDELDMGAEIDRDLTTLHASYEDRHAHWATRPLTP
FT                   EVKDGLAASDIQVRKFWDIAEKQFRPALRAGDVAAMNTALDAMTIAYREHRRVITELTP
FT                   LVVGLSKAKVEAAEAQSQRIFIAVGLATALMLIVAAGGVWILRRKMVRPLLGMTGYMGA
FT                   LADGNYDKDVPYQGRADELGDMARSVGVFRTAVLERRAAREQQLAADARAMDAQQRQAA
FT                   QSQADARARDLVVSALDRGLNGLARGELQQRIDEPFPAEFEQLRINFNASVQMLEATLA
FT                   KVIALAGSVGGGAGEISSAADDLSRRTEQQAASLEETAAALQEVTSTIRQSAERAAMAQ
FT                   QATSRSRSSVTQSADLAGEAIGAMERIDTSSRQINQIIGVIDEIAFQTNLLALNAGVEA
FT                   ARAGEAGRGFAVVAMEVRALAQRSADAAKEIKGLIAEASSSVDSGVGLVGRVGQALGAV
FT                   VDEFSGIEALVNDIATTAKEQATGLGQINTAVSQMDQVTQQNAAMVEETTAASHSLKRE
FT                   ASDLMNLVRAFSLSEDVRQKAA"
FT   gene            complement(558249..559709)
FT                   /locus_tag="CCNA_00539"
FT   CDS_pept        complement(558249..559709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00539"
FT                   /product="salicylate hydroxylase"
FT                   /EC_number="1.14.13.1"
FT                   /note="CC_0505"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94004"
FT                   /db_xref="GOA:A0A0H3C627"
FT                   /db_xref="InterPro:IPR011483"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C627"
FT                   /protein_id="ACL94004.1"
FT                   /translation="METMRAWTGLVLAITLGWIAPAHAAPEASAPAKARLIVLSDIENE
FT                   PDDTQSFVRLLLYANEIDIEALVATTSTHMRGEIHPESIRRLVSLYGQVRPNLVLHANG
FT                   YPTAESLSARIRAGQPAYGLAATGPGKDTEGSRAIIAALDSPDPRPVWVSVWGGANTLA
FT                   QALKTLEATRPAAEVQRLISKLRVYTISDQDDAGAWIRKTYPSLFYIVSPGGYGAATWG
FT                   GIFQAVDGLDNTTVSNAWLAQNIQQGRGPLGAAYPDVAYGMEGDTPAFLNLIPTGLADP
FT                   ERPDWGGWGGRYALYTPNLADTDPKGFTGGVPIEPETRPIWTNAIDTVAPHEPAPFGRA
FT                   VKVSARVHKDYRATVWRWRDAFQNDFAARIGWTTLPRDKANHPPVAVLDHADRLTVRAG
FT                   KTFSLSARGSHDPDGDSLSFLWFNYPEAGTWKTSIPANGAENIYRASFTAPAVTKPETA
FT                   HFIVAISDKGAPALTRYRRVIVTFLPAP"
FT   gene            complement(559904..560776)
FT                   /locus_tag="CCNA_00540"
FT   CDS_pept        complement(559904..560776)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00540"
FT                   /product="coproporphyrinogen III oxidase"
FT                   /EC_number="1.3.3.3"
FT                   /note="CC_0506"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94005"
FT                   /db_xref="GOA:B8GZX1"
FT                   /db_xref="InterPro:IPR001260"
FT                   /db_xref="InterPro:IPR018375"
FT                   /db_xref="InterPro:IPR036406"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZX1"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL94005.1"
FT                   /translation="MSTDQDLDTKKAAARAWFESLRDQICAAFEQLEDEAPADLYPGAP
FT                   GRFAKKAWDRPAGGGGVMGMMHGRLFEKVGVHVSTVFGTFTPEMAKTMPGAAEDPRFFA
FT                   TGISLIAHMTNPRVPAVHMNTRFIATTKSWFGGGGDLTPLLGYQRQQDFPDAIDFHAAY
FT                   KRACDKYDPEWHPKYKAWCDEYFFLPHRNEPRGIGGIFYDHHDSGDWARDFAFTQDVGR
FT                   AFLEIYPTLVRRRMGEAWTADEREQQLIQRGRYVEFNLLYDRGTMFGLKTGGNVESILS
FT                   SMPPAVKWP"
FT   gene            complement(560907..560972)
FT                   /locus_tag="CCNA_03923"
FT   CDS_pept        complement(560907..560972)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_03923"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_03923"
FT                   /db_xref="EnsemblGenomes-Tr:AHI88526"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3IXM1"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="AHI88526.1"
FT                   /translation="MSIAVRIFDIVVVALIFTALT"
FT   gene            561036..561344
FT                   /locus_tag="CCNA_00541"
FT   CDS_pept        561036..561344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00541"
FT                   /product="hypothetical protein"
FT                   /note="CC_0507"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00541"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94006"
FT                   /db_xref="GOA:A0A0H3C725"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C725"
FT                   /protein_id="ACL94006.1"
FT                   /translation="MLMALFFDAAWYDQRLVERGLTRGILAAVAGMSEGDLALAFKDQR
FT                   ELSMREINAFAELLGVSAAEAASRAGVRPAPPGDRDRIAALEARVAALEAELARLTR"
FT   gene            complement(561341..561664)
FT                   /locus_tag="CCNA_00542"
FT   CDS_pept        complement(561341..561664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00542"
FT                   /product="hypothetical protein"
FT                   /note="CC_0508"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94007"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C3Z5"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94007.1"
FT                   /translation="MSGPIDPLRRPGSTRRALPGPRDSARNDADEDVVFVVEEDVQPTP
FT                   PPPRRDGFAAFAAHIMGQSGQKRGLRGGQEVLDTARSTYLGTEYSGPADRRPPTGLLKK
FT                   TNI"
FT   gene            complement(561713..562363)
FT                   /locus_tag="CCNA_00543"
FT   CDS_pept        complement(561713..562363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00543"
FT                   /product="methyl-accepting chemotaxis protein"
FT                   /note="CC_0509"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00543"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94008"
FT                   /db_xref="GOA:A0A0H3C4X3"
FT                   /db_xref="InterPro:IPR007897"
FT                   /db_xref="InterPro:IPR010134"
FT                   /db_xref="InterPro:IPR012909"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4X3"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL94008.1"
FT                   /translation="MSENPEKGETTAGGEKSSGQRVIIKKYANRRLYNTASSSYVTLEH
FT                   LSDMVKEGVDFVVYDAKTNDDITRSVLTQIIFEEENRGGGQNLLPIQFLRQLIGFYGNS
FT                   MQAFLPSYLEMSLESFAKQQERLRGQLSTMAPGKMPGMGVYEEQIRQNMALFDRAMKMF
FT                   SPFAYVRPEDAAAAPAEPAPAPAPAPPSDDSLADLKRQLEAMQEQIAKLASKS"
FT   gene            562579..563754
FT                   /locus_tag="CCNA_00544"
FT   CDS_pept        562579..563754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00544"
FT                   /product="acetyl-CoA acetyltransferase"
FT                   /EC_number="2.3.1.9"
FT                   /note="CC_0510"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94009"
FT                   /db_xref="GOA:A0A0H3C5Q0"
FT                   /db_xref="InterPro:IPR002155"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR020610"
FT                   /db_xref="InterPro:IPR020613"
FT                   /db_xref="InterPro:IPR020615"
FT                   /db_xref="InterPro:IPR020616"
FT                   /db_xref="InterPro:IPR020617"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Q0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL94009.1"
FT                   /translation="MSEIVIVSAARTPVGSFNGALASLPASELGKAVIEAAVSRAGIAP
FT                   SDVDEVILGQVLQAAAGQGPARQASVKAGIPVEAPAWSLNQLCGSGLRAVALAAQQIAD
FT                   GSAKVVVAGGQESMSQAPHAQNLRGGQKMGDLQFVDTMIKDGLWDAFHGYHMGQTAENI
FT                   ASRWQITREDQDKFAVTSQNRAEAAQKAGKFDDEIVPITIKGRKGDTIVDKDEFIRHGA
FT                   TIESVQGLKPVFNKEGSVTAANASGLNDGAAALVLMSAEEAAKRGLKPLARIASWANAG
FT                   VEPEIMGTGPIPASKKALEKAGWSVSDLDLVESNEAFAAQALCVVRELGLDPAKVNVNG
FT                   GAIAIGHPIGASGARILTTLVHEMKRSGAKKGLATLCVGGGMGVAMCVEAV"
FT   gene            complement(563800..564505)
FT                   /locus_tag="CCNA_R0110"
FT   ncRNA           complement(563800..564505)
FT                   /locus_tag="CCNA_R0110"
FT                   /product="small non-coding RNA"
FT                   /experiment="EXISTENCE:RNA-seq"
FT                   /ncRNA_class="other"
FT   gene            563825..564547
FT                   /locus_tag="CCNA_00545"
FT   CDS_pept        563825..564547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00545"
FT                   /product="acetoacetyl-CoA reductase"
FT                   /EC_number="1.1.1.36"
FT                   /note="CC_0511"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94010"
FT                   /db_xref="GOA:A0A0H3C629"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C629"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /experiment="Start codon verified by LC-MS"
FT                   /protein_id="ACL94010.1"
FT                   /translation="MTRVAFVTGGTRGIGRAICERLIADGHKVAAGYSGNEAAAEACAK
FT                   ELGVMVVKGNVGVFEDCQAAVKKVEAELGPIDILVNNAGITRDGMLHKMTYEQWSEVIR
FT                   VNMDSAFNMTRPVIEGMRDRSWGRIINISSINGQKGQMGQTNYSAAKAGLIGFTKALAL
FT                   ENAKKGVTVNVICPGYIDTEMVAAVPENVLAQIVAGIPVGRLGRGEEIADMVSFLAGER
FT                   AGFVTGATLTLNGGQYMA"
FT   gene            564671..565453
FT                   /locus_tag="CCNA_00546"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        564671..565453
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00546"
FT                   /product="hypothetical protein"
FT                   /note="CC_0512"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00546"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94011"
FT                   /db_xref="InterPro:IPR032591"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C730"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94011.1"
FT                   /translation="MTFHKAEFGDWGARAALMIAALMLMGAPAHAQQLPHSLRDALLGH
FT                   KGQGEARRAPAPPVARYVSETGGAFVFDQAAPRPLIKFDNSAEIWVLQAQPASRGDVIY
FT                   RNDLGEPVLRVTKLGGIILFTDDAPMGAAVALSGRAQSIQPPAMLSFNVFVQRVRIATA
FT                   RASRAAQRDIEFATVQDVRPETSVLAADTATIVAEAFERMARKGDRSLISGIARVLLAE
FT                   GHKPSASLKDGALTITYSPEQGLAGRPSSKRIIKVINR"
FT   mobile_element  complement(565450..565566)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            565748..565879
FT                   /locus_tag="CCNA_00547"
FT   CDS_pept        565748..565879
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00547"
FT                   /product="PurR-family transcriptional regulator"
FT                   /note="CC_0513"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94012"
FT                   /db_xref="GOA:A0A0H3C400"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C400"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94012.2"
FT                   /translation="MNSETAPAPDRGRLKMADIARMAGVSISTVSRDLPLIFSSTRS"
FT   mobile_element  complement(565843..567108)
FT                   /mobile_element_type="insertion sequence:IS511 family"
FT   gene            565904..566170
FT                   /locus_tag="CCNA_00548"
FT   CDS_pept        565904..566170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00548"
FT                   /product="transposase, HTH-Tnp1 superfamily"
FT                   /note="CC_0514"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94013"
FT                   /db_xref="GOA:A0A0H3CAT5"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3CAT5"
FT                   /protein_id="ACL94013.1"
FT                   /translation="MKRARFTEEQIIGILRENEAGAKAGELARKHGVSEGTIYAWKAKF
FT                   GGMSVSEAQRLKALEDENRRLKSLLADAILDKAALNELLSKKW"
FT   gene            566164..567090
FT                   /locus_tag="CCNA_00549"
FT   CDS_pept        566164..567090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00549"
FT                   /product="transposase, IS2 family"
FT                   /note="CC_0515"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94014"
FT                   /db_xref="GOA:A0A0H3C5Q5"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5Q5"
FT                   /protein_id="ACL94014.1"
FT                   /translation="MVGPAAMREGVAHLRTVFEISERRACSIVKADRKMVRYRSRRPPD
FT                   TELRERLRGLAAERRRFGYRRLFVLLRREGELSGKNRIYRLYREEGLTVRKRRARRRAI
FT                   GTRAPILVEAKANARWSLDFVHDQFAGGRRFRVLNVVDDVTRECLAAIPDTSISGRRVA
FT                   RELSALIARRGRPGMIVSDNGTEFTSTAILAWAEDHRVAWHYIAPGKPTQNGFVESFNG
FT                   RMRDELLNETLFFGLDHARQKLAAWAEDYNTRRPHSSIGYQTPAAYAAHLNATGRPAAQ
FT                   CGSSTARPVATTAPSGVTNAETLVRAG"
FT   gene            567006..568052
FT                   /locus_tag="CCNA_00550"
FT   CDS_pept        567006..568052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00550"
FT                   /product="LacI-family transcriptional regulator"
FT                   /note="CC_0516"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94015"
FT                   /db_xref="GOA:A0A0H3C633"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C633"
FT                   /protein_id="ACL94015.1"
FT                   /translation="MWELHGSACCYNRAIGRNQCRDSGPRWMKDQRQVTRALAGNPLIP
FT                   KPLRDQIVEIAQTHGYVVNQSARSLRLRKTDTIGVIIPLGHETGQLISDPFFLEMIGRL
FT                   ADEITRRNYAVLLHKVVVTETGWLERIIQAHRADGLLLIGQSNQHDVLNAVAQTYKPLV
FT                   VWGAQLPGQTYCAVGSDNVAGGRLAVAHLVQAGRRKIAFLGATHAPEAAQRFEGYRQGL
FT                   AEAGLAFDPALVVAAHYTMDEAREAIADFIATGADFDAVFAFSDVIALAAIAALTEAGR
FT                   SVPRDVAVVGFDDIVLARHSAPPLTTVRQDLEFAARKMVDRLFARMAGEPAESALSPVE
FT                   LIVRGSSV"
FT   gene            complement(568260..568700)
FT                   /locus_tag="CCNA_00551"
FT   CDS_pept        complement(568260..568700)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00551"
FT                   /product="hypothetical protein"
FT                   /note="CC_0517"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94016"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C734"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94016.1"
FT                   /translation="MSEEYANARAASRYATDYILRWVEIANEVHGSDLLYALVFTTLWA
FT                   GNCSHIRGGHYADIDEVPPDHERRPLTVRQVADSLDLPYETVRRRFVEMLERGMAQRVG
FT                   REGFIVPQSALAKPEVLQGLRRSHQSLTRFLKDLKSIGIEAA"
FT   gene            complement(568956..569426)
FT                   /locus_tag="CCNA_00552"
FT   CDS_pept        complement(568956..569426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00552"
FT                   /product="cupin superfamily protein"
FT                   /note="CC_0518"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94017"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C403"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94017.1"
FT                   /translation="MNDMTKLGLGLSGDLGAQEIVRMLDLQPHPEGGWYRQTFQDAPGP
FT                   DGRAASTCIYYLLEAEQMSAWHRVDAVETWHYYAGAPISLTLSPPDGKGASAYVLGPDL
FT                   RAGCRPQVIVPTLWWQTAVSLGAWTLVGCTVAPGFRFEGFEMAPPDWTPSTG"
FT   gene            complement(569423..570172)
FT                   /locus_tag="CCNA_00553"
FT   CDS_pept        complement(569423..570172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00553"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number="3.1.2.6"
FT                   /note="CC_0519"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94018"
FT                   /db_xref="GOA:A0A0H3C4Z8"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C4Z8"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94018.1"
FT                   /translation="MALTVHQFRCLSDNYGFLVRDEASGKVATIDTPDAGAILAELAKL
FT                   GWSLDLILNTHWHPDHAGGNETLKTATGATIVGPAEVTRIAPLDRVVRDGEEVMLGDTR
FT                   LTVIDTGGHTLGHVSYYDAEDAIAFVGDTLFALGCGRLFEGTAEQMWDSLGRLIALPDE
FT                   TTVYCAHEYTASNARFALSVDSSAALAARAEAVFAARARDEATVPTTIGVEKATNPFLR
FT                   APLLRPDAPSPAQAFAEIRAAKDSFKG"
FT   gene            570238..571044
FT                   /locus_tag="CCNA_00554"
FT   CDS_pept        570238..571044
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00554"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="CC_0520"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00554"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94019"
FT                   /db_xref="GOA:A0A0H3C5R0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5R0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94019.1"
FT                   /translation="MRRDVLDLRAFYASPLGRVARTMLTRKVEEAWGDTRDLDVLGVGY
FT                   ATPFLDAARAKARRVVAAMPAQQGVEVWPQGGRNQACLVEDAALPLPNALFDRVLAVHA
FT                   LEEADDPAALLAEIGRVMAPTGRLIVAVSSRDGVWAGAERTPFGHGRPYSRSQLESLIR
FT                   EAELEPAGWTRALYVPPLAAMSSWAEGFEQVGATLWPRFAGVILMEAIKQTFAVKPRGH
FT                   RARARVFAPGVLLPSPAGPTPARQTGERPVPVNTAPVHKAPSGLDR"
FT   gene            571117..571461
FT                   /gene="glnC"
FT                   /locus_tag="CCNA_00555"
FT   CDS_pept        571117..571461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="glnC"
FT                   /locus_tag="CCNA_00555"
FT                   /product="nitrogen regulatory protein P-II"
FT                   /note="CC_0521"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94020"
FT                   /db_xref="GOA:A0A0H3C637"
FT                   /db_xref="InterPro:IPR002187"
FT                   /db_xref="InterPro:IPR002332"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="InterPro:IPR017918"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C637"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94020.1"
FT                   /translation="MKMIVAVIKPSRLDAVLEAVTEAGASGLTVTEVRGYGRQKGKTEV
FT                   YRGAEYEVKLLPKVKLEIAVPTDVLEPVIEALQRTANTGKIGDGKVFVMDLEQALRIRT
FT                   GERDAAAIAG"
FT   gene            571546..573063
FT                   /locus_tag="CCNA_00556"
FT   CDS_pept        571546..573063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00556"
FT                   /product="phospholipase D"
FT                   /EC_number="3.1.4.4"
FT                   /note="CC_0522"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94021"
FT                   /db_xref="GOA:A0A0H3C739"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR015679"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C739"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94021.1"
FT                   /translation="MDMVERASVFQPGYNCWRVEPADRVALLIDNDEAFDALKPLLLAA
FT                   RKSIWILAWVFDPLTRLDPDRVRKSGDPRSADRIGLILRRQAALNPALDVRVLTWDMPF
FT                   PIAAAQMFGPHRGAAFFAGSRVKYRLDATLPASACHHQKAVIIDGVTALVSGGDIGVDR
FT                   WDDTRHLDENPLRRLPTGRRYPARHEVSMLVDGRAGEAMADLFVDRWRASGGDAIARPV
FT                   RPDQPPWPAGLVPDLRRAPVAVARTSAAWRGRPEITECMLLHLSAIRRAKRLIYLENQY
FT                   VTSPLLVEALAERLAEPDGPEVVTIGPARSPSYFDQITMDSARTAAINRLREVDLHHRF
FT                   TAFSAHTPKGGPIIVHSKVSIIDDEVLRIGSANLNNRSIGLDSECDLAFEARDDLERET
FT                   IRGFLGRLIGHFIDRSALDVLEAMEREGGLAAAINALDAHGGPPRRLRPVPTRRLTRVQ
FT                   QFIADWNLGDAMTPDDAWRPWGRRKRLRADLARLTAPPPLPPGHLRP"
FT   gene            complement(573020..573799)
FT                   /locus_tag="CCNA_00557"
FT   CDS_pept        complement(573020..573799)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00557"
FT                   /product="endonuclease/exonuclease/phosphatase family
FT                   protein"
FT                   /note="CC_0523"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94022"
FT                   /db_xref="GOA:A0A0H3C408"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C408"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94022.1"
FT                   /translation="MKTFRLMTYNVHRCVGTDRKLDVERVAEVIAAERPDVVALQELDV
FT                   GRARTQSVDQAHRLAELLKMSFHFHPAMAVEEELYGDAILTALPERRIKAQGLPLYRRV
FT                   PGLEPRGALWIEVEVGGAKVQIINTHLGLVPQEQKRQAAALLGPEWIGEEAWRAPGVLL
FT                   GDFNATPYSATYRMLRTALRDAQAPSPAWLRPATATFPSSFPFMRIDHVFVTKGLETRA
FT                   VSSPYDARARIASDHLPLVIDLEITDAGDRAAEAAAR"
FT   gene            complement(573796..574461)
FT                   /locus_tag="CCNA_00558"
FT   CDS_pept        complement(573796..574461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00558"
FT                   /product="methyltransferase"
FT                   /EC_number="2.1.1.-"
FT                   /note="CC_0524"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00558"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94023"
FT                   /db_xref="GOA:A0A0H3C502"
FT                   /db_xref="InterPro:IPR010743"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C502"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94023.1"
FT                   /translation="MMTSIREDFREILRLVRPGSRVLDVGCGEGVLLDLLAHEKQVDAR
FT                   GLELSASGVAACMARGLSVVQGDADLDLDHFPDRSFDYAVLSQTLQATRNPRHVLDELL
FT                   RIADRAIVSFPNFGHWRVRWSLLSRGRMPETKALPLPWWSTPNIHLCTLADFMALTQDL
FT                   NLRVDASAAFAGKGAARPMNPTSAWENWRSETCLFMLSRNSAPPIRELPPSSGDLFDG"
FT   gene            complement(574589..575737)
FT                   /locus_tag="CCNA_00559"
FT   CDS_pept        complement(574589..575737)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00559"
FT                   /product="homoserine O-acetyltransferase"
FT                   /EC_number="2.3.1.31"
FT                   /note="CC_0525"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94024"
FT                   /db_xref="GOA:B8GZZ0"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR008220"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8GZZ0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94024.1"
FT                   /translation="MAALDPITPAGGGTWRFPANEPLRLDSGGVIEGLEIAYQTYGQLN
FT                   ADKSNAVLICHALTGDQHVASPHPTTGKPGWWQRLVGPGKPLDPARHFIICSNVIGGCM
FT                   GSTGPASINPATGKTYGLSFPVITIADMVRAQAMLVSALGVETLFAVVGGSMGGMQVQQ
FT                   WAVDYPERMFSAVVLASASRHSAQNIAFHEVGRQAIMADPDWRGGAYAEHGVRPEKGLA
FT                   VARMAAHITYLSEPALQRKFGRELQRDGLSWGFDADFQVESYLRHQGSSFVDRFDANSY
FT                   LYITRAMDYFDIAASHGGVLAKAFTRARNVRFCVLSFSSDWLYPTAENRHLVRALTAAG
FT                   ARAAFAEIESDKGHDAFLLDEPVMDAALEGFLASAERDRGLV"
FT   gene            575815..576327
FT                   /gene="sixA"
FT                   /locus_tag="CCNA_00560"
FT   CDS_pept        575815..576327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="sixA"
FT                   /locus_tag="CCNA_00560"
FT                   /product="phosphohistidine phosphatase SixA"
FT                   /EC_number="3.1.3.-"
FT                   /note="CC_0526"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94025"
FT                   /db_xref="GOA:A0A0H3C5R5"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5R5"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94025.1"
FT                   /translation="MERLILMRHGKAERHAQSGGDFERALAESGRADASLMGRVLAGLA
FT                   YEPDLFLVSSARRTRETAEQVAAHFSKARVEHLRDLYHADPEEILQAVEDAVDAAGTVM
FT                   VVGHNPGMHELALRLAVQAGASPIQSNKLRSRFPTATVVVLAWDGTQTPRLEHLLYVNE
FT                   NGGMGGE"
FT   gene            576324..576668
FT                   /locus_tag="CCNA_00561"
FT   CDS_pept        576324..576668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00561"
FT                   /product="conserved hypothetical cytosolic protein"
FT                   /note="CC_0527"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94026"
FT                   /db_xref="InterPro:IPR009297"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C640"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94026.1"
FT                   /translation="MTLIYKILSRAEWDAAKAQGRFEGSAVDLADGFIHLSAGEQAQET
FT                   AAKWFRGQANLVLLAVEAEPLGEDLKWEASRGGARFPHLYRPLLVSEVTREADLDLDAD
FT                   GVPQLGDHLA"
FT   gene            576665..577723
FT                   /locus_tag="CCNA_00562"
FT   CDS_pept        576665..577723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00562"
FT                   /product="dihydroorotate dehydrogenase"
FT                   /EC_number="1.3.98.1"
FT                   /note="CC_0528"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94027"
FT                   /db_xref="GOA:A0A0H3C744"
FT                   /db_xref="InterPro:IPR001295"
FT                   /db_xref="InterPro:IPR005719"
FT                   /db_xref="InterPro:IPR005720"
FT                   /db_xref="InterPro:IPR012135"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C744"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94027.1"
FT                   /translation="MSLHDIAARALHAFDPEDAHGWAIRGLKWGLGPRDAQPDDPILAV
FT                   KIAGLELPNCVGLAAGFDKNAEVPDAMLAAGFGFVEAGTVTPLAQAGNPRPRLFRLTED
FT                   QAVINRMGFNNGGLEPFAQRLAARQGRGGVVGANIGANKDATDRIQDYVTGLTRLWGLS
FT                   DYFTANISSPNTPGLRALQTKAALEELLGRLAETRAALKVASGADYPIFLKVAPDLEDG
FT                   EVEAIVETVVGAGLDAIIVSNTTIARPETLKSRFAGESGGLSGAPLLEASTAVLARFHA
FT                   AAAGRVALIGAGGVADGAGAYAKIRAGARAVQLYSALVYGGPGLVTRIKRDLAARLRAD
FT                   GFAAVEDAIGAA"
FT   gene            577720..578457
FT                   /locus_tag="CCNA_00563"
FT   CDS_pept        577720..578457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00563"
FT                   /product="SNARE-associated family membrane protein"
FT                   /note="CC_0529"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94028"
FT                   /db_xref="GOA:A0A0H3C414"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C414"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94028.1"
FT                   /translation="MSRDEVLTRMRRFGPLAVVAVLCAAAFASGLVEHISLEELRLRGT
FT                   QLQAFAHENPLLCAAIYLAVYVGTVAISLPGALILSLTGGFLFGPIGGGLAAVTGATGG
FT                   STVTFLVFRTAFGEALPFKSSAFIARIAEGLKGDAFNYLLTLRLIPAFPLLAVNVAAGV
FT                   MNVRVRTFLLASVLGMIPSSFVYAGIGAGLGHVFAKGGPVTVESLLSPRIYLPIIGMGV
FT                   LAFLPPLWRHWRNGRDVASLDEK"
FT   gene            578467..579972
FT                   /gene="cenK"
FT                   /locus_tag="CCNA_00564"
FT                   /experiment="gene is essential according to Tn-seq
FT                   experiments of Christen, et al. (2011) Mol Syst Biol.
FT                   30;7:528. doi: 10.1038/msb.2011.58"
FT   CDS_pept        578467..579972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cenK"
FT                   /locus_tag="CCNA_00564"
FT                   /product="sensory transduction protein kinase CenK"
FT                   /EC_number="2.7.13.3"
FT                   /note="CC_0530"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94029"
FT                   /db_xref="GOA:A0A0H3C509"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C509"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94029.1"
FT                   /translation="MVEPGSPSEDKTQKPRKRFPWPGGLSARLLLFTAVVVNFGGLLIL
FT                   PPALAAYEEQWLLDRVRAGELASTIAESDPELRVSDAVANQMFDQAGAVTVAVQVDGAR
FT                   RLVLPPKQPFETPYLVDLRRQNPGSWLAAPFYTLTSPKGSMVRVMAEPRFRKAEFIEVV
FT                   LPDAPLKARLVAYFWQLAGVTIFVATLAGVLVYAFLNIFLVRPMQRITRAMEAFRSDPD
FT                   DPAARIVLSNRRDEIGRAELELDRMQADLLAALSSKARLAALGEAVAKINHDLRNMLTS
FT                   AQMASDRLAALGDPKVAQALPRLERALDRAINLASDVMAYGKSKEPEPVIRVIPLRPAL
FT                   DMAAEDAGLSAQGVSLETVIGPREQVLADPDQLHRILTNLLRNAREAIEGAPDRGGKGK
FT                   VFVELRRADGSSVLRLSDDGPGVPERARANLFQPFVGSVRRGGTGLGLAIARELAQGHG
FT                   GDLALVETGPGGSVFDLTLSGAPDPLPETPSEPGDRAADAPAG"
FT   gene            complement(580036..581778)
FT                   /locus_tag="CCNA_00565"
FT   CDS_pept        complement(580036..581778)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00565"
FT                   /product="gamma-glutamyltranspeptidase"
FT                   /EC_number="2.3.2.2"
FT                   /note="CC_0531"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00565"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94030"
FT                   /db_xref="GOA:A0A0H3C5S0"
FT                   /db_xref="InterPro:IPR000101"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5S0"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94030.1"
FT                   /translation="MRRLASLLALSAALQLSLAPVAALAESIPLAMPTPRPAATSTPAK
FT                   GMVAAANPLAVEAGLRVLRDGGSAVDAAVAIQAVLSLVEPQSSGLGGGAFLMAYDAKTG
FT                   KITAYDGRETAPSAATPDMFMGPEGKPLSFVKVLLSGRSSGVPGAVAMLAQAQKDHGKV
FT                   AWSTLFKDAETLAADGFVVSPRLAGMINSPRAPQASQPDAVKYFTKPDGTRYKAGDVLK
FT                   NPAYAETVRRIAAEGPSALYEGPIAQAIVERLREGELPGSMTLEDLKRYKPRAGAPLCR
FT                   PWKVYTVCVPNPQSSGLAIIQALQMLEHTDIGKRGPTDPVAWTLLAQAERVMYADRDRY
FT                   VGDPDFVTVPVAGLLDPKYVAQRAKLITDKAGPAPSFGQPKGAPKVGVDATHEPGGTTH
FT                   FVVADTQGNVVSMTTTVESIFGNGRMVGGFFLNNQLTDFSFSPVEKDGAPAANAIAGGK
FT                   RPRSSMAPLIVLDKKGKFLAAVGSPGGNAILSYNLKAMVGLFYWNLNMQQAVSLPNLVA
FT                   RGENFSGDADLFGPEMLAALNARGVTVKVGQLETSGLQGVIVRPGNVLEGGADPRREGV
FT                   AKGL"
FT   gene            582032..582108
FT                   /locus_tag="CCNA_R0008"
FT   tRNA            582032..582108
FT                   /locus_tag="CCNA_R0008"
FT                   /product="tRNA-Arg"
FT                   /note="CC_t04"
FT                   /experiment="EXISTENCE:RNA-seq"
FT   gene            complement(582330..583541)
FT                   /locus_tag="CCNA_00566"
FT   CDS_pept        complement(582330..583541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00566"
FT                   /product="mannonate dehydratase"
FT                   /EC_number="4.2.1.8"
FT                   /note="CC_0532"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00566"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94031"
FT                   /db_xref="GOA:A0A0H3C643"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034589"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C643"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94031.1"
FT                   /translation="MLKIIDAKVIVTCPGRNFVTLKITTEDGITGVGDATLNGRELSVV
FT                   SFLQDHMVPSLIGRDAHQIEDIWQFFYRGSYWRGGPVAMTALAAVDMALWDIKGKVAGL
FT                   PVYQLLGGACRTGVTVYGHANGETIEDTIAEAVKYKAMGYKAIRLQTGVPGLASTYGVS
FT                   KDKMFYEPADNDLPTENIWSTAKYLNSVPKLFERAREVLGWDVHLLHDVHHRLTPIEAA
FT                   RLGKDLEPYRLFWLEDSVPAENQAGFRLIRQHTTTPLAVGEIFAHVWDAKQLIEEQLID
FT                   YLRATVLHAGGITNLKKIAAFADLHHVKTGCHGATDLSPVTMAAALHFDMSITNFGLQE
FT                   YMRHTPETDAVFPHAYTFSDGMLHPGDKPGLGVDIDEDLAAKHPYKRAYLPVNRLEDGT
FT                   MFNW"
FT   gene            complement(583664..585976)
FT                   /locus_tag="CCNA_00567"
FT   CDS_pept        complement(583664..585976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00567"
FT                   /product="alpha-1,2-mannosidase"
FT                   /note="CC_0533"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00567"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94032"
FT                   /db_xref="GOA:A0A0H3C749"
FT                   /db_xref="InterPro:IPR005887"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012939"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR041371"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C749"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94032.1"
FT                   /translation="MPDKRLCWSKRSLALALTLAIGCGQAAWAQPATDLLAKVDPFVGV
FT                   DGGGVTGGNTVPGAGAPFGFVSLSPDTTNADTNGYDSRSPIMGFSYTHVSGTGGSGKYG
FT                   NFRVTPTVGPLRVNHLHFGKTDERASPGYYTVGLGNTDAERIKVELTATRRVGLQRLTY
FT                   PASAESHLIFDVSSVIAMRGRGQRVRLAKVELIDDHTLAGEVTVEGGWNPTPYTLYFHA
FT                   VTDRPAKAFGAWKAGQGWMETKPGPGRSEGGVQVKSAANRLGLMIEYDTEREFSNRLGA
FT                   YLTFDTTANRQVQMKLAVSFISADKARANLDEEAPGWDFDATRRTTEAQWSDALSKIRV
FT                   EGGREEQQRIFYSALYRSHTMPHDLTGENVWWTSDEPHYEDFYTLWDTFRTLHPLLTII
FT                   QPQRQRDMIRSLLDTYKHTGWMPDSRIAGANGMTQGGSNGDILIADAVSKKLGGFDVNL
FT                   AYEAILKNGEVDSDKPFMQGRVLKDYLKLGYVPFTETRSASRTLEYAYNDFAIAVVAKS
FT                   LGKTEDAKRYLARSGNWKNLWDDAIGCVRPRYPNGEWVENYSCTYDYPDRSGPWWDAVF
FT                   YEGNSLQYSSFVPQDVAGLMANTGGPDGFVKWLDHLFDGHYSQSNEPDLLAPYLYIHAG
FT                   RPDRTHEIVRGLMAKHYRLSRTGLPGNDDAGAMSSWYVWNAMGLYPNAGQPFYYLSAPI
FT                   FARSQISLEGGKTFVVSAPNTSDENRYIVGAKLNGKPLERAWISHDELARGGVLELTLA
FT                   PAPGAWGKSLPKPPQGL"
FT   gene            complement(585948..587111)
FT                   /locus_tag="CCNA_00568"
FT   CDS_pept        complement(585948..587111)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00568"
FT                   /product="N-acetylglucosamine-6-phosphate deacetylase"
FT                   /EC_number="3.5.1.25"
FT                   /note="CC_0534"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94033"
FT                   /db_xref="GOA:A0A0H3C418"
FT                   /db_xref="InterPro:IPR003764"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C418"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL94033.1"
FT                   /translation="MPIALVNGRVLTPAGFVSGKAVLVENGVVVALLDARDVPADAQRH
FT                   DLGGDRLVPGFIDTQVNGGGGALFNDAPTARTIATIGEAHRAYGTTGFLPTLISDDLEV
FT                   VDAALRATEDAIAQGVPGVLGVHIEGPFLNPKRKGIHDEAKFRVIDEDAIALLSSLKRG
FT                   KLLLTLAPERTTPDIIARLAAAGVIVAAGHTNAHYETMRRALDHGLTGVTHLFNAMSPL
FT                   TSREPGVVGAVLENQNAWAGIIVDGRHVDPVTLKIALRTRPLDRFMLVTDAMPTVGLTN
FT                   KRFNLQGREIVVRDGVCVDEAGTLAGSDLDMAAAVRNAVSMLGLTLEDAVMMASAAPSA
FT                   LLGLQQRRGAIAPGLAADFCRLDDALNVTSTWIDGKETHARQEALLV"
FT   gene            complement(587111..588187)
FT                   /locus_tag="CCNA_00569"
FT   CDS_pept        complement(587111..588187)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00569"
FT                   /product="glucosamine-6-phosphate deaminase"
FT                   /EC_number="3.5.99.6"
FT                   /note="CC_0535"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94034"
FT                   /db_xref="GOA:A0A0H3C515"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C515"
FT                   /protein_id="ACL94034.1"
FT                   /translation="MEATVLTRPEGAAPARLSPEDTRMFLEAGEGAAVVRTLLAANAER
FT                   VAALAERLRAHPPRVVVTCARGSSDHAATFARYLIETKAGVLTSSAGLSVSSVYDASPN
FT                   LEGALCLAVSQSGKSPDLLASVKAAKAAGAHAVAFVNVEDSPLAALADVVIPLHAGPEL
FT                   SVAATKSYIAALAAITQLIAAWTQDEALTAALEGLPLQLEAAWNLDWSSAVEGLRHAIN
FT                   LYVLGRGVGFGVALEAALKFKETCGLHAEAFSAAEVLHGPMALVKEGFPALVFAQNDES
FT                   RESVVEMAQGLRQRGASVLMAAPGDDAPGGLPTPLSHPVLEPILMVQSFYRMANALSVA
FT                   RGYNPDSPPHLNKVTETL"
FT   gene            complement(588225..589130)
FT                   /locus_tag="CCNA_00570"
FT   CDS_pept        complement(588225..589130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00570"
FT                   /product="GntR-family transcriptional regulator"
FT                   /note="CC_0536"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94035"
FT                   /db_xref="GOA:A0A0H3C5S5"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR011663"
FT                   /db_xref="InterPro:IPR028978"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5S5"
FT                   /protein_id="ACL94035.1"
FT                   /translation="MARTPFHGPRICCYNGICSRGFEVSRLDLPMVDWSHIGIPRSHLS
FT                   EAPERRSRRDVSLSKRIGFAHGAVPAPLYLQLQRALREAIEVKVLAPDDALPPERDMAE
FT                   DFAVSRITVRKALEGLVSEGLLTRRQGAGTFVAARVEKNFSKLTCFTEDMRSRGRAPAS
FT                   EWITRAEGAVTPEEALMLGVSPNTPVYRFHRIRIADGAPMAVEYTTIAGFALPSADAVK
FT                   DSLYEAMAATGHRPTRALQRLRGVLISREHASLLGVKPKDAGLLVERRGYLRDGRAVEI
FT                   SHSYYRGDAYDFVAELNDAT"
FT   gene            589132..591768
FT                   /locus_tag="CCNA_00571"
FT   CDS_pept        589132..591768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00571"
FT                   /product="phosphoenolpyruvate-protein
FT                   phosphotransferase/phosphocarrier protein HPr/PTS system,
FT                   glucose-specific IIA subunit"
FT                   /EC_number="2.7.3.9"
FT                   /note="CC_0537"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00571"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94036"
FT                   /db_xref="GOA:A0A0H3C647"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR001127"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C647"
FT                   /protein_id="ACL94036.1"
FT                   /translation="MQKWPCQMVLKWNVVRSAGWTLAERGIQMSALVLTAPLQGWVSAL
FT                   EEAPDAVFAERMLGDGLAIDPLGSTLHAPCDGSVVSVHRARHAVTLRATNGAEILMHVG
FT                   LETVALNGEGFEVFVEEGQTVKAGDRLIGLDLDLLAQRARSLITPVVITNGEAFQIVRR
FT                   DQDRQIGVGQFLMELSPIAGASRAAASGAADQITRQIIVPLAHGIHARPAARIAQMAKT
FT                   FASDLTLATGPRRANARSPVGLMSLAIRHGDTIQLLASGPDAQAAVTALAELIEGGMGE
FT                   GAPVAAKTSSTKTAPTKTEPSEPPPPAPLPRDGVLKGVPAAPGLAIGKAVRLSTAEIVV
FT                   REAGEGVAHEEAALAVALETVRARIGKAAETGDKARKAILAAHQAFLDDPELYAGAHRL
FT                   IAEGKSAGFAWRRAVGGYVQALQALGDRRMAERVDDLIDLERQVLRALSGEEETGAALA
FT                   PGSILLADELLPSQLMGADPAALAGFATARGGPTSHVAILAAAMGVPALVAVGGALSKV
FT                   KDGATLILDADAGTLRVAPDAKALEAAQTALAQRQQRKAAAKAAAHEPAVTRDGVRIEV
FT                   FANTGSVADAQAAVANGAEGSGLLRTEFLFLDRETPPDEDEQARQYQAIAEALDGRPLI
FT                   IRTLDVGGDKAAPYLPIPAEENPALGLRGVRVSLWRPHLLKAQLRAILRVEPRGQCKIM
FT                   VPMVASLDELRAVRAVLEEAKRELGITDRVQLGVMIETPAAAVTADLLAAEADFLSIGT
FT                   NDLTQYVLAMDRGNPELAAGIDALHPAVLRMIDQTCQGAARHHRWVGVCGGLASDLDAT
FT                   PILLGLGVAELSTTASIAPDVKARVRALSLEACRALAAQALEQTSPQAVRALVQGQTNT
FT                   PLGGLNP"
FT   mobile_element  complement(589229..593458)
FT                   /mobile_element_type="insertion sequence:possible IS
FT                   element"
FT   gene            591765..593513
FT                   /locus_tag="CCNA_00572"
FT   CDS_pept        591765..593513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00572"
FT                   /product="PTS system, N-acetylglucosamine-specific IIBC
FT                   component"
FT                   /EC_number="2.7.1.191"
FT                   /note="CC_0538"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94037"
FT                   /db_xref="GOA:A0A0H3C778"
FT                   /db_xref="InterPro:IPR001996"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR010974"
FT                   /db_xref="InterPro:IPR013013"
FT                   /db_xref="InterPro:IPR018113"
FT                   /db_xref="InterPro:IPR036878"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C778"
FT                   /protein_id="ACL94037.1"
FT                   /translation="MRSPLEILQPLGRALMLPIAVLPVAALLLRIGQPDLLGAPALAAA
FT                   THGMSLSVANTFGAAGGAIFASLGLIFAIGVAVGLARENHGAAGLAGVVCYVIATKGVE
FT                   ALLVAPPEVAAKAVEGAKDLAIAAWKAKEIGKLSIPVGILSGVISGALYNRYSTIQLPE
FT                   YLAFFGGRRFVPIVAGLAGVVLALLFGAFWSTLEAGVDGLSGLVTASGDLGLVVYGLLN
FT                   RLLIVTGLHHILNNVVWFILGDFNGVTGDLNRFAAGDKTAGAFMSGFFPVMMFGLPAAC
FT                   LAMLHTARPERRKAVAGMLGSLALTSFLTGVTEPIEFTFMFLAPVLFAIHALLTGLSMA
FT                   LMNMLDVKLGFGFSAGLFDYVLNFNKATRPLLLIPVGLVYGALYYGVFRFAILRFDLKT
FT                   PGREDEAPPSAQAVTTGGGRGADMLAALGGAANLVSVDACTTRLRLIVVDQGLVNEPAL
FT                   KALGARGVVRPSDKALQVVLGPIADTVAGEIRHAISAPPAPAPAPAPDVSQAAKALLAA
FT                   LGGADNLRDLSVHASRLRVVLNDPERVDQAALHTAGVRGFAAVAPGAVHIIIGPHAERI
FT                   AEVLRP"
FT   gene            593829..596600
FT                   /locus_tag="CCNA_00573"
FT   CDS_pept        593829..596600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00573"
FT                   /product="TonB-dependent receptor"
FT                   /note="CC_0539"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94038"
FT                   /db_xref="GOA:A0A0H3C423"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010104"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C423"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94038.2"
FT                   /translation="MKKVLEWSASCLQCATSPQSVFAPLSQGGIQKMTNTKTTATAGRR
FT                   KAFVIALLSGACFAEAALAQSTPAPAADQAAVDEVVVTAFRKSLATALEVKRKDVRVSD
FT                   GISSEDIGKFPSENIAEAIQRIPGVQISAINGRGSTISIRGLGPQYALTTVNGQAFKSS
FT                   NFTDGFRYDVIQTELASGIQVYKSPTADMDAGGLAGTVNIDTVHPFDVKGRQIIVAGKL
FT                   QQQELIGGNPTGKYGLTYVDHFLDGKLGVFLGGGYQELKDRGDYLWMDRWTVSNNVYTP
FT                   ARLRYRRIDRETKRSMINGAVQWKPTEHLQMDLIGTYAEDKTTQNIHQQVFLFTTPSAS
FT                   NVVPITVANGTSTKVQVNNFRLENNQQYENRPQSTSALTTKLHYTGLENWDFNAVAHYS
FT                   RGNAKHNEEAAVLGINIPSATVDIADPKNVIFTTSTALTNTAQYAPTTLIRNTYPTGAF
FT                   RTVGSHESAAQFDAKRYLDWGILESVQVGAKTRSEVLKRYVIRKDNQVVPASFSPTMAN
FT                   SGIAVTNFLDGQMTLPNAWVSPNLDAYREALKAQGISVYEGFDPLGSYRVERDLTSVYA
FT                   MANLRGEVLSKSYRANIGVRNESTDQTIKGYIGSTANPQNTEVRLAAGNYTAKKSYDNL
FT                   LPSANLSVDLTDNLLLRVAAAKVLVRPIIDSSNQLARTMTSATDTTGRRIFTISSGQGN
FT                   LNPMTANQLDLTLEWYYGQGNGLSAGYFSKKVKNGVFSQLTCPTSYESVALSRDSSGVC
FT                   VAANGDNYMITESFNDSRVVDIHGYEVNWQQSLDAWLPIEGFGLIANYTHVTPAKSTTG
FT                   FRLANLSEHTANGTVYWENQKFSARLSANYRSAYDQTSVESFFAGPLGHTIKARTQLDL
FT                   NLGYNFNERLSFAFAAMNINNAQEEAYLINASRWQETAVTGPSYFLSFQYKM"
FT   gene            596740..599052
FT                   /locus_tag="CCNA_00574"
FT   CDS_pept        596740..599052
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00574"
FT                   /product="alpha-N-acetylglucosaminidase"
FT                   /EC_number="3.2.1.50"
FT                   /note="CC_0540"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94039"
FT                   /db_xref="GOA:A0A0H3C518"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007781"
FT                   /db_xref="InterPro:IPR024240"
FT                   /db_xref="InterPro:IPR024732"
FT                   /db_xref="InterPro:IPR024733"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C518"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL94039.1"
FT                   /translation="MPMKASLNRRQAISLAAAAFVASPALAAGSTDGVAAARASLKRLF
FT                   GRRLAGAHLTVTPGAERSWYAIGGKGGAISISGDSPVALVRGAYAHLRQAGLAHVSWEG
FT                   DRVVQAGAVPAGAGARVETPFRHRAYLNTCTYGYTTPWWGWGRWTREIDWMAAHGIDMP
FT                   LAMEGQEYVWRALWREFGLSEAELADYFSGPAFTPWHRMGNIEGYKAPLPTAWIDKKKD
FT                   LQVKILGRMRSLGMTPILPAFGGYVPKAFAEKNPKARIYRMRPWEGFHETYWLDPADPL
FT                   FAKIAARFLALYTETFGAGTYYLADSFNEMLPPINADGADARDAAYGDGTANTAVTKTK
FT                   VEVDPALKAQRLAAYGKAIYDSIRQTRPDAVWVMQGWLFGADSHFWDPAAISAYLSLVP
FT                   DDKLMILDIGNDRYPNVWKNAKAFGGKPWIYGYVHNYGGSNPVYGDLGFYRQDIPAIAA
FT                   NPDAGKLAGFGMFPEGLHNNSIVYEAVYDLAWSEGQASPATWLTRYARARYGKTSPALD
FT                   AALGQLVEAAFSTRYWSPRWWKSKAGAYLFFKRPTATVGDFPQHPGDRAKLEAAVKALT
FT                   ALAPTYGQEPLFVLDLTDATRHLATMKIDDLLQVAVAAYRRGDTAAGDAARVEIEALAL
FT                   SIDKLLGVQPDTLATWIDEARAYGDTPADAAAYVANAKAQVTIWGGEGNLNDYASKAWQ
FT                   GLYKSFYLPRWSRFLDALKAAGTGTFDEVTVTRGGVAWERAWVEAEVAYRREKPADPIG
FT                   EIKTLIARIDRGGEKTP"
FT   gene            599049..600167
FT                   /locus_tag="CCNA_00575"
FT   CDS_pept        599049..600167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00575"
FT                   /product="hypothetical protein"
FT                   /note="CC_0541"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00575"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94040"
FT                   /db_xref="GOA:A0A0H3C5T0"
FT                   /db_xref="InterPro:IPR012429"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C5T0"
FT                   /protein_id="ACL94040.1"
FT                   /translation="MSQPAARFLSLDVFRGLTVFLMIVVNTAGPGAKAYSQLVHAPWFG
FT                   FTAADAVFPSFLFAVGCSMAFAFSKPIPLNDFTVKVLRRAALIFLLGFLMYWFPFVRKV
FT                   DGDWALIPFSDTRVMGVLQRIALCYLLAAFAVRWLSPRLIVALCAVLLLGYWAILMAFG
FT                   DPAAPLSKLGNAGTRLDLLLIGQNHLYRKDGGFDPEGLLGTLPSTVNVLAGYLAARFLK
FT                   ENPGSSQAMGRMAIAGLVLILAGLVWSPLFPIAKKLWTSSFVLLTVGIDLILLAGLAKL
FT                   LEGKASNPGTYFFQVFGLNPLVLYLFSELFVVVLGMIEVAPGVGIYEWVGVNLFQAVMP
FT                   GAFGSLLCALAYTLVCWLLGYVMARRGVVVKL"
FT   gene            600176..601420
FT                   /gene="oppA"
FT                   /locus_tag="CCNA_00576"
FT   CDS_pept        600176..601420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="oppA"
FT                   /locus_tag="CCNA_00576"
FT                   /product="oligopeptide-binding protein oppA"
FT                   /note="CC_0542"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94041"
FT                   /db_xref="InterPro:IPR000560"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="InterPro:IPR033379"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C650"
FT                   /protein_id="ACL94041.1"
FT                   /translation="MRLSLRIAVVTLALASAGAASAETLEKVVILSRHGVRSAMSSPER
FT                   LEEASARPWPRFEVPAGHLTARGETLVARMGDYYRRHYAAQGLLKPGDCASVYAWANVT
FT                   QRTIATAKAYRETLAPGCPVTVNTVGEGNIDPMFEPVKAGIVKADHALARAAVAGRVGG
FT                   DLTAWSASHNQEAEQLDALLMQCDKGPCPPAPGKRRVFDAKPGFVDGEELAGLSGPEAF
FT                   ASGVTESLLMAWADGRDFAGLGWKSLDEEALTRSFFLHQAEFDLRLRTPYVARTLAGHL
FT                   ADRLAATLRDGAAAIGPVDARLVIIAGHDGTLASLGGLLRMEWTLPGYQPNQIQPGGAL
FT                   VFERWRRDDGVRVVRVRFTGQSLSQLRNMTALDAKTPPLSAPVFVQGCGTATPAFDCRL
FT                   EDFETVVRGATRADG"
FT   gene            601496..604033
FT                   /locus_tag="CCNA_00578"
FT   CDS_pept        601496..604033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00578"
FT                   /product="family 67 glycosyl hydrolase protein"
FT                   /note="CC_0544"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00578"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94043"
FT                   /db_xref="GOA:A0A0H3C783"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR031924"
FT                   /db_xref="InterPro:IPR042301"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C783"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94043.1"
FT                   /translation="MHVAAVFALALASSAVPAHEVWAAGAPSRAPSRAIAETAPIFADA
FT                   PARGGFQLVGAGVVPTLVVDPADAAVVRHAAQDLSDDIETVTGQRSAVAAAPAGKTAIF
FT                   IGTLGQSPLIDQLVAAKRLDVSKLKGAWESFIIASVDRPAPGVDKGLVVIGSDRRGTAF
FT                   GVYEVAQAMGVSPWAWWADVTPQRREALFVRAGVHRFGPPSVRYRGIFVNDEDWGLYPW
FT                   AVKTFDPERGDIGPKTYRKIFTLLLRLKANTLWPAMHHTTAPFNSDPANAKLAEEYGIV
FT                   MGSSHAEAMLRNNVGEWKDDPAKFNYATNPEGVKAYWEERAKTNAGYESLWTVGMRGIH
FT                   DTGMVGPKTIEEKVALLDKIIADQREILAKNVNADVAKIPQIFVPYKEVLGIYRAGVKV
FT                   PDDVTIVWPDDNFGYIRQFASPEEAARKGGAGVYYHLSYLGYPLSYMWLSTTPPALVQE
FT                   EMIHAWDKGARNVWIANVGDIKPAEIGTSHFLEMAWDIDRWRGKSQKQFLSDWTARNLG
FT                   PALAAKTADLLDRYYRLNFERRPEHLEWPPVAENRHLSSYTPKEVSARLRAFRTLVAET
FT                   KATSQQVPPTLQDAWFELVEFPIRISAAANMRFFAAERYNALIDGRQAMARSAGGAAVE
FT                   AQAEITALTDRFHNQIAGGKWRWFMPEEPADSQWRIYRARPIPLPGAALTADPAAFLAE
FT                   VDGTLFAGSPVFEAEAFKANRGWRFVEGVGRGDGVMIADAAGADLTLEVEVKTEGRSLR
FT                   IGVLPIFPDGQGGEIALDVSINGEAPQRVSWPRAVGSPAWAQGVLDNQLTATVGAPLPP
FT                   GKHVVRVTSRAGRVAVDQLRLVTPEVIAVHENH"
FT   gene            complement(604210..606009)
FT                   /locus_tag="CCNA_00579"
FT   CDS_pept        complement(604210..606009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00579"
FT                   /product="endonuclease"
FT                   /EC_number="3.1.30.-"
FT                   /note="CC_0545"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00579"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94044"
FT                   /db_xref="GOA:A0A0H3C426"
FT                   /db_xref="InterPro:IPR001604"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR020821"
FT                   /db_xref="InterPro:IPR040255"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C426"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /experiment="EXISTENCE:Ribosome profiling"
FT                   /protein_id="ACL94044.1"
FT                   /translation="MALEAIIRLTGRPPLIVRNDAVVIEPPLLEEFPITITGQIKAVEP
FT                   ALASVGRIEFVNHEMAWGGTGWVVDSGADSALVVTNRHVAKLVAKRSADGRGVFLRSPY
FT                   SGARYGASIDFNEEVDARVTDARNASATAVEYLADDTGADVALLRIKRPLNAAWAWPDS
FT                   VPLADQEAGLEELVALIGYPAYDTRNDVTAMERYFRGLYDVKRFAPGRVTRAADSGGVI
FT                   SHDCTSLGGNSGSVLLSLERRVAVGLHFAGQYGIANSAVSAATLRRLVFGSRTTVAGAV
FT                   LQETFVEAKDGLHTADDLKDREGYVPGFLGKTTPPVPWPTLAPEIAAGLAKPVDALPGR
FT                   PHELRYTHFGVLFSQDLKLPAATAVNIDGKQPVRIKRGDDKWFVDARIDPACQYTAKHY
FT                   GDQAIDRGHMVRREDPNWGDDAIQANFDTFHYTNAAPQHALLNQGKSLWQGLENYILDN
FT                   SRTEGFKACVFTGPILNGDYEYLPEEGDVRVPLEFWKVAVMTAKTEDGQDTLHATAYVL
FT                   SQGHLIRKLLEDRQRSEALEGFRLGAYRTFQVAIRDLEAATGMNFHDLRNYDPLAATKA
FT                   GSEAIAQDEPVFVPLETAADLVL"
FT   gene            complement(606207..609290)
FT                   /locus_tag="CCNA_00580"
FT   CDS_pept        complement(606207..609290)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="CCNA_00580"
FT                   /product="AAA ATPase domain protein"
FT                   /note="CC_0546"
FT                   /db_xref="EnsemblGenomes-Gn:CCNA_00580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL94045"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041664"
FT                   /db_xref="UniProtKB/TrEMBL:A0A0H3C522"
FT                   /experiment="EXISTENCE:LC-MS"
FT                   /protein_id="ACL94045.1"
FT                   /translation="MSETPLPDLDVGSPSLTGMKAEAEGLITLARRYAALSGPFAPVEA
FT                   LRAAGAVEPIDLAITVSSALDAVCDVSATGQWLLRASERAWDLKRLNDEGSLRKAIGWR
FT                   RDLGADPATADLLDALLGKGAFSPKAMARMLERIEAQEAAAGPELRRLATALEWSGALA
FT                   PAAALLARLQAALNRTDQARRGELLLADGFQGREQAVETLTDWIRNPDQDPIRVRALYV
FT                   SGLPAIGKSTLLEHVLRQVAQQGVETVVVRLDFDRASLDVLDQLGLSVEVARQVASQLP
FT                   SAAADLRQARLEAITTTQEIRLKGGGRSGIPYALIQALGVQLQSAGRRLVMVLDTLEVL
FT                   RGRGETHPRQLFDWLDQLARAVLVPLVVVAAGRGRALEPVADRVAETLNLDRLTDAEAE
FT                   RLLSAADVPPALWTQVIALAEGDPLQLRLLATLARDEGQAGLTGKGGATITLYRSLEAR
FT                   LGGRHAKLARFIPLFRRFNSELLGAVMAPVVLGERLSPGAAAALWAELKDQTWLIAGET
FT                   EGWLTPQPDLRRRLAGKLYDEHARRTGALHRRAARWFAERPELWAGAESLYHRLQATRW
FT                   AGPDALKGMNLAAGVAFQSADLEELPEAARDALLRARGERSYEGRGDALTPSGEVSPAA
FT                   ADELRMLISKGDLAEASHFYGRVFRPAALDPTSPTADVALTLLWRTGRWTEARRLAAER
FT                   AWTLPWDHALFDTWPEATLVRLEMQAEFNFADLQGWFRQDGEDRPARAARLIRTSRNHL
FT                   GFGALAFALDPDRLFGDRANPPAAVLAMWTPDAPQEGLTRALATAHERRQRIAGGGGSS
FT                   LAAPSRPDDARTLAILSPYGDLAEGLLPRDREGGLLRLLRHQLAALPEAASGRLDGANP
FT                   ASALSALGFTAEWLSAAGLLLRDPDLRLIGRSAERWRAAAAGRWRYARRSPGWRGAPTR
FT                   LDVVIEDRLTALFEAPSPIDAARAQLASWAGDEAGVARVLRSAKLDAVRAELAKQPVEA
FT                   PREAASRAAWQLLRRWIPAAFVPPLAILAIEPEGMLRS"
FT   gene            complement(609287..611065)
FT                   /locus_tag="CCNA_03886"
FT   CDS_