(data stored in ACNUC1104 zone)

EMBL: CP001341

ID   CP001341; SV 1; circular; genomic DNA; STD; PRO; 4395537 BP.
XX
AC   CP001341; ABKU01000000-ABKU01000276;
XX
PR   Project:PRJNA20011;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 4)
XX
DE   Pseudarthrobacter chlorophenolicus A6 chromosome, complete genome.
XX
KW   .
XX
OS   Pseudarthrobacter chlorophenolicus A6
OC   Bacteria; Actinobacteria; Micrococcales; Micrococcaceae; Pseudarthrobacter.
XX
RN   [1]
RP   1-4395537
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Goltsman E., Clum A., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Jansson J., Richardson P.;
RT   "Complete sequence of chromosome of Arthrobacter chlorophenolicus A6";
RL   Unpublished.
XX
RN   [2]
RP   1-4395537
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Tice H., Bruce D.,
RA   Goodwin L., Pitluck S., Goltsman E., Clum A., Larimer F., Land M.,
RA   Hauser L., Kyrpides N., Mikhailova N., Jansson J., Richardson P.;
RT   ;
RL   Submitted (06-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 87673a2811f743a87390162dd01ecd8c.
DR   BioSample; SAMN00000051.
DR   EnsemblGenomes-Gn; Achl_R0001.
DR   EnsemblGenomes-Gn; Achl_R0002.
DR   EnsemblGenomes-Gn; Achl_R0003.
DR   EnsemblGenomes-Gn; Achl_R0004.
DR   EnsemblGenomes-Gn; Achl_R0005.
DR   EnsemblGenomes-Gn; Achl_R0006.
DR   EnsemblGenomes-Gn; Achl_R0007.
DR   EnsemblGenomes-Gn; Achl_R0008.
DR   EnsemblGenomes-Gn; Achl_R0009.
DR   EnsemblGenomes-Gn; Achl_R0010.
DR   EnsemblGenomes-Gn; Achl_R0011.
DR   EnsemblGenomes-Gn; Achl_R0012.
DR   EnsemblGenomes-Gn; Achl_R0013.
DR   EnsemblGenomes-Gn; Achl_R0014.
DR   EnsemblGenomes-Gn; Achl_R0015.
DR   EnsemblGenomes-Gn; Achl_R0016.
DR   EnsemblGenomes-Gn; Achl_R0017.
DR   EnsemblGenomes-Gn; Achl_R0018.
DR   EnsemblGenomes-Gn; Achl_R0019.
DR   EnsemblGenomes-Gn; Achl_R0020.
DR   EnsemblGenomes-Gn; Achl_R0021.
DR   EnsemblGenomes-Gn; Achl_R0022.
DR   EnsemblGenomes-Gn; Achl_R0023.
DR   EnsemblGenomes-Gn; Achl_R0024.
DR   EnsemblGenomes-Gn; Achl_R0025.
DR   EnsemblGenomes-Gn; Achl_R0026.
DR   EnsemblGenomes-Gn; Achl_R0027.
DR   EnsemblGenomes-Gn; Achl_R0028.
DR   EnsemblGenomes-Gn; Achl_R0029.
DR   EnsemblGenomes-Gn; Achl_R0030.
DR   EnsemblGenomes-Gn; Achl_R0031.
DR   EnsemblGenomes-Gn; Achl_R0032.
DR   EnsemblGenomes-Gn; Achl_R0033.
DR   EnsemblGenomes-Gn; Achl_R0034.
DR   EnsemblGenomes-Gn; Achl_R0035.
DR   EnsemblGenomes-Gn; Achl_R0036.
DR   EnsemblGenomes-Gn; Achl_R0037.
DR   EnsemblGenomes-Gn; Achl_R0038.
DR   EnsemblGenomes-Gn; Achl_R0039.
DR   EnsemblGenomes-Gn; Achl_R0040.
DR   EnsemblGenomes-Gn; Achl_R0041.
DR   EnsemblGenomes-Gn; Achl_R0042.
DR   EnsemblGenomes-Gn; Achl_R0043.
DR   EnsemblGenomes-Gn; Achl_R0044.
DR   EnsemblGenomes-Gn; Achl_R0045.
DR   EnsemblGenomes-Gn; Achl_R0046.
DR   EnsemblGenomes-Gn; Achl_R0047.
DR   EnsemblGenomes-Gn; Achl_R0048.
DR   EnsemblGenomes-Gn; Achl_R0049.
DR   EnsemblGenomes-Gn; Achl_R0050.
DR   EnsemblGenomes-Gn; Achl_R0051.
DR   EnsemblGenomes-Gn; Achl_R0052.
DR   EnsemblGenomes-Gn; Achl_R0053.
DR   EnsemblGenomes-Gn; Achl_R0054.
DR   EnsemblGenomes-Gn; Achl_R0055.
DR   EnsemblGenomes-Gn; Achl_R0056.
DR   EnsemblGenomes-Gn; Achl_R0057.
DR   EnsemblGenomes-Gn; Achl_R0058.
DR   EnsemblGenomes-Gn; Achl_R0059.
DR   EnsemblGenomes-Gn; Achl_R0060.
DR   EnsemblGenomes-Gn; Achl_R0061.
DR   EnsemblGenomes-Gn; Achl_R0062.
DR   EnsemblGenomes-Gn; Achl_R0063.
DR   EnsemblGenomes-Gn; Achl_R0064.
DR   EnsemblGenomes-Gn; Achl_R0065.
DR   EnsemblGenomes-Gn; EBG00001161610.
DR   EnsemblGenomes-Gn; EBG00001161611.
DR   EnsemblGenomes-Gn; EBG00001161612.
DR   EnsemblGenomes-Gn; EBG00001161613.
DR   EnsemblGenomes-Gn; EBG00001161614.
DR   EnsemblGenomes-Gn; EBG00001161615.
DR   EnsemblGenomes-Gn; EBG00001161616.
DR   EnsemblGenomes-Gn; EBG00001161617.
DR   EnsemblGenomes-Gn; EBG00001161618.
DR   EnsemblGenomes-Gn; EBG00001161619.
DR   EnsemblGenomes-Gn; EBG00001161620.
DR   EnsemblGenomes-Gn; EBG00001161621.
DR   EnsemblGenomes-Gn; EBG00001161622.
DR   EnsemblGenomes-Gn; EBG00001161623.
DR   EnsemblGenomes-Gn; EBG00001161624.
DR   EnsemblGenomes-Gn; EBG00001161625.
DR   EnsemblGenomes-Gn; EBG00001161626.
DR   EnsemblGenomes-Gn; EBG00001161627.
DR   EnsemblGenomes-Gn; EBG00001161628.
DR   EnsemblGenomes-Gn; EBG00001161629.
DR   EnsemblGenomes-Gn; EBG00001161630.
DR   EnsemblGenomes-Gn; EBG00001161631.
DR   EnsemblGenomes-Gn; EBG00001161632.
DR   EnsemblGenomes-Gn; EBG00001161633.
DR   EnsemblGenomes-Gn; EBG00001161634.
DR   EnsemblGenomes-Gn; EBG00001161635.
DR   EnsemblGenomes-Gn; EBG00001161636.
DR   EnsemblGenomes-Gn; EBG00001161637.
DR   EnsemblGenomes-Gn; EBG00001161638.
DR   EnsemblGenomes-Gn; EBG00001161639.
DR   EnsemblGenomes-Gn; EBG00001161640.
DR   EnsemblGenomes-Gn; EBG00001161641.
DR   EnsemblGenomes-Gn; EBG00001161642.
DR   EnsemblGenomes-Gn; EBG00001161643.
DR   EnsemblGenomes-Gn; EBG00001161644.
DR   EnsemblGenomes-Gn; EBG00001161645.
DR   EnsemblGenomes-Gn; EBG00001161646.
DR   EnsemblGenomes-Gn; EBG00001161647.
DR   EnsemblGenomes-Gn; EBG00001161648.
DR   EnsemblGenomes-Gn; EBG00001161649.
DR   EnsemblGenomes-Gn; EBG00001161650.
DR   EnsemblGenomes-Gn; EBG00001161651.
DR   EnsemblGenomes-Gn; EBG00001161652.
DR   EnsemblGenomes-Gn; EBG00001161653.
DR   EnsemblGenomes-Gn; EBG00001161654.
DR   EnsemblGenomes-Gn; EBG00001161655.
DR   EnsemblGenomes-Gn; EBG00001161656.
DR   EnsemblGenomes-Gn; EBG00001161657.
DR   EnsemblGenomes-Gn; EBG00001161658.
DR   EnsemblGenomes-Gn; EBG00001161659.
DR   EnsemblGenomes-Gn; EBG00001161660.
DR   EnsemblGenomes-Gn; EBG00001161661.
DR   EnsemblGenomes-Gn; EBG00001161662.
DR   EnsemblGenomes-Gn; EBG00001161663.
DR   EnsemblGenomes-Gn; EBG00001161664.
DR   EnsemblGenomes-Gn; EBG00001161665.
DR   EnsemblGenomes-Gn; EBG00001161666.
DR   EnsemblGenomes-Gn; EBG00001161667.
DR   EnsemblGenomes-Gn; EBG00001161668.
DR   EnsemblGenomes-Gn; EBG00001161669.
DR   EnsemblGenomes-Gn; EBG00001161670.
DR   EnsemblGenomes-Gn; EBG00001161671.
DR   EnsemblGenomes-Gn; EBG00001161672.
DR   EnsemblGenomes-Gn; EBG00001161673.
DR   EnsemblGenomes-Gn; EBG00001161674.
DR   EnsemblGenomes-Gn; EBG00001161675.
DR   EnsemblGenomes-Gn; EBG00001161676.
DR   EnsemblGenomes-Gn; EBG00001161677.
DR   EnsemblGenomes-Gn; EBG00001161678.
DR   EnsemblGenomes-Gn; EBG00001161679.
DR   EnsemblGenomes-Gn; EBG00001161680.
DR   EnsemblGenomes-Gn; EBG00001161681.
DR   EnsemblGenomes-Gn; EBG00001161682.
DR   EnsemblGenomes-Tr; Achl_R0001-1.
DR   EnsemblGenomes-Tr; Achl_R0002-1.
DR   EnsemblGenomes-Tr; Achl_R0003-1.
DR   EnsemblGenomes-Tr; Achl_R0004-1.
DR   EnsemblGenomes-Tr; Achl_R0005-1.
DR   EnsemblGenomes-Tr; Achl_R0006-1.
DR   EnsemblGenomes-Tr; Achl_R0007-1.
DR   EnsemblGenomes-Tr; Achl_R0008-1.
DR   EnsemblGenomes-Tr; Achl_R0009-1.
DR   EnsemblGenomes-Tr; Achl_R0010-1.
DR   EnsemblGenomes-Tr; Achl_R0011-1.
DR   EnsemblGenomes-Tr; Achl_R0012-1.
DR   EnsemblGenomes-Tr; Achl_R0013-1.
DR   EnsemblGenomes-Tr; Achl_R0014-1.
DR   EnsemblGenomes-Tr; Achl_R0015-1.
DR   EnsemblGenomes-Tr; Achl_R0016-1.
DR   EnsemblGenomes-Tr; Achl_R0017-1.
DR   EnsemblGenomes-Tr; Achl_R0018-1.
DR   EnsemblGenomes-Tr; Achl_R0019-1.
DR   EnsemblGenomes-Tr; Achl_R0020-1.
DR   EnsemblGenomes-Tr; Achl_R0021-1.
DR   EnsemblGenomes-Tr; Achl_R0022-1.
DR   EnsemblGenomes-Tr; Achl_R0023-1.
DR   EnsemblGenomes-Tr; Achl_R0024-1.
DR   EnsemblGenomes-Tr; Achl_R0025-1.
DR   EnsemblGenomes-Tr; Achl_R0026-1.
DR   EnsemblGenomes-Tr; Achl_R0027-1.
DR   EnsemblGenomes-Tr; Achl_R0028-1.
DR   EnsemblGenomes-Tr; Achl_R0029-1.
DR   EnsemblGenomes-Tr; Achl_R0030-1.
DR   EnsemblGenomes-Tr; Achl_R0031-1.
DR   EnsemblGenomes-Tr; Achl_R0032-1.
DR   EnsemblGenomes-Tr; Achl_R0033-1.
DR   EnsemblGenomes-Tr; Achl_R0034-1.
DR   EnsemblGenomes-Tr; Achl_R0035-1.
DR   EnsemblGenomes-Tr; Achl_R0036-1.
DR   EnsemblGenomes-Tr; Achl_R0037-1.
DR   EnsemblGenomes-Tr; Achl_R0038-1.
DR   EnsemblGenomes-Tr; Achl_R0039-1.
DR   EnsemblGenomes-Tr; Achl_R0040-1.
DR   EnsemblGenomes-Tr; Achl_R0041-1.
DR   EnsemblGenomes-Tr; Achl_R0042-1.
DR   EnsemblGenomes-Tr; Achl_R0043-1.
DR   EnsemblGenomes-Tr; Achl_R0044-1.
DR   EnsemblGenomes-Tr; Achl_R0045-1.
DR   EnsemblGenomes-Tr; Achl_R0046-1.
DR   EnsemblGenomes-Tr; Achl_R0047-1.
DR   EnsemblGenomes-Tr; Achl_R0048-1.
DR   EnsemblGenomes-Tr; Achl_R0049-1.
DR   EnsemblGenomes-Tr; Achl_R0050-1.
DR   EnsemblGenomes-Tr; Achl_R0051-1.
DR   EnsemblGenomes-Tr; Achl_R0052-1.
DR   EnsemblGenomes-Tr; Achl_R0053-1.
DR   EnsemblGenomes-Tr; Achl_R0054-1.
DR   EnsemblGenomes-Tr; Achl_R0055-1.
DR   EnsemblGenomes-Tr; Achl_R0056-1.
DR   EnsemblGenomes-Tr; Achl_R0057-1.
DR   EnsemblGenomes-Tr; Achl_R0058-1.
DR   EnsemblGenomes-Tr; Achl_R0059-1.
DR   EnsemblGenomes-Tr; Achl_R0060-1.
DR   EnsemblGenomes-Tr; Achl_R0061-1.
DR   EnsemblGenomes-Tr; Achl_R0062-1.
DR   EnsemblGenomes-Tr; Achl_R0063-1.
DR   EnsemblGenomes-Tr; Achl_R0064-1.
DR   EnsemblGenomes-Tr; Achl_R0065-1.
DR   EnsemblGenomes-Tr; EBT00001750256.
DR   EnsemblGenomes-Tr; EBT00001750257.
DR   EnsemblGenomes-Tr; EBT00001750258.
DR   EnsemblGenomes-Tr; EBT00001750259.
DR   EnsemblGenomes-Tr; EBT00001750260.
DR   EnsemblGenomes-Tr; EBT00001750261.
DR   EnsemblGenomes-Tr; EBT00001750262.
DR   EnsemblGenomes-Tr; EBT00001750263.
DR   EnsemblGenomes-Tr; EBT00001750264.
DR   EnsemblGenomes-Tr; EBT00001750266.
DR   EnsemblGenomes-Tr; EBT00001750267.
DR   EnsemblGenomes-Tr; EBT00001750268.
DR   EnsemblGenomes-Tr; EBT00001750269.
DR   EnsemblGenomes-Tr; EBT00001750270.
DR   EnsemblGenomes-Tr; EBT00001750271.
DR   EnsemblGenomes-Tr; EBT00001750272.
DR   EnsemblGenomes-Tr; EBT00001750273.
DR   EnsemblGenomes-Tr; EBT00001750274.
DR   EnsemblGenomes-Tr; EBT00001750275.
DR   EnsemblGenomes-Tr; EBT00001750276.
DR   EnsemblGenomes-Tr; EBT00001750277.
DR   EnsemblGenomes-Tr; EBT00001750278.
DR   EnsemblGenomes-Tr; EBT00001750279.
DR   EnsemblGenomes-Tr; EBT00001750280.
DR   EnsemblGenomes-Tr; EBT00001750281.
DR   EnsemblGenomes-Tr; EBT00001750282.
DR   EnsemblGenomes-Tr; EBT00001750283.
DR   EnsemblGenomes-Tr; EBT00001750284.
DR   EnsemblGenomes-Tr; EBT00001750285.
DR   EnsemblGenomes-Tr; EBT00001750286.
DR   EnsemblGenomes-Tr; EBT00001750288.
DR   EnsemblGenomes-Tr; EBT00001750289.
DR   EnsemblGenomes-Tr; EBT00001750290.
DR   EnsemblGenomes-Tr; EBT00001750291.
DR   EnsemblGenomes-Tr; EBT00001750292.
DR   EnsemblGenomes-Tr; EBT00001750293.
DR   EnsemblGenomes-Tr; EBT00001750294.
DR   EnsemblGenomes-Tr; EBT00001750295.
DR   EnsemblGenomes-Tr; EBT00001750296.
DR   EnsemblGenomes-Tr; EBT00001750297.
DR   EnsemblGenomes-Tr; EBT00001750298.
DR   EnsemblGenomes-Tr; EBT00001750299.
DR   EnsemblGenomes-Tr; EBT00001750300.
DR   EnsemblGenomes-Tr; EBT00001750301.
DR   EnsemblGenomes-Tr; EBT00001750302.
DR   EnsemblGenomes-Tr; EBT00001750303.
DR   EnsemblGenomes-Tr; EBT00001750304.
DR   EnsemblGenomes-Tr; EBT00001750305.
DR   EnsemblGenomes-Tr; EBT00001750306.
DR   EnsemblGenomes-Tr; EBT00001750307.
DR   EnsemblGenomes-Tr; EBT00001750308.
DR   EnsemblGenomes-Tr; EBT00001750309.
DR   EnsemblGenomes-Tr; EBT00001750310.
DR   EnsemblGenomes-Tr; EBT00001750311.
DR   EnsemblGenomes-Tr; EBT00001750312.
DR   EnsemblGenomes-Tr; EBT00001750313.
DR   EnsemblGenomes-Tr; EBT00001750314.
DR   EnsemblGenomes-Tr; EBT00001750315.
DR   EnsemblGenomes-Tr; EBT00001750316.
DR   EnsemblGenomes-Tr; EBT00001750317.
DR   EnsemblGenomes-Tr; EBT00001750318.
DR   EnsemblGenomes-Tr; EBT00001750319.
DR   EnsemblGenomes-Tr; EBT00001750320.
DR   EnsemblGenomes-Tr; EBT00001750321.
DR   EnsemblGenomes-Tr; EBT00001750322.
DR   EnsemblGenomes-Tr; EBT00001750323.
DR   EnsemblGenomes-Tr; EBT00001750324.
DR   EnsemblGenomes-Tr; EBT00001750325.
DR   EnsemblGenomes-Tr; EBT00001750326.
DR   EnsemblGenomes-Tr; EBT00001750327.
DR   EnsemblGenomes-Tr; EBT00001750328.
DR   EnsemblGenomes-Tr; EBT00001750329.
DR   EnsemblGenomes-Tr; EBT00001750330.
DR   EuropePMC; PMC2991359; 21124797.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00634; SAM-IV.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01688; Actino-pnp.
DR   RFAM; RF01746; mraW.
DR   RFAM; RF01747; msiK.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01763; ykkC-III.
DR   RFAM; RF01766; cspA.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001341.
DR   SILVA-SSU; CP001341.
DR   StrainInfo; 267825; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4024171
CC   Source DNA and bacteria available from Janet Jansson
CC   (janet.jansson@microbe.slu.se)
CC   Source DNA available from Janet Jansson
CC   (janet.jansson@microbe.slu.se)
CC   Contacts: Janet Jansson (janet.jansson@microbe.slu.se)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-PGF
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4395537
FT                   /organism="Pseudarthrobacter chlorophenolicus A6"
FT                   /strain="A6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:452863"
FT                   /type_material="type strain of Pseudarthrobacter
FT                   chlorophenolicus"
FT   gene            177..1598
FT                   /locus_tag="Achl_0001"
FT   CDS_pept        177..1598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: art:Arth_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38004"
FT                   /db_xref="GOA:B8H7C8"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7C8"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACL38004.1"
FT                   /translation="MTVDEANHANTVGSSWRRVISLLENDHRVTPRQRGFVILAQAQGL
FT                   IGSTLLVAVPNELTREVLQTQVKDALDDALHNVFSEDIRCAIDVDTDLVPIHKEPEPVV
FT                   EPAYAQDQLIEQKPQPMLPSTSHEFGRLNPKYVFDTFVIGSSNRFAHAAAVAVAEAPAK
FT                   AYNPLFIYGDSGLGKTHLLHAIGHYARRLYSGIRVRYVNSEEFTNDFINSIRDDEGASF
FT                   KTTYRNVDVLLIDDIQFLAGKDRTLEEFFHTFNSLHNNNKQVVITSDQPPKLLAGFEDR
FT                   MKSRFEWGLLTDIQPPELETRIAILRKKALSEGLSAPDDALEYIASKISSNIRELEGAL
FT                   IRVTAFASLNRQPVDVALAEMVLKDLITDDGAQEITSGQILQQTADYFKLSMEELCSKS
FT                   RTRTLVTARQIAMYLCRELTDMSLPKIGQELGGRDHTTVIHADRKIRELMAERRVIYNQ
FT                   VTELTNRIKQQQRDS"
FT   gene            2127..3251
FT                   /locus_tag="Achl_0002"
FT   CDS_pept        2127..3251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number="2.7.7.7"
FT                   /note="KEGG: art:Arth_0002 DNA polymerase III, beta
FT                   subunit; TIGRFAM: DNA polymerase III, beta subunit; PFAM:
FT                   DNA polymerase III beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38005"
FT                   /db_xref="GOA:B8H7C9"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7C9"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACL38005.1"
FT                   /translation="MKFRVDRDVLAEAVTWTARSLSPRPPVPVLSGLLLKAEAGTVSLS
FT                   SFDYETSARLEITADIRDEGTILVSGRLLADICRSLPSAPVDVETDGNKVTLTCRRSSF
FT                   HLATMPEAEYPPLPALPAISGTVPGDAFAQAVSQVIIAASKDDTLPILTGVRMEIEDDL
FT                   ITLLATDRYRLAMREVPWKPVTPGVSTSALVKAKTLNEVAKTLGNSGDISLALSDDDTR
FT                   LIGFESGGRTTTSLLVDGDYPKIRSLFPESTPIHATVQTQELVEAVRRVSLVAERNTPV
FT                   RLAFTAGLLNLDAGTGEDAQASEELEAQLSGDDITVAFNPHYLVEGLSVIETKFVRFSF
FT                   TSAPKPAMITAQADADGEDQDDYRYLVMPVRLPN"
FT   gene            3360..4244
FT                   /locus_tag="Achl_0003"
FT   CDS_pept        3360..4244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0003"
FT                   /product="6-phosphogluconate dehydrogenase,
FT                   decarboxylating"
FT                   /note="TIGRFAM: 6-phosphogluconate dehydrogenase,
FT                   decarboxylating; PFAM: NADP oxidoreductase coenzyme
FT                   F420-dependent; 6-phosphogluconate dehydrogenase domain
FT                   protein; 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: art:Arth_0003 6-phosphogluconate dehydrogenase-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38006"
FT                   /db_xref="GOA:B8H7D0"
FT                   /db_xref="InterPro:IPR004849"
FT                   /db_xref="InterPro:IPR006114"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR006183"
FT                   /db_xref="InterPro:IPR006184"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D0"
FT                   /inference="protein motif:TFAM:TIGR00872"
FT                   /protein_id="ACL38006.1"
FT                   /translation="MHIGLIGLGKMGFNMRERLRNGGIEVTGYDRNPDVTDVATVDDLL
FT                   AAVPAPRLIWVMVPAGAVTDAVITELAGKLDQGDLVIDGGNSRFTEDQKHGELLAGKGI
FT                   RFVDCGVSGGVWGLQNGYGLMAGGDAADVDLALPVFDALRPEGDRADSFVHVGGVGAGH
FT                   YAKMVHNGIEYGLMQAYAEGYQLLASKDIISDLPGTFRAWQKGTVVRSWLLDLLVKALE
FT                   EDPGLQNIDDYVEDSGEGRWTVEEAIANAIPAPAITAALFARFESREDSSPAMKMVSAL
FT                   RHQFGGHATRPAK"
FT   gene            4290..5498
FT                   /locus_tag="Achl_0004"
FT   CDS_pept        4290..5498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="KEGG: art:Arth_0004 recombination protein F;
FT                   TIGRFAM: DNA replication and repair protein RecF; PFAM: SMC
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38007"
FT                   /db_xref="GOA:B8H7D1"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8H7D1"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACL38007.1"
FT                   /translation="MYLEHLSLTDFRSYAQVDLVLSPGVTVLVGYNGIGKTNLMEAIGY
FT                   LATLSSHRVSSDGPLLRFGTERALVRARLVRNGQTTVLELEINAGRANRGRINRSNPVR
FT                   ARDLLGICQTVLFAPEDLALVKGDPSNRRRFLDELLASLVPHHAATRSDYDRVLKQRNA
FT                   LLKSARAGRVTAAHEATLDVWDQHMAKAGAELLHARLELVELLRPHLARAYAELTDASK
FT                   PADAIYRSTLQNQMDDDGASLGATGRPGPGDAAAAEDLRGLSIEELTQRYVRAFGESRK
FT                   KELERGISLVGPHRDDLELVLGQAPAKGYASHGETWSMCLSLRLASYYVMLDDARTGGS
FT                   APILILDDVFAELDVQRRRKLAAIVSGAEQVLVTAAVDADIPEELSGRRVKVVPGGIDE
FT                   QGE"
FT   gene            5482..6039
FT                   /locus_tag="Achl_0005"
FT   CDS_pept        5482..6039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0005"
FT                   /product="protein of unknown function DUF721"
FT                   /note="PFAM: protein of unknown function DUF721; KEGG:
FT                   art:Arth_0005 protein of unknown function DUF721"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38008"
FT                   /db_xref="InterPro:IPR007922"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D2"
FT                   /inference="protein motif:PFAM:PF05258"
FT                   /protein_id="ACL38008.1"
FT                   /translation="MSRESDVGGLQPGRDPDQIDAPQAALNRMREAAAARGEIRRKAQR
FT                   PGQQKTRGSIRDTRGFSQFHATGRDPLGLGKVVGRLVAERGWTSPVAVGSVMAEWATLV
FT                   GPEISAHCTPESFTDTTLHVRCDSTAWATQLRLLSASLLEKFRVELGDGVVTSIQVLGP
FT                   SAPSWRKGGRSVNGRGPRDTYG"
FT   gene            6422..8509
FT                   /locus_tag="Achl_0006"
FT   CDS_pept        6422..8509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /EC_number="5.99.1.3"
FT                   /note="KEGG: art:Arth_0006 DNA gyrase, B subunit; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38009"
FT                   /db_xref="GOA:B8H7D3"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D3"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACL38009.1"
FT                   /translation="MANDNTDILAVDPAAGDAGGPDATAEAATPREYGASDITVLEGLE
FT                   AVRKRPGMYIGSTGPRGLHHLVYEVVDNSVDEALAGYCSHIEIVLQADGGVKVVDDGRG
FT                   IPVDMHPTEHKPTVEVVMTILHAGGKFGGGGYAVSGGLHGVGISVVNALSSRVDTEVRR
FT                   QGHVWRMSFANGGKPQGSLVQGEETERTGTTQTFYPDAEIFETTEFDFETLRARFQQMA
FT                   FLNKGLRITLTDERAATEEEADADPDLDGMVTEGEINAEHRTVVYQYDEGLLDYVKHLN
FT                   SGKKVDVVHEDVIAFETEDKDRKIALEMAMQWTNAYSESVHTYANTINTHEGGTHEEGF
FT                   RAAMTSLVNRYAREKGIIKEKDDNLTGDDIREGLTAVISVKLSEPQFEGQTKTKLGNSE
FT                   VKGFVQRVVTDGLGDWLERNPGPARDVIRKAISAAQARMAARKARDNARRKSPLESFGM
FT                   PGKLSDCSSKDPEKCEVYIVEGDSAGGSAKRGRNPETQAILPLRGKILNVERARLDKAL
FT                   GNAEVQSMITAFGTGIGEDFDLAKLRYHKIVLMADADVDGQHITTLLMTLLFRYMRPLI
FT                   ENGYVYLAQPPLYRIKWSNAPHDYVYSDRERDAKLVSGQAAGRRIPKDNGIQRYKGLGE
FT                   MDYTELWDTTMDPDNRTLLQVTMDDALAADQIFSVLMGEDVESRRNFIQQNAKDVRFLD
FT                   I"
FT   gene            8562..11192
FT                   /locus_tag="Achl_0007"
FT   CDS_pept        8562..11192
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0007"
FT                   /product="DNA gyrase, A subunit"
FT                   /note="TIGRFAM: DNA gyrase, A subunit; PFAM: DNA
FT                   gyrase/topoisomerase IV subunit A; DNA gyrase repeat
FT                   beta-propeller; KEGG: art:Arth_0007 DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38010"
FT                   /db_xref="GOA:B8H7D4"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D4"
FT                   /inference="protein motif:TFAM:TIGR01063"
FT                   /protein_id="ACL38010.1"
FT                   /translation="MSDETRENPATDAGNPETVLEGDVLIDRVEQVDLQTEMQRSYLDY
FT                   AMAVIVGRALPDVRDGLKPVHRRVLYAMFDGGYRPDRSFNKCARVVGEVMGQYHPHGDT
FT                   AIYDALVRLIQDWTMRYPLALGQGNFGSPGNDGAAAPRYTETKMAPLAMEMVRDIDEET
FT                   VDFQDNYDGKNQEPTILPARFPNLLVNGSSGIAVGMATNIPPHNLREVADGVQWYLANP
FT                   AATREELLEELLRRVKGPDFPTGATILGHKGIEDAYRTGRGSVTMRAVVNVEELQNRTC
FT                   LVVTELPYQANPDNLAIKIAELVKDGKIQGIADLRDETSGRTGQRLVIVLKRDAVAKVV
FT                   LNNLYKHTELQSNFSANMLAIVDGVPRTLSLDAFIRHWVTHQMDVIARRTRYRLRKAEE
FT                   EAHILRALLKALDMLDEVIALIRASNTTEAARDGLMELLDIDELQARAILDMQLRRLAA
FT                   LERQKIQDRHSELEALIAEYNAILASEERQREIISTELGEIVDKHGDDRRTKILMGFDG
FT                   DMSMEDLIPEEEMVVTITRGGYVKRTRSDNYRSQQRGGKGIKGAQLRGDDVVEHFFVTT
FT                   THHWLLFFTNLGRVYRAKAYELMEAGRDAKGQHVANLLAFQPDEHIAQVLDLKDYQQSP
FT                   YLVLATKRGLVKKTRLEDYDTNRSAGVIAINLRDGDELVSAQLVSETDDLFLVSRMGQS
FT                   IRFTATDDALRPMGRATSGVTGMKFREDDELLAADVVTDGSFVFIVTEGGYAKRTAVEE
FT                   YRLQGRGGLGIKVGKYQEERGHLVGALIVQEEDEVLVVMEGGKVVRSSVAGVPAKGRDT
FT                   MGVIFAKPDKNDRIIEVARNSERGLEDEESAEDDVTLAEESPAFVSEDASGDAEPNDDN
FT                   TEVTE"
FT   gene            11462..11848
FT                   /locus_tag="Achl_0008"
FT   CDS_pept        11462..11848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0008"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: aau:AAur_0008 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38011"
FT                   /db_xref="GOA:B8H7D5"
FT                   /db_xref="InterPro:IPR021949"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D5"
FT                   /inference="similar to AA sequence:KEGG:AAur_0008"
FT                   /protein_id="ACL38011.1"
FT                   /translation="MKPAPKAKARRARLLISKVDPWSVLKMAFLLSVALGIVTVVAAIV
FT                   LWTVLDLTGIFDQVDSLLGTLAGSEGGGFELKKVASLGQVASFATIIAVVNVVLLTALS
FT                   MLSAVLYNISATLVGGIGVTLTDD"
FT   sig_peptide     11462..11590
FT                   /locus_tag="Achl_0008"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.925 at
FT                   residue 43"
FT   gene            11947..12020
FT                   /locus_tag="Achl_R0001"
FT                   /note="tRNA-Ile1"
FT   tRNA            11947..12020
FT                   /locus_tag="Achl_R0001"
FT                   /product="tRNA-Ile"
FT   gene            12053..12205
FT                   /locus_tag="Achl_0009"
FT   CDS_pept        12053..12205
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0009"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38012"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38012.1"
FT                   /translation="MRNTAAGRNGEHVKKLLVLAAAIAGVLLYRKAQESEARKDVWSKS
FT                   TDTVN"
FT   gene            12278..12353
FT                   /locus_tag="Achl_R0002"
FT                   /note="tRNA-Ala1"
FT   tRNA            12278..12353
FT                   /locus_tag="Achl_R0002"
FT                   /product="tRNA-Ala"
FT   gene            12446..13384
FT                   /locus_tag="Achl_0010"
FT   CDS_pept        12446..13384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0010"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: aau:AAur_0012 integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38013"
FT                   /db_xref="GOA:B8H7D7"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D7"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL38013.1"
FT                   /translation="MTLFIAAMGVLGVASSGPLIAATLGATSVSALAIAFWRNAIAAVV
FT                   MAGPTLVREPRRFGSITGREFRWSLLAAVALALHFACFITSLQLTSVAAATALVCLQSA
FT                   WIAIFQLLRGTRHRWQVLAGLGIAFGGVVAITGFDMGSSPEALLGDMLALAGGALAGLY
FT                   TLAGGKARQSMTTGTYTALCYGMCAALVAVLALATGQPLAGFDAGGWLGILAITVCAQL
FT                   VGHTAFNHLLATMSPLLVSMIILLEIPGAAFLASVFLGETLPAGTYAGLGLIMVGLAVV
FT                   VAGQRSGRARLRIKAPGDEPASDRIAELGTD"
FT   sig_peptide     12446..12511
FT                   /locus_tag="Achl_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.903 at
FT                   residue 22"
FT   gene            complement(13401..14276)
FT                   /locus_tag="Achl_0011"
FT   CDS_pept        complement(13401..14276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0011"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   art:Arth_0010 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38014"
FT                   /db_xref="GOA:B8H7D8"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D8"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACL38014.1"
FT                   /translation="MSADQSSGDPLNDAADLPRVSVVIPAYNEESVIRQCLIAAIYQSV
FT                   PAHEIIVVDNLSTDRTAAIVRQMQLEYPESPILLLTQDSEQGLIPTRNFGLDHATGDVL
FT                   GRIDADSVVEPDWVEQVQKAFQDHSVQAATGPVVYYDMPMRRFGLKADDKMRQLMLKLA
FT                   KQQYHFLFGSNMALRSTAWNTIRAETCRDEKDEMHEDIDLSLHLAEHDLKVQYWPQMVS
FT                   GMSARRLEDSPRDYRYYVTRFDRTYKAHNVKKMALKAPMVVFFSVYFPAKLLRAIHTVN
FT                   TAQPVRRGGQ"
FT   gene            complement(14413..15399)
FT                   /locus_tag="Achl_0012"
FT   CDS_pept        complement(14413..15399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0012"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0011 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38015"
FT                   /db_xref="GOA:B8H7D9"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7D9"
FT                   /inference="similar to AA sequence:KEGG:Arth_0011"
FT                   /protein_id="ACL38015.1"
FT                   /translation="MKKSDRIARDLEQSVTHAVENAKDWATPRVEAAVDWAVPRLQHGL
FT                   DTASPKIQEGLKSAAHNLADGVATVTPRLQDGLAQLAPRINDVVENASPKLHEALDKAT
FT                   PVVLNARDRVVVEYLPKLSDQLGVASEAVHRTLEGAPARVDAVAQRLGDAGIVHSIQEQ
FT                   AQATGTQLKAAAAEAGRSVGIQLAKPEPKKKRGWLVFGVIAAAVAAGVAAWKASKPVED
FT                   PWKTPSPVTPTPAPVPATTVNEVKETTADAAEKASDAAGSFAAAGADKVSESADTAKEK
FT                   AEDAADKAKHVAEDAADAAPKVATDAKTATRNIANSIHNGDKGTTQA"
FT   gene            15555..16100
FT                   /locus_tag="Achl_0013"
FT   CDS_pept        15555..16100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0013"
FT                   /product="Peptidylprolyl isomerase"
FT                   /EC_number="5.2.1.8"
FT                   /note="PFAM: peptidyl-prolyl cis-trans isomerase
FT                   cyclophilin type; KEGG: art:Arth_0012 peptidylprolyl
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38016"
FT                   /db_xref="GOA:B8H7E0"
FT                   /db_xref="InterPro:IPR002130"
FT                   /db_xref="InterPro:IPR020892"
FT                   /db_xref="InterPro:IPR024936"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E0"
FT                   /inference="protein motif:PRIAM:5.2.1.8"
FT                   /protein_id="ACL38016.1"
FT                   /translation="MTAIATAKATIHTSLGDIVVNLFGNHAPKTVKNFVGLATGEQDWT
FT                   HPETGEAKTGTPLYNGTIFHRIIKDFMIQAGDPLGRGTGGPGYRFDDEIHPELSFNQPY
FT                   KLAMANAGIQMGKGTNGSQFFITTIPTDWLQGKHSIFGEVADDESKKVVDAIEGVRTGM
FT                   GDRPVEDVTINSIDIEQL"
FT   gene            16110..16988
FT                   /locus_tag="Achl_0014"
FT   CDS_pept        16110..16988
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0014"
FT                   /product="Rhomboid family protein"
FT                   /note="PFAM: Rhomboid family protein; KEGG: art:Arth_0013
FT                   rhomboid family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38017"
FT                   /db_xref="GOA:B8H7E1"
FT                   /db_xref="InterPro:IPR000315"
FT                   /db_xref="InterPro:IPR022764"
FT                   /db_xref="InterPro:IPR035952"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E1"
FT                   /inference="protein motif:PFAM:PF01694"
FT                   /protein_id="ACL38017.1"
FT                   /translation="MSYGIPSAEPSAQVPVCPRHPDRPSYVRCQRCGRPACPDCQRAAA
FT                   VGFQCVDCVNETRRTTPEVRSVYGGAVATGKPMVTFGIIAACAVLYVLQWIIPNDAVYQ
FT                   SLGFANIYAEPRYGQFEPWRMLTAAFLHSQGFILHIALNMYMLWIFGQALEPLLGRVRF
FT                   LAVYLLSALGGSVGYLLLTPLYVPGQPLYGVVGASGAIFGLFGAMLLVQRQRGGDTRQL
FT                   WILIAINGAIGFLVPQIAWQAHLGGLVTGALCAAVIAYTPRGPRRGVLQAVGLLAVLAL
FT                   LAAAVWVRVTI"
FT   gene            complement(17781..18389)
FT                   /locus_tag="Achl_0015"
FT   CDS_pept        complement(17781..18389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0015"
FT                   /product="DNA-3-methyladenine glycosylase I"
FT                   /EC_number="3.2.2.20"
FT                   /note="PFAM: methyladenine glycosylase; KEGG: art:Arth_0014
FT                   DNA-3-methyladenine glycosylase I"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38018"
FT                   /db_xref="GOA:B8H7E2"
FT                   /db_xref="InterPro:IPR005019"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E2"
FT                   /inference="protein motif:PRIAM:3.2.2.20"
FT                   /protein_id="ACL38018.1"
FT                   /translation="MSPSADLIVGDDGLARPAWASTDPLMRTYYDQEWGLPVRDEHGLY
FT                   ERICLEGFQAGLSWATILRKRPAFRAAFADFNPDAVALYTDGDVNRLMQDSGIVRNRLK
FT                   IIATIKNARATIALREEGGLVDFVWGFQPASTPQPLAHADIPTQSVESVALSKALRRKG
FT                   FAFVGPTTMFALMEAIGMVDTHLVDSHRRGSSGVWPLPS"
FT   gene            complement(18438..18689)
FT                   /locus_tag="Achl_0016"
FT   CDS_pept        complement(18438..18689)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0016"
FT                   /product="protein of unknown function UPF0233"
FT                   /note="PFAM: protein of unknown function UPF0233; KEGG:
FT                   art:Arth_0016 protein of unknown function UPF0233"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38019"
FT                   /db_xref="GOA:B8H7E3"
FT                   /db_xref="InterPro:IPR009619"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E3"
FT                   /inference="protein motif:PFAM:PF06781"
FT                   /protein_id="ACL38019.1"
FT                   /translation="MPESKPRKKTASTAEKAAPDAYKPNPVWFKPVMFGLMIIGLFWII
FT                   TFYISEGRFPVQPWGSWNIVAGFGIAIVGFMMTTRWRS"
FT   gene            18855..19637
FT                   /locus_tag="Achl_0017"
FT   CDS_pept        18855..19637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0017"
FT                   /product="sortase family protein"
FT                   /note="TIGRFAM: sortase family protein; PFAM: peptidase C60
FT                   sortase A and B; KEGG: art:Arth_0017 sortase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38020"
FT                   /db_xref="GOA:B8H7E4"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042003"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E4"
FT                   /inference="protein motif:TFAM:TIGR01076"
FT                   /protein_id="ACL38020.1"
FT                   /translation="MVLQEKARPAAPPTAGVVILRGAVQVVGELLITAGVILLLFVAWQ
FT                   LWWTNVESDAKQSEVIKEFAQDLGAAPAPAPTAPPAEGEDFGEPVVGAAPGHAGTIGIM
FT                   YIPRFGPNYTRPIVQGTSQDVLDTLGLGHYDSTAMPGAVGNFAVAGHRQTHGAVLDNIH
FT                   TLVPGDKIYVQTKDGYYTYVFRNNQIVMPSRTDVLAPVPTLQGVAPTERFLTMTSCNPR
FT                   FGAEERIIAYALMDSWRPGSAGPPAEIAAQVAAAIGKG"
FT   gene            19640..19810
FT                   /locus_tag="Achl_0018"
FT   CDS_pept        19640..19810
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0018"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0018 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38021"
FT                   /db_xref="GOA:B8H7E5"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E5"
FT                   /inference="similar to AA sequence:KEGG:Arth_0018"
FT                   /protein_id="ACL38021.1"
FT                   /translation="MYGWIFRHLPGPLWLRIVTSVVLVAAALVLMVQFLFPWMSEYTQF
FT                   TDSTIGAASQP"
FT   gene            19807..20448
FT                   /locus_tag="Achl_0019"
FT   CDS_pept        19807..20448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0019"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I;
FT                   molybdopterin binding domain; KEGG: art:Arth_0019
FT                   anthranilate synthase, component II"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38022"
FT                   /db_xref="GOA:B8H7E6"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E6"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACL38022.1"
FT                   /translation="MTTTKILVVDNYDSFVYTLVGYLQELGAETTVVRNDDVTLAEAIE
FT                   LAGTRDGVLVSPGPGNPAEAGICIELIKWCGENSVPMFGVCLGHQALAEAFGGTVTHAP
FT                   ELMHGKTSQVEHIGTSVFAGLPSPITATRYHSLAAVRESIPDVLEVTAQTASGVVMGLQ
FT                   HRTAPLCGVQFHPESVLTEGGYQMLGNWLESLGMAGAAARAAKLSPLIQH"
FT   gene            complement(20503..22449)
FT                   /locus_tag="Achl_0020"
FT   CDS_pept        complement(20503..22449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0020"
FT                   /product="serine/threonine protein kinase with PASTA
FT                   sensor(s)"
FT                   /note="PFAM: tyrosine protein kinase; PASTA domain
FT                   containing protein; Serine/threonine protein
FT                   kinase-related; SMART: serine/threonine protein kinase;
FT                   KEGG: art:Arth_0020 serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38023"
FT                   /db_xref="GOA:B8H7E7"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017441"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E7"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACL38023.1"
FT                   /translation="MNESSRAPLHREDNVPVDNKRVLSGRYELGGLIGRGGMADVYSGT
FT                   DTRLGRTVAIKILRPDMARDPQFQARFKREAQSVAALNHSSIVAIYDTGEQQVHDGSEE
FT                   SVRLPYIVMEFVDGKTLRDLIRAKDVSIGQAIDYTLGVLGALEYSHRAGIVHRDIKPAN
FT                   VMFCEATNSIKVMDFGIARAMADSSATMTQTQAVVGTAQYLSPEQARGETVDARSDLYS
FT                   AACLLYEMLTSRPPFIGDSPVSVAYQHVREIPAPPSSINPEVSSALDTVMAKALQKNRD
FT                   DRFQDAAAFQRALRAARSGVAVPAVPASEAPTDPNDHVPAPDSPPTEAFAAAAGAGFLD
FT                   DAPTGRLAVTGRDDAGARAPLSVADEPGEAEPLPLGLSPEREPSPRQKSRRRAWIATLV
FT                   IFTVLILAGGGLWVYSVVNRPAPPPPKVDIPVVASMTESAALQELYNANLKPKITRSQN
FT                   DAVPKGIAIGTDPVSGQKLDPGAEVILNISEGPSAVKIPETIPGSTEAAARDVLRQVGL
FT                   VGAPSTTTANSATVPAGIVITTSPAPGQSVGVGTTVELVVSTGKVAVPELRGRTREEAE
FT                   AALKDLGLVPNVVEAENGQVEAGRVTDQSDAVNAAVEQGKTITVVVAKAPPPPPTATPT
FT                   PTPTSTKGSRDRD"
FT   gene            complement(22462..24207)
FT                   /locus_tag="Achl_0021"
FT   CDS_pept        complement(22462..24207)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0021"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; Serine/threonine
FT                   protein kinase-related; SMART: serine/threonine protein
FT                   kinase; KEGG: art:Arth_0021 serine/threonine protein
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38024"
FT                   /db_xref="GOA:B8H7E8"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:B8H7E8"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACL38024.1"
FT                   /translation="MRPTTGITLGGRFQLTTRIAIGGMGEVWKAKDLVLGRIVAIKVLK
FT                   EEYTGDPGFLQRFRAEARHTALLNHVGIANVFDYGEEEGSAYLVMELVPGQPLSSIIEH
FT                   EHVLSPDRTLSIMAQTARALSVAHAQGLVHRDIKPGNLLITPDGRVKVTDFGIARLADQ
FT                   VPLTQTGQVMGTAQYLAPEQATGQTATGSSDIYSLGVIGYECLTGHRPFSGESQIAIAL
FT                   AQVNDAPPPLPETLPTPVRALLMSMLAKDPKNRPANAIKLAEAAEAIRNGDVGAARAAV
FT                   PGMLLFDAPDTGPITAPVDTATAPTGVIGAQRDSSPTATSALPVVGAAAAGAAAGAAAA
FT                   NAADGDAPDGNAAQGPLARANALAAERNWNQEETTYDDEPSDEPQRKGRSPWTWPLIAL
FT                   ILLVLFALVGVLLNNMGVFSPSNSPTSVATSSIPKTTSATPTRTSQAPSPTPTRDTPTP
FT                   TPTPTPTQETVNVIPDAYLGKDYRTVQSELSALGLVVNGVQQESTEDPGTVLDLNPTGP
FT                   VPAGSTITVTYAIAPSPAPTSQAPTSEAPTATAPATAESAPSPQLPLPTCSTGQEPGTP
FT                   PTCAR"
FT   gene            complement(24204..25664)
FT                   /locus_tag="Achl_0022"
FT   CDS_pept        complement(24204..25664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0022"
FT                   /product="Peptidoglycan glycosyltransferase"
FT                   /EC_number="2.4.1.129"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   KEGG: art:Arth_0022 peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38025"
FT                   /db_xref="GOA:B8H851"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B8H851"
FT                   /inference="protein motif:PRIAM:2.4.1.129"
FT                   /protein_id="ACL38025.1"
FT                   /translation="MNQAIRHSWIAAVAMFALLFGALSFVQVVGADELKANPLNQRAIL
FT                   QNYCSDRGAIIVGGTPVAESVETGSETCKFQRTYPQPELYAGMTGYFSQNYGATGLERA
FT                   MGEVLTGDSDQLFLDRVGQLFLGNQPKGASVELTIDPELQQLAYSLIPDGQRGSIVVTN
FT                   PKTGAILAMASKPSYDPNKVAVQDPEAESASINEFLKVPGINLNQNVSGPTGELLAPGS
FT                   VFKLVDTAAALSSGKYNADSVLPNPAEMPFDGISYRLPNYAGGNCYTRDTASFAFALQQ
FT                   SCNTPFASIALDLGRDAIASQAQKFGFGEDLGDQLKLGYARGNGFPDELDAPGLAQSAI
FT                   GQKDVRATPLQVNMMTSAIANDGVQMRPSLIKTLRSPDLRVIDEPQPEQLRTSTTPEIA
FT                   NQITDWMVSAVSEGIANRAGVPGVQVAGKTGTAELGNGTNNSWFTGFAPANNPQVSVTI
FT                   VMEGVDITTGAQLTSPNAKKIFEAVLNK"
FT   sig_peptide     complement(25569..25664)
FT                   /locus_tag="Achl_0022"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.649 at
FT                   residue 32"
FT   gene            complement(25661..27049)
FT                   /locus_tag="Achl_0023"
FT   CDS_pept        complement(25661..27049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0023"
FT                   /product="cell cycle protein"
FT                   /note="PFAM: cell cycle protein; KEGG: art:Arth_0023 cell
FT                   cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38026"
FT                   /db_xref="GOA:B8H852"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="UniProtKB/TrEMBL:B8H852"
FT                   /inference="protein motif:PFAM:PF01098"
FT                   /protein_id="ACL38026.1"
FT                   /translation="MSQLSTALKPRRNVELALLVLALAVGIGANMMVGVDKEKAFDSDF
FT                   WFQSSLLAVAALVFHGVLRFRAKYADPIMLPLVVALNGLGLAMIHRLDPPGADTGNNQL
FT                   RWTLIAMAVAIAVIWFLKDHRILRRFTFISLAASALLLVLPLVPGISAGEILGARVWIR
FT                   LGPMTFQPGEVAKITLAIFFAGYLSSNRDLILLAGRKIGPLQFPRFKDMGPMIAAWLVS
FT                   IGVLIFQRDLGSSVLFFGLFIVMIYVATSRISWVVIGLALILGGGFVASRVFSHVEQRI
FT                   NGWINAFTPEVYENGSRQVIQGLFGMANGGLVGTGLGQGRPDLVPFANSDMIIASLGEE
FT                   LGLIGIFAIVLMYLLLVTRGFRAALGTRDAFGKLLACGLSFAVALQCFVVIGGVTRLIP
FT                   LTGLTTPFLAAGGSSLLANWIIVGLLLLISHTARGPVDTTPLPPSKSADTTGIDTPTEA
FT                   VKQA"
FT   gene            complement(27046..28749)
FT                   /locus_tag="Achl_0024"
FT   CDS_pept        complement(27046..28749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0024"
FT                   /product="protein serine/threonine phosphatase"
FT                   /note="PFAM: Protein phosphatase 2C-like; SMART: protein
FT                   phosphatase 2C domain protein; KEGG: art:Arth_0024 protein
FT                   serine/threonine phosphatases"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38027"
FT                   /db_xref="GOA:B8H853"
FT                   /db_xref="InterPro:IPR001932"
FT                   /db_xref="InterPro:IPR015655"
FT                   /db_xref="InterPro:IPR036457"
FT                   /db_xref="UniProtKB/TrEMBL:B8H853"
FT                   /inference="protein motif:PFAM:PF00481"
FT                   /protein_id="ACL38027.1"
FT                   /translation="MAVSENPATGPQPAPRPLIMRYAARSDVGRIRSKNDDSAYAGRHL
FT                   AVVADGMGGHAGGDVASAATVLDMIHLDRADYEGDAGTILADEIQTANSLLSELVHINP
FT                   KLAGMGTTVTALLLAEGKLHFAHIGDSRAYRLRDGEFEQVSVDHTFVQRLIDEGRLRPE
FT                   EAETHPHKNVLMRVLGDVDASPELDLDTLEARPGDRWLLCSDGLNYVAGHAVERTVKET
FT                   PNLRECVETLVDLTLEAGSPDNVTVIMLEIAEETPDDVSTAAVDVIPAARTAQSADAPA
FT                   ADTTPEAGIPEIRATDAEDARDPGAKSAVAGTATSGGSEADTGPAEDKAPDPGSTDPHL
FT                   GEHLSAEVLREELSSRPHELVGAAATAAESGSIPSIAGRTVARRAATVLTHKAEPAAND
FT                   DDETLVPLKPRRWITWSVAAAVVVVLGVGLWLGYAWTQTRYYVGESDSRVAIFNGVSQR
FT                   LGPIQLSSLETVTDIRMDSLPQFSQQRVRQTVPANDLYDAQRIVKNLELTGTTSPEEEC
FT                   PAATASPSPTPGATTPAPSATASAAPPSAAPASGSPTPSPSPTVNCEGAK"
FT   gene            complement(28752..29234)
FT                   /locus_tag="Achl_0025"
FT   CDS_pept        complement(28752..29234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0025"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   art:Arth_0025 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38028"
FT                   /db_xref="GOA:B8H854"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="UniProtKB/TrEMBL:B8H854"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACL38028.1"
FT                   /translation="MSDLTITALRFGFLLLLWVLVFSIVSAMRRDLMVGRKAASGAPTA
FT                   REVRKNPDLAEAPPQPVKQQARQLVVVEGPLKGTTLPLAASPVLLGRAQEATLVLEDDY
FT                   ASGRHARLFPQGSRWFIEDLGSTNGTYLADQQLTRALPVEPGVPVRIGKTVIELRP"
FT   gene            complement(29231..29974)
FT                   /locus_tag="Achl_0026"
FT   CDS_pept        complement(29231..29974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0026"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   art:Arth_0026 FHA domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38029"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="InterPro:IPR022128"
FT                   /db_xref="InterPro:IPR032030"
FT                   /db_xref="InterPro:IPR042287"
FT                   /db_xref="UniProtKB/TrEMBL:B8H855"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACL38029.1"
FT                   /translation="MGLLDKVERGIEKAVRGVFSTGSKAQVEPVEIASKLRREVDHKAL
FT                   TVAAGRTLAPNVFDVQLSDDDFKRAQEWGTPLAEELCDVVINHVRSQGYTLQGSVRISF
FT                   RRDSELRAGDFEIVSSTEKSKGNGNAQPSRPTVPAAPSRQPVRLQPVLDIDGQRYSLNA
FT                   PSIVLGRSSEADIHVEDTGVSRRHLEIRTANGATSAVDLGSTNGSYVNGQRVSGSVELT
FT                   DGSTITMGRTKIIFRLLPANPGGHA"
FT   gene            30349..30431
FT                   /locus_tag="Achl_R0003"
FT                   /note="tRNA-Leu1"
FT   tRNA            30349..30431
FT                   /locus_tag="Achl_R0003"
FT                   /product="tRNA-Leu"
FT   gene            complement(30578..31528)
FT                   /locus_tag="Achl_0027"
FT   CDS_pept        complement(30578..31528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0027"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: msm:MSMEG_6126 D-isomer
FT                   specific 2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38030"
FT                   /db_xref="GOA:B8H856"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H856"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL38030.1"
FT                   /translation="MKNIAVLQVGPLMPVVQESITKDYGAVRLPDGQEERAEFLGQHGG
FT                   TFDVAVTSGKFGVGTDLMRALPNLRAVINFGVGYDTTDVAQAFERGIIVSNTPDVLNDC
FT                   VADTAVALYVDVLRGISAADRFVRRGDWLSKGNFPLATKASGRKVGILGLGRIGKVIAR
FT                   RLEGFDCEISYHSRNPVAGVDYRYAASPRELAAGCDVLIVAAAGGPGSTGLVDTGVIDA
FT                   LGPRGYLINIARGSVVDQDALVDALLSGKLGGAGLDVFVDEPKVPQDLLELENVVLLPH
FT                   LGSGTHETRAAMADLTLANLRSYSEDGSLVTPVHP"
FT   gene            31837..33399
FT                   /locus_tag="Achl_0028"
FT   CDS_pept        31837..33399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0028"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: mva:Mvan_1024 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38031"
FT                   /db_xref="GOA:B8H857"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8H857"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL38031.1"
FT                   /translation="MTSSSKFPFSTAAVKWPALAAVAVLGLSGCSVANSDGAGGGAADT
FT                   VRVVLGQEPPTLEACESNLTSTGVVVRSNVTEPLIERNPQSGELEPKLATEWKATSDTE
FT                   WTLKLREGVNFQDGTPFNAEAAAFTIDRAVNSKLGCNVEGYVFGDADLDVKAVDATTLT
FT                   VTTPEPDPILPLRLSFLEVVPTSTSTTEKVREPIGTGPYKIDSWDAGQKISLSSWDGYW
FT                   GNKPAYAKAEYQWRSESSVRAAMITSGEADVAMGLSPDDNIGDLGVDYPNNETVALRMD
FT                   ANEAPLNDIRIRQAVNYAIDKEGIVNSLYQGKHQVAAQLVPEGIVGHNDELKGWPFDLE
FT                   KAKSLVAEAKADGVDTSKQISLVVRSAQFPKITELAQVLQEQLSQAGLNVKLKMLETSQ
FT                   HLTYQVRPFAEDDGAVALMTQHGNQAGDAAFTVDQYMLSTGAQSYFGTPEFDAMIKKAD
FT                   AASGDDRQKAFEEIFAYQNDKVVQFAHISHQTGILGKAKSVNYTPNSSSGDELRISEMT
FT                   PAS"
FT   sig_peptide     31837..31944
FT                   /locus_tag="Achl_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.582 at
FT                   residue 36"
FT   gene            33426..34355
FT                   /locus_tag="Achl_0029"
FT   CDS_pept        33426..34355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0029"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rha:RHA1_ro03929 ABC
FT                   dipeptide transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38032"
FT                   /db_xref="GOA:B8H858"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H858"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38032.1"
FT                   /translation="MLTYLRKRIISSALPLVVVVVGVFALARMTGNPAALYLPLNATQQ
FT                   MRDDFTARNGLDQPLLVQMADYFGGVLRLDFGQSLRTGQDAAAMALRAFPATLQLAATT
FT                   MVLAVVLAVIVGCWAALKPNGIADRISSFISMAAASIPDFWLAIVGIWIFAITLGWVPT
FT                   SGVSGASAWVLPIATLLLRPFGVLVQIVRGSMVSALSEPYIKLARSRGAGELRVVTHHA
FT                   LRNAAAPALTVAGDLTVGLVNGAVVVETIFGWPGIGKLMIDSILQRDFAVLQAAVLLTA
FT                   VAIFALNILIDMGYALLDARVRPVTVKA"
FT   sig_peptide     33426..33509
FT                   /locus_tag="Achl_0029"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.735 at
FT                   residue 28"
FT   gene            34364..35368
FT                   /locus_tag="Achl_0030"
FT   CDS_pept        34364..35368
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0030"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: rha:RHA1_ro03930 ABC
FT                   dipeptide transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38033"
FT                   /db_xref="GOA:B8H859"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H859"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38033.1"
FT                   /translation="MTSSLTDDAAQEGQEDRQPAKQPPTRNAPPKDGQPSLFRLLLKDR
FT                   FATVAAFVLLLVGLTALVGPALMGDLATKQNLLFANKAPFTMAHGWEYFLGSDSLGRSM
FT                   LARLVVASRTTLSVALPAVAVALVIGSLWGVWAGYHRGWRENVSMRIADVIMSFPSLLL
FT                   AVVVLYVFSPSAANIVLILALTRIPIYLRTARAESAELQSRTFVDAARTFGAKPNAIIV
FT                   RHVIPVVLPTLLTLATLEFCYVMLAESSLSFLGIGIQPPDVSWGLMVSQGRQYLQTAWW
FT                   LSIFPGVAIVVTTIAANVLAAWLRIATDPAQRWRLALPRKRLIARIPVKEAQP"
FT   gene            35365..36504
FT                   /locus_tag="Achl_0031"
FT   CDS_pept        35365..36504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0031"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rha:RHA1_ro03931 ABC dipeptide transporter,
FT                   ATP-binding component; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38034"
FT                   /db_xref="GOA:B8H860"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H860"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL38034.1"
FT                   /translation="MKTAADPSTLRRTRGSTATESQAHDVVLQVSGLAVDIRTHRGTVR
FT                   AVNSVGFEARAGETLALLGESGCGKSMTAKALAGIMDPVCDLADGQIVLNGTDLAALTP
FT                   KERLKFAGPELGIVFQDALTALNPVYTVGTQLGEAFRIHRGLNAKQARAEAIDLMKRVG
FT                   IPEPESRVNSYPHQFSGGMRQRILIAMAVALNPRLLIADEPTTALDVTVQAQIMQLLRK
FT                   LREEGQMAVILITHDLAVVAEEADSVAVMYAGNVVESGPVAEVFADPRHPYTKGLLESV
FT                   PVHLERGDQLKSIPGSPPELHDIPSGCVYQSRCPMVQDICRAERPALRPAGRRRAENGA
FT                   ATATADLERTTSAGTNDGGATARPVRTAACHFSEEITNA"
FT   gene            36497..37537
FT                   /locus_tag="Achl_0032"
FT   CDS_pept        36497..37537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0032"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: rha:RHA1_ro03932 ABC oligopeptide transporter,
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38035"
FT                   /db_xref="GOA:B8H861"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H861"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL38035.1"
FT                   /translation="MPEPLLSIEGLTKTFHVAKSASGNTRLKALDGISLTVGRGETLGL
FT                   VGESGCGKSTLARTLMMLETPDEGTVSFEGTNPFGLKGKELLAWRRRVQMVFQDPFASL
FT                   NARMSAGDIIAEPWATHRSLYPSSRERDERVKELLQMVGLRASDARKSPQEFSGGQRQR
FT                   IGIARALALKPDVIILDEPVSALDLSVQAQVLNLLNELQKELGVSYIFISHDLTVVRHV
FT                   ADRVAVMYLGRIIETGETEEVFDHPRHPYTAALMSASPKLDVSGAKRDRIVLQGELPSP
FT                   LDPPSGCHFRTRCWKAQDICAEVAPEPQVLTAPDGRRHLAECHFPLDTIKGLTGAAAAA
FT                   STANAL"
FT   gene            37534..38259
FT                   /locus_tag="Achl_0033"
FT   CDS_pept        37534..38259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0033"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   msm:MSMEG_6119 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38036"
FT                   /db_xref="GOA:B8H862"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B8H862"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACL38036.1"
FT                   /translation="MTGAEYAIIAGAIFLAACLQASSGFGMGMLAAPVIAIIDPELLPA
FT                   TLILLALLVTVMVTVTERQSLDLRGTGWALVGRVPGSMLGAWLVAITSREGMAWVVVAV
FT                   VLAGLVLAGRGWVPRPGRTNLVVAGAASGIMGTATSIGGPPMALIWQGHEGPRLRGTMS
FT                   AFFMVGSAISMALLWLAGTVTEHMLVLALWMVPAVLAGYAVSRYVNRFLSRARLRKLAL
FT                   GASALGSAMLVMQLLLGLS"
FT   sig_peptide     37534..37644
FT                   /locus_tag="Achl_0033"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.798) with cleavage site probability 0.481 at
FT                   residue 37"
FT   gene            complement(38231..39259)
FT                   /locus_tag="Achl_0034"
FT   CDS_pept        complement(38231..39259)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0034"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: msm:MSMEG_6115 phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38037"
FT                   /db_xref="GOA:B8H863"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H863"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL38037.1"
FT                   /translation="MSAPAEPGSIQSLRIVVTDPIISRFEEALRSDGGAHHWDMAADWP
FT                   PERRAAALARADVVVCSALPPHEAEAAGNVRLVHVTGAGYDKISFPHLAPGAAVANTFH
FT                   HARPIAEHVLMVTLMLSRNVVRADREVRNGQWRTIATTPDVPFHPVLSDLTLGLVGLGS
FT                   IGAEVARVAGAMGMKVRAVRRNPAATLPEGVQLDWVGGNSDLPALLAGSDVVVVTVPLA
FT                   EDTRGMIGAAELGAMKPSAFLINVARGAVVDQGALYAALSERRIAGAGLDVWWGTPAGG
FT                   VVPPAEWPFTELENTVLTPHHSGHARVTFERRAGDIAANIRQLAGGLPLRNVVRTDPAA
FT                   VA"
FT   gene            complement(39256..40557)
FT                   /locus_tag="Achl_0035"
FT   CDS_pept        complement(39256..40557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0035"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: sen:SACE_4841 mandelate racemase/muconate
FT                   lactonizing enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38038"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B8H864"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ACL38038.1"
FT                   /translation="MTTAFDPSHHLGQVRITGVTITPVAFKDPPLLNTVGVHEPFALRA
FT                   IIEVLTDSGVSGFGETYGDAGHLARLQLAADSLTGVDVFNINTLRGRIAQALSVDTIEG
FT                   GHGMSGMVTGSSTADRVLSAFDVAALDIQGKLLGRPVSDLLGGAVRDSVQFSGYLFYKW
FT                   EGHPGQEADRWGAALDPEGIVRQARAMVDGYGFGALKLKAGVFPPEEEIAAIQALRAEF
FT                   PDLPLRIDPNAAWTVETSIRVGKELDGVLEYLEDPTPGIEGMAAVRREVGMPLATNMCV
FT                   VSFADVAPSVAAGAVDVILSDHHFWGGLRRSQFLAGITETFGLGLSMHSNSHLGISLAA
FT                   MVHLAAATPNLDYACDTHWPWKDPEEDVIEGGVLRFTDGGVAVPTAPGLGIIIDRDALD
FT                   RLHRQYLDCGLRSRDDTGYMQRLHPSYQLQSPRW"
FT   gene            40680..41600
FT                   /locus_tag="Achl_0036"
FT   CDS_pept        40680..41600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0036"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rha:RHA1_ro03793 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38039"
FT                   /db_xref="GOA:B8H865"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H865"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL38039.1"
FT                   /translation="MFSLPQLEAFVAVAEELHFGAAAERLNMTQPPLSRQIQMLEKKLN
FT                   TTLFSRTSRKVELTAAGATLLPRARQILDMCIKTDMDVRRVSSGQAGTITVGYTAIAGQ
FT                   SALPMMLRKAAEGMPGVSFVLRELVSTDQMDGLVKGSVDIGLLRPIVARPGVVFRPLMQ
FT                   DRLVVAVPEGSPVLGNTRIPDGQPLPLGSLDRRPLLMYSTKEARYFHDLVLRLFASAGA
FT                   HANITQYASQVPALLAFVQAGLGVTLVPASAMAFAPPGVEFHEIDGRHGMQELNRVDLE
FT                   LAWNEETANPAVLRLLDLIGESVSA"
FT   gene            complement(41597..42301)
FT                   /locus_tag="Achl_0037"
FT   CDS_pept        complement(41597..42301)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0037"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: art:Arth_0031 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38040"
FT                   /db_xref="GOA:B8H866"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H866"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL38040.1"
FT                   /translation="MSRNLTADLAADLRNRIVDGIIQPGEKLPSENTLISDFGVSRTVV
FT                   RAALTRLQAEGLVETERGRGSFALTPPSDGPQAVPGARPVATTEDRLHLLEFRMGVETE
FT                   AAALAARNHTERQLRAVGTALEAFTDSAGHPSHAMKSDFDFHRAVAAASGNPYYSDCLA
FT                   ALGQTMIAMPRTRLMTGVEHYARDHFDQVVQEHRSILDAIADGDEAAAAAAMRSHLANS
FT                   RRRFKASARPSS"
FT   gene            complement(42325..43452)
FT                   /locus_tag="Achl_0038"
FT   CDS_pept        complement(42325..43452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0038"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: aau:AAur_0037 mandelate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38041"
FT                   /db_xref="GOA:B8H867"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR033978"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B8H867"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ACL38041.1"
FT                   /translation="MSTVDLIRHVKLSTARLPLAVPISDAKVFTGRQKPMTEVVFLFAE
FT                   ITTELGHSGIGFSYSKRAGGPAQYAHAKEVAEGIIGEDPNDIAKIYTKLLWAGASVGRS
FT                   GVATQALAAIDIALYDLKAKRAGLPLAKFLGSYRDSVQTYNTSGGFLNATLDEVKARAT
FT                   QSIEEGIGGIKIKVGLPDSAEDLRRVAGIREHIGWDVPLMVDANQQWDRATALRMGRRL
FT                   EEFNLVWIEEPLDAYDFEGHAHLAQVLDTPIATGEMLASVAEHKGLIAANGCDIIQPDA
FT                   PRVGGITQFLRLAALADERGLGLAPHFAMEIHLHLAAAYPREPWVEHFDWLDPLFNERL
FT                   ETKDGRMIVPDRPGLGVTLSDQARAWTTDSVEFGA"
FT   gene            complement(43561..44169)
FT                   /locus_tag="Achl_0039"
FT   CDS_pept        complement(43561..44169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0039"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Tetracyclin repressor
FT                   domain protein; KEGG: art:Arth_0039 transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38042"
FT                   /db_xref="GOA:B8H868"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR003012"
FT                   /db_xref="InterPro:IPR004111"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8H868"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL38042.1"
FT                   /translation="MLDKAGITSAALELVSRKGYDGLTMAALAKILDVAPSALYNHVSS
FT                   KQDVLLLVEDHLMSLVDVSSFGAAPWDEAVRTWAWSYRNVFAEHTPLIPVIAVLPVTDA
FT                   PQTLAMYETVSKGFLDAGFPQERIISAIVALESFIFGSAYDVTAPEDIFDPGTMAESTP
FT                   YFSAAVRGSTGEGVPAADAAFTLGLDALVAGLGGLRTAD"
FT   gene            44390..45781
FT                   /locus_tag="Achl_0040"
FT   CDS_pept        44390..45781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0040"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; HI0933 family protein; FAD
FT                   dependent oxidoreductase; KEGG: art:Arth_0040 putrescine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38043"
FT                   /db_xref="GOA:B8H869"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8H869"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACL38043.1"
FT                   /translation="MLNLNRDVVVVGAGPSGLTAARELKKAGLSVAVLEARDRVGGRTW
FT                   TGTVDGATLEIGGQWVSPDQEALLELLQELNLETYPRYRDGESVYIGSDGVPVRYTGDS
FT                   FPVDPETAVEMDRLVAILDQLAAEIGPAEPWAHPKARDLDTISFHHWLRQNSASEEACK
FT                   NIGLFIAGGMLTKPAHSFSALQAVLMAASAGSFTNLTDEDFILDRRVVGGMQQVSQLLA
FT                   QDLGDDVVLNSPVRTINWEPDAEGGHRVTVQSDRATVNARFVIMAVPPNLYSRVSFNPP
FT                   LPRRQHQMHQHQSLGLVIKVHAVYATPFWRDKGLSGTGFGADALVQEVYDNTNHGDARG
FT                   TLVGFVSDEKADAVFELSAEERKEAILASVAGYLGDEALTPEVYYESDWGSEEWTRGAY
FT                   AASYDLGGLHRYGKDQHAPVGPIYWSSSDLAAEGYQHVDGAIRMGRRTAERIAEVARVS
FT                   VPAGA"
FT   gene            45860..46342
FT                   /locus_tag="Achl_0041"
FT   CDS_pept        45860..46342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0041"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: aau:AAur_2021 putative general stress
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38044"
FT                   /db_xref="GOA:B8H870"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR038725"
FT                   /db_xref="UniProtKB/TrEMBL:B8H870"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACL38044.1"
FT                   /translation="MTDPQGISKVTEIINDSKIGMVTTINEEGALVSRPLAVQEVKDDG
FT                   DMWFFTGLGTSQVAHVRADSRVNVSFGKKTEWVSVAGTAEVVTDRAKIHEMWNQVVEAW
FT                   FPDGPDTPEVCLLRVDSDSAEYWTSPGGTAATVLQWVKSKVTNSRMSVGESGTVEL"
FT   gene            46527..46994
FT                   /locus_tag="Achl_0042"
FT   CDS_pept        46527..46994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0042"
FT                   /product="protein of unknown function DUF1348"
FT                   /note="PFAM: protein of unknown function DUF1348; KEGG:
FT                   aau:AAur_0438 putative protein of unknown function
FT                   (DUF1348)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38045"
FT                   /db_xref="InterPro:IPR009783"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B8H871"
FT                   /inference="protein motif:PFAM:PF07080"
FT                   /protein_id="ACL38045.1"
FT                   /translation="MQRPPLPPFNEASAIQKVRSAEDAWNTRDPERISLAYSEGSRWRN
FT                   RSVFLTGRPAIVDFLSGKWERELDYRLIKELWAYTGDVIAVRFAYEYHDAAGQWFRAYG
FT                   NENWKFDDDGLMTHRHASINDVAIDESGRKFHWDTSGPRPSDHPGLTELGL"
FT   gene            46994..47560
FT                   /locus_tag="Achl_0043"
FT   CDS_pept        46994..47560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0043"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: aau:AAur_0437
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38046"
FT                   /db_xref="GOA:B8H872"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8H872"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL38046.1"
FT                   /translation="MPRTVLDRADAVRALAGVFRRRGFESGSLSVIQQETGIGRGSLYH
FT                   FFPDGKADMARAVLAQVRAWFDEQVFAPLRTADDAAQAVAAMSQVVEEYFVSRERVCLF
FT                   AAMTLGEEQETFAREVRAYFADWVGVLAETLRRGGIVESDAADLAVDAVAAIQGGLIMT
FT                   RALDDDAVFTGIVARTDRRLQAALT"
FT   gene            complement(47677..48279)
FT                   /locus_tag="Achl_0044"
FT   CDS_pept        complement(47677..48279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0044"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38047"
FT                   /db_xref="UniProtKB/TrEMBL:B8H873"
FT                   /inference="similar to AA sequence:KEGG:Arth_0044"
FT                   /protein_id="ACL38047.1"
FT                   /translation="MKPEEIPARDQYGRLLEDRGVWRQATTLEGAGELTARWLEGGSSY
FT                   QPGHFAPGYDDETNPIAATLAELNRNGLFTRESQPGILGGAGAQRQYVTGFCSGAAAGE
FT                   LLALSTRTELVTIAHAPGEASSAAIPVTLDGTEVVTVLGSSENPVNEEQIKAWADETND
FT                   SLALLLADSWYVEILDPVWGRNDVLLPAVLGALTGQD"
FT   gene            complement(48334..48981)
FT                   /locus_tag="Achl_0045"
FT   CDS_pept        complement(48334..48981)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0045"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0045 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38048"
FT                   /db_xref="GOA:B8H874"
FT                   /db_xref="UniProtKB/TrEMBL:B8H874"
FT                   /inference="similar to AA sequence:KEGG:Arth_0045"
FT                   /protein_id="ACL38048.1"
FT                   /translation="MAAVTEGLVQGLVEGAWALVLCGPVLVASVAATVFVVRRRTLLAP
FT                   DGGGQRSDQLFWDLFLGSCVALPALLIPTLISPWTGLFLAGAAVAAGIGAYRGTPRYLA
FT                   KRSRRRDDLARESAHLAARAQHDELMAKWSRYELDPACSIEYPALTDVRLPETSALIKA
FT                   MRAAEQLRNNPGHGSASGTGNEYPDAVTSLAASLANAERAAGIPAGQGPGSS"
FT   gene            49214..49594
FT                   /locus_tag="Achl_0046"
FT   CDS_pept        49214..49594
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0046"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: aau:AAur_0047 putative
FT                   glyoxalase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38049"
FT                   /db_xref="GOA:B8H875"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8H875"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL38049.1"
FT                   /translation="MRIKMCSIHVKDPALAHDFYTKTLGFDTLMAMPEYNLYIIKDPGA
FT                   PDNTAGLLLEPSDNPIGADYMNAVHEAGLPAIVFGVPDVQAEYDRLVAAGVSFKSPPAE
FT                   DPSGISAVFDDGCGNYIQLHQD"
FT   gene            complement(49702..50076)
FT                   /locus_tag="Achl_0047"
FT   CDS_pept        complement(49702..50076)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38050"
FT                   /db_xref="UniProtKB/TrEMBL:B8H876"
FT                   /inference="similar to AA sequence:KEGG:Arth_0058"
FT                   /protein_id="ACL38050.1"
FT                   /translation="MKPATVAKKLGIYLPATPQEFQDSTITREEFAELQANPPEWLAEL
FT                   RRNGPHPRPVVAQKLNVSISGLARGGVEDALTTAEITALLQAPPQWLVTERSTHAAVRA
FT                   EAQRVKDEAAKKEAKRARAN"
FT   gene            50138..50893
FT                   /locus_tag="Achl_0048"
FT   CDS_pept        50138..50893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0048"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: LysR substrate-binding; KEGG: art:Arth_0059
FT                   transcriptional regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38051"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="UniProtKB/TrEMBL:B8H877"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL38051.1"
FT                   /translation="MPSTTSSPDDAVSAGDIPAEAPRELRIAYVPGVTPGKWIRRWEER
FT                   MPHIPLHAQMHDGVTPAEEVRGGSADMAFVRLPIVRDGLSVIPLYEEQAVVVAPKGHEI
FT                   SVFEEVALADLDQESLLDVAALGGPEPALQVVASGAGLVVLPMSVARHFNVKDTVARRA
FT                   TDAPVTEIALVWATESTDEVLEEFIGIVRGRTAQSSRQPSAQPVKEKKAPKPDRRGSGA
FT                   KKAAPKVAQRYAPNPDKGRGKGSRKKGKR"
FT   gene            complement(50917..51027)
FT                   /locus_tag="Achl_0049"
FT   CDS_pept        complement(50917..51027)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0049"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38052"
FT                   /db_xref="UniProtKB/TrEMBL:B8H878"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38052.1"
FT                   /translation="MKKLLFAFLPAIIGRILRARKARQTGTGQVPPRNRY"
FT   gene            complement(51120..51794)
FT                   /locus_tag="Achl_0050"
FT   CDS_pept        complement(51120..51794)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38053"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:B8H879"
FT                   /inference="similar to AA sequence:KEGG:Arth_0346"
FT                   /protein_id="ACL38053.1"
FT                   /translation="MSENPDAIRADIEATRARLGTNVDAVADKVTPSNIVHRQTDKVKD
FT                   AVSGVKEKIMGAADHTTTRVQDTLHHGAQSSAGHTTNALHSTGESLHDAKDNVASTLSD
FT                   AGHTVAATPDRVKAKTQGNPLAAGLIAFGAGMLISSLIPASDKERQAADQLKTAAEPLT
FT                   TELTDAAKGMVQDLKEPAQHAMDNVKTTATDGIEHVKTDSQDAATDVKDRATTAKDTIQ
FT                   NT"
FT   gene            complement(51791..52219)
FT                   /locus_tag="Achl_0051"
FT   CDS_pept        complement(51791..52219)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0051"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   art:Arth_0347 protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38054"
FT                   /db_xref="GOA:B8H880"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B8H880"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ACL38054.1"
FT                   /translation="MSSQFPESPNVAHQKADNASLGDLLGDVTRDLSTLMRQEVELAKA
FT                   ELKQSATRAGKGGGMLAGAGVAGHFVLIFLSLALMFALGALMPLGWAAVIVAVIWAITA
FT                   AILASIGRKNLKEIKGLPQTGETLAEIPPTLKPGEVNR"
FT   gene            complement(52219..53088)
FT                   /locus_tag="Achl_0052"
FT   CDS_pept        complement(52219..53088)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0052"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38055"
FT                   /db_xref="UniProtKB/TrEMBL:B8H881"
FT                   /inference="similar to AA sequence:KEGG:Arth_0348"
FT                   /protein_id="ACL38055.1"
FT                   /translation="MTENQWPQTPNPAVTDPYGAATVEDDFTTASMSGPAGGSKTDAAK
FT                   SEASDVAGQATSAAKDVAHTAKEEAANVAAEAKTNAKDLMNQAKTGLTSEAGAQQQKAA
FT                   EGIRNISGQLHSMASAPEQQGVASDLIRQAAERGDSVASWLENREPGDLLGEVQRFARN
FT                   KPGTFLLLAAGAGLLAGRLTRSLTAGAPEQAPGTAGAGQAQSQASTQPAAHSAPVQPLH
FT                   QETVYAAGTDDLFAEPTVSGGTPSSTSTLPGGTAEDTPLRYEDDPFRDEDGSYRTAEGG
FT                   FRSTEGRP"
FT   gene            53380..53976
FT                   /locus_tag="Achl_0053"
FT   CDS_pept        53380..53976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0053"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: art:Arth_2545
FT                   transcriptional regulator, MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38056"
FT                   /db_xref="GOA:B8H882"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H882"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACL38056.1"
FT                   /translation="MTSNLDPDARNSYRLITLAARLVQRRQDEALAPLGLTRAAVIALE
FT                   GLSGGPLNQERLADAIRVQSQTLGRVLTRLEAAGQITRTRQASDRRQLKVELTEVGLAA
FT                   LEAARQAEVDAYPDDPDIGWSVLRDELAKFIRAAPASRNSGVVPFAPPQHRAGHERTPH
FT                   GTQPSERSSRDRPVHDRKGHGPPAAGGLHGLDQSQ"
FT   gene            complement(54019..54354)
FT                   /locus_tag="Achl_0054"
FT   CDS_pept        complement(54019..54354)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0054"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: aau:AAur_0312 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38057"
FT                   /db_xref="UniProtKB/TrEMBL:B8H883"
FT                   /inference="similar to AA sequence:KEGG:AAur_0312"
FT                   /protein_id="ACL38057.1"
FT                   /translation="MKRRFAALSAAPLLLLLSGCGAVEDAATDAANDAASKVATAAADE
FT                   VNKQICAVVQDGLVSVQDKQVLAGLVSAARTAGVPTDITTPLGEIAEAGDQVPAESVQA
FT                   LQDACAA"
FT   sig_peptide     complement(54286..54354)
FT                   /locus_tag="Achl_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.386 at
FT                   residue 23"
FT   gene            complement(54405..55661)
FT                   /locus_tag="Achl_0055"
FT   CDS_pept        complement(54405..55661)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0055"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein;
FT                   D-arabinono-14-lactone oxidase; KEGG: aau:AAur_0055
FT                   putative xylitol oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38058"
FT                   /db_xref="GOA:B8H884"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR007173"
FT                   /db_xref="InterPro:IPR010031"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8H884"
FT                   /inference="protein motif:PFAM:PF01565"
FT                   /protein_id="ACL38058.1"
FT                   /translation="MKNWAGNLEYASSAVHRPGSVDELAALVAAAPRVKALGSRHSFNR
FT                   VGDTEGLHILLDGLPHSIEPDSERQTVKVSGGVSYGELCRALEQSGLAIHNLASLPHIS
FT                   VAGAIQTGTHGSGVNNQSLAGKVQSIDLVRPSGDVLTLSPADGDDFLASVVGLGAMGVV
FT                   TAVELSTRPSFRMRQRVLENLPWDAALANFDALASAAYSVSLFTTYAGDSVSQVWLKAL
FT                   DAEPPLAELFGATAATRPLHPLPDMSAENCTQQLDEAGPWLDRLPHFRHEFTPSNGEEL
FT                   QSEYILPLEHAPAAIEAVRTLADRLAPLLFISEIRTGAADEFWLSPFYRQQSVALHFTW
FT                   KPLQADVEALLPELEDLLRPFGARPHWGKLFTPSRFDWEQLYPRFAGFRSLASAHDPEG
FT                   KFRNALLDSILGVPAASGR"
FT   gene            55778..57061
FT                   /locus_tag="Achl_0056"
FT   CDS_pept        55778..57061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0056"
FT                   /product="putative alpha-galactosidase"
FT                   /note="KEGG: kra:Krad_3464 putative alpha-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38059"
FT                   /db_xref="GOA:B8H885"
FT                   /db_xref="InterPro:IPR002241"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR041233"
FT                   /db_xref="UniProtKB/TrEMBL:B8H885"
FT                   /inference="similar to AA sequence:KEGG:Krad_3464"
FT                   /protein_id="ACL38059.1"
FT                   /translation="MTLAATPPMGWNSWDCYGTSVTEAEVLANAAFMAQHLLPHGWDTV
FT                   VVDIQWYEPAARAGGYNHGARLELDPYGRQLPAVNRFPSAAGGLGFKPLADRIHALGLK
FT                   FGLHIMRGIPRQAVLERLPVEGTSVTADLIADTASVCNWNADNYGLDHSQPGAQAYYDS
FT                   QLRLFASWGVDFVKADDMLGPYFDAEIAAYRSAMDRCGRDMVLSLSPGRALSLSRLEHL
FT                   RANAAMWRVSDDLWDVWEDVEAQFARLARWAPHQRPGSWADADMLPVGRLAQRAERGGE
FT                   RLSRLTADEQRTMLSLWCIARSPLMLGCDLPASPPETLDLLTNPDLLAAHRAGANSREL
FT                   LRDGDLVVWAAESTTSEDRYVACFNTGTAGLARSLPLADLGLPQPHGWQVREAWSGSGA
FT                   GITAVDRVPALDVDLPAHGVRFHTFFRA"
FT   gene            complement(57096..57947)
FT                   /locus_tag="Achl_0057"
FT   CDS_pept        complement(57096..57947)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0057"
FT                   /product="pentapeptide repeat protein"
FT                   /note="PFAM: pentapeptide repeat protein; KEGG:
FT                   aau:AAur_1319 pentapeptide repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38060"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:B8H886"
FT                   /inference="protein motif:PFAM:PF00805"
FT                   /protein_id="ACL38060.1"
FT                   /translation="MNIQPNGAPLLTQDTLRPDCSNCFALCCTAFGFTRSADFAIDKPP
FT                   ATECPNLAYDFSCTIHSRLRARGFRGCTVFDCFGAGQSVSQILFGGISWREDPESQPAM
FT                   FGAFRVVKQLHEMLWHLAEAHRRTYSPDTAADVQHLRVTLEEAAASGSQAVLELDVEAL
FT                   HHSTAQLLGAVSEEVRAGYFTDDGGPVTGLRPGADLAGAGLRGERLCGADLRNAVLIGA
FT                   DFRGTDLTAVDLLGADLRDARLDDADLAGALFLTQAQAASARGNGGTRLPSVLARPGHW
FT                   TD"
FT   gene            complement(58152..59882)
FT                   /locus_tag="Achl_0058"
FT   CDS_pept        complement(58152..59882)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0058"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: aau:AAur_3573 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38061"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8H887"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL38061.1"
FT                   /translation="MSPINVVEASIGTLRSALETGETTSEELVRTYLARIEKYDSNGIC
FT                   LNAMVVMNPDALEEARESDRRRAEGTLLGPLDGIPYTAKDSYQARGLTVAAGSPAFKEL
FT                   VAQRDAFTIERLRAGGAVLIGLTNMPPMANGGMQRGVYGRAESPYNADYLTAAFASGSS
FT                   NGSGTATAASFAAFGLAEETWSSGRAPASNNALCAYTPSRGVISVRGNWPLVPTMDVVV
FT                   PHARTMADLLEVLDVVVADDPETRGDFWRVQPWIQVPRASAIRPPSYVDLAVPGASAAA
FT                   GVLAGKRFGVPRMYINADPDAGTAPNPGIGGPTGRRIDTRGSIIDLWNAARRDLEAAGA
FT                   EVVEVDFPVVSNYEGDRPGAPTLATRGLVSADYLRREIVDLSAWAWNDFLDSNGDPRLN
FT                   RLADVKGADIFPAPDGSLPDRYDGFDDDISDYPAWIGEHGVPELAGIPHLRAGLEGLEE
FT                   TRRKDLEQWMDRLGLDAVVFPAAADVGPADADRNRDSADLAWRNGAWVSNGNLVPRHLG
FT                   IPTVTVPMGLAADIGMPVGLTIAGRAYSDTELLRLAAAFEATGSRRVPPPRTTSTEDVG
FT                   "
FT   gene            complement(59879..61006)
FT                   /locus_tag="Achl_0059"
FT   CDS_pept        complement(59879..61006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0059"
FT                   /product="Agmatine deiminase"
FT                   /EC_number="3.5.3.12"
FT                   /note="PFAM: Porphyromonas-type peptidyl-arginine
FT                   deiminase; KEGG: kra:Krad_0833 agmatine deiminase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38062"
FT                   /db_xref="GOA:B8H888"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="UniProtKB/TrEMBL:B8H888"
FT                   /inference="protein motif:PRIAM:3.5.3.12"
FT                   /protein_id="ACL38062.1"
FT                   /translation="MTFIYASLDGAGAAPAQATVDQAAPASANASGVMPAEWSPHQQTW
FT                   MAFPPPNDTFGAAGSATLDRARAAWTSVARTIARYEPVTVVADPRDATAAREWLGSGIA
FT                   VVEIPLDDAWIRDSGPSFVHQPDGSLTAVDWVFNGWGAQEWAAWGKDRKVASAVAAQSD
FT                   VPVRSSSLVNEGGGFHVDGEGTVLLTETVQLDPGRNPGATKESVEVEIHAALGTTKAIW
FT                   LPRGLTRDYDEFGTRGHVDIVAAFAGPGTILLHRQDNPDHPDHAVYLQLKAVLQGQLDA
FT                   QGRPLRIIDVPAPTVLSDDEGYVDWSYINHYVANNAVVLCAFGDPNDAIAQGILERAYP
FT                   GRTVELVDARDIFAFGGGIHCITQQQPEPRESASS"
FT   gene            complement(61119..61826)
FT                   /locus_tag="Achl_0060"
FT   CDS_pept        complement(61119..61826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0060"
FT                   /product="putative esterase/lipase"
FT                   /note="KEGG: aau:AAur_3919 putative esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38063"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8H889"
FT                   /inference="similar to AA sequence:KEGG:AAur_3919"
FT                   /protein_id="ACL38063.1"
FT                   /translation="MDIILVPGFWLDASSWAGVVPAIEAAGHRSVPLTLPGLESKDANR
FT                   AGIGLRDHIDAVVAAVDGLDGKVVLVGHSGGGAIIHGVIDARPDRVARAIYVDSGPLGE
FT                   GGVVNDELEADGDDIPLPPWEGFEDADLVDLDDALREQFRARAIPQPKGVAFDQQHLHD
FT                   ERRYDVPATVIACEFPSAMLHEWIAGGHPFVAELGRMTDVEYVDLPTGHWPQFTKPDEL
FT                   GSVIVAAVDRTGT"
FT   gene            complement(61999..63159)
FT                   /locus_tag="Achl_0061"
FT   CDS_pept        complement(61999..63159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0061"
FT                   /product="ribosome small subunit-dependent GTPase A"
FT                   /note="TIGRFAM: ribosome small subunit-dependent GTPase A;
FT                   PFAM: GTPase EngC; KEGG: art:Arth_2843 ribosome small
FT                   subunit-dependent GTPase A"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38064"
FT                   /db_xref="GOA:B8H890"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B8H890"
FT                   /inference="protein motif:TFAM:TIGR00157"
FT                   /protein_id="ACL38064.1"
FT                   /translation="MNTSSGNALDSTITQQPTADGPFGFGYTAAVAQYFKDHPCPGATG
FT                   AGRVVRVDRNLLLVAVADGLLHLPYPLTGEPAVTGDWVWIGPNRAGDRQILAVLPRRSE
FT                   LSRKRAFEDSSAEQVLAANMDTVGVVVPVDRPLTHNRLERTLVAAWDSGATPLVIITKA
FT                   DLAQVADDVVGKVILQAAGVEVVTTSAEHGDGIDELLVHIPAGGTIVLLGPSGAGKSTL
FT                   INSLVGREVQHTGEVRSGDFKGKHTTTSRELVPLANGTVLMDTPGVRGFGLFDAEDGMD
FT                   EMFGDVEELAARCRFADCGHGNEPGCAVREAIDVGSLPERRWQSYLKMQREIAALARRS
FT                   DVAAQRAYYREWHQKVVSVGKSQRWAEREVAEKRDQAGGKRRKRTR"
FT   gene            complement(63444..64484)
FT                   /locus_tag="Achl_0062"
FT   CDS_pept        complement(63444..64484)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0062"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; KEGG: art:Arth_3663 protein of
FT                   unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38065"
FT                   /db_xref="GOA:B8H891"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="UniProtKB/TrEMBL:B8H891"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACL38065.1"
FT                   /translation="MSEYLPGIIWLAVLLVVNGFFVGAEFAVISARRSQIEPKAEAGSK
FT                   AAKTTLWAMEHATLMLATSQLGITVCSLIILNVSEPAIHHLLEIPLGLTSLSYEAISII
FT                   AFIVALLLVTFLHVVLGEMVPKNISFSVPTRAALILAPPLVIVARIFKPVIWTLNGIAN
FT                   GILRLFKVEPKDEATSAYTLDEVANIVEQSTRDGMLKDTTGALTNAFEFTAKTVADVQV
FT                   PLADIVLLPETATPADIQQAVARHGYSRYILTDSNGEPAGYLHLKDVMDLTSPEKFARP
FT                   VPAKRIRRLASAFAGSELEDALAAMRRTGAHVARVFDAQGATTGMLFLEDIIEELVGEV
FT                   QDATSA"
FT   gene            complement(64477..65835)
FT                   /locus_tag="Achl_0063"
FT   CDS_pept        complement(64477..65835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0063"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: art:Arth_3662 protein of unknown function DUF21"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38066"
FT                   /db_xref="GOA:B8H892"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8H892"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACL38066.1"
FT                   /translation="MYEWIMLGIGLVLTVGTGFFVASEFALVNLDRHDLEARQARGEKR
FT                   LGPTIKALKITSTHLSGAQLGITLTTLLTGYTFEPAISRMLNGPLTSAGLPEAVVPAVG
FT                   SVAGIFLATIFSMVIGELVPKNFALALPLATAKVVVPFQALFTTVFKPVILLFNNTANK
FT                   IIRGFGIEPKEELSGARSAEELSSLVRRSAVEGVLDLDHATLLHRTLRFTEHSAVDVMT
FT                   PRVRMTAVGTADTAEEIVGLAKSTGYSRFPVIGRDRDDVVGVLHVKQAFAVALSDRARI
FT                   TAEELMIEPLRVPESMGVDTLLNLLRKQGLQVAIVSDEHGGTAGIVTLEDLVEEIVGEL
FT                   EDEHDRARVGVVRTGRSITFDAALRPDELLDRTGIRVPDGEYDTVAGFVTDQLDRLPEL
FT                   GDEVEVDGGTLRVERAMETRVERLRFTPAESGDAPQSPHDRIVDNITRELTHE"
FT   gene            complement(65960..66196)
FT                   /locus_tag="Achl_0064"
FT   CDS_pept        complement(65960..66196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0064"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38067"
FT                   /db_xref="InterPro:IPR031493"
FT                   /db_xref="UniProtKB/TrEMBL:B8H893"
FT                   /inference="similar to AA sequence:KEGG:Arth_3176"
FT                   /protein_id="ACL38067.1"
FT                   /translation="MLLLFGFKTVNNALPGRSATCQHCRAHAHHTLVERATKFTLFFIP
FT                   VLTTSRKFHITCTNCGYVSSISGRQKRALEMRG"
FT   gene            66359..67510
FT                   /locus_tag="Achl_0065"
FT   CDS_pept        66359..67510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0065"
FT                   /product="diguanylate cyclase"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; KEGG: art:Arth_0476 diguanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38068"
FT                   /db_xref="GOA:B8H894"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8H894"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL38068.1"
FT                   /translation="MVLDTTTLRIAFGLMALVLVVLFYFSAYRVTRSPYSGWWCVALVF
FT                   FLGGSGCFLLDGTPHQIWANPVGNVLLVHGGVAVWAGARSLRTARPPMWAFTGLPLATL
FT                   VASVLDNPATNTWSGGTVFLAAMSISIGLASRELWRLEPGYSRVRIPMAVSAGGLAVYY
FT                   FFRWLAFVLEGQDGRIFVTVFGSAVTTLVTMVLLVVVSFSMAALSSEQQTRALRVVASR
FT                   DDLTGLLNRKAFLDLAAEQLADRAITGASGALILADLDHFKSVNDTYGHAAGDVALRRF
FT                   ADACIATVRTTDLVGRYGGEEFVLLMPGASPERAELVASEISRRLAADARLDGVEMPTA
FT                   SYGISTYDAGTSQVDDLIAAADAALYTAKSLGRNRSARSDGRI"
FT   gene            complement(67507..68646)
FT                   /locus_tag="Achl_0066"
FT   CDS_pept        complement(67507..68646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0066"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; homoserine dehydrogenase NAD-binding; KEGG:
FT                   aau:AAur_1535 oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38069"
FT                   /db_xref="GOA:B8H895"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H895"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38069.1"
FT                   /translation="MGQPLIPGTAITVGIIGCGAISAQYLASFRRLPNVRLAAVADLDP
FT                   SRAQAVADSCDGVRALAVDDLLDDPAVGLVLNLTIPAAHADIALRAIAAGKSVYGEKPL
FT                   AASTKEAREVLDAAKAAGVAVGCAPDTVLGTGIQTARKAIDDGLIGTPIAATAVMATPG
FT                   HERWHPNPDFYYQPGGGPLLDMGPYYVSALVTLLGPVVSVTGAASRTRKQRTIGSGPRT
FT                   GETVPVQVDSHVAGTLTHAGGAISTLVMSFDAVRTKSPNLEIHGERGSLVVPDPNRFDG
FT                   DVELFALGAADWEVLPVSAGYAGAGRGIGIADLASTPPGTEPRAGGELAFHVLDVMESL
FT                   LEAARTGTATDVRSTVARPAPVPLTPARPEDGTDGLSRA"
FT   gene            complement(68631..69329)
FT                   /locus_tag="Achl_0067"
FT   CDS_pept        complement(68631..69329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0067"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0085 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38070"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8H896"
FT                   /inference="similar to AA sequence:KEGG:Arth_0085"
FT                   /protein_id="ACL38070.1"
FT                   /translation="MTGTKNALVVRGGWDGHQPVEATDLFVPFLKDHGYEVRIEESPKI
FT                   YADADYLAGVDLIVQCMTMSTIEKDEFAGLRAAVENGTGLAGWHGGIADSYRNTSDYLH
FT                   LIGGQFACHPGKHPDERHGEQADNYVPYTVNMLPAAADHPITRGIPDFELVTEQYWVLA
FT                   DDYIDVLATTTQKVRPWDPWHREVTSPAIWTRQWGKGKIFVSTPGHQVEILQDSNVRTI
FT                   IERGLLWASR"
FT   gene            complement(69326..70555)
FT                   /locus_tag="Achl_0068"
FT   CDS_pept        complement(69326..70555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0068"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: art:Arth_0087 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38071"
FT                   /db_xref="GOA:B8H897"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H897"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38071.1"
FT                   /translation="MAHSTPLRIGMAGYAFMGAAHSHAWRTAPRFFDLPLIPELTALAG
FT                   RNADATAAAAAKLGWSSTESDWRRLIEQDDIDLIDICTPGDTHAEIAIAALEAGKHVLC
FT                   EKPLANTVEEAERMAAAARTAATRGVYAMCGYSYRRTPALALAKRMVDGGRLGTIRHVR
FT                   AQYLQDWLSDENAPMTWRLDKSRSGSGALGDIGAHIIDAAQWITGSKISGVSALMETFV
FT                   RERPLAGDLVGLGGHGNLDAGSPRGAVTVDDAAIFTARFDDGPVGVFEATRYALGRRNA
FT                   MRLEINGSEGSLAFDFEDNNVLSFYDAAEGPDAGFRRIIVTEPEHPYAGNWWPTGHGLG
FT                   YEHGFTHQVVDLVTALAAGRQPEPSFGDALQVQHVLAAVEASGGNASRWQEIRQPEPAS
FT                   SSYAHEGISL"
FT   sig_peptide     complement(70481..70555)
FT                   /locus_tag="Achl_0068"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.826) with cleavage site probability 0.413 at
FT                   residue 25"
FT   gene            70684..71712
FT                   /locus_tag="Achl_0069"
FT   CDS_pept        70684..71712
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0069"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: aau:AAur_1542
FT                   LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38072"
FT                   /db_xref="GOA:B8H898"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8H898"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACL38072.1"
FT                   /translation="MENRSRLTLSAVARQAGVSVPTVSKVINGRPDVAADTRKRVLAIL
FT                   AESGYTSPVQHRRSLAAVPVVEVVVDSLNSGYTAEVLAGIMDSATSGGVEVVLSSTGSH
FT                   GGAPNPEQRAQRIVDQGRCGMIVVTSAFGGAPLDAFHRRGVPVVVIDPLNPPSEQVVSV
FT                   GCTDWAGAKEATAHLLALGHRRIAFLGGPEAVECSQARLHGYLAALRSQGIAAEDRYVL
FT                   AGEFRSDDGARRLRDLLLLDPRPTAVVAASDTIALGVIAEALRQQVQIPQELSVVGFDG
FT                   IRQAEESVPALTTVAQPLRDIGRAALRIILRQVRGEVPDSRRVELATKLVVRESTAAPR
FT                   GE"
FT   gene            complement(71800..72201)
FT                   /locus_tag="Achl_0070"
FT   CDS_pept        complement(71800..72201)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0070"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38073"
FT                   /db_xref="UniProtKB/TrEMBL:B8H899"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38073.1"
FT                   /translation="MAGTDAVGDTYRVSITGQQYGTESPDILTSCRNPGATCSLSRAVT
FT                   MSATVSGGFGLSAGAVSAQAGLSYSVSVSDTVSCTSPVLGYNQLYIARPSGTFVFYNVD
FT                   RYNLFGFHTGTERGTAFFPTGVSCRVIYG"
FT   gene            72618..73055
FT                   /locus_tag="Achl_0071"
FT   CDS_pept        72618..73055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0071"
FT                   /product="putative lipoprotein"
FT                   /note="KEGG: aau:AAur_0272 putative lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38074"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A0"
FT                   /inference="similar to AA sequence:KEGG:AAur_0272"
FT                   /protein_id="ACL38074.1"
FT                   /translation="MPVRGTLVTSAVAALAMLALVSCTPEPAQPGMAILDRAASAEDEV
FT                   PAFVDLKGKDPSTVRLAADHGGFRFYLARPDQGAGFCLIQVAEAGKDRWGSACTTDGKP
FT                   VLTTNLLGYGSEAAVVADGGDTGDLVGQGYALIQDNILVRR"
FT   sig_peptide     72618..72686
FT                   /locus_tag="Achl_0071"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.977) with cleavage site probability 0.922 at
FT                   residue 23"
FT   gene            complement(73094..74593)
FT                   /locus_tag="Achl_0072"
FT   CDS_pept        complement(73094..74593)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0072"
FT                   /product="sulphate transporter"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: yen:YE0973 putative membrane transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38075"
FT                   /db_xref="GOA:B8H8A1"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR011547"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A1"
FT                   /inference="protein motif:PFAM:PF00916"
FT                   /protein_id="ACL38075.1"
FT                   /translation="MAVTNHPRPFRQPITVLTALRSPRQLSREVLAGMVTTLALVPEVI
FT                   SFSIVAGVDPMVSLVASIVLALAMSILGGRPGVVTAAAGSVALVIAPLVHEHGVQYVLP
FT                   TVLLAGVIQVVFGLAGLARLMRFIPRSVMIGFVNALGVLIFMAQVPHVLNVPGLAYALF
FT                   ALTFAIIFILPRFTKAVPSPLVAIVVVTAIAIIAGLAVPNVSDEGPLTGKLPGFTPFLF
FT                   PLNVETFQLILPTALSVAFVGLMETLLTAKLVDDITDTPSHKGRESWALGVSNILAGFY
FT                   GGIAGCAMIGQTVLNVKTGQARTRISTTVAGVFLLALVTGLSSVMGQIPMVALAAVMMV
FT                   VAVTTVDWHSVKPSTLKRMPLPETLVMGVTVAVVVFTGNLAYGVLVGVVLAMVLFARRV
FT                   AHVISVDRKLADDGESVRYDVVGPLFFGSSNDLVEHFAYAEDPASVTINLSRAQIWDAS
FT                   TVAALDSIETKYGDHGATVTIEGLDERSTGFHRRLSGHLGS"
FT   gene            74774..75175
FT                   /locus_tag="Achl_0073"
FT   CDS_pept        74774..75175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0073"
FT                   /product="transcriptional regulator, MerR family"
FT                   /note="PFAM: regulatory protein MerR; KEGG: cmi:CMM_2956
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38076"
FT                   /db_xref="GOA:B8H8A2"
FT                   /db_xref="InterPro:IPR000551"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A2"
FT                   /inference="protein motif:PFAM:PF00376"
FT                   /protein_id="ACL38076.1"
FT                   /translation="MVKEMTAEEVVATMHIGELADRAQMSLRTIRHYDEVGLLKPSGRT
FT                   EGGFRLYTERDFTRLLVIRRMKPLGFTLEAMAGLLRVIDALEASEPGQDDTATRSELNS
FT                   FIEEAARRRAKLEEQLGMADEFLALLRAQ"
FT   gene            75318..77009
FT                   /locus_tag="Achl_0074"
FT   CDS_pept        75318..77009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0074"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: aau:AAur_0326 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38077"
FT                   /db_xref="GOA:B8H8A3"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A3"
FT                   /inference="similar to AA sequence:KEGG:AAur_0326"
FT                   /protein_id="ACL38077.1"
FT                   /translation="MTAGGSHLRTSESRPDTPATASAPAKGRAYLATIEGFIGSLMMFV
FT                   GSIGTGWIANGSPMIRQPVVIALRTEGWGVTVSTFLLTLGAMLLMRSWLRLGQRLADWG
FT                   SKSLRSVVIAVSAWSLPLIFCVPVFSRDVYAYTGQGRLVQEGQNPYEVGISTLNNWFAL
FT                   GADPAWAENRTPYGPYFLWLARGVVGLTGAQPDASVLLFRLLAGVGVLLCVIYVPKLAE
FT                   LHGINGARALWITVANPLFLISFIASAHNDALMVGLAVAGVYFAATRRYVAGILLVTAS
FT                   IGIKPITVLLLPFIGVMWAGPSASWLRKFLMWGATAGISLAVLLLSGIPYNLGMGWTWA
FT                   ILDTTPGYTGYSPSGFLGQQVEFLANVLGLPGGTFATWLRTGMKWTAIGLVLLLMFRGD
FT                   YSRAVRRMALAFTAVVMLSPIIQPWYILWFLPFLAVTGIRDDWQIRSLYVGVTFFVVFG
FT                   AQDQLSVWGFVELPIPPSSLAFVTALAFTFYLLFLDVHTRKLLIEGRPLDLARTGWQWV
FT                   AERRAARRAHGDADAEASAAVGTADGPGAPDQASADQASADQAEGR"
FT   gene            complement(77006..78229)
FT                   /locus_tag="Achl_0075"
FT   CDS_pept        complement(77006..78229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0075"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: aau:AAur_0327 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38078"
FT                   /db_xref="GOA:B8H8A4"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A4"
FT                   /inference="similar to AA sequence:KEGG:AAur_0327"
FT                   /protein_id="ACL38078.1"
FT                   /translation="MVDWFARPSSVWWGFAVVHLYFLGWMASFFLNGDTFSDTEQYRQW
FT                   ATDGYNPQDLDGKISPWVYPVLAQLPIFLANIAGPSLYLLVWFLIITALNAVGILYLTR
FT                   GPRRVSGIAPAWWWLFFTIFMGYLSFARVEGITAPIVLIALLYAAERPVVAGVLLSIAT
FT                   WIKVWPAAVLAPIVIASRKRIQVVLAGAGVTAVVALGTWLSGGLPHIMDFLLNQGERGM
FT                   QLEATFSTPWVWLSVFNIAGSKMADNTAINSTEVYGPGASTAAFLMQPLLILAAVVAAV
FT                   LLVRALNRGAEREELFLEGSLMMVTAFIVFNKVGSPQFIIWLAPVIIAGLTHDWDRWKV
FT                   PAALLMGIAMTTFVIYPLFYTPLIHAHPVMAAILTTRNVLLVVLLWWSVKRTAELGRKN
FT                   SAPVPAGA"
FT   gene            complement(78291..79535)
FT                   /locus_tag="Achl_0076"
FT   CDS_pept        complement(78291..79535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0076"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: aau:AAur_0325 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38079"
FT                   /db_xref="GOA:B8H8A5"
FT                   /db_xref="InterPro:IPR018584"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A5"
FT                   /inference="similar to AA sequence:KEGG:AAur_0325"
FT                   /protein_id="ACL38079.1"
FT                   /translation="MLNTPRGLLGGFIVVHLVFLIFAASLSLRGEAFSDTFIYRDWAMA
FT                   GFNDANLSGGPSPWVYPILALIPMAIAGAAGPGPFFFLWVLMTTLLNGWALLKLTERGR
FT                   NTGAIPAGWWWLAFTFLMGWLGFARVDGLTAPLVLVALAYGVGRPFIASVLLAIGTWVK
FT                   VWPAAIMLALFAVVKNRVVVVLAGLATSAAVVALAAALGSVPKLLNFLTQQGDRGMQLE
FT                   ATFTTPWLWLSVLNVDGSRMYMNTDINSMQVDGPGTATMSVLMQPLLILAALVVAGMTF
FT                   WALHNGKQHKVAGGVDRTELLLAGALALAAAFVVFNKVGSPQFMVWLGPAVAVGLAHSW
FT                   REWRVPAVMLIAIAVATYFIYPLFYDALSHNNPWMALVLTIRNVLLVVLFLWSVRRVYL
FT                   LGRKTPASAPALKES"
FT   gene            79927..80127
FT                   /locus_tag="Achl_0077"
FT   CDS_pept        79927..80127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0077"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3486 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38080"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A6"
FT                   /inference="similar to AA sequence:KEGG:Arth_3486"
FT                   /protein_id="ACL38080.1"
FT                   /translation="MNFPLTFTVSDRQSMDSQLDAAVSVARKHAMDSRHGILVTRHGVN
FT                   KFTVALSDTVPFGLTQELQAW"
FT   gene            complement(80463..81971)
FT                   /locus_tag="Achl_0078"
FT   CDS_pept        complement(80463..81971)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0078"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG:
FT                   aau:AAur_pTC20095 putative succinate-semialdehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38081"
FT                   /db_xref="GOA:B8H8A7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A7"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL38081.1"
FT                   /translation="MSLAPALSPAVSPEREASLLAAVPTGLLINGKWVDASDGGTFDVH
FT                   DPATGEVLATLASATSEDARTALDAADAAQASWARTAPRVRAEILRRAFDLVTERAEDF
FT                   ALLMTLEMGKPLAEARGEVTYGAEFLRWFSEETVRDYGRYLTAPEGKNKILVQHKPVGP
FT                   CLLITPWNFPLAMATRKVAPAVAAGCTMVLKPAKLTPLTAQYFAQTMLDAGLPAGVLNV
FT                   VASASASGISGPLLKDSRLRKVSFTGSTPVGKRLMADAAQNVLRTSMELGGNAPFIVFD
FT                   DADLDAAVEGAMAAKMRNMGEACTAANRFLVHESVAQEFTKKFAAAMAALTTGRGTHPE
FT                   TKVGPLIDSGARDDVHALVSAAVDAGAVAVTGGAPVDGPGYFYQPTVLANVPNDAAILG
FT                   EEIFGPVAPVTTFTTEEDAIRLANASEYGLASYLYSRDFNRLLRVAEQIEFGMVGFTAG
FT                   VISNAAAPFGGVKQSGLGREGGTEGIGEYTTTQYIGIADPYAGQ"
FT   gene            complement(82058..83734)
FT                   /locus_tag="Achl_0079"
FT   CDS_pept        complement(82058..83734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0079"
FT                   /product="choline/carnitine/betaine transporter"
FT                   /note="TIGRFAM: choline/carnitine/betaine transporter;
FT                   PFAM: BCCT transporter; KEGG: sen:SACE_4607 glycine betaine
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38082"
FT                   /db_xref="GOA:B8H8A8"
FT                   /db_xref="InterPro:IPR000060"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A8"
FT                   /inference="protein motif:TFAM:TIGR00842"
FT                   /protein_id="ACL38082.1"
FT                   /translation="MTHTHNAEDLMDTSSSGTGASPTILNSPNSGGPHIESALAKADRL
FT                   RGRPGSVFWTSVGLIGAFTAWASLSPSSLSTVMTAAMDWVAQSVGWSYLVVTLGCIGLL
FT                   IYIAISRFGRIRLGAQDSKPEFSTWAWLAMILSAVMGIGLISYGVAEPISHFASPPHGL
FT                   AQAGTMEAAVRAMQFSYFDWGPHAWAVFGVFGLAIAYSTHCRNNPGLVSPMLRPIFGKM
FT                   VDGWFGKMIDVFAIIATLFGTTTSLGLGASQIGEGVNRVFGIPSSLFGQILIIAVITVI
FT                   FTLSALSGVHRGVKYLSQGTMVLSVGLGLYVLFTGPTNFISNLFFRSLGEYLSSFFAVS
FT                   LLTPGTPEDVQWMQWWTYFMMAWWLSWGAFVGVFLAKISKGRTIREFVAGVMIVPSVVF
FT                   FVWFTIFGGTAIKFDMENGGQIGAAALDDVNSAFFATLAELPLSGLTSIVAIILVVMYF
FT                   VSGADANTFVLSMMSSRGTLEPTKPVLTTWGLLTGLCAVVLLIVGGLGALQQAAMLSAL
FT                   PFTVIVALLGVGLVKELRNDPRFDRTRSVTQSDLNKILTPQ"
FT   gene            complement(83851..84801)
FT                   /locus_tag="Achl_0080"
FT   CDS_pept        complement(83851..84801)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0080"
FT                   /product="flavin reductase domain protein FMN-binding"
FT                   /note="PFAM: flavin reductase domain protein FMN-binding;
FT                   protein of unknown function DUF1486; KEGG: sil:SPO2711
FT                   CaiB/BaiF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38083"
FT                   /db_xref="GOA:B8H8A9"
FT                   /db_xref="InterPro:IPR002563"
FT                   /db_xref="InterPro:IPR009959"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8A9"
FT                   /inference="protein motif:PFAM:PF01613"
FT                   /protein_id="ACL38083.1"
FT                   /translation="MQQTINDSVTAAWTAAWDEGDVTAFDAIVTPDYQRESTGTGKVSG
FT                   LKELQQEILDVRSAFPDLTTRIEKVIASGDDMAIFWKSTGTFTQPLRGVPPTGRVVETR
FT                   GSNALTLRDGRIAHEQVTWDAVELLAHVGIPSLSSAFEDETPEVVVDNLSGNLPLDIMK
FT                   GFNRQFITGVTVVTTVDEEGTPRGLAANSYASISLDPPLVLVCVQKTSSTYPALFQSSH
FT                   FGINILSNNQLGTVQTFASKTPDKFADLEWHTGPNGVPLIDGSAASLEAEIKERFQAKT
FT                   HTIFVGRVRHAEVADVDPMIYKAGHFFDGAQLEEL"
FT   gene            84919..85614
FT                   /locus_tag="Achl_0081"
FT   CDS_pept        84919..85614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0081"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: glo:Glov_0874 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38084"
FT                   /db_xref="GOA:B8H8B0"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B0"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL38084.1"
FT                   /translation="MQEVIQLRKAAQTSVSQVSLLDKLRKLVLSGEYPPGAPLPELFLA
FT                   EEFDVSRTPVREALKQLENEGLVEIRPKVGTFVRIPTRREIVELFQLKESLEGLAASLL
FT                   ARRGPVPEMDILKRNIEESERAERNSDSAKYAELVHEFHWTIVRGSDNSKLVEHYGRLM
FT                   NQLAYHRIVLKTVERPARMRASIREHQSVIDALLEKDPVGAELAMRGHVNASSLAAARG
FT                   TDAGAPTDA"
FT   gene            85670..86335
FT                   /locus_tag="Achl_0082"
FT   CDS_pept        85670..86335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0082"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   bam:Bamb_4326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38085"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B1"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ACL38085.1"
FT                   /translation="MPETALSPVAEGTSPATTVEDLARDLGVRKVTVLTEEILRDGSGA
FT                   LATSVTRAAAAAIVRNPWAGSAVSTDLAPETERLAPVLAKILTDRLTEALGGAGEIEAF
FT                   GKSAVVGLKGEVEHAAALIHTPFFGNLVREFLEGTSILSFSDDRAEPGTTIAVPMWHKE
FT                   AASTRSHYQTLTLSLSDAPHPNEIVVVAAASTGSRPHPRIGDRTTDRPVTAEILEGIL"
FT   gene            86335..86886
FT                   /locus_tag="Achl_0083"
FT   CDS_pept        86335..86886
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0083"
FT                   /product="protein of unknown function DUF1185"
FT                   /note="PFAM: protein of unknown function DUF1185; KEGG:
FT                   pen:PSEEN2034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38086"
FT                   /db_xref="InterPro:IPR009569"
FT                   /db_xref="InterPro:IPR035936"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B2"
FT                   /inference="protein motif:PFAM:PF06684"
FT                   /protein_id="ACL38086.1"
FT                   /translation="MNIRKIVTLSEEILTEGGRPVTPGARVAIAVAVVENPWAGQGFVE
FT                   DLTAGIDATASDLGALLTPKVIEALGAPVEAYGKAAIVGIEGEVEHGSALIHTLKFGDH
FT                   YRKAASATTLLPAVEKRAPAGTVFDIPMKHITDATIRSHHQSVEVRVADAPHPGEILIA
FT                   LAASAQGRPQERLAPLSTEQ"
FT   gene            86883..87623
FT                   /locus_tag="Achl_0084"
FT   CDS_pept        86883..87623
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0084"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG:
FT                   pfo:Pfl01_3232 3-oxoadipate enol-lactonase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38087"
FT                   /db_xref="GOA:B8H8B3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B3"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACL38087.1"
FT                   /translation="MSHVPGTPVALLHGVGLDAGMWEPVRDALKRNSVAIDLPGHGRRP
FT                   ALTAPTSLAELAADVLERLPEKSHLVGFSLGALIAQYIARFHPDRVETLTCVNSVCRRT
FT                   EDESTAVLTRLAAAESDFPATVEASIDRWYTGTSVPQSVVETTRRTLAGNDVGSFVHAY
FT                   RVFATGDAVIGPELGNIHVPTLAVTGELDPGSTPDMTLRLAEAIPGARSLVVPGARHML
FT                   PVQDADVLAGAINDFIQESEGERA"
FT   gene            87620..89101
FT                   /locus_tag="Achl_0085"
FT   CDS_pept        87620..89101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0085"
FT                   /product="Aldehyde dehydrogenase (NAD(+))"
FT                   /EC_number="1.2.1.3"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: psp:PSPPH_2565
FT                   aldehyde dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38088"
FT                   /db_xref="GOA:B8H8B4"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B4"
FT                   /inference="protein motif:PRIAM:1.2.1.3"
FT                   /protein_id="ACL38088.1"
FT                   /translation="MTLRLDHFIGGTWSAPAGGEYFPSTNPATLETLYEAARGTEEDVR
FT                   RAVAAAKEAFGSPLWRDLTATKRGHLLRRLGDLIGEHADELAELETLDNGKLLREMRGQ
FT                   LASLPEYLYYYAGLADKVQGSQIPTNSITMLNYTQREPLGVVGAITPWNSPLTLTTSKL
FT                   APALAAGNTVVIKPSEYTSRTILRVAELASEAGIPDGVVNVVTGFGQEAGAALVSHRDL
FT                   AKISFTGSTQTGARIAAETASRFIGSTLELGGKSPNIVFEDADVSNAAMGVIAGIFAAA
FT                   GQTCIAGSRVFAHRSVYDELVERVAERAASIIIGDPRLATTELGPLAFGAQLEKVSSYV
FT                   DIGVSEGATVRTGGKRPDIELPGYFFAPTVLTGVDNSMRVVREEIFGPVAAIMPFDSED
FT                   EVVGLANDTEYGLAAGIWTQNLARAHRMARRLEAGTVWVNTYRAMSPMSPRQGFKNSGV
FT                   GIEHGLESMHEYTRLKSVWINTDEGPVSDPFVLRS"
FT   gene            89113..89313
FT                   /locus_tag="Achl_0086"
FT   CDS_pept        89113..89313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0086"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   rha:RHA1_ro03879 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38089"
FT                   /db_xref="GOA:B8H8B5"
FT                   /db_xref="InterPro:IPR004370"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B5"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ACL38089.1"
FT                   /translation="MPLIEVSIARGRSPEQLRSLIDELHHAAEKAVGAVPENTTVIIRE
FT                   IEHEHWSRGNQTIAERNAAAQ"
FT   gene            89370..90437
FT                   /locus_tag="Achl_0087"
FT   CDS_pept        89370..90437
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0087"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   pfo:Pfl01_3263 luciferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38090"
FT                   /db_xref="GOA:B8H8B6"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B6"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACL38090.1"
FT                   /translation="MRFSLFVHMERWDESVSHQECFENLTELALIAEAGGFSTVWIGEH
FT                   HSMEYTISPSPMPQLAYLAAKTSKIRLGAGTIIAPFWNPLRVAGECALLDVISNGRAEV
FT                   GLARGAYQFEFDRLMGGMSAVDGGKHLRELVPAVRALWEGDYAHDGDVWQFPTSTSVPK
FT                   PVQKPTPPMWIAARDISSHEFAVANGCNVMVTPLMKGDEEVEDLARKFDSAVESNPGVP
FT                   RPDLMVLRHTHVHSEDEPEGWRRPAEGINKFYRTFDAWFGNKTAPTNGFLEPSPEEKFA
FT                   ERPEFTPESLHKTAMIGTPQEIIERLRHYEALGVTEFSVWSDNSLTHEEKKRSLELFIE
FT                   HVVPAFQEQPAAVAR"
FT   gene            90718..91917
FT                   /locus_tag="Achl_0088"
FT   CDS_pept        90718..91917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0088"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   aau:AAur_1949 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38091"
FT                   /db_xref="GOA:B8H8B7"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B7"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACL38091.1"
FT                   /translation="MQQLAHRLERLGTETAFSVAQAAASWKAQGNLVYPFHLGDINIPT
FT                   APHIVEAMNRAIADGYTGYCPGPGIPQLREALAEDLGSRRGITFSPDNVVVMTGGKPVI
FT                   TKFLQAVMNPGQDVLYPNPGFPIYESQIEYLGGNAVPYRYVPTESGFAIDLDQVRASIT
FT                   DKTVAIIYNDLQNPISAESTAAEREAIAQIAQEHDLWVLSDEAYFETRYEGVSQSIATL
FT                   PGMAERTVILYTFSKKFAMTGSRLGCAVAPLEIAKVLSTLNTNDESCTTHYVQWAGIEA
FT                   LRGPQEPVQQMLDILRERRDAACDLVNAIPGMHVAVPQSTFYLFPDVTEAMERMGFTAV
FT                   GDFATEALYKTGVSFCTREHFGRRLPGEERQYIRLAYSGIDVANIREGLGRLNQWIESA
FT                   "
FT   gene            91914..92873
FT                   /locus_tag="Achl_0089"
FT   CDS_pept        91914..92873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0089"
FT                   /product="Glyoxylate reductase"
FT                   /EC_number="1.1.1.26"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: aau:AAur_1948 D-isomer
FT                   specific 2-hydroxyacid dehydrogenases family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38092"
FT                   /db_xref="GOA:B8H8B8"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR015878"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B8"
FT                   /inference="protein motif:PRIAM:1.1.1.26"
FT                   /protein_id="ACL38092.1"
FT                   /translation="MSRVVVTGRIPEAAIEKLRAEHEVDVWEGPESISREELLRRVAGA
FT                   DGIVSLLTERVDAELLDAAGPQLKVVANVAVGYDNIDVPACTERGVIATNTPGVLTDAT
FT                   ADIALSLILMATRRLGEGERLIRSGEAWKWGMFFLLGSSLQGKTLGVVGMGGIGQATAR
FT                   RAKAFGMEIVYQSRSEIDPAIAGELGARRVELDELLAISDVVSLHCPYGPATHHLIGAE
FT                   QLAAMKDSAFLVNTARGPIVDEAALAAALRDGRIAGAGLDVYEKEPQVHPGLLGLDNVV
FT                   LLPHLGSATVETRTAMAMLAADNALAVLSGERPATPIR"
FT   gene            93073..94566
FT                   /locus_tag="Achl_0090"
FT   CDS_pept        93073..94566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0090"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; FAD dependent
FT                   oxidoreductase; KEGG: sme:SMa1939 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38093"
FT                   /db_xref="GOA:B8H8B9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8B9"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACL38093.1"
FT                   /translation="MKHQVVVVGSGPTGLMLAGELALAGVDVAVVERRPGQELAGARAG
FT                   GLHARTIEVLDQRGIAERFLAEGQVAQVAGFAGTRFDLTGFPTRYPYGLGLWQNHIERI
FT                   LAGWVEELPVAFHRGTEVTGLAQDGTGVEVSLADGRTLQADFVVGCDGGRSLVRKAAGI
FT                   EFPGWDPTTSALIAEVEMTGQPEFGVHKNPFGIHSFGRREYTIQDGRVVYADSGPVAVM
FT                   VTEEHVGAGEPGLADLSAALTAVCGTDYGAHSPTWISRFTDATRQAATYRKGRVLLAGD
FT                   AAHIHAPDGGQGLNIGVQDAVNLGWKLAQVLHGTSPESLLDTYHAERHPVAARVLRNTM
FT                   AQSALRRPDPRIAAAGEVMAELLGMEEPRRRFAGMQSALDVQYDLGEGHPLLGRRMPDL
FT                   DLETPAGPRRMFALLHTARPVLLNLGAAGAFDATPLPPAVQLVDATYGGEWELPVLGTV
FT                   APPSAVLVRPDGYVAWVGEGTASGLAEALGNWFGPSAAR"
FT   gene            complement(94696..95496)
FT                   /locus_tag="Achl_0091"
FT   CDS_pept        complement(94696..95496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0091"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: sgr:SGR_353 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38094"
FT                   /db_xref="GOA:B8H8C0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C0"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL38094.1"
FT                   /translation="MATTTPPTAGQAEEGPKSSNMRSLSRALEVFAELQRAERPQRLSD
FT                   LARNCGMSLPTTLRILRVLQDFGMVSQTDKSYRIGPAVLPAARSFLENDPLVVAARPIL
FT                   QQVASQTGLTASLYSRLGFERILVARVDGEAPLRYDLPLGKRLPLTLGAAGKILLASAS
FT                   DDELQQVVMAAVASGQEDADLTADVLRGRLPEPGTDYAYSADERATGVLSVAMAVPNRT
FT                   GRPTESISLTSPVEAASEATLKAGVPELRRAAGRLSELLEGSVY"
FT   gene            95617..96126
FT                   /locus_tag="Achl_0092"
FT   CDS_pept        95617..96126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0092"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38095"
FT                   /db_xref="GOA:B8H8C1"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C1"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_0123"
FT                   /protein_id="ACL38095.1"
FT                   /translation="MTTESVTTKPGNGNATRVAPSVLAGIGAFAAVGVYVLVSSISLGL
FT                   WTSLGPGPGLFPFAMGAVLAAMALLWLLQELRSPSETAAGVDRGLVIAVVASLVILAAV
FT                   MDLLGFQLSMFAFLLYHLKIRGRRTWVSSLIIAVAGSFGAFYAFNYGLNVALPVSTIPS
FT                   LNAIGH"
FT   gene            96129..97631
FT                   /locus_tag="Achl_0093"
FT   CDS_pept        96129..97631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0093"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: sth:STH2229 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38096"
FT                   /db_xref="GOA:B8H8C2"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C2"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ACL38096.1"
FT                   /translation="MDTLNELLNGFAAAMTWQNLLFAFLGCLLGTIIGVLPGIGPVAGV
FT                   ALLIPLTLNMDATGAIIMLCAIFYGTAYGGTITSVLLNTPGEAASAITTIDGYAMTKIG
FT                   KAGAALTIAAVGSFVGGTIATIGLVAAAKPLGELGLLVGPPEFFALMVVGISLLVALAG
FT                   KSMVKAVISGALGLLISMVGIDPVAGAPRFTFGMDRLLDGVSFVAVIVGVFGLSELLSY
FT                   RKGDQPAAVHAPNLRSLLPTGKEWLRSAPAMARGTGIGFGLGLIPGMTGSVSSLLSYGA
FT                   EKKFSRNRHELGKGAIEGVAGPETANNAHANAALIPLFTLGIPASPTIAVLMGAFLQQG
FT                   LTPGPTLFTENSEIAWAIIASLFIGNLILLLLNVPLVGLWTSILRVPSSILTALILLFM
FT                   VIGAYTINFSVFDVFVMIGFGLLGLALRHLDIPLAPMVLTLVLGPLMERSLRESLEISQ
FT                   GDFSIFTSRPISAVLIGLGLLIIFSPLLKLRKPKALNEDPET"
FT   gene            97683..98684
FT                   /locus_tag="Achl_0094"
FT   CDS_pept        97683..98684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0094"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   nth:Nther_1958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38097"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C3"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACL38097.1"
FT                   /translation="MKTRMRLAAALAAASLIGLTGCGANPGATGAAGDFPKKGKSIDII
FT                   VAFGSGGAVDTAARLIQPVLENELGTNVEVINKPGAGGQIGYTQLTSAKPDGYTIGATG
FT                   SPSVVVSPLDPSRGAKYTRESFQPLGRQVIDPTVIAVQPDSPYKTIKDLVDAAKANPKS
FT                   MTASTTGLQTGEHFALAQLQENTGAEFAPVHFSEGASQATTAFLGKHVDVLVANVSDVN
FT                   DLSKQGKARVLGVMSAERAPSLPDIPTFKESGYDLTAGTARGYSAPAGLPEDVATKLEA
FT                   AIQKAIEDPAVVKKMQDLGLQTSYLNGADYKTFWAGQEEDFKEVLPLVQKKD"
FT   sig_peptide     97683..97775
FT                   /locus_tag="Achl_0094"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.373 at
FT                   residue 31"
FT   gene            98715..99344
FT                   /locus_tag="Achl_0095"
FT   CDS_pept        98715..99344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0095"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   sco:SCO5940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38098"
FT                   /db_xref="GOA:B8H8C4"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C4"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ACL38098.1"
FT                   /translation="MTTPAIDATSADFARPDRDTIERLAKLPAANIGDAMDRLGVADSA
FT                   IQAVWPGAKLAGPAFTVWTRPGDNKGIHAALQQVRPGDVIVVAGGGDESRALLGELIGE
FT                   RAINLGVAGFVLDGAARDAEALGEIGMPVFARATSPAGPYKDGPFRLGTAVAFGGVPVL
FT                   PGDVIVGDSDGVVVIPREHAAAVAEAAEAVFADETNRRQAIVAARN"
FT   gene            99384..100163
FT                   /locus_tag="Achl_0096"
FT   CDS_pept        99384..100163
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0096"
FT                   /product="Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   Phosphogluconate dehydrogenase, NAD-binding, putative-like;
FT                   KEGG: rxy:Rxyl_0198 6-phosphogluconate dehydrogenase,
FT                   NAD-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38099"
FT                   /db_xref="GOA:B8H8C5"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C5"
FT                   /inference="protein motif:PFAM:PF09130"
FT                   /protein_id="ACL38099.1"
FT                   /translation="MTACTVIGLGEAGATYAAALTAAGHKVTGFDPVAPTTPAGVTRAA
FT                   TAAEACAGADIVLVMTGAAAARSVAGECLPVLDPGSVYADFTSSSPGAMQELGQLPSQA
FT                   AFADVAILGPVSALGEKTPLMVSGPGARAVADLLVPLGVQVEIADGEPGAAMAHKLLRS
FT                   VLMKGLASVVVEAVTAGRAAGLEDWIRGQIAGQLAGDGQAVIDRFLTGSAKHAVRRSKE
FT                   MQDTASYLSDLGVPAEMTTASATALARMAQATEPALR"
FT   gene            100243..101580
FT                   /locus_tag="Achl_0097"
FT   CDS_pept        100243..101580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0097"
FT                   /product="TRAP C4-dicarboxylate transport system permease
FT                   DctM subunit"
FT                   /note="PFAM: TRAP C4-dicarboxylate transport system
FT                   permease DctM subunit; KEGG: bpu:BPUM_3411 TRAP-T family
FT                   tripartite ATP-independent periplasmic membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38100"
FT                   /db_xref="GOA:B8H8C6"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C6"
FT                   /inference="protein motif:PFAM:PF06808"
FT                   /protein_id="ACL38100.1"
FT                   /translation="MIGIWALGAYLAVILLWTTVVKRSVGEAMILGFLAVLPFTGAAAA
FT                   AVGWDALYDAITDEIVYATMAFVFMGYLLDKAGVLDRLIDLLNSLIGGVKGGPAWVSTV
FT                   ASAGLGGVVHNQAAIAATVGSVTIPWMEKSKLDKPSAATLVAGNAGMGITFPFSASMFV
FT                   LVGSATVGPLLDINALVLPLLFGGLWCFLHRLVVTWLLVRKSGMTPLDAAHRLSIRSAF
FT                   GRGWATLLLFVVVAIPLVITTGALAKGLSDWTGGDVTKSVSVIVWIPVVLIITGLLLGR
FT                   KNLPGSGRGWWNLLQESAPRFGIVGVTVVFAFAGANALAATGLPKQMTTLLNGMNLPLW
FT                   LLAILIGLIIIAVAAPLSATATMAAVGTVGVASLVAAGVPATTAAVAVLVFSSCEAAVP
FT                   PGGAPLYVACGIADVDPLRTFARLLTHYALPLLGIGVLIILGILPI"
FT   gene            101591..101845
FT                   /locus_tag="Achl_0098"
FT   CDS_pept        101591..101845
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0098"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bcl:ABC3760 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38101"
FT                   /db_xref="GOA:B8H8C7"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38101.1"
FT                   /translation="MHSFRRAIEVLFVLTLAVLLAGGILFVLGQAVALVAGQGQWLTLL
FT                   NETIKTRICIAASICAVAGFLLSYKRRQPQEQFQRADAR"
FT   sig_peptide     101591..101692
FT                   /locus_tag="Achl_0098"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.363 at
FT                   residue 34"
FT   gene            101842..102825
FT                   /locus_tag="Achl_0099"
FT   CDS_pept        101842..102825
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0099"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rha:RHA1_ro06956 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38102"
FT                   /db_xref="GOA:B8H8C8"
FT                   /db_xref="InterPro:IPR007325"
FT                   /db_xref="InterPro:IPR037175"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C8"
FT                   /inference="similar to AA sequence:KEGG:RHA1_ro06956"
FT                   /protein_id="ACL38102.1"
FT                   /translation="MNSLDGMYPDFAGLLQREGSLAGTSWGLFPRPTRGTPSFITPESL
FT                   LHARECIRSGTVFGLDYPADAFDPGMSLKRGAPRHTIYSSHPAHRDDFLDGYYLQGSSQ
FT                   VDGLRHRRADDVGFYNGTADDRVVEGTPDLGIQEWADEPIVGRAVLVDLDGYRTARGAP
FT                   IDHAAGEPLRLDLINAALEAQSATLRPGDILLLHTGWCEWFLDLLTAEKQKVRDSRKAT
FT                   GIAQSQDFVAWAWDHRLALLAADNFALECLPAVPDSPYRDSAFNDHGMMHQQLLAKLGM
FT                   PLGELWRLGPLARHMRSTGQWDAFISIKPLNITGGTGSPANATAIL"
FT   gene            complement(102829..103821)
FT                   /locus_tag="Achl_0100"
FT   CDS_pept        complement(102829..103821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0100"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: sen:SACE_3696 EamA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38103"
FT                   /db_xref="GOA:B8H8C9"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8C9"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL38103.1"
FT                   /translation="MHFSGHRARPDTVGMDASLLHGEGKTRGATGTPGGPPSSLVRGLL
FT                   TMTGAGLSNQIGAGIGAHAFPVIGPAGVVAVRQLVAAAVLVPAARPPFHRFTWRQWWPV
FT                   LLLGAATALMNICLYVAIDRIGLGLAVTLEFLGPLAVALLSSRSRWDLLCGIAAGVGVY
FT                   VLVMPGPASDLAGIVIGLGGAAGWAAYILLNRVAGQRLPGLQAPAAASLVSLALYVPVA
FT                   IHLLASGRFTGQSLAYAAAAGILCSVVPYAADLISLRFVPAGFFGVYMSINPILAALSG
FT                   IVVLGQVLVLHEWLGIALIVSANATAIWLAGRRGRIPGRTGQLVSTRRN"
FT   gene            103849..104706
FT                   /locus_tag="Achl_0101"
FT   CDS_pept        103849..104706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0101"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: sen:SACE_3695 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38104"
FT                   /db_xref="GOA:B8H8D0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D0"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACL38104.1"
FT                   /translation="MNVELRYLRALVAVVDAETFTDAAIELGTSQAAVSRSIAALEHAL
FT                   GLRILQRTTRSVAPTPVGERIIAHARSVLAELALLEREARDHGSELRVSYAWSALGRRT
FT                   IALQRQWEEVHPEVSLVWVQSSAPSGGLADGSADVAVLRRSIADARFSSTPIGTEARYA
FT                   AVASGDPLSRRRFLRMADFADRTIAVDRRTGTTSEELWPEGSRPAGFRLVQGVDEWLTL
FT                   ISTGKALGMSSEATAAQNPRPGIAYRPVRDAPRIDVFLASWRDDPSPAVADFIRLARAA
FT                   YALG"
FT   gene            104808..106178
FT                   /locus_tag="Achl_0102"
FT   CDS_pept        104808..106178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0102"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: aau:AAur_0583 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38105"
FT                   /db_xref="GOA:B8H8D1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38105.1"
FT                   /translation="MSTTHSSAATTGAVRTSGAAGSGPRDPKKAAMSGWIGSALEYYDF
FT                   ALYSLAATLVFPTIFFPSENPTVGIIASLATYAVGYVSRPIGAVVLGAYGDRKGRKSVL
FT                   VFAMLLMGFATFAVGLLPTYGQVGLLAPALLVVLRLIQGFAVAGELGGASAMIVEHSPD
FT                   ARRGFFASFSLQGTQVGSILATAVLLPLSAALPADQFASWGWRIPFLLSAVVIFAGYFI
FT                   RRRVQEPPAYAATSGDTAQKQRFPLVELLRTRPGALVRCILMTFANVIGMATLIFGVSY
FT                   ATQKGYGNGFSSSEFLWVTLVANIAAVVTIPLFGALSDRIGRRTLMAGGGLLGGVMVGG
FT                   YLWAIEQGSLPLVFVSVVIVQGIFFQMWNATFATFFQEQFPMRIRVTGFAVSQNIGLMI
FT                   ASFFPSIFTAIAPPGTANVPLTIGLTTFVICLVATVATLMSSDTKGKSLEDLEAHKA"
FT   sig_peptide     104808..104870
FT                   /locus_tag="Achl_0102"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.858) with cleavage site probability 0.296 at
FT                   residue 21"
FT   gene            106437..107102
FT                   /locus_tag="Achl_0103"
FT   CDS_pept        106437..107102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0103"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: art:Arth_1988 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38106"
FT                   /db_xref="GOA:B8H8D2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D2"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL38106.1"
FT                   /translation="MPAIPARNTGAHVVYAELKRRILSLDLKPGERIYEPAMATALQVS
FT                   RTPLREAIRRLISENLLEQQPTGGVVVPVLDEAEISELYEVRAAVESLMARNACLKATP
FT                   ADLDELHGILARNAALVEFADDAMRQGMALHARIAVIAGNSWAGRFHDQVSSQMERYRH
FT                   YTNSTQRRRDQALAQHRALVEAIATGDPEQAAKMAFDHVMGARDAAVRALSGKNGAGS"
FT   gene            107099..108274
FT                   /locus_tag="Achl_0104"
FT   CDS_pept        107099..108274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0104"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aau:AAur_3570 putative transmembrane efflux protein (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38107"
FT                   /db_xref="GOA:B8H8D3"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38107.1"
FT                   /translation="MIGELGRRSATALLLHSALIQAVTFLVRPAATYRALELDVPGFAL
FT                   GLLAASYAVFPLLLAVPTGGLVDRLGERRLMAIGSGVVLACSAFLLFWGSSITALVIGT
FT                   AFLGAGQLACVVGQQAVVANNAAASRMDSAFGYLTFAASLGQALGPLAISLVGGNSIQP
FT                   DTNMIFLLAVVMSAVLFLDTFLVSAEVSGGTRKAGEVDGGKGSAIALLKTPGVARALAT
FT                   SATVLAVVDLTMVYLPALGTDRGLTAATVGAMLTVRAVFSMVSRLLLGRVSRRIGRMRL
FT                   LVTSLALSTAALAAAAIPMPAWLLFVVMAVLGLGLGIGQPLTMSWLSSQAPAGQRGRAL
FT                   ALRLAGNRVGQVVLPSAIGVVAAGLGAAGVFLASAVVVGGSMVLLRGVKLD"
FT   gene            complement(108513..109496)
FT                   /locus_tag="Achl_0105"
FT   CDS_pept        complement(108513..109496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0105"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_1199 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38108"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D4"
FT                   /inference="similar to AA sequence:KEGG:AAur_1199"
FT                   /protein_id="ACL38108.1"
FT                   /translation="MTSTRTLATSLMSLTTAALFALCSAGQATAAPAQPDNKDVAGVSS
FT                   AAVTDTSGADYWTPERMKSAIPADVLAKKAVDRQKASPAVLPEQAKGPETKIQGSAPQI
FT                   QAKANASETPVSHIGKVFFTLGGTNYVCSANSVVSTNRNTVSTAGHCLNEGPGAFATKF
FT                   TFVPAYLNGSAPYGKWTAKALYAPTQWSSSGSMEYDTGFAVMSQLNGRNLADVVGASGV
FT                   SFNAARGLAYKAFGYPAASPFNGESLKSCSGTATNDPYNPQFNSQGIPCNMTGGSSGGP
FT                   WFIGTSSSGYQNSVNSYGYGTNSTKMYGPYWGSVIQQAYNTASSAS"
FT   sig_peptide     complement(109404..109496)
FT                   /locus_tag="Achl_0105"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            complement(109637..110209)
FT                   /locus_tag="Achl_0106"
FT   CDS_pept        complement(109637..110209)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_3460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38109"
FT                   /db_xref="GOA:B8H8D5"
FT                   /db_xref="InterPro:IPR005302"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D5"
FT                   /inference="similar to AA sequence:KEGG:AAur_3460"
FT                   /protein_id="ACL38109.1"
FT                   /translation="MAEKFRYDVEILHLLVSPAHAYFGRARDGAADVPTADAEVAEVVA
FT                   GKGIVGDRFFGKAAHMDAAVTLFAVESLEAIAAGLGAGPFNPLLTRRNVILRGAQLPPL
FT                   LGQDFTLESGGSSVSFFGGRHAQPCAWMNEMLAPGAHPAMRGRGGIRCRAVSGGQLHAG
FT                   PAVLVSPVPLDPARAGEASVLRASRLP"
FT   gene            110270..111241
FT                   /locus_tag="Achl_0107"
FT   CDS_pept        110270..111241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0107"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cdf:CD2228 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38110"
FT                   /db_xref="GOA:B8H8D6"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR029059"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38110.1"
FT                   /translation="MDSSFPAATAAPARRRTAIYWASAVCAAALIAVPAWMLVANPAVL
FT                   GGHPLLPGLLIAAAVVGLFWAVLLWRRRDSPRPRSLVRAIGAWAGRIAVLALVAALAWL
FT                   NPFAYQPGAAAEAGPTSDLIVTETNTTITMTPDGGRAPTKGLVFYPGARVDARAYQDIL
FT                   APAVGAGVRVVILKEPLGLSLLEANQARSAMADNPDITTWAVGGHSLGGVAASSFAQSN
FT                   ADVKGLVLYASYPLDSLRDRSGLKVLSVSGTKDGLSTPAKIDASLELLPADTEFTAVQG
FT                   GVHAFFGDYGAQPGDGDPGISREAAQEQIAAATVTFLGQLQG"
FT   gene            complement(111294..113684)
FT                   /locus_tag="Achl_0108"
FT   CDS_pept        complement(111294..113684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0108"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: art:Arth_2199 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38111"
FT                   /db_xref="GOA:B8H8D7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL38111.1"
FT                   /translation="MSTDTGTDNRAAAAHVADSHDLISVQGARENNLKDVSLELPKRRL
FT                   TVFTGVSGSGKSSLVFATIAAESQRMINETYSAFVQGFMPSLARPDVDRLEGLTTAIIV
FT                   DQERMGANPRSTVGTATDANAMLRILFSRLGKPYVGPPTAFSFNVPTRKASGVMSTEKG
FT                   GRVEKSIVQQATYLGGMCPRCEGMGNVSDIDRTALYDDSKTLAEGALTVPGYSMDGWYG
FT                   RLFEGMGLPMDKPIASFTKKQLDTMLFAEPTKIKVEGVNLTFEGIIPKIQKSMLSKDVE
FT                   AMQPHVRRFVERAVTFALCPECKGTRLTPEALGSKINGKSIADLCTMQISDLAQWIREL
FT                   DEPSVRPLLAGLRDLLDSFTEIGLGYLSLDRPAGTLSGGEAQRTKMIRHLGSSLTDVTY
FT                   VFDEPTIGLHPHDIERMNNLLLQLRDKGNTVLVVEHKPETIAIADHVVDLGPMAGTGGG
FT                   EIVYEGDVDGLRSSDTVTGRHLDDRARIKDAVRAATGALEVRGAATNNLKNVDIDVPLG
FT                   VLCVVTGVAGSGKSSLIHGSLAKREGVLVIDQGAIKGSRRSNPATYTGLLEPVRKAFAK
FT                   ANGVKPALFSANSEGACPTCNGAGVIFTELGVMATVESTCEDCEGRRFQAAVLEYTLGG
FT                   SSIADVFDMSVDAALQYFADGEAKTPAAHKILERLADVGLGYITLGQPLTTLSGGERQR
FT                   LKLATQMAEKGDVYILDEPTTGLHLADVEQLLGLLDRLVKSGKSVIVIEHHQAVMAHAD
FT                   WIIDIGPGAGHDGGTVVFEGTPADLVAARSTLTGQHLAAYVGA"
FT   gene            complement(113760..114179)
FT                   /locus_tag="Achl_0109"
FT   CDS_pept        complement(113760..114179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0109"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mva:Mvan_3007
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38112"
FT                   /db_xref="GOA:B8H8D8"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL38112.1"
FT                   /translation="MTGMDINISSTFLPATDPDASLAFYRDALGFEIRNDVGRGTMRWI
FT                   TVGPAGQKDVSIVLHPPAVDPGITEDERRTIAEMMAKGTYATIVLSSPDVDAAFAKVEA
FT                   SGADVVQEPIDQPYGIRDCAFRDPAGNTVRINQQP"
FT   gene            complement(114176..114622)
FT                   /locus_tag="Achl_0110"
FT   CDS_pept        complement(114176..114622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0110"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: nfa:nfa43930 putative transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38113"
FT                   /db_xref="GOA:B8H8D9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8D9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL38113.1"
FT                   /translation="MTSTPADPYLRELIQLRRVKDRMDREYAQPLDVESLARDVPMSAG
FT                   HFSRRFKLAYGESPYSYLMTRRIERAMALLRKGDLSVTEVCFAVGCSSLGTFSTRFSDL
FT                   VGMPPSAYKQEAEHPTAGIPACVEKQVTRPVRNREAPAGEALLA"
FT   gene            114842..115234
FT                   /locus_tag="Achl_0111"
FT   CDS_pept        114842..115234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0111"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38114"
FT                   /db_xref="GOA:B8H8E0"
FT                   /db_xref="InterPro:IPR019629"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E0"
FT                   /inference="similar to AA sequence:KEGG:Arth_3620"
FT                   /protein_id="ACL38114.1"
FT                   /translation="MELLWEIAGWAGAVAILSAYLSVSMGWLKAGKGFQTANLFGSVAF
FT                   IINGTLHGAWPSVVTNVAWFLISAVALVRMREVDAPVQPTEAHVQYPGVPDSTGQMAVV
FT                   EAVEALTGSLPVVGSVPTAADTRLAA"
FT   gene            115382..116458
FT                   /locus_tag="Achl_0112"
FT   CDS_pept        115382..116458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0112"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; CoA-binding
FT                   domain protein; Oxidoreductase domain; KEGG: aau:AAur_1984
FT                   oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38115"
FT                   /db_xref="GOA:B8H8E1"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E1"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38115.1"
FT                   /translation="MNAFCRSFGGHKVSDLRIGVVGYGTGGRNFHTPFIEAAQGITLAG
FT                   VVTRSTERTAEVAADWPGVPVFGSLDDMVAAGVDAVTITTPPGTHPELAFQAIAAGLHV
FT                   MVDKPFAPSAAEGRELAAAADRAGVVLSAYHNRRWDADARTLAGVLSEGRLGKLWRVYS
FT                   RMDQHNPGSLTAGAADGLLLDLGSHLVDQLIWLLGPVRSVNAHVDWVETDSGCTDAGFT
FT                   LDLVHTSGARSYAEASKANHAEARELRAYGSKGSYLSLASDVQAAAVLSGLRPAAKPED
FT                   WGYEDRGHWPILSTASGRQRIPSLQGRWQDLYGAFAKAIRDGGPAPVPAGEAIRTLQVL
FT                   DAARESALAGSTVEVGVP"
FT   gene            116608..117603
FT                   /locus_tag="Achl_0113"
FT   CDS_pept        116608..117603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0113"
FT                   /product="putative ABC-type sugar transport system"
FT                   /note="KEGG: aau:AAur_1988 putative ABC-type sugar
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38116"
FT                   /db_xref="GOA:B8H8E2"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E2"
FT                   /inference="similar to AA sequence:KEGG:AAur_1988"
FT                   /protein_id="ACL38116.1"
FT                   /translation="MKKFSWQRAAVAAVAIPMLALTACSSSGGRAPDTAGNGSAGEVAA
FT                   TERMKIALITHAPSGDTFWDIVRKGAEEAAAKDNVELQYLNDPEAGRQSQLIEQAINQK
FT                   VDGIAVTLATPEALKDAIKKATDAGIPVVSLNAGENVSQKLGAFTHFGSNDELAGEAVG
FT                   QKLADQGFSHPICVIQVQGHVGLESRCAGVKAKVPGTEVLYVTGSDMTAVASTSTAKLQ
FT                   ASKDADVIIGLGAPITLTLLKSVAESGSKAKVASFDLNKELAGKIADGSLLFTVDQQPW
FT                   LQGYGSIDALWQFKRGGFLIGGGQPVLTGPTIVDKANVASVQKFADAGIR"
FT   sig_peptide     116608..116697
FT                   /locus_tag="Achl_0113"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.245 at
FT                   residue 30"
FT   gene            117614..118660
FT                   /locus_tag="Achl_0114"
FT   CDS_pept        117614..118660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0114"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   aau:AAur_1989 putative sugar ABC-type transport systems,
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38117"
FT                   /db_xref="GOA:B8H8E3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL38117.1"
FT                   /translation="MTQTALAAPPVIDERVGRRNPFQKLLGRPEVGALVGAVVLFIFFS
FT                   SVSGTFLQPNAFATVLYGASTIGIMAVGVSLLMIGGEFDLSTGVAVISSALTASLFSWY
FT                   FSMNIWVGVLLALAVSLGIGFINGWILVKTKLPSFIVTLATFLMLTGLNLALTRAIGGG
FT                   VSSPSIADMDGFDSARAIFASSVTLAGVEIKVTVFFWIVLVAVASWVLLRTRVGNWIFA
FT                   VGGDANAARAVGVPVTRTKIGLFMAVGFCGWVLGMHNLFAFDAVQSGEGVGNEFLYIIA
FT                   AVIGGCLLTGGYGSAVGGAIGAFIFGMANKGIVYAQWNPDWFKFFLGLMLLLATIVNLI
FT                   VKRRADLR"
FT   gene            118670..119617
FT                   /locus_tag="Achl_0115"
FT   CDS_pept        118670..119617
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0115"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aau:AAur_1990 putative ABC sugar transport, ATP
FT                   binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38118"
FT                   /db_xref="GOA:B8H8E4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL38118.1"
FT                   /translation="MTAETNHSSAPAAGKRARISNETLLQGETDPLTDRAVHLLQLDGV
FT                   GKHYGNIIALRDVTMAVDNGRVTCVLGDNGAGKSTLIKIIAGLHQHDQGVFSIMGEERK
FT                   LNSPREALDAGIAAVYQDLAVVALMPIWRNFFLGSELTTGRGPFRRMDVEKMKEVTRKE
FT                   LADMGIDLRDVEQPIGQLSGGERQCVAIARAVHFGAKVLILDEPTAALGVKQSGVVLRY
FT                   ILQARDRGLGVIFITHNPHHAFPVGDRFLLLKRGRSIGYYDKKDITLEELTAQMAGGAE
FT                   LAELAHELESLGGHRDTLEEVKAETASVTGKAAG"
FT   gene            complement(119705..120745)
FT                   /locus_tag="Achl_0116"
FT   CDS_pept        complement(119705..120745)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0116"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: aau:AAur_1987
FT                   LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38119"
FT                   /db_xref="GOA:B8H8E5"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E5"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACL38119.1"
FT                   /translation="MEWDDCTVKASTDSASARPTIYDVAHRAGVSKSLVSLVLRGSPNV
FT                   SDPRREAVQAAIDELGYRPSRAASALAANRTQSIGLLIDDFHNPWFVEVLRGLRSVLDP
FT                   AGWNISVADLQLEALSGRNPLDGFLAMHVDGLIIAAEPHAAPPLRNLDVPFVVAGVREL
FT                   DSGPADVVASDEVQGAGLAVEHLVQLGHRRIAHLSGTGGSAKARLDGYLRSVRAAGLEP
FT                   LVVGESGDTTEEAGYTAARELFSGHDGVTAVFAANDTMALGALAALKEHGLRTPEDVSV
FT                   VGYDNTPLAESRYLDLTSIDSHNASIGSEAARALLGRIAEPSAPRRQLLLAPSLMARGS
FT                   TAAPPS"
FT   gene            120882..122078
FT                   /locus_tag="Achl_0117"
FT   CDS_pept        120882..122078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0117"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: aau:AAur_1986 oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38120"
FT                   /db_xref="GOA:B8H8E6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E6"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38120.1"
FT                   /translation="MSKSLGVAVIGAGMAGKAHAAAYRTASTLYSPDLPEIRLVSIGDV
FT                   NAEFGSAAAKRFGYDRHDSSWQAIAEADDIDVVSVVIANKLHREVVEGLLAAGKHVLCE
FT                   KPLSDTMEDARAMAEAARNASSLGRIGFTFRRTPGIAYIRDLIRSGTLGKVLHFSGRYW
FT                   TDYGCSPEAPMSWRYKGGAGSGALADVGSHLAYVAEFLCGDIQSVSGGQLSTVIPQRPL
FT                   PLGAVMGHDHSAVSDIFEPVENDDVAAFSAEFTTGVGSLAVSRVAAGHANTLTFEVFCE
FT                   NGAALFDQRRPAEIGLFLNEGASAQNGYRQVVLGPEHPYIAGGLAMDAPSVGFGQNDAF
FT                   GYQARAFLEEVAGLPAEKSLPRCATFEEGVRNMEILAAVTESAQLGGRSVAIPQPAFA"
FT   sig_peptide     120882..120944
FT                   /locus_tag="Achl_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            122092..123534
FT                   /locus_tag="Achl_0118"
FT   CDS_pept        122092..123534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0118"
FT                   /product="sugar transporter"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: art:Arth_0827 sugar transporter; TIGRFAM:
FT                   sugar transporter; PFAM: General substrate transporter;
FT                   major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38121"
FT                   /db_xref="GOA:B8H8E7"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E7"
FT                   /inference="protein motif:TFAM:TIGR00879"
FT                   /protein_id="ACL38121.1"
FT                   /translation="MTARTETPGAAAPRKFMRKIAFFSTFGGLLFGYDTGVINGALPFM
FT                   RDDLSLNPLQEGLVTSALLLGAAFGAMYTGRLSDRNGRRRTIRWLAVAFFITTAAAAAA
FT                   PTTELLVVARFLLGLCVGGASVTVPVYLAEMASSKDRGRIVTQNEVMIVSGQLIAYVSN
FT                   ALLGTFFGDDHIWRWMVALATLPAVVLWFGTLVLPESPRWLAAGGRGDEAFDVLRRVRP
FT                   ANELQREFDDVIRMAREDYDSSKGGWRELLAHSWTKRILIVGLGMAAIQQISGVNAIMY
FT                   YSTSILSEAGFGTTGALWATIANGAVSVAAATTGMALLGRVRRRPMLITGLAGTSSSLL
FT                   LIGIVSLVTEPGMLRAVLFLGLMATFLAFMQGSIGPVTWLMLSEMFPLTLRGAGMGVCV
FT                   FALWVINFLIGLFFPVLVSQIGISGTFFIFVALGAAGLVFLKVYMPETKGKSLEELEEE
FT                   FKTGNTGALVREGSAVEPTPIS"
FT   gene            123544..124560
FT                   /locus_tag="Achl_0119"
FT   CDS_pept        123544..124560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0119"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: aau:AAur_1985 putative suger phosphate
FT                   isomerases/epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38122"
FT                   /db_xref="GOA:B8H8E8"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E8"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL38122.1"
FT                   /translation="MKLGVYNAILHDRTLPEALKVIANLGLTGIEINTGGFLPPVHIPN
FT                   IDEILTSDAARDEYLATFEGTGVSIAGLNCNGNPLHPNREIGEKHAEDIRQSIRLAHRL
FT                   GQNRVVTMSGLPGGEPGATVPNWIVNAWNSAALDVLEYQWEIAGAFWKEIDQLARELDV
FT                   KVALELHPQNLVFNTADVRKLVELTGATNVGVELDASHLFWQQMDPVAVVRELGPLVFQ
FT                   AAAKDVRVNKENAALYGVLDNSFRKLSPEENRTNLGGDEWANEWPKDSAWDFVALGRGH
FT                   DTAYWTEFLRALHEVDPEMLVNIEHEDVSLGRIEGLQVAAKVLRDADAALRSSLVSQ"
FT   gene            124629..125672
FT                   /locus_tag="Achl_0120"
FT   CDS_pept        124629..125672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0120"
FT                   /product="Inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: cmi:CMM_0793 putative myo-inositol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38123"
FT                   /db_xref="GOA:B8H8E9"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8E9"
FT                   /inference="protein motif:PRIAM:1.1.1.18"
FT                   /protein_id="ACL38123.1"
FT                   /translation="MNTAGKVRIAVIGSGKMASLHARNIALTPGACLAAVAGGSGASGL
FT                   ASAYGTACLEVDDAFSHPGVDAVVIASPNRFHADHIVQAANGGKAVLVEKPVDLHLGRV
FT                   DECIAAVGAASDRVVVAFNRRFDPSFAAVRERILGGEIGAVEQLLIISRDPAPPPLEYV
FT                   PGSGGLFRDMMIHDLDMARFLVPGIVSVQATTQETDPQLAALGDASGAVVTLATCSGAL
FT                   ITILNSRSNASGYDQRLEAAGPRGTLSVKNATETLVLGSGRGGTNTGGAFTPWYGDRYA
FT                   TAYGREIEHLVAVARGEAIPIASLHDGRAALALAVAAARSAAMGQRVSVGPAAAQETTP
FT                   MQVPLPG"
FT   sig_peptide     124629..124775
FT                   /locus_tag="Achl_0120"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.947) with cleavage site probability 0.887 at
FT                   residue 49"
FT   gene            125802..128204
FT                   /locus_tag="Achl_0121"
FT   CDS_pept        125802..128204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0121"
FT                   /product="phosphoenolpyruvate synthase"
FT                   /EC_number="2.7.9.2"
FT                   /note="KEGG: aau:AAur_1894 phosphoenolpyruvate synthase;
FT                   TIGRFAM: phosphoenolpyruvate synthase; PFAM: PEP-utilizing
FT                   protein; pyruvate phosphate dikinase PEP/pyruvate-binding;
FT                   PEP-utilising protein mobile region"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38124"
FT                   /db_xref="GOA:B8H8F0"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR002192"
FT                   /db_xref="InterPro:IPR006319"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018274"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F0"
FT                   /inference="protein motif:TFAM:TIGR01418"
FT                   /protein_id="ACL38124.1"
FT                   /translation="MTDVLWFSDLGLSDLDQVGGKNASLGEMVRNLASAGVKVPDGFAT
FT                   TADAYRRFLAESGLDARIEGILEDLDSGDVAALTVVGKQIRDLIRETPYPKGFEEQIRS
FT                   AYERLTGSHGADVSWAVRSSATAEDLPDASFAGQQETFLNIRGVDNVLLAIKDVFASLY
FT                   NDRAIAYRVHHGFTHSEVALSAGIQRMVRSDVGASGVMFTMDTESGFNDAVFITSSYGL
FT                   GEAVVQGAVNPDEFYVHKPALAAGRPAVLKRGLGEKAVQMIYTDSDEVGRTVDFVPVPQ
FT                   DLRRRFSLTDDEVQELARHALAIEAHYGRPMDIEWGKDGVDGELYILQARPETVESRKA
FT                   SGTISRYTLTEHSAVLAEGRAIGQRIGAGQVRVLTSIDQMASFQAGDVLVANMTDPDWE
FT                   PIMKKAAAIVTDRGGRTCHAAIIARELGIPAVVGTGKASQVLKDGTPVTVSCAEGEAGF
FT                   VYEGLLDYSLQEASLDTMPEAPVKIMMNVGTPEQAFSFSKLPNHGVGLARLEFIINRQI
FT                   GIHPNALLAVAGEIERPASLSDFTVRQIREKTAAYDGPRDYYVRRLAEGISTIAAAFAP
FT                   EPVIIRLSDFKSNEYANLLGGPAFEPSEENPMIGYRGASRYLSDSFRQAFELECEALKF
FT                   VRNEMGLTNIKIMVPFVRTLAEARGVTELLAANGLTRGENGLEIVMMCELPANALLADE
FT                   FLEYFDGFSIGSNDLTQLTLGLDRDSALVAEGFDERNPAVTKLLEMAISACRAKGRYVG
FT                   ICGQGPSDHPDFAEWLLAQGISSISLNPDAVTETWLRLARTSNQPAV"
FT   gene            128204..129055
FT                   /locus_tag="Achl_0122"
FT   CDS_pept        128204..129055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0122"
FT                   /product="protein of unknown function DUF299"
FT                   /note="PFAM: protein of unknown function DUF299; KEGG:
FT                   pau:PA14_41680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38125"
FT                   /db_xref="GOA:B8H8F1"
FT                   /db_xref="InterPro:IPR005177"
FT                   /db_xref="InterPro:IPR026530"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F1"
FT                   /inference="protein motif:PFAM:PF03618"
FT                   /protein_id="ACL38125.1"
FT                   /translation="MPDTPWRDTVGTGSTSVPTVFFLSDSTGITAETLGNTLLTQFPAQ
FT                   HLERRSIPFITTVEQAQEVVAVIDRVAAAGPRPIVFSTTVSLDVRAVLARSRGHFFDLI
FT                   GTHLGQLEQALHASASGQPGQAHGLGDAVRYQSRMAAVEYAIEHDDGQSLRALERAELI
FT                   LIAPSRCGKTPTTMYLALQHGILAANFPLVEEDFESLSLPKPLLPFARKCFGLTSLPVR
FT                   LSQIRQERRPGSNYASLNQCTFELRNAEDMYRVNSIPFVNSASMSVEEISATVLQRMEL
FT                   HH"
FT   gene            129124..132444
FT                   /locus_tag="Achl_0123"
FT   CDS_pept        129124..132444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0123"
FT                   /product="Tetratricopeptide TPR_4"
FT                   /note="PFAM: Tetratricopeptide TPR_4; KEGG: ote:Oter_3370
FT                   TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38126"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR033396"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F2"
FT                   /inference="protein motif:PFAM:PF07721"
FT                   /protein_id="ACL38126.1"
FT                   /translation="MVTNDAKSTIVLPGAPQDQQKILAAGGVACWSEPVLIDTYAPGQP
FT                   DRYPMFLDRRVYQGSSGKVYPVPFIDSIAADKEPRLWQAIHLENEYVRLMLLPEIGGRI
FT                   HIGYDKTAGYDFFYRNNVIKPGLVGLAGPWISGGVEFNWPQHHRPATFLPVDTAVERSA
FT                   NGNVTVWHSDLDPLQRMRGTHGVRLTPGSSLIEVEARLHNRTDEPQTFLWWANVAARVH
FT                   EKYQSFFPTDVTHVADHARRAVTAFPRADRPYYGVDYPALAAEGAPAAGRPGADRLDFY
FT                   ANIPVPTSYMVTDTRDSFFGGYDHAAGAGFVHWADRSIAPGKKQWTWGTGPVGTAWDRH
FT                   LTDDDGPYVELMAGVFTDNQPDFSYLAPGETRTFSQYWYPIGQMGPAQQANLDAAVALS
FT                   LDDSGRTATVGVSATARRDARIELRLGEATLHTWSAVLSPAHPFTATLHLPAPAAGTDL
FT                   TLRVMDGDTELISWTPRGAAENPEPRTATEPAQPQNMDSMDELFVTGTHLAQNRHPTRS
FT                   PLPYFGEMLRRDPQDSRASTALGAAEYRIGHYARARDLLENALARLTRRNLNPPSGEAG
FT                   YRLGLVLERTGRFDEARERFGKAAWDRAWAHPAHLALARLALRSGDPAEALRHAGAALA
FT                   TEATSPEAKHLRFLALERLGRPTESTALLSDILAADPLDPVAQALAGTLNVADPKTGLA
FT                   VACWLARAGQWQRALDLAGIADAADAHPAFGSPGPLLHYLRASWLEEMLDPEAAAAERA
FT                   RARRADPTYAFPYGLDDFDALQRALDADPKDRVAHGLLGCWLLDAGRTADAMGHLEKAV
FT                   AHGSQDPVVWRNAALATVNTGGDPVAADRYFGRALELAPDDARLVFERSVLAEVRGLPA
FT                   GERIAAIEQHGPAVLDRDDLALRYANLLTEAGRAQDALALLASRSFQPFEGGEGLALAA
FT                   YDRAAVQHARVLMEERPTAAAALLRDGIEAPANLGEGRHPADSMAERFVALGDALELAG
FT                   DASAAEEAWNRALLPGGPLAVDRRPVGPADYWRGIAFVRLGLPDGAEDVWRQLEARASE
FT                   LDSAPAAPDYFATSLPELLLFNTHTASARAAAAAQLRQLAGQGRVLTTHAGTKEGASL"
FT   gene            132441..133790
FT                   /locus_tag="Achl_0124"
FT   CDS_pept        132441..133790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0124"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pdi:BDI_3295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38127"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024778"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38127.1"
FT                   /translation="MTEKLQTQTSGTDGPRYLGSGTVEGDTRSLTGAPPSHLPPRLAIT
FT                   LWDFSWYTRAEAGGPYADLDPACARAAELGYNAIRICAAPLLLFGGLGLDSLAEDLEIE
FT                   GLGTAPDGGIYGRGTRWYDAPGGYRLNLRERLLRLFDAAERHGLVILLASWEYQQSPVF
FT                   AASPQWFEAIDAVPLAGRYRVLGDAWDRLVRFLTEAGHRERIAMVELHNEVDFSILPAL
FT                   ADGGTEQVQRLRQLHPDLLVTASYGKPPHLAMHTVPEGLGAAQFHVYSYGVLDALQQRI
FT                   DIRSEGTEGFPNAALRALLRAEAPSLAGYGRLAAWKYRATVVTDQMFYGYDWIDPAAWD
FT                   TWLDKEYRPYREVMRREIESRVVAVAAWARWKDVPAVVGEGWIGYTPLRGGFEEGPAGL
FT                   ELAEHGIRTALAHGVWGMVLCSNAAPHHPMWADAEWQQRMNDLILSLPAG"
FT   gene            133861..134727
FT                   /locus_tag="Achl_0125"
FT   CDS_pept        133861..134727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0125"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: msm:MSMEG_3998 MmsAB operon regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38128"
FT                   /db_xref="GOA:B8H8F4"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F4"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL38128.1"
FT                   /translation="MARATGFQNQRLVVVPRPLVRDALSRPITRHLVVTDAGVFPAAAD
FT                   HGRHRPDGAAETIVILCVAGAGWVETGGMRTAVGAPAAVVLPGGTGEAHAYGAAEGDPW
FT                   TIWWCHVRGADVPDLLEGAGVRGAQVIPLVAVDRLTAMLDEIITALEKDQSPARLMATA
FT                   GMAWRLLTALAIDRRLPEKGTPLQQAMNYLEERVDGSVRLADLAALVGVSSSYLSKLFR
FT                   EATGGGVLAHHTALKMARARLLLDTTDLPIAEVGREIGLQDQFYFSRQFRRLHGVSPSA
FT                   YRAERKG"
FT   gene            134859..136358
FT                   /locus_tag="Achl_0126"
FT   CDS_pept        134859..136358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0126"
FT                   /product="cell envelope-related transcriptional attenuator"
FT                   /note="TIGRFAM: cell envelope-related function
FT                   transcriptional attenuator, LytR/CpsA family; PFAM: cell
FT                   envelope-related transcriptional attenuator; KEGG:
FT                   art:Arth_2228 cell envelope-related transcriptional
FT                   attenuator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38129"
FT                   /db_xref="GOA:B8H8F5"
FT                   /db_xref="InterPro:IPR004474"
FT                   /db_xref="InterPro:IPR027381"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F5"
FT                   /inference="protein motif:TFAM:TIGR00350"
FT                   /protein_id="ACL38129.1"
FT                   /translation="MDSTPRPENSDPAAARYPGQGKLAEGSARYSRRRVPRWLLIAGAS
FT                   VAVLLVAALVFGGYWAFRLQSNIKSSALGAGGQRSEGPVDDRTDRLQVLILGTDTRDGK
FT                   NAAYGTADQSSGYGQSDVMMLLDISANNQDVNVISFPRDLLVDVPSCEDQDTDRRYAAR
FT                   PGAMINSAMAEAGIGCAVDTVNEVTGFEIDHFMMADFNSVKELSNAVGGVDVCVDAAVF
FT                   DPDSGLRLPEGTSSVQGDQALAFLRTRYAFADGGDLGRIQAQQAFLGSLTRKLKDEGTL
FT                   RNPQKVLGIADTVTRNLTVDDGLASIPALLTIADRLKNIDPARVNFITVPTVPAADPNR
FT                   LQLSEPAAGNLFAALRQSAELAGPAPAPSDAPPAEAPSPGYDRSLQPVLIANGTTVPGR
FT                   SHDITPILTGAGFTNLSRIEAQPADETTVYYGPDFEDVAVDVAALFGLPASKVQADSSV
FT                   YGVQLYLGIDFTSGTKPSVTEPSARDVVAQTAEDQKCQAVR"
FT   gene            137123..137356
FT                   /locus_tag="Achl_0127"
FT   CDS_pept        137123..137356
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0127"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0400 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38130"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F6"
FT                   /inference="similar to AA sequence:KEGG:AAur_0400"
FT                   /protein_id="ACL38130.1"
FT                   /translation="MKARALLKSRKEICVPDWQELCLGESVSILKNAQVIAMGRVKEVS
FT                   KSGRVLWITTPSQVTEEFIMSDDVTVKISGRA"
FT   gene            137356..137559
FT                   /locus_tag="Achl_0128"
FT   CDS_pept        137356..137559
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0128"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0629 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38131"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38131.1"
FT                   /translation="MPRNFRWKWDDVIQHDLVTVSMDGKFVQEGVVDDRSVDGAFVWLF
FT                   DSLGQRKLLHEHDGYDLVKLHR"
FT   gene            complement(137582..138229)
FT                   /locus_tag="Achl_0129"
FT   CDS_pept        complement(137582..138229)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0129"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: eca:ECA2069
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38132"
FT                   /db_xref="GOA:B8H8F8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL38132.1"
FT                   /translation="MTASSHESALAAFRTQLEEWNWADQTAARKNILVAFLELAIANGF
FT                   NSVSMRTIANAVHIKPPSLYSHFPAGRDEIVAESLRWHFHRFGVALLEAVAPAQGADEF
FT                   WDAMVRLHFTRQVRLPESNLWDLLVAMDRVAGILPKEVRTEVDSWIELHENMYVACAKD
FT                   LGVAEAEERVRVVITLLEGATRWASPECDDEELSRLTDQAIVITRALLKVDF"
FT   gene            138362..138586
FT                   /locus_tag="Achl_0130"
FT   CDS_pept        138362..138586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0130"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38133"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8F9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38133.1"
FT                   /translation="MITETTSLGATRNSNLILGSGLSGMVAAYIDACALEDEASQHEDW
FT                   SAERALRLRLPRWRPRNIRPGGTGPALAS"
FT   gene            138687..140408
FT                   /locus_tag="Achl_0131"
FT   CDS_pept        138687..140408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0131"
FT                   /product="sigma 54 specific transcriptional regulator, Fis
FT                   family"
FT                   /note="PFAM: helix-turn-helix Fis-type; KEGG:
FT                   rha:RHA1_ro11054 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38134"
FT                   /db_xref="GOA:B8H8G0"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G0"
FT                   /inference="protein motif:PFAM:PF02954"
FT                   /protein_id="ACL38134.1"
FT                   /translation="MQPHADLSGIRPIIARSWYRSRAAGVDAFADRGFFDEGRVDEFTV
FT                   AAAGPHLQKLDEVAADLGGYVNITAPNGVLVKASFLRDDGFPAGYSLLEESCGSNGEGL
FT                   ALEEGRGVWLAPEEHFREDMRGNWCFASLVRDPFHNRVRAVIGLTLPANRVSTLEPSST
FT                   LLMLEGVASRIERDIEVRTSSKERALLSEYLRISRRRGNRAVIAVDGKNSLQNASATAT
FT                   LVDNDFSIIFGYAKAVMSSGRDMNCEVMLQGPGLSTLEISPVTLSAANVGAIVVVRPHA
FT                   PTKNRSTDTTSALLQLVSAPQETAERLLKHVDGTSTEFKRTLNLARKAVDQDRSVVMIG
FT                   ELGSGKLRLADAIAALRGGRMIVDARNGDLRNPNISDVLHRLATELPATLIVEHADELS
FT                   QNEASEIARNLRGHSTTKLIFTITRPTEATLLLAEAFDVLEVSVAPLRNRREDIPQLAN
FT                   AIAEELGERRLSRRLLTTLTHADWPRNIDQLRSVVSNAVERAEGAEVTVDDLPQGFHRV
FT                   LTKGRLSRLEDAELSELRTALQEAKGNRSLAAETLQIGRSTLYRRMDYFRSRGFDL"
FT   gene            140669..141616
FT                   /locus_tag="Achl_0132"
FT   CDS_pept        140669..141616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0132"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; alanine dehydrogenase/PNT domain
FT                   protein; KEGG: yps:YPTB1320 D-isomer specific 2-hydroxyacid
FT                   dehydrogenase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38135"
FT                   /db_xref="GOA:B8H8G1"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G1"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL38135.1"
FT                   /translation="MTRDAKGTILVAPHHFPDLDREHALAKEFGYTLNAAADTDAFREG
FT                   LPEADIVMITPYAKLTAADFPLMAKCRAVIRYGIGYDNIDVAAATAAGIPVSIVPGTAS
FT                   EEVASHAFAMGLALARRLPAGNAAIDNLGWAGTIGYDTPVLSELEVGVLGMGRIGQHVA
FT                   RMYAAVGARVRAYDPFVTNSFVEMSGLEDILENSDVVSLHLPLNAETTNLISTDVLATM
FT                   RKGTVIVNVSRGGLIDEASLAEALASGQIAGAGIDTFAQEPLAADHALRTAPNAILTPH
FT                   IAWRSNRSTGALQDGAVERVRLALTGQPLIDLVN"
FT   gene            141637..142932
FT                   /locus_tag="Achl_0133"
FT   CDS_pept        141637..142932
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0133"
FT                   /product="aminotransferase class-III"
FT                   /note="PFAM: aminotransferase class-III; KEGG: rpd:RPD_2366
FT                   aminotransferase class-III"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38136"
FT                   /db_xref="GOA:B8H8G2"
FT                   /db_xref="InterPro:IPR005814"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G2"
FT                   /inference="protein motif:PFAM:PF00202"
FT                   /protein_id="ACL38136.1"
FT                   /translation="MATTNHLEDLAALQNPAEDPHLRRGPRGFPLLPGGYGRSTYYTGA
FT                   PSPYAIKGHGYRVWDDRGRELIDANNNFTSLIHGNAHPEITEAATKALTTGASWGIPNL
FT                   YEWELAELLLGRLPELDQVRFANSGTEAVMSAIRISRASTGRERVIVTKGGYHGTSEVA
FT                   LVPGGPSYQRGVTRGVIDDVTAVPLNDVDFLRQAVESAPDAYAAIILDLLPNRAGLLTI
FT                   NEEFVRTARELATRYGIVLIIDEVISLRLGYSGFSGEYGVTPDLLTTGKLIGGGFPVGA
FT                   VCGKAELMAEVDPTRPGSLPHGGTFSGNPVSMAAGSVALRLYTEDEVKRLNQLGDTARD
FT                   TANALVADAGWEIRGRGSLLRAVPAGAEKVDEHTQHKLWWASYERGLLGSPANLLSLST
FT                   PMDEKVVADITDRLADAVLAVASEAPTTEGAK"
FT   gene            142935..143834
FT                   /locus_tag="Achl_0134"
FT   CDS_pept        142935..143834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0134"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bha:BH2000 2-hydroxyhepta-2,4-diene-1,7-dioate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38137"
FT                   /db_xref="GOA:B8H8G3"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G3"
FT                   /inference="protein motif:PRIAM:4.1.1.68"
FT                   /protein_id="ACL38137.1"
FT                   /translation="MKIVSYEHESGIRGGVLINDAVHDLELLLQASRQAVHGATTSVRE
FT                   FLELYGDRLEAISSEIENLADQDPEAHVGVRTDVRLTTPVPDPSKVLCIGLNYKDHVAE
FT                   TGRAFPEYPDVFAKFASTMVGPEDEIGGAKVSENLDFEGELAVVIGREASEVTEEEALN
FT                   YVAALAPLNDVTARDLQYRCTQWLAGKAVDGSTPWGPALVTLDEVGDPQNLDLTTRVNG
FT                   IEVQRSNTSYQIFPIARIVSYLSSFLTLEPGDVIATGTPQGIGAKRNPPVWLKPGDTVE
FT                   IDIDKVGQLRNTVGKPHL"
FT   gene            143858..145957
FT                   /locus_tag="Achl_0135"
FT   CDS_pept        143858..145957
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0135"
FT                   /product="5-oxoprolinase (ATP-hydrolyzing)"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG:
FT                   pde:Pden_0472 5-oxoprolinase (ATP-hydrolyzing)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38138"
FT                   /db_xref="GOA:B8H8G4"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G4"
FT                   /inference="protein motif:PRIAM:3.5.2.9"
FT                   /protein_id="ACL38138.1"
FT                   /translation="MKTMSDVQTQPGEARYRIAVDTGGTFTDVVVGSNSGDMAVGKALT
FT                   TYDRVFTGFEASVRRAAESVGWSGDDVLRNADVIVYGTTHATNAVLTGKVAKTALLTTD
FT                   GFADTLLLREGGRRDAFDSKAAYPPPYIPRQLTFEITERISAEGDILVELDEEQVREVL
FT                   GSFKEQGIEAVAVSFLWSIINDAHEKRAAELIQEILPGVPYTLSNAANPTIREYRRSSA
FT                   ASIDASLKPLMADHLGKLRSDLQEYGFAGDLLVVTSEGAVLDVADVLDRPVLLLNSGPS
FT                   MAPLVGAAAAPDHDTVVVCDMGGTTFDVSLVENGVVRHTREAWLGEPFVGHLTGLSSVA
FT                   VSSIGAGGGSIAWIDGGGLLRVGPQSARSTPGPAAYGRGGEEPTVTDACVALGYLDTEG
FT                   FEGGFTLNREAAIKAIDTRIAGPLKMDTLQAAQAILDVSANHMATAIRQSALEQGVDPR
FT                   GALIVAGGGAGAMVAAIIGKLLEADTVLIPATAGVLAAYGAHRAPIATEFLSPLHNDTR
FT                   SFDAGSASRAVEDLTAKAEVFVKRFDGVGEAPKVTYFVDARYPGQAWDLRVYLDAAPDT
FT                   SGDAAGIIERAFHEEHDRRNGTHDPDSRVEIITWGVRVEIPRPEHTRSESELSRTAEIH
FT                   RTDSIVFGGDPFSTQRYRGVTLAPRDKIVGPAVIDQPTTTIVVPPEWDATLDDRSNIYL
FT                   TRKEA"
FT   gene            145960..147720
FT                   /locus_tag="Achl_0136"
FT   CDS_pept        145960..147720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0136"
FT                   /product="Hydantoinase B/oxoprolinase"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG:
FT                   pde:Pden_0473 hydantoinase B/oxoprolinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38139"
FT                   /db_xref="GOA:B8H8G5"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G5"
FT                   /inference="protein motif:PFAM:PF02538"
FT                   /protein_id="ACL38139.1"
FT                   /translation="MTREFDPVKLSVLANAFDGIVREMTSGLLRSARSSVINTARDFSC
FT                   AVLTADNQLLAAAEGVPVHVFGAGPLGEDMVELHKDIREGDAFLHNDPYMGNSHAADHV
FT                   ILVPIFIQGRHLFTAVTKAHQADCGNSLPTTFFATARDVYEEGALIFPCVRIQRDYTDI
FT                   DDIIRMCRSRIRVPDQWYGDYLASVGASRIAERRIHELAEKFGVDDLVDFVDAWFDYSE
FT                   RLTASAIEKLPEYVLHGSSAHDPFPGTGPEGVQLQATLEVKPKQGKVVIDLRDNPDNLP
FT                   NGLNLTKATATGAALAGILSGIPENLPSNAGTFRRVEVLLRDGCAVGVPKHPYSCSSGT
FT                   TNLADRVVNIVQAAFSQIDDGYGTAEGAAGQAPAKSVISGTDERNGNPYVNQILVGGVG
FT                   GPATPYVDGWPTYQRPVCGALLYHDSVEVDEQRYPILVHERALVADTGGAGRQRGGLAT
FT                   RVTMEPRGESVTLTYGIEGKINPPKGVRGGHDGAEPSAWVEDVKTGERREIPVVGRYDL
FT                   QSGEKVVSITPGGGGYGDPLERDVLAVLDDYRESRVTLEAAAAHYGVVITDGAIDEAAT
FT                   AKTREERLAG"
FT   gene            147802..148935
FT                   /locus_tag="Achl_0137"
FT   CDS_pept        147802..148935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0137"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; homoserine
FT                   dehydrogenase NAD-binding; KEGG: rrs:RoseRS_3454
FT                   oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38140"
FT                   /db_xref="GOA:B8H8G6"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G6"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38140.1"
FT                   /translation="MEPIRVGIIGVGNVLNQYLDKIGVHPDVQIVALADVNPEAVRKRA
FT                   AEYDVPKALTPDELLADEDVELVLNLTPPKLHAPVTLQAIAAGKHVLSEKPFATSLEEA
FT                   KQILEAAREAGVKVGSAPTTFLGSGMQTSRKLIDDGWIGKPVAAFASFACRGYEHWHPN
FT                   VDPFYSPGAGPMLDIGPYLITNLVNFFGPVSRVSATTPRSAETRPRPGKDGEVIQIQTP
FT                   THVTGTLDFESGATATVIVSWDIWNHNLPHLEIYGTGGSLAAPNPDHFSGAPVLRRGEP
FT                   GDLALDMTPPGGGDWRETPITHRDDAYRGIGLAEFGYAIRKGVEPRTGGDFAYHVLEVL
FT                   LAFEASSEHGKHIAIASTCERPRPLPSVGPQEPYRFD"
FT   gene            149124..151085
FT                   /locus_tag="Achl_0138"
FT   CDS_pept        149124..151085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0138"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: sen:SACE_5186 thiamine pyrophosphate-requiring
FT                   enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38141"
FT                   /db_xref="GOA:B8H8G7"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR030817"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G7"
FT                   /inference="protein motif:PFAM:PF00205"
FT                   /protein_id="ACL38141.1"
FT                   /translation="MTSTAAADTGTEVNIAADKKAVRRRTVAQAIVEYLQVQYSELDGE
FT                   QRRLIAGMYGIFGHGNSVGLAQGIDEYGVDFPHYQGKNEQSMVHAAIGFAKASNRAATL
FT                   ACTASAGPGSTNMISGAATATTNRLPVLLFPADIINNRFGDPVLQQIEHPVERDVSAND
FT                   CFRPVSRYFDRITHPAQLLSTLPEAMRVLTDPVETGAVVVCLPQDIQGTEFDFPESFFT
FT                   PRVWHIRRRPAVEDELRDAAEIIRNAKRPLLIAGGGVRYSKAQDELARFSSEFGIPVSE
FT                   TYAGKGSGPITDLNLGALGVTGTVGANEIADNADVVVTVGSRLQDFITASHSLFQNPDV
FT                   KFVNLNVGSFDAHKMGSFPVIGDAKLNLAALRERLAAVGYSTSGEFRSDVADALKATLE
FT                   VRRHDLQAFPGELMSQAQVIDVLNKRTTSEDALILGSGGVVEGIHKAWDPSNGTEIHFE
FT                   YANSCMGHEIPAGLGYRLARPDEPGEVYVLIGDGTYFMQPTELVTAVQERKKIITIVID
FT                   NRGHQCIWPLQVAKGGPGREFGTQYRERSKESGRLDGAVLDFDIAANAASMGCAAWSTT
FT                   TIEEFSAALTEAQEAEGPAVIVARVEPWRYLSGNGAFWDVGAPMTSERPATLEGAAKHL
FT                   KGRERQRFYAATSAPDAR"
FT   gene            151164..152519
FT                   /locus_tag="Achl_0139"
FT   CDS_pept        151164..152519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0139"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: rha:RHA1_ro00587
FT                   succinate-semialdehyde dehydrogenase (NAD(P)(+))"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38142"
FT                   /db_xref="GOA:B8H8G8"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G8"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL38142.1"
FT                   /translation="MSAFAVIDPATGTIHAEYPAATDAEVEAGLAAAQNTYHEWSRTTT
FT                   VAERAGMARRLAELFVERKDKLAAIINREMGKPLQQAAGEAEFSGSIASAFAENAEEWL
FT                   ADEQLEVADGLRSFFRYQGLGVILGIMPWNYPYYQVARFAIPNIILGNTVIVRHASQCP
FT                   ESALALEELFRDAGFPEGAYVNLFATHQQISNIIADDRVQGVSLTGSEQVGAIVAEQAG
FT                   RALKKCVLELGGADVFLVLDTDDVDLAVKKAVMGRMGNTGQSCNGSKRIVVLDKYFDEF
FT                   SEKFKAAIAGQSYENGDFGPMSSDSATKFLASQVQGALDQGAEILVGNNQPQGNVFTPT
FT                   IITNITPSMDVYSEELFGPVAQLYKVSSDAEAINLANSSPYGLGSVVICDDVERAERVG
FT                   NQLDVGMVFVGAYDLSGADVPFGGVKKSGYGRELGKVGMLEFANKKLFRFAK"
FT   gene            152641..153942
FT                   /locus_tag="Achl_0140"
FT   CDS_pept        152641..153942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0140"
FT                   /product="tryptophan synthase, beta subunit"
FT                   /EC_number="4.2.1.20"
FT                   /note="KEGG: art:Arth_1688 tryptophan synthase, beta
FT                   subunit; TIGRFAM: tryptophan synthase, beta subunit; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38143"
FT                   /db_xref="GOA:B8H8G9"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR006653"
FT                   /db_xref="InterPro:IPR006654"
FT                   /db_xref="InterPro:IPR023026"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8G9"
FT                   /inference="protein motif:TFAM:TIGR00263"
FT                   /protein_id="ACL38143.1"
FT                   /translation="MNVALGDPGMAPADEPQPGQSSFRNAPGPYFGSFGGRWMPEALIA
FT                   ALDELENTFREAKVDPEFATQIADLNRNYTGRPSPLTEATNFARHAGGVRVFLKREDLN
FT                   HTGSHKINNVLGQALLAKRMGKSRVIAETGAGQHGVASATAAALLDLDCVVYMGAEDCR
FT                   RQALNVARMKLLGATVVPVATGSKTLKDAINEALRDWVANVDTTHYMLGTAAGAHPFPA
FT                   MVRYFHQVIGDEARSQVLERTGRLPDAVCACIGGGSNAIGIFHAFLDDPSVAIHGFEAG
FT                   GEGIETGRHAAPITLGLPGVLHGAKSYLMQDDDGQTIESHSISAGLDYPSVGPEHAYLA
FT                   DIGRVSYEPITDREAMDAFGLLCRTEGIIPAIESAHALAGALKVGQRMATADTATGDSN
FT                   KRIVIVNLSGRGDKDVGTAAEWFDLLGPESVVVS"
FT   gene            complement(154244..155428)
FT                   /locus_tag="Achl_0141"
FT   CDS_pept        complement(154244..155428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0141"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: pac:PPA0466 putative myo-inositol
FT                   2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38144"
FT                   /db_xref="GOA:B8H8H0"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H0"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38144.1"
FT                   /translation="MEDQNRIGVGLISVGWMGRLHSRAYLATKQFFPELPRHPELVIAA
FT                   DPDDAGRHHAEDALGYKETATDYRKVLENPDVDVVSICSPNFLHHEIALATIEAGKHFW
FT                   IEKPMGRSARESREIAQGAEAAGLITSVGFNYRHAPAVAEARRLIRSGALGKVTNVQIR
FT                   LLTGYASDPTQVFTWRYEQARAGSGVLGDVLSHGFDLAQFLVGRITSLNAVTETFIKDR
FT                   PLPAGNSSNSFDMGQASDVTREVENEDYTAMLARFEGGAIGMFESTRVAIGPHAEYIIE
FT                   VYGTEGSLRWNFERMNQLEVATDRSGYRTIMTPPSYGEFGRFQPGPGPGIGFNDLKTIE
FT                   AALFLRSVAEGKQIGPSAADGWSASELVDASLRSADSTTWVDIPQVTGSTTYDA"
FT   gene            155617..156384
FT                   /locus_tag="Achl_0142"
FT   CDS_pept        155617..156384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0142"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bcs:BCAN_A1141 bacilysin biosynthesis
FT                   oxidoreductase BacC"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38145"
FT                   /db_xref="GOA:B8H8H1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38145.1"
FT                   /translation="MMDRSMWSRTEPLRVLVTGATSGVGEATAKLFAGRGARVALLGRR
FT                   EGELQRVAGDIDGGAHQVVTDVADAESVRNGVRGAIHALGGLDVAVNAAGVASHAPLED
FT                   LDEKRWREVLDTNLSGTFYVAREAGLYLRRSGGGAIVNVASDLATMGVAGLVHYCAAKA
FT                   GVVGLTKALALELAPHVRVNAVCPGPIDTPMLRSGLELQSNPLLALQQKESTVPLNRLA
FT                   HPEEVAAAIYFLAVEGTFATGTSMAFDGGTSAA"
FT   gene            156438..158198
FT                   /locus_tag="Achl_0143"
FT   CDS_pept        156438..158198
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0143"
FT                   /product="Dihydroxy-acid dehydratase"
FT                   /EC_number="4.2.1.9"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: aav:Aave_3759 dihydroxyacid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38146"
FT                   /db_xref="GOA:B8H8H2"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H2"
FT                   /inference="protein motif:PRIAM:4.2.1.9"
FT                   /protein_id="ACL38146.1"
FT                   /translation="MPDPNYMDLRSARWFAPHDLTGFVHRTAIQAEGFSRFAIKDRPVI
FT                   GIANSWSELVNCNIHFKLLAEAVKRGVLMAGGLPLEFPTISLGESLMKPSAMQFRNLMA
FT                   MDVEESIRAYPLDAIVLLGGCDKTVPAQLMGAASADIPTIMLTGGPQEPAHFRGKQLGV
FT                   GTDTWKYADELRAGKITEADFDELESAAKPSAGHCSEMGTASTMTSLVEALGMCLPGSA
FT                   SIPAVDSRRGQAAEATGRRAVEMALSQGPKPSEILTKEAFDNAITLLMAVGGSTNAVVH
FT                   LLALARRVGYELQLDRFHEISQRTPRIVNVRPSGEYLVKQLFEVGGIPTVLKALDPLLN
FT                   RDAITVTGESLEKGYIHAPEADGVVVSSLEAPFDASGGIAVVRGSLAPNGAVIKRSAAS
FT                   KDLLQHKGSAIVFDDIYDLGRRIDDPDLDITEDSVLVLRNSGPVGAPGMPEWGMLPIPQ
FT                   KLLRRGIRDIVRISDARMSGTAFGTTVLHVSPEAAVGGPLAIVRDGDPIVLDVENQRLD
FT                   LDLPEEEIEARLAELKLPEPKYRRGYGRLFLDHVNQAHEGCDFDFLKGLPDEEPQRLPY
FT                   GLMSGWQGGW"
FT   gene            158310..159278
FT                   /locus_tag="Achl_0144"
FT   CDS_pept        158310..159278
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0144"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: sen:SACE_3772 putative D-isomer specific
FT                   2-hydroxyacid dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38147"
FT                   /db_xref="GOA:B8H8H3"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H3"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL38147.1"
FT                   /translation="MPPVDRLEKEADVVVVRTAEEFRGALPGTEILFLNDFRTKLLREV
FT                   GPGSLRWIHTSSIGVDSLMTEEIIDSDIVVSNSRGVCERPIAEWVLGVLLMFTKDLRRT
FT                   IELQRSRTWQHRETEPLLGRRVLVVGPGPVGRETVLLLRAAGMDVTVVGRSARDDAQLG
FT                   AIASFDELDALLGEAQDVVLTVPLTEETRGLFNAARFDKMRPGARLVNVGRGAVVVEQD
FT                   LLDAIDAGHLGAAALDVFENEPLAAENPLWSRNNILVSPHASGDLIGWRGRVVDCFAKN
FT                   LQQWKTGQPLNDVVDLTKLGGTAPKALSQAGTVLPQSASIV"
FT   gene            159311..160771
FT                   /locus_tag="Achl_0145"
FT   CDS_pept        159311..160771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0145"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   rha:RHA1_ro02835 phenylethylamine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38148"
FT                   /db_xref="GOA:B8H8H4"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H4"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACL38148.1"
FT                   /translation="MTSSTKGKPITPTQTQEHKLSGNMGVGELVMNVLAFSSPLTTVAG
FT                   TLPVMLLFSGHTAPGIYLLVTLMLLIFSVGFVKMSRSVEAPGGFYSFVTAGLGKPAGLG
FT                   GALLALVGYVFIGFFAPSLFALTLQSFVVNTMGGPDIPWYWYGLGIIAITTALAYNRID
FT                   LSAKVLTVVMLLESTVVVIFDVAAFASGDVSQGVGFSMPWITDAGLGLALLFAVGNFFG
FT                   FEATVIYRDEVKNPDRTIPRATYLAVVGIGLFYAIAAWAYTAFLGADNVQEEAKANTVN
FT                   LFNDGAIALVGKIFADIGVVLLITSILASMLSIQNIAARYSFSLAADGALPKALGRVHP
FT                   RHKSPYISAVGVGLVWATATVVFTVVGVAPEALYPIASGSGTFSVLLLMFITSFAVLVY
FT                   FVRRRSFAPESVWKTIAAPIVSVLFLGLITYLAIANYPELIGGSLLMTVIFMTFTFALF
FT                   IGGIIYAYFLRSKRPDVYARLGRQKIEQ"
FT   gene            160798..161808
FT                   /locus_tag="Achl_0146"
FT   CDS_pept        160798..161808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0146"
FT                   /product="Inositol 2-dehydrogenase"
FT                   /EC_number="1.1.1.18"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: cmi:CMM_0793 putative myo-inositol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38149"
FT                   /db_xref="GOA:B8H8H5"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR030827"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H5"
FT                   /inference="protein motif:PRIAM:1.1.1.18"
FT                   /protein_id="ACL38149.1"
FT                   /translation="MTQQIRVGLFGTGRIGQVHAMSLATLEEATLAWVCDPFIEGAKRT
FT                   AAEFGGRVSDDPEEVFASGEVDAVIVASPTATHVDLIEQSIDAGIPVLCEKPIDLEIGR
FT                   VDALRAKAAATDVPIALGFNKRFDRHFVELRRRVGAGEIGALEQLIVTSRDPGEPPAAY
FT                   LPQSGGIFRDMTIHDLDMARYFIPDIVEVSARGANVFSEGIRQAGDFDSTVVTLRGSKD
FT                   ELVTIFNSRHSAYGYDQRIEAFGSTGLLQVTNKNDSLVRHWGARSVEGAGPYQNFFLER
FT                   YAEAYRLEVAEFLRAVRGLPSRSPGFEDGRAALILADAAEKSARTGAAIAVELSA"
FT   gene            162147..163031
FT                   /locus_tag="Achl_0147"
FT   CDS_pept        162147..163031
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0147"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: rsh:Rsph17029_3423 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38150"
FT                   /db_xref="GOA:B8H8H6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL38150.1"
FT                   /translation="MTDAPPATTPLVALKDIHKTFGAVSALRGVSIDVMPGETFALLGD
FT                   NAAGKSTLMKVLTGVYQPDRGSIELDGKATAFPTPSASRDQGVEMVYQDFALADNLDVR
FT                   TNIFLGREPQKNILGPLLRIIDRKKMESETKRVLERLDIPINPRLKVKRLSGGQRQAVA
FT                   IGRALAFDARLIIMDEPTANLSVAKVDKLIEVTQRLKDLGIAVIIITHRLDEAFAVADR
FT                   FAVMRQGQVVGRFRVGEVSEAQVAHLISHGTLDDYVDHGSGIPEDRRKIGSTSSMETVD
FT                   AFSARGTTNGSDS"
FT   gene            163028..164026
FT                   /locus_tag="Achl_0148"
FT   CDS_pept        163028..164026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0148"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   vei:Veis_2045 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38151"
FT                   /db_xref="GOA:B8H8H7"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H7"
FT                   /inference="protein motif:PRIAM:3.6.3.17"
FT                   /protein_id="ACL38151.1"
FT                   /translation="MTITMDTLKTKLGPADLKEGLTATRVKRFIGDYGIIILFVVILVF
FT                   LAAAAPNFLTLNNIVNVVRQSSIIGLIALGMTFIMITAGIDLSVGSVVGLAGMTFALLA
FT                   PDSGGAFWLPLIAGLGVGLLVGFLSAAMVVWGAILPFLATLATMAIARTAALVITDGQV
FT                   VSGLSGPAEWLGSGFLGPVPVPVIIFLVAAIICEFVLSRTKFGSHVYAVGGNEESAKKV
FT                   GISTSRVLFMVYLIGGVTAALGGLVLTARLDGAAPVAGTGYELQVIAAVVIGGTSLFGG
FT                   VGTIRGTVIGVLLLGVVMNGMNLMGVSSYFQQGVQGVILVLAVLLNRWKSD"
FT   gene            164096..165064
FT                   /locus_tag="Achl_0149"
FT   CDS_pept        164096..165064
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0149"
FT                   /product="periplasmic binding protein/LacI transcriptional
FT                   regulator"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: tte:TTE0206 periplasmic
FT                   sugar-binding proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38152"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8H8"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACL38152.1"
FT                   /translation="MGMRRKIAAAVAMMAAGALTLTGCAGSSNATSSGEAAKTYNIGVV
FT                   VLDLQDPDLAHMTDAMKKTADEKGVKLNITDSKKDVGSELNQVEDLLTRQVDAVIMQPL
FT                   DGDASQNAAKRVIAANIPLFILSTEFAEGSDVGYKSYIGVDDTVAGQMQAEYLNKLMPN
FT                   GGNLVFAAGVYGASWTDRRKNGFDKTINENFKIVAEFQAKGSRDDAKRNMEDTLQRFPS
FT                   GQIDAVVANNDEMAIGAASAIADAGRTAEFKAVVGVDGTEPALQDIEGGTMSATVRQDS
FT                   AGQGVKAVEVVTDFLNGGNVDNRYTLPFTLITKDNLSEFLK"
FT   sig_peptide     164096..164188
FT                   /locus_tag="Achl_0149"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.732 at
FT                   residue 31"
FT   gene            165192..168125
FT                   /locus_tag="Achl_0150"
FT   CDS_pept        165192..168125
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0150"
FT                   /product="D-lactate dehydrogenase (cytochrome)"
FT                   /EC_number="1.1.2.4"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   rha:RHA1_ro01642 FAD binding oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38153"
FT                   /db_xref="GOA:B8H8Z4"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8Z4"
FT                   /inference="protein motif:PRIAM:1.1.2.4"
FT                   /protein_id="ACL38153.1"
FT                   /translation="MPHGDDGDTKAEQLLAALRAQGIEVDDAPRRLSEYSYDASNYRVR
FT                   PAAVAFPASVKDVRKVLRACSTLGVPVTARGGGTSMAGNAIGGSLVIDLSRRLTSVGEL
FT                   DGGKAAVWVDAGVILGELRSYVEKASGGEVTFAPDPSSMTRATIGGSIGNDACGNHSVA
FT                   YGRMTQHVQEVELVTADGAHLHAGRDFLRAVDAGDQQSVARAAELFAGLKELAQDNLAP
FT                   LRVELGNIPRQVSGYHLGHLLPENGLDVAAALAGSEGTCALVVRAKVGLVPKPRTTALL
FT                   CLGYANTIDSARDVTTILAARPSAIEGLDASIVDIMRHRRGAASVDSLPQGKAFLMVEF
FT                   PADSIEQAAAECERLLEKLTADGRVLDHAIVTEPAERAKLWRVREDGAGLSSRRIDGVQ
FT                   TWPGWEDSAVAPERLADYLAELLPLVEQYGYTAFMYGHFGAGCVHMRLDYDLRSDAGRE
FT                   SFENFTREAAALVVAHGGSLSGEHGDGRARSELLDVMYSPAMVGIFRAFKHLWDPAGIL
FT                   NPGIIVDPEPFAASLAPEGVPLPGHARGEPAAVPGAAVVPSSGNRSLLPVASPFVGNTH
FT                   ACIGVGRCRATTGGFMCPSYRATKDEKDSTRGRSRVLQELTRTKGTSHGGWSSPEVREA
FT                   LDLCLSCKACSADCPTGVDIAEAKSELVDQHYRGKIRPFTHYSIGWLPRWLPLLTRIAP
FT                   LANAGTGFGPFRWVGEKLGVSARRRLPDFAPSARIRRRIREAQFADNADILLFIDSFTR
FT                   AFRPEVVPAAARVLRDSGISVGCTPDACCGLTWISTGQRDGARRRLARLISRLDDGTNR
FT                   DIVVLEPSCAATIRDEGPKMVGGAAAARVAARVRSFSVAIDEAIKRGWKPSVAPPQTAV
FT                   LQTHCHEHAVFGSGSQKRVLKAWGVPNLVESSSCCGVAGNFGFEAEHFDMSMKVAEHSI
FT                   VPALDSGAGLVLTDGFSCAMQVSQVAPGRTSQHLAAALDPQSARGVA"
FT   gene            168126..168323
FT                   /locus_tag="Achl_0151"
FT   CDS_pept        168126..168323
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0151"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38154"
FT                   /db_xref="GOA:B8H8Z5"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8Z5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38154.1"
FT                   /translation="MEYFGVFLVLVAAALNFVAPYMNENAKKTRSRPNLLTVPTVPPAA
FT                   AAALIAVSGVFIFVVGIDSK"
FT   gene            169201..169920
FT                   /locus_tag="Achl_0152"
FT   CDS_pept        169201..169920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0152"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: eca:ECA2069 TetR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38155"
FT                   /db_xref="GOA:B8H8Z6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38155.1"
FT                   /translation="MSPSPREQANAAVLEFLSQRDWSTQTPAKKRILLTFLRLAAANGY
FT                   NSVSMRTLGRELGVRAPSLYSSFPQGKDQITADSLLWFTHGFAQELLERVQGIQCADDY
FT                   WAALVRFHVTQQIGSPEPDLWNLLVASDKVAGFLGEGLREELACWQGLHEAMYAAAAEE
FT                   MGLAVTRQAIQAIFALLDRAAHWSAWDGTAAQLENLADRGVALSRSLLVVSAGSGPGTW
FT                   PELSQHGTTPLIAPSIL"
FT   gene            169952..171415
FT                   /locus_tag="Achl_0153"
FT   CDS_pept        169952..171415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0153"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   eca:ECA2068 putative permease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38156"
FT                   /db_xref="GOA:B8H8Z7"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8Z7"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACL38156.1"
FT                   /translation="MNNTTIDALKVSRQTQENRLSGNMGVGELVMNVLAFSSPLATVAG
FT                   TLPVLLMFSGQTAPAIYLLVTLMLLIFSVGFVKMSRSVQGPGGFYSFVTAGLGKPAGLG
FT                   GAFLALFGYIFIGFFAPSFFGVTLQGFVVNTLGGPDIPWYWYALAITAVTTLLAYNRID
FT                   LSAKLLTIVMLLEVAVVVVFDVASFSANGLGAMQGAGFALPSITDATLGLALLFAVGNF
FT                   FGFEATVIYRDEVKDPDKTIPRATYLAVVGIGLFYAMAAWAFIAFFGADKIQAEAGNNT
FT                   VNLFNDALVGLVGRIFADIAVIMLITSVLACMLSIQNIAARYSFALASDHALPRFLGRV
FT                   HPKHKSPYASALAVGTIWAAATALFSLLGVAPEALYPIASGSGTFAVLLLMFITSFAVL
FT                   VYFARRRSFEPESVWKTVVAPVISVLFLGAITCLAIANYPELIGGSAILTLIFMTFTFA
FT                   LFFGGIIYALFLRANRPEVYARLGRQKID"
FT   gene            172854..174128
FT                   /locus_tag="Achl_0154"
FT   CDS_pept        172854..174128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0154"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38157"
FT                   /db_xref="GOA:B8H8Z8"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8Z8"
FT                   /inference="similar to AA sequence:KEGG:AAur_0776"
FT                   /protein_id="ACL38157.1"
FT                   /translation="MPDDDSGQETGQKESFGSGIRGWVLPVAAAVVAAGFGGVSISNGL
FT                   ADRDRANQEAAASQSAAAVPVCQVVDRKDLIPASGALFGVNLNLDAKPLSRYAADLGRK
FT                   PAVSVSFADFPYTGAEKAHLQAAAAQIRDDGHMMLLTLEPKQGLAAVTADVIDELVQDL
FT                   VSINNQGVPVIVRFAHEMNGSWYPWSQQPVEYKAVFTRVADAVHSRAPGSAMMWAPNYG
FT                   GGYPFAGGQFEAKPGSADFAALDTDGDGVLTMADDSYAPYYPGDEAVDWVGMSLYHWGA
FT                   KYPWGENELPEANKFADQLTGNYIGANGDDSLLTDFYHVYGADHGKPVAIPETAALYNP
FT                   AAGGASEADIKRGWWEQVFGPETHAAFPDLKMVNWFEWDKNEVEVNGRVDWTVTNTPAI
FT                   RDAFTAALPDWLEYGTGTACRPAGT"
FT   gene            174184..175398
FT                   /locus_tag="Achl_0155"
FT   CDS_pept        174184..175398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0155"
FT                   /product="GAF sensor signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase A domain protein; KEGG:
FT                   art:Arth_3731 GAF sensor signal transduction histidine
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38158"
FT                   /db_xref="GOA:B8H8Z9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8H8Z9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL38158.1"
FT                   /translation="MSVDALVRDAVLARTGLPTPGPDGKLAVPAPSERLQNLVELARTV
FT                   CQQPVTAINIITADLQYQVAAVGMEPYLCSREDSMCAVSFLGGRPTVVEDASLDPRYSG
FT                   NPYVDGRRGAVRFYASIPLVAEDGFVLGTLCAGAREPGRLSDRQRHGLEILAAEIVDVL
FT                   HLERRARQLSDALGEARRANALLAEFAGRISHDLRNPLTSVLGYVELGQMSDGAASDPD
FT                   LAGYLEVAAGSGQRMLSMIEDVLSYATTGGDLRPARVSLKDLVQDVVQDLAASLEVSGA
FT                   AVDAGDLIFTADAGQMRVLLQNLIHNAVTYSRPGIAPVVRVTGHVSEGGVTLRVIDNGK
FT                   GISEPDRDRVLDPLVRLHRDGDPPGTGLGLATCARIASAAGGRLEIGPVPGEGTMISIH
FT                   LQQES"
FT   gene            complement(175603..176238)
FT                   /locus_tag="Achl_0156"
FT   CDS_pept        complement(175603..176238)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0156"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bmu:Bmul_0438 ammonium transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38159"
FT                   /db_xref="UniProtKB/TrEMBL:B8H900"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38159.1"
FT                   /translation="MTPRTAPLVSLLLSSLLLAGCAGPAGSPTAAPGPGKGSPTASAAA
FT                   TPQATAGGHHHAAASAPRKTPDGPSEAAKMVCGDQPMDRLTAILHLQQDPHTVNSWADS
FT                   TFTCTYHLTDGALNIAVQEAPDQAQALTYFNAGQALAKNATPIQGLANLGFPAYETADG
FT                   TAVFQKDSFILTVDASDLPATIGPDAVTRNALAYQLSTTILACWVEHH"
FT   sig_peptide     complement(176146..176238)
FT                   /locus_tag="Achl_0156"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 31"
FT   gene            complement(176308..177015)
FT                   /locus_tag="Achl_0157"
FT   CDS_pept        complement(176308..177015)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0157"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   ace:Acel_0348 peptidase C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38160"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:B8H901"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACL38160.1"
FT                   /translation="MTRTTSGHRGGLGASTAAGLLLLFLLTLTGCGGTTPPSNTAAPQA
FT                   TASAAAPATSGTSTTPATVSPSAPASAPAPASAEKLPVLSRSEPVTLEIPSIGVVTNLL
FT                   HLGLRENGSLEVPQDTGNGAPASWYDGSPTPGERGPAVLLGHVNALGGHQGVFAGLRKL
FT                   APGDQLKVSRADGSTAMFTVDRGAVYGKDSFPTLEVYGNTPGAELRLVTCDGYDPATGL
FT                   FDDNYVIYAKLTT"
FT   sig_peptide     complement(176890..177015)
FT                   /locus_tag="Achl_0157"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.435 at
FT                   residue 42"
FT   gene            complement(177039..177812)
FT                   /locus_tag="Achl_0158"
FT   CDS_pept        complement(177039..177812)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0158"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ace:Acel_0349 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38161"
FT                   /db_xref="GOA:B8H902"
FT                   /db_xref="InterPro:IPR010895"
FT                   /db_xref="UniProtKB/TrEMBL:B8H902"
FT                   /inference="similar to AA sequence:KEGG:Acel_0349"
FT                   /protein_id="ACL38161.1"
FT                   /translation="MNKTLRFLAVPTLALGALALSSAPASAADHSYQSTLSQINGSSAS
FT                   GTVTVDVTGNQAHAVLKVSGLAPTFMDAPYPHVQHIHGGAQGVCPAPSADTDGDGVVST
FT                   TEGAPSYGGIVTTLSTSGDTSPAAGLDLKVAGQGASYTVDRTFELNAETKAALEAGTAV
FT                   VVVHGLDPATLTEKGQAAKSDLVPSLPLAATSPALCGTLAAGQMKMPAGGADTGVAQQT
FT                   GNTDTGVLALGGGLVLAAAAGGTYLIRRRNAGSAA"
FT   sig_peptide     complement(177729..177812)
FT                   /locus_tag="Achl_0158"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 28"
FT   gene            178353..179033
FT                   /locus_tag="Achl_0159"
FT   CDS_pept        178353..179033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0159"
FT                   /product="beta-Ig-H3/fasciclin"
FT                   /note="PFAM: beta-Ig-H3/fasciclin; KEGG: art:Arth_2547
FT                   beta-Ig-H3/fasciclin"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38162"
FT                   /db_xref="InterPro:IPR000782"
FT                   /db_xref="InterPro:IPR036378"
FT                   /db_xref="UniProtKB/TrEMBL:B8H903"
FT                   /inference="protein motif:PFAM:PF02469"
FT                   /protein_id="ACL38162.1"
FT                   /translation="MQTIKRTTFTVAGVAAAALLSLTACGGSGTTSGSSASSAPMSSAP
FT                   SSSMASPSASASADGMDPAANLVGPGCAAYAEQVPTGAGSVSGMALDPVAVAASNNPLL
FT                   TTLTAAVSGKLNPKVDLVDTLNGGEFTVFAPVDDAFKKIDPATIETLKTDDALLSKILT
FT                   YHVVPGQITPDKIAGTHATVQGDSVTVTGSGDNLKVNDANVICGGVKTKNATVYLVDSV
FT                   LMPK"
FT   sig_peptide     178353..178505
FT                   /locus_tag="Achl_0159"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.255 at
FT                   residue 51"
FT   gene            179224..180819
FT                   /locus_tag="Achl_0160"
FT   CDS_pept        179224..180819
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0160"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: aau:AAur_0515
FT                   putative molybdopterin oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38163"
FT                   /db_xref="GOA:B8H904"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B8H904"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACL38163.1"
FT                   /translation="MPAMTMLRNRLTGPAPLAALAGVVAAAVVLAVAELLGAFFTARAT
FT                   PLFALGSTFIDFTPGWLKDFAIATFGTNDKAALFVGMGLTITVLACVLGIVAFRNWALG
FT                   VLGVLFMGAVIVACVVTRAGVSAVDAIPAVLGTLAGVAVLRFLVNRVQALKAWPEAPAD
FT                   LAYDADARVGNEGSSRRRFFAAAGITAVAAGVAATGGRLLGAARSNIAKAREALQLPTP
FT                   ATAAPPIPAGVQSSVDGAPPWVTPNNDFYRIDTALSVPEINADDWELRVHGLVEQEVRL
FT                   TFQDLLDADLIESHVTLTCVSNPVGGNLAGNAKWLGLPLREVLKRAKPKDGADMVLSTS
FT                   IDGFSASTPLEVLQDGRDAMLAIGMNGEPLPLEHGYPVRMVVPGLYGFVSATKWVVDLE
FT                   VTRFADSKAYWTERGWAERGPIKTMARVDVPKSFAKVPAGKVAVGGTAWAQTRGITKVE
FT                   IQIDNADWVEATLSTEASLVTWRQWSYEWDATPGPHYIKVRATDGTGEVQTEQRADPVP
FT                   DGASGWQSVMVTVQ"
FT   sig_peptide     179224..179304
FT                   /locus_tag="Achl_0160"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.403 at
FT                   residue 27"
FT   gene            complement(181002..181412)
FT                   /locus_tag="Achl_0161"
FT   CDS_pept        complement(181002..181412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0161"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0361 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38164"
FT                   /db_xref="UniProtKB/TrEMBL:B8H905"
FT                   /inference="similar to AA sequence:KEGG:AAur_0361"
FT                   /protein_id="ACL38164.1"
FT                   /translation="MGEGTKADPWKLVTAPGSSEYQMYRDAEAEPPALVCQVGSTTLKY
FT                   HLRAVEDLHAWLVQQGDWVPLGAADESKPAPEGSVEAWGRDPGNPVGGWYGLRKGYRGR
FT                   FGMYLPPLLEALGLAELTHEKRNNTIRALPTP"
FT   gene            182285..182800
FT                   /locus_tag="Achl_0162"
FT   CDS_pept        182285..182800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_pTC10117 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38165"
FT                   /db_xref="UniProtKB/TrEMBL:B8H906"
FT                   /inference="similar to AA sequence:KEGG:AAur_pTC10117"
FT                   /protein_id="ACL38165.1"
FT                   /translation="MEKVETDHGGDTWWDTTVQGNALAMAGFGKPISRKTADRLIADLL
FT                   DRAGAYNADPARPLFINTLRVFGSYLDPQTDPFGDVDLELTYGRRITDPKLVADYARAS
FT                   GRSFTTYVDRLLWPHTELVQHLKNRSAFINITTEDITRLTDRSEAIYRVDDDPQAVPPP
FT                   ADRTLTGR"
FT   gene            complement(183125..183757)
FT                   /locus_tag="Achl_0163"
FT   CDS_pept        complement(183125..183757)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0163"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mmi:MMAR_0963 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38166"
FT                   /db_xref="GOA:B8H907"
FT                   /db_xref="UniProtKB/TrEMBL:B8H907"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38166.1"
FT                   /translation="MDPNASAALSAYGSLIAAAAAVVALIFTGIAAVAAYKQTRLQKQI
FT                   AEDAAQPYVWVDMRPDTKQGGLLNLIVGNSGPTVATDVTVGFEPPLQMPFEDEAGHALE
FT                   VLRRGIPSLPPGRTLVWNLGVAWQIVGADSPKRYKLTISAAGPFGGLKPLTYIVDVDDI
FT                   RATAAVPDGSLHLVAEAVSKTNRTLERLTDFFAAVERTRRRSTEGPK"
FT   sig_peptide     complement(183698..183757)
FT                   /locus_tag="Achl_0163"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.404 at
FT                   residue 20"
FT   gene            complement(183915..186725)
FT                   /locus_tag="Achl_0164"
FT   CDS_pept        complement(183915..186725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0164"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: slo:Shew_1693 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38167"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR025375"
FT                   /db_xref="UniProtKB/TrEMBL:B8H908"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38167.1"
FT                   /translation="MRAPKNEAIGTSGESEVLAQFERLGWGGVIDSRHDTGTDLYLRPR
FT                   DTRRFELGAVMGAQVKTGPSYFTSPQRDTDGTITGWWFTEGDREHFDYWLRHALPHVVI
FT                   LRDQEKNLSYWVHVTPERVVSTGKGAKILLSASQTVDSDHNEALSDVALTQLAAPNWDG
FT                   TAWTGAVHLPPADEIRHALITPRLIAPHPNLAPDSITGQEALALQALLRMDIERILDPF
FT                   DFSGSAQEPDATRKGLSLEEARKSDDWSWRATAALHRWQYEGNSDDLIGLVGAASTPPE
FT                   RAAAVVLCCIHHLWENDADTALRVVQDALEHDDYTSVDHAWLEAQRARLLLETGRHEDA
FT                   FDLAMATQRIHREAPHDVTAAAIAGACAGTSFKAAGWMKGDLANIVQRNDNPASWWRSQ
FT                   ITSYGLSAHLSEGFRAWSEDPSIRIGNSDETHRRLLSAALLASCAGDHDGWRHATGALG
FT                   KHFLMTSDPTDSAEAVAARLTRLRVSGDSESARLATRHIIRRGPAKAARIAASIVDLSR
FT                   STRTSALADIEMLTAAGDVIEPAQADQICAWALATLRDPQPYSERVRPTFSLLYKIIDL
FT                   LKSMVWTMSETAQHTVIDYFLNEAAITDDGAAQTLARLIHVIPESAWTESHRQRAAERS
FT                   KTDAAYLREAYLAVAAKAVPESRSEIHQRARAGELLAFEAIEDVRDLPSDAVAALVDRL
FT                   CGVIDSLIDNAANGMHSVGGLDPGEALALLSVWHHQYARWDRIQLLLTAPHVLGRERSG
FT                   ALTVLAMHGAGLSEETKKQLAEHVFPLRDSAPGRQFLDDDKDVRGLAAEAFSALTDELS
FT                   RNHVVRELLGGNAAHRASSARIIEKHGDAAESEVLMALAGDNNQTVRDAALSGLSKLVA
FT                   SGRASGVVVTALSKTLVLGGTQSASSVVSRLTVSAEETVVHELLAVAAEHPSARIRQAV
FT                   RSTYKD"
FT   gene            complement(186712..187890)
FT                   /locus_tag="Achl_0165"
FT   CDS_pept        complement(186712..187890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0165"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38168"
FT                   /db_xref="UniProtKB/TrEMBL:B8H909"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38168.1"
FT                   /translation="MYLPPAGPNLTTEQRQELDDTFLSSDPYGYFSLRIGMVLRWADCG
FT                   GDSKTHPVMANEDVPDQDKKAKKFAQFLGQSDSFFPDISPKSITTQVATDAYALRHHAA
FT                   ESLVRLTAALSSGMKVAEPCVWEALSTGPNQLDQVVEQLQEFFSSPEAPMKFARLVLRQ
FT                   HDLQGGMTEQLASASNVFADWLQFAIDLLAGHELQLNAAHNKVKHGLSVRARDDLKVSF
FT                   ASTPPSADGTIPLSALTGPDALDIFDRPVIEVLAQAPRVAGHRQGLELTQLRVDVPAIL
FT                   AEAYMIVWTHGAMFHVAAARHFGGRPNLPPQSPGALAPWLSGGRTTPSPYFCQGAGRDE
FT                   VPTYQSSRWRACPASRRNRVSRLICSARIHWFCNAQRPRCSRRYEGGVSAGA"
FT   gene            complement(188420..188986)
FT                   /locus_tag="Achl_0166"
FT   CDS_pept        complement(188420..188986)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0166"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Resolvase helix-turn-helix
FT                   domain protein; KEGG: aau:AAur_pTC20225 Tn3 family
FT                   resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38169"
FT                   /db_xref="GOA:B8H910"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR006120"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8H910"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL38169.1"
FT                   /translation="MNGQRIGYVRVSTLDQNEQRQLDGQVLDRVFTDKASGRDTARPQL
FT                   TELLRFVRDGDAVVVHSMDRLARNLDDLRALVQGLTRRGVRVEFLKEQLVFTGEDSPMA
FT                   NLMLSVMGAFAEFERSLIRERQREGIALAQQRGAYKGRKKTLTPERAAELVQRAGTGIP
FT                   KVVLARDYGISRETVYQYLRHAQLE"
FT   gene            189182..189484
FT                   /locus_tag="Achl_0167"
FT   CDS_pept        189182..189484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0240 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38170"
FT                   /db_xref="InterPro:IPR025242"
FT                   /db_xref="UniProtKB/TrEMBL:B8H911"
FT                   /inference="similar to AA sequence:KEGG:Arth_0240"
FT                   /protein_id="ACL38170.1"
FT                   /translation="MAADYDEVRSDVKESQERSLEALKSASAPDARSVVTELDEADALD
FT                   EGLTPGGEIVSEELIVQVVPQAADEFTCSSCFLVRHRSQLVRERNGQFYCIECEG"
FT   gene            190671..191978
FT                   /locus_tag="Achl_0168"
FT   CDS_pept        190671..191978
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0168"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: aau:AAur_4049 FG-GAP
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38171"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B8H912"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACL38171.1"
FT                   /translation="MTLGEHLFRKILGATIGAVVIAATSLVGITAAQAAPVLYLPYPAG
FT                   VSHTVTNYPHPADGYQNNAVDFDLAFGEAILASGAGRVYAAGYDNNPAPETNGLQVLID
FT                   HGGDQCTQYGHLSSVAVTVGQNVPQGQYLGGAGRTGAATGYHLHWNLVRCSDRKAVFGP
FT                   VATVENPTASYWVGEVLRSQNAPKSPGADGERVSDFSGDGQSDVLGVDGNGDFWFYPHN
FT                   GNGLSARSKIGSGWANHKHVMSADWSGDGAADVLGVDPAGDLWYYPNNNYQLSSPMKIG
FT                   SGWGNFLHVAAADWSGDGQADVIGVDANGDLWYYAHNGNGLSAGVKIGSGWANFKQMAA
FT                   ADWSGDGQADVIGVDANGDLWYYAHNGNGLSAGVKIGSGWANHKQMIASDWSGDDQADI
FT                   LGVDANGDLWYYAHNGNGLSAGVKIGSGWATFRHIM"
FT   sig_peptide     190671..190775
FT                   /locus_tag="Achl_0168"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.988 at
FT                   residue 35"
FT   gene            complement(192142..192324)
FT                   /pseudo
FT                   /locus_tag="Achl_0169"
FT   gene            complement(192648..192944)
FT                   /locus_tag="Achl_0170"
FT   CDS_pept        complement(192648..192944)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0170"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38172"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8H913"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38172.1"
FT                   /translation="MAVHLYTGRAGDALTESRNGHVREPENLMHLVNYAHALLFLGREE
FT                   EALGLYAELVPRWHPGKAKTLGSIIANDLRLMRLSGVICAGMPAVDALLTAAT"
FT   gene            complement(192988..195405)
FT                   /locus_tag="Achl_0171"
FT   CDS_pept        complement(192988..195405)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0171"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cmi:CMM_0738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38173"
FT                   /db_xref="UniProtKB/TrEMBL:B8H914"
FT                   /inference="similar to AA sequence:KEGG:CMM_0738"
FT                   /protein_id="ACL38173.1"
FT                   /translation="MSSAPGQLNFVGSNVTQNLNKAFAYYQQMVENIGSDEDPQSNLRD
FT                   VIGAARTSLERCLRGFDSFDALAFIRLAAGPWDFTDLRESDSQVESSQAAQDVVALTLM
FT                   GMGLPRQPLTGANSGQPNPAEALGLAAQIVTAARTLALFQGRQANQPLGALAGEFVGYE
FT                   LSVRGRQYESIAREVNSELLGHPSVESVIKHVLGFTLDDIRAVREASTALMNERLFGAR
FT                   DRIGEATKAGAPADSEAFLRDINIMMNECRLFGAVAPADVATRSGVAETTARAVLDFFS
FT                   TSRPAENDVNPVLRFVDGELPAPWGCIADEDEYLLLNGFLSEDELRRNLERGLIAAAAE
FT                   KKNSAAKMWPKYDKRRAVYSESKAADLLGKMLHGAKPRWEGQKYIGPIDAADTPSLGKT
FT                   ADRTAVDTDKFESDILFLVDGVAICVEVKAASITEKSRSGNAQRLAKDLEKTLKEGSAQ
FT                   ADRLTRLITTNGGAWSVEGKWIDLSSASEVHSIVVMLDDMGPLSLSMNVLADKGIIESA
FT                   EVPWIVSMHDLMVLSRTLDHPAQFLEYLRRRRGRRLATMVNGVDELDMFMWFLDGGMYF
FT                   NPDPQEIAKQLPLERPIKASDARRYEEQSRVRLGTLTDPLDAWFYWQEGLSRTQAAKPV
FT                   RQEQPWVEQYLSSSEAAQTPGWLRFGADLVGLSESAQRNIGKNLRELRRAAQGGGIERS
FT                   LTTHSAGSYGSWLLTISVAPKDASTEHLAEYMDAKQYQTHSDRSMLLLYQPDSSLLGTR
FT                   YRGRPQERTIDRDYAVDIAPLRSLKMTFSNLPPSARRSTVRLRGSRGKKKRE"
FT   gene            195646..196578
FT                   /locus_tag="Achl_0172"
FT   CDS_pept        195646..196578
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0172"
FT                   /product="protein of unknown function DUF344"
FT                   /note="PFAM: protein of unknown function DUF344; KEGG:
FT                   aau:AAur_4071 putative polyphosphate kinase 2 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38174"
FT                   /db_xref="GOA:B8H915"
FT                   /db_xref="InterPro:IPR016898"
FT                   /db_xref="InterPro:IPR022486"
FT                   /db_xref="InterPro:IPR022488"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H915"
FT                   /inference="protein motif:PFAM:PF03976"
FT                   /protein_id="ACL38174.1"
FT                   /translation="MDVGGKLTPWGQGWVRENLREAIDRLVDLGYTVTGGQGDDPELID
FT                   PGGSAVETWREDYPYGERLTREEYDLEKYRLQIELLKFQYWGQDQGLKTVIVFEGRDAA
FT                   GKGGSIKRFTEHLDPRSARTVALAKPSDREQGQWYFQRYIQHLPTAGEIVMFDRSWYNR
FT                   ANVERVMGFCSDAEYETFMAQAPLFEQMLVDSGIHLTKFWFSVTRLEQRTRFAIRQIDP
FT                   VRRWKLSPMDLASLDRWQDYTESKEQTFLRTDTDHAPWITIKSNDKKRARLNAMRYFLN
FT                   QFEYDGKDPSIVFGPDPLIVRRGRDAVGD"
FT   gene            196732..197718
FT                   /locus_tag="Achl_0173"
FT   CDS_pept        196732..197718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0173"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: rce:RC1_3354
FT                   oxidoreductase, aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38175"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8H916"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL38175.1"
FT                   /translation="MHTRTLGQGFEVSAIGFGAMGMSMSYGPNPGDRADMVDVIRYAVD
FT                   QGVTFIDTAEVYGPYVNEELVGEAIAPIRHQVQVATKFGWNIVDGRMQGTDSRPEQIRR
FT                   VAEGSLRRLGVDSIDLFYQHRVDPAVPIEEVAGTVGELVAEGKVKHFGLSEAGAGTIRR
FT                   AHAEFPVTAVQSEYSLWTRDPEAEVLPMLAELGIGFVPFSPLGKGFLTGTVPASSTFAP
FT                   DEIRSRIPRFQGENLAANQALVDHVRALAGARGATAGQVALAWLLAQHPFIAPIPGTRR
FT                   RERIDENAAATTVALSADDVADLNGLASRLGVAGDRYDENGMKMVNL"
FT   gene            complement(197742..199517)
FT                   /locus_tag="Achl_0174"
FT   CDS_pept        complement(197742..199517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0174"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: biotin/lipoyl attachment domain-containing
FT                   protein; phosphoribosylglycinamide synthetase;
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   art:Arth_0096 carbamoyl-phosphate synthase L chain,
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38176"
FT                   /db_xref="GOA:B8H917"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR001882"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8H917"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACL38176.1"
FT                   /translation="MRKVLIANRGEIAVRVARACEDAGLESVAVYADVDADAMHVSAAT
FT                   EAYSLGGNAPSETYLDVAKLLGVAAESGADAVHPGYGFLSENAGFAEAVIGAGLTWIGP
FT                   SPEAIRQLGNKITAREIAVRAGAPLVAGSDGPVDSAAEARAFVEEHGLPIAIKAAFGGG
FT                   GRGLKVVRDMGQVEEAFDSAVREAVVAFGRGECFVERYLDRPRHVEAQVLADQHGNVVV
FT                   VGTRDCSLQRRHQKLVEEAPAPFLTDGQTRQIYDAAKAVCREASYAGAGTVEFLVAADG
FT                   TVAFLEVNTRLQVEHPITEETTGIDLVQEQFRIAAGERLRFASDPSPRGHAFEFRLNAE
FT                   DVGRGFLPSPGTVTAFSGPTGPGIRLDSGVRAGSVVAPQFDSLLAKLIVTGADRQQALR
FT                   RARRALAEMQIGGVATVLPFHRAVVEAPDFTSETGLGIHTRWIETDFAETIGADPEFGT
FT                   SVPDGARRTITVDVDGRRLAVGLPAALLDGWARSGGPVPAGVTLAGGPISGEHDGGTAA
FT                   GAAAPGELRADMAGTVVKWLVEPGAEVAAGDPVVVLEAMKMETQVTAHRAGTLGDVRVD
FT                   AGGVVTAGGVLALIA"
FT   gene            complement(199517..201205)
FT                   /locus_tag="Achl_0175"
FT   CDS_pept        complement(199517..201205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0175"
FT                   /product="urea amidolyase related protein"
FT                   /note="TIGRFAM: urea amidolyase related protein; PFAM:
FT                   Allophanate hydrolase subunit 2; Allophanate hydrolase
FT                   subunit 1; KEGG: art:Arth_0095 UreA amidolyase related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38177"
FT                   /db_xref="GOA:B8H918"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B8H918"
FT                   /inference="protein motif:TFAM:TIGR00724"
FT                   /protein_id="ACL38177.1"
FT                   /translation="METVSSPATAARALSARVLAVRPVGTTAVLAELSGLHDVLALQAL
FT                   LLESPLPGQVDVLAAAETVMVKADSPAAARRMADRLLAMDLTVQSHTEGALITIDTVYD
FT                   GEDLAEVGRLTGLGADGVVAAHTGQVWTVAFGGFAPGFGYMVGENQALEVPRRSSPRTA
FT                   VPAGSVALAGNYSAVYPRQSPGGWQLIGRTAAPMWDLSREQPALAAPGDRVQFRAVREL
FT                   VEIPAAPAETSGHSAVKSGLRILSPGLQSLVQDLGRPGHAGLGVSSAGALDRASVRRAN
FT                   RVLGNGPSAAVIESVAGGLRVQAVGDQVLAVTGAPSALTVVTPSSAAGTDNNEDGAQYE
FT                   EVRTVPMATAFALLDGETLTVGAPEKGFRTYLAIRGGVEAEAVLGSRSTDTMSGIGPAP
FT                   LAAGQLLGAGVATNSNVVGNPELQPDYPDAGVTVLDIVPGPRDDWFDAAALELLCSQDW
FT                   AVTPRSNRVGMRLAGEPLRRSRDGELPSEGTMAGALQIPPEGQPVLFLADHPITGGYPV
FT                   IGVVADYHLDLAAQVPVGGSIRFRWAPGLPAPANSSHDSLNEVSN"
FT   gene            complement(201225..202574)
FT                   /locus_tag="Achl_0176"
FT   CDS_pept        complement(201225..202574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0176"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: aau:AAur_0052 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38178"
FT                   /db_xref="GOA:B8H919"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H919"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38178.1"
FT                   /translation="MTSTNKAAKTAARKPPAGALKAYVASLTGTSLEYYDFAIYSVASA
FT                   LVFPKIFFPSDDEFVGLLLSFSAFAVGYLARPIGGVVFGRLGDKVGRKYVLVFTLVLIG
FT                   AATVLIGALPDYSAIGVAAPIILVLLRLAQGIGVGGEWGGAVLLSSEFGDPNKRGFWSS
FT                   AAQIGPPAGNLMANGVLAVLAASLSNEAFLSWGWRVAFLASALLVAFGLLIRLKLEETP
FT                   VFKAIQAHGDRPKAPIKEVFTKEPKALVSAALSRLCPDVLYALFTVFVAVYATKELGMT
FT                   TGNVLAAILIGSAFQLFLIPAAGALTDRFNRRWVYGIAAAATAVYIPLFFLMIQGKSVL
FT                   MLTIGVVIGLALHAFMYGPQAAFITEQFPARLRYAGSSLAYTLAGVIGGAVAPLIFTAL
FT                   YGAASGGWHLIAGYLALTAVITIVGMRLGRDPQPEEDVRLLNNSAKESHA"
FT   gene            complement(202653..203411)
FT                   /locus_tag="Achl_0177"
FT   CDS_pept        complement(202653..203411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0177"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: art:Arth_0093
FT                   LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38179"
FT                   /db_xref="GOA:B8H920"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8H920"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACL38179.1"
FT                   /translation="MTSIDLNSDVGESFGRWTLGDDAAMFSSVSSANVACGFHAGDPSV
FT                   IRRTCRNAAEAGVVIGAHVGYRDLAGFGRRFLDISPSELADDVVYQIGALQALAAAEGT
FT                   KVQYVKPHGGLYNAIVSHTDQARAVVDAVKSVDPGLPIMGLPGSEVLRLAEEAGLRAVT
FT                   EAFADRAYNPDGTLVSRTQPGAVLHDPAEVAEHVLRMATEQSVRTIDGSILKIRAESIC
FT                   VHGDSPGAVAMATAVKSALADAGISIGAFA"
FT   gene            203519..204196
FT                   /locus_tag="Achl_0178"
FT   CDS_pept        203519..204196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0178"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: art:Arth_0092 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38180"
FT                   /db_xref="GOA:B8H921"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H921"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL38180.1"
FT                   /translation="MATIDSAPASAGRLRVAVPSVAERVAQELRRQLAEGALIPGARLT
FT                   ESTIAEDLGVSRNTVREAFAELASERLVVRHPNRGVFVASLGAEDIHDVYTVRRFIEVS
FT                   AMRGGGSPEDVAAVRAAVEEGKRAAAAGDDEAGGTANQHFHGAIVAMARSPRLNTIMAQ
FT                   VLAEMRLFFHKATADALFYQRYLPDNEAICEALEAGEPDRAADLLLAYLDRSEDNLAAV
FT                   HGE"
FT   gene            complement(204222..204704)
FT                   /locus_tag="Achl_0179"
FT   CDS_pept        complement(204222..204704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0179"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   aau:AAur_1110 cytosine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38181"
FT                   /db_xref="GOA:B8H922"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8H922"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACL38181.1"
FT                   /translation="MTSETRLPAATLPPKATSESAFEAAYAAARKSSSEGGIPIGAALA
FT                   RNGVVIASGHNERVQNGDPIAHGEMSALRAAGRQRSYRDTTLYTTLAPCAMCTGTIIQF
FT                   KIPRVVVGEARTFPGEFELLRSRGVEVIVLDDQRCVDMMREFQDTSPDLWAEDIAE"
FT   gene            complement(204799..204945)
FT                   /locus_tag="Achl_0180"
FT   CDS_pept        complement(204799..204945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0180"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bcl:ABC3412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38182"
FT                   /db_xref="GOA:B8H923"
FT                   /db_xref="UniProtKB/TrEMBL:B8H923"
FT                   /inference="similar to AA sequence:KEGG:ABC3412"
FT                   /protein_id="ACL38182.1"
FT                   /translation="MLLWIAIIIAVLWLLGLLANIGGGLIHILLVVAVVVLIFHFVQGR
FT                   TRA"
FT   sig_peptide     complement(204886..204945)
FT                   /locus_tag="Achl_0180"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.629) with cleavage site probability 0.517 at
FT                   residue 20"
FT   gene            complement(205118..206224)
FT                   /locus_tag="Achl_0181"
FT   CDS_pept        complement(205118..206224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0181"
FT                   /product="RelA/SpoT domain protein"
FT                   /note="PFAM: RelA/SpoT domain protein; KEGG: art:Arth_0105
FT                   RelA/SpoT domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38183"
FT                   /db_xref="GOA:B8H924"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="UniProtKB/TrEMBL:B8H924"
FT                   /inference="protein motif:PFAM:PF04607"
FT                   /protein_id="ACL38183.1"
FT                   /translation="MPSNWENLDEPLRESVQHNVELYERVRPALKLVTRDVLLVLRDML
FT                   KDSEVTPLFVTGRTKTVESFKEKISRTEEPLEPGGRRLLKFPDPFRTLNDMVGIRVITK
FT                   LPAENAAVANIIKRQRQLFDCRGDREKDIGSIESGTYGYSSRHLILRTIQNEAVKEYQQ
FT                   VFNPEITPNGSYFFECQIRTIFAHAWSEIEHDIRFKAEDPRAWTPHFDRQFTATAAMLE
FT                   TVETAFADLHERYEEVRSFWDMDGEGAAPLTPNRIRDVWRTLLPHVDRKVDDDWGWASE
FT                   LLAAHGLTQTMELAGLLRAEQITEVRKALDHRYSPGPDRLLDDLLLWQFGTRHIDLTAE
FT                   AADAVPHPRRDSLLRRLRQIERYRVTKK"
FT   gene            206539..208017
FT                   /locus_tag="Achl_0182"
FT   CDS_pept        206539..208017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0182"
FT                   /product="Peptidase M1 membrane alanine aminopeptidase"
FT                   /note="PFAM: Peptidase M1 membrane alanine aminopeptidase;
FT                   KEGG: sma:SAV_2764 metallopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38184"
FT                   /db_xref="GOA:B8H925"
FT                   /db_xref="InterPro:IPR001930"
FT                   /db_xref="InterPro:IPR014782"
FT                   /db_xref="InterPro:IPR034019"
FT                   /db_xref="InterPro:IPR042097"
FT                   /db_xref="UniProtKB/TrEMBL:B8H925"
FT                   /inference="protein motif:PFAM:PF01433"
FT                   /protein_id="ACL38184.1"
FT                   /translation="MTNLSKARRIAAAAAALLTAAALGISPAQAAPQSGARYGPGAAGS
FT                   GDSYFPNAGNGGYDVLHYGLDLHYTPPSGAGGAGNLTAEASITLRATQDLDALNFDLRG
FT                   LTVTAVDVDGKDVNRGAGALEWTQVQDDANRRWELTVGLRPKLKEGQKATITISYGGAT
FT                   GRPQDTTGALYGWVTTPDGAIVVNEPDGAPTWFPVNDDPEDKATYSFRITVPEGKTAVA
FT                   NGLPGGDPETQAGWTTWSWEAAGPMASYLATASVGDFTLSYGEGPGGLPIINAVDTGVT
FT                   GSALVTTDAALALQPEMIRYLSDLFGPYPFEAFGAIVDDDSVDYALETQTRPVYSGVAG
FT                   EDTVAHELGHQWFGNSVSPADWKDIWLNEGWATYVEWLWAEHQGKATLAQQFTDTVAEL
FT                   DSKNLWGLDISDPGRDNLFAEQVYRRGAITLHALRARIGDTAFFAGATEWLDRYGNSSA
FT                   TTRDFEKVMEEASGQQLDAFFNDWLREGNRPAMP"
FT   sig_peptide     206539..206631
FT                   /locus_tag="Achl_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 31"
FT   gene            complement(208007..208987)
FT                   /locus_tag="Achl_0183"
FT   CDS_pept        complement(208007..208987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0183"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: art:Arth_0080 transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38185"
FT                   /db_xref="GOA:B8H926"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8H926"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACL38185.1"
FT                   /translation="MVAARAGVSTATVSLVANGKTAGRVSEDNVTRVRDAIAELGYVVD
FT                   GIGSSLAKGVSSIVILVAPDISNPFFAKVIDGVRESLGPQYQLLLSVTEAGEFPQANDV
FT                   RRLMSLRPAGLLVDAPNADFLEDLASPSPLVLLDAPGLESYAPSVNLDVASGARQLAAH
FT                   LAAAGHTEAAYVDSVTGTDTFAVRRAAFLEEAAALGISVSPDRIISTTIDVGTAAAAFA
FT                   AAWPEWQRAGVTAVVCGTDTHGYGVLQEARVAGVRIPEELAVAGFDDLPYSATSNPGLT
FT                   SVHLPATSLGQKAGEQLRRLMEGKFLKPGGVTLETSLVVRGSTTA"
FT   gene            complement(209081..209284)
FT                   /locus_tag="Achl_0184"
FT   CDS_pept        complement(209081..209284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0184"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38186"
FT                   /db_xref="GOA:B8H927"
FT                   /db_xref="UniProtKB/TrEMBL:B8H927"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38186.1"
FT                   /translation="MDNTKRATLIWSLGAVVFSLIGVYIALTANGVWYSIVSAAILLLA
FT                   GCAFASRAILTSRGQARSGRGS"
FT   sig_peptide     complement(209189..209284)
FT                   /locus_tag="Achl_0184"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.891) with cleavage site probability 0.704 at
FT                   residue 32"
FT   gene            209573..210640
FT                   /locus_tag="Achl_0185"
FT   CDS_pept        209573..210640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0185"
FT                   /product="Purine nucleosidase"
FT                   /EC_number="3.2.2.1"
FT                   /note="PFAM: Inosine/uridine-preferring nucleoside
FT                   hydrolase; KEGG: art:Arth_0081 purine nucleosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38187"
FT                   /db_xref="GOA:B8H928"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR015910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B8H928"
FT                   /inference="protein motif:PRIAM:3.2.2.1"
FT                   /protein_id="ACL38187.1"
FT                   /translation="MEPTFQNPEPVQGIERRKIILDCDPGHDDAVALLLAHGNPNIDLL
FT                   AVTTVVGNQTLEKVTRNALAVGTIAGITGVPFAAGCDRPLVRSIETAPDIHGESGMDGP
FT                   ALPESTIELDPRHAVDLIIETVMAHEPGTVTLVPTAGLTNIAMAARKEPRIVERVKEVV
FT                   LMGGGYHVGNWSAVAEFNIIIDPEAAHIVFNEKWPVVMVGLDLTHQALATPEVVEKIAA
FT                   IGTGPAKFVTELMDFFAHTYKDAQGFDYPPVHDPCAVAYVIDPSIVSTRKVPVNIELQG
FT                   TLTLGMTVADFRAPAPADCHTSVAVDLDHARFWDLVTDALVRIGEPGAGDLHSAGNASD
FT                   VVPSESAQLTAGGVK"
FT   gene            210641..212068
FT                   /locus_tag="Achl_0186"
FT   CDS_pept        210641..212068
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0186"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   art:Arth_0082 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38188"
FT                   /db_xref="GOA:B8H929"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H929"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38188.1"
FT                   /translation="MTTTLTETKTGRGNIAALMTALLAACVAFQLNASMLSPALVTMGE
FT                   ELKADQAVIGLSQTWFFTAAALFSLFLPRLSDIVGRKKVLVGMMVLMAVGSVIAALAPD
FT                   ITWLFVGRIIQGVSGPTVPLCLIMLRSAVSNPRKYGTLMGLITAVNGGVAGVDSFVGGY
FT                   FAEHFGFRSIFWLMVVLAVAATALIMFLAAESKPAAGTRMDWLGVSFIVVAVGALLTAL
FT                   NQGSKLVGGFNSGTLILSLALVAVSAVAFFAFWRTEQRAAQPMVETVHLRQRATWAPLL
FT                   TTTLTMTGIFAVINGIVPAYVQAADPGFGVGPTEMSLIILTPYALLGWVVGPLSGKLAP
FT                   VLGYTKVLRIGLLGSIAALAVIGFLGLHSLPMMIAGTVLLGIMYAGTVNIMLNGLGVVL
FT                   SPAGNPGFLPGMNAGAFNLGAGLSFLILPAVLVATASLGDATASYLTVVVVGLALTVAA
FT                   FAASLLIPKPVEAEVAA"
FT   sig_peptide     210641..210742
FT                   /locus_tag="Achl_0186"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.977 at
FT                   residue 34"
FT   gene            212065..213048
FT                   /locus_tag="Achl_0187"
FT   CDS_pept        212065..213048
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0187"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: art:Arth_0083 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38189"
FT                   /db_xref="GOA:B8H930"
FT                   /db_xref="InterPro:IPR002139"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011877"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8H930"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACL38189.1"
FT                   /translation="MSTAAGPADSTGTGRIVVVGSLNADLTIYCERLPQPGETVHGNGF
FT                   AVNPGGKSANQAVAAGRLGGRVSLVGAVGDDPNGHMLLSSVAGAGVDVGLVRSSSEPTG
FT                   VAVISVDAAGENNIIISAGANGTLSPADVAGAADVLDGAAVVSLCLEVAMPTVLAAAQA
FT                   GHDAGAKVLLNLSPYAHIPRELAGLVDVLLVNAHEAALFLGPGASVPGADAHAAQWDAV
FT                   RERFAERGIRQVLVTLGAHGSVVLDSDAPAGRAVVFVAPTKVDAVDTTGAGDAFTGAVA
FT                   VRLAAGDALADAAAFASVAAALATTRKGTQAAYPETADVERRLRKS"
FT   gene            complement(213161..214084)
FT                   /locus_tag="Achl_0188"
FT   CDS_pept        complement(213161..214084)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0188"
FT                   /product="Auxin Efflux Carrier"
FT                   /note="PFAM: Auxin Efflux Carrier; KEGG: aau:AAur_4066
FT                   putative integral membrane permease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38190"
FT                   /db_xref="GOA:B8H931"
FT                   /db_xref="InterPro:IPR004776"
FT                   /db_xref="UniProtKB/TrEMBL:B8H931"
FT                   /inference="protein motif:PFAM:PF03547"
FT                   /protein_id="ACL38190.1"
FT                   /translation="MDGVLKGFFVVGVVMLVGYVLGKTNSLGPQGTKVLSSLTFLVGLP
FT                   SLMFSMIATRHISEVLSETGLISVVTAVAMMAVFALVGVIARWGVRRTTIGALATGIVN
FT                   STNLGVPLSQYVMGSATYVTPIMLFQLAVITPIALTILDLTNPDGTKPSLRRILATPFR
FT                   NPVTVAAILGIIVSAAGIEIPELVLDPLKLIAQVTVPLMLIIFGMSLHGLSPRASSSES
FT                   APTFLAVVLKSAIQPALAWILARYVFQLDDFNTFVVTACAILPTGQNVVLYAVRYRVGQ
FT                   SLAQTTAVITSALAVPLLLGAAWLLN"
FT   gene            complement(214122..214703)
FT                   /locus_tag="Achl_0189"
FT   CDS_pept        complement(214122..214703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0189"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="KEGG: sco:SCO5942 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38191"
FT                   /db_xref="UniProtKB/TrEMBL:B8H932"
FT                   /inference="similar to AA sequence:KEGG:SCO5942"
FT                   /protein_id="ACL38191.1"
FT                   /translation="MPMSFISSTSRTAPSILTPLTPLLWQRTIPAVAERAGPSLATAYR
FT                   YLLTLDELRRKFMLGVIDGLYESTKNLKSNGLELLEDTMAEWIKVVAEDGPAMVLVRSR
FT                   EGFLCRLQQGEPNVRAFEKVWGPPIRQLLDKAGIDWTQFPYAIGVFNAMFNSREIMDLK
FT                   AVTGLNDEKLVTGCSRLYWAALQGLCDTND"
FT   gene            215088..216533
FT                   /locus_tag="Achl_0190"
FT   CDS_pept        215088..216533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0190"
FT                   /product="Gluconate transporter"
FT                   /note="PFAM: Gluconate transporter; Citrate transporter;
FT                   TRAP C4-dicarboxylate transport system permease DctM
FT                   subunit; KEGG: aau:AAur_4146 putative gluconate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38192"
FT                   /db_xref="GOA:B8H933"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B8H933"
FT                   /inference="protein motif:PFAM:PF02447"
FT                   /protein_id="ACL38192.1"
FT                   /translation="MSDVAVLTNTAVAVLAAVVLIVRFRVNPVIALVIGSVYLGLAVGL
FT                   GVEKTVETITAGFGEIMVDVGLLIAFGVLMGSILNQSGAIRRLVEHLLNTFGPKRLPYT
FT                   MGLAIGTVLQSIFLDVLLVISAPLARKLAPRIGKLGTARMATAMAIALECGIVFTVPGV
FT                   ASLALAGLLNVPLGKMLLFGLLLVIPTIIISIAIMTFLFRRGFWNEAKDEDHTFVAEED
FT                   REGEPDDEEAAPAAGTGGTAPTRNSGSEGTDRQSSTVALAKRGQKEFPLLLLFAPLLTS
FT                   LLLIGAGAILQILEIEMPWLQLLGEPVIALLIGLIGTALVTRAAIGQSRVEEAITIGFK
FT                   ESGQILILTGVGGSLAATVAAAGLGDILGGFFSASTVAPLLVVWAIAAVLHIAVGSVTL
FT                   SAITAAGLLAPIAPAIGLDPVLLALAAGAGSLFMVHVTSNTFWLLQSLLGQSVRGALKS
FT                   VSVGVSVASVVAILLILPMSLLF"
FT   gene            216582..217832
FT                   /locus_tag="Achl_0191"
FT   CDS_pept        216582..217832
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0191"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: aau:AAur_4147 CaiB/BaiF family acyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38193"
FT                   /db_xref="GOA:B8H934"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B8H934"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACL38193.1"
FT                   /translation="MTEPRIAPLAGVRVLELGNYIAAPTAGRLLADFGAEVIKVERPGT
FT                   GDELRNWRLHKGDTSMLYRTINRNKKSVVLDLRTEAGKEAVLALAAESDILLENFRPGT
FT                   LEKWGLGPEVLNEANPELVITRISAFGQTGPLSERPGFAAVAEAYGGFRNLVGDPDRAP
FT                   VRVGVSIGDSIAGLYAAFGSMMSLFQREARRRDAAGAAPLTERIIDVALNEAMFSMMES
FT                   LIPDYQAYGVDRQRVGGRMEGIAPSNAYVCKDGASIVVAGNGDSIYQRYMQTIGRPDLA
FT                   TDPSLQTNAERWARREELDQAIGEWARKHSAADALAALDADGVPAGPIYTAADISEDSQ
FT                   YAARNMIQKFDVSTGEEIIPGVGFPGIVPVIGDQSLPIRNLGPDLGENTDEILGGLLKM
FT                   DPAKISAASGRQEAMQA"
FT   gene            217829..218809
FT                   /locus_tag="Achl_0192"
FT   CDS_pept        217829..218809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0192"
FT                   /product="pyruvate carboxyltransferase"
FT                   /note="PFAM: pyruvate carboxyltransferase; KEGG:
FT                   aau:AAur_4148 putative hydroxymethylglutaryl-CoA lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38194"
FT                   /db_xref="GOA:B8H935"
FT                   /db_xref="InterPro:IPR000891"
FT                   /db_xref="InterPro:IPR002034"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8H935"
FT                   /inference="protein motif:PFAM:PF00682"
FT                   /protein_id="ACL38194.1"
FT                   /translation="MNNNLTAMLAKTILRDVTLRDGLQLTGKVLSTERKVETVRELIRL
FT                   GVPAIELGSMARADLVPTMANTLEVVQALTPEELEKCWIWVATPGHVAKASAAGARNFQ
FT                   YCLSASDSHNKANIGRTTEESLAALPEAVTYTQSVNGQIQLCIATSFTCPFEGYVPEER
FT                   ILSIANDPRAEGTTDIVLCDTLGQAIPTQVAGLINRVREESPARRIVYHGHDTWGLGVA
FT                   NTLAAIQAGAAMVDGALGGLGGCPFAPGASGNTSTEDILFATRPEWLTTEVFADLVVLS
FT                   EKLLAELGEPNRSKAAQGARSKAPAFEWVLPAGSTAPVPCSTGGN"
FT   gene            218812..219801
FT                   /locus_tag="Achl_0193"
FT   CDS_pept        218812..219801
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0193"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: aau:AAur_4149 glyoxylate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38195"
FT                   /db_xref="GOA:B8H936"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H936"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL38195.1"
FT                   /translation="MGHRFLVTTAIPDPGFQLLSDAGEVTVLPEPPDYETLAAFCASGD
FT                   FDAVLTQLRDVVDAPLLAGARVKGISNYAVGYNNIDIDAATRHGILVGNTPGVLTDATA
FT                   DIAMLLILGAARRVVEADRLVRDGKFHGWEPELLLGRDVSGAVLGVAGFGRIARATARR
FT                   ALGFGMQVIFSPRPPGDRPVSEDELGEFAGKVQQVAWSELIERSDFLSLHVPLNEDTRH
FT                   LVDAQILGRMKPDAILINTARGPVVDEAALVDALRSGVIAGAGLDVFEDEPKLAAGLAE
FT                   LPNTVLLPHVGSATVRVRSEMARLSALNAIAIAEGRLPLHPVNPQALA"
FT   gene            219798..220769
FT                   /locus_tag="Achl_0194"
FT   CDS_pept        219798..220769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0194"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="PFAM: glycerate kinase; KEGG: aau:AAur_4150 putative
FT                   glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38196"
FT                   /db_xref="GOA:B8H937"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B8H937"
FT                   /inference="protein motif:PRIAM:2.7.1.31"
FT                   /protein_id="ACL38196.1"
FT                   /translation="MTVLVAPDSFKGTYSAAEVAAAISEGINDGGGCAVQLPVADGGEG
FT                   TFDALCRSLQAAAVSVDVVNSWGEPLRAVIGLTKDGNAVVEVAQAGGLTAGRITPHDAV
FT                   AASTYGTGMMIVAAVALGAKHIFVAAGGSATTDGGAGAVQAIIDGGGLHGARITVLTDV
FT                   TTSFLDAPRVFGPQKGADPAAVEALEERLAALAASSPRNPAGVPRTGAAGGLSGGLWAY
FT                   FEAELVSGADAVLDAAGFDSCLASADAVVVGEGRLDSQTGEGKIISAILERVQSSGRKT
FT                   PVIAVVGSLAEDLGDYAENFAAILLATDATAMRAAGREIARG"
FT   gene            complement(220791..221624)
FT                   /locus_tag="Achl_0195"
FT   CDS_pept        complement(220791..221624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0195"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: aau:AAur_4157 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38197"
FT                   /db_xref="GOA:B8H938"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H938"
FT                   /inference="protein motif:PFAM:PF01614"
FT                   /protein_id="ACL38197.1"
FT                   /translation="MGKWLQMRPASSVSSMASDAAAKSSGNPLLVLGKITSILDSFSLS
FT                   KPVQSLSDIRESTRMPTSTVQRLVTNLVSQGFLDREEDSYRIGMRMAYWAAPATRGMEV
FT                   VDILSPLLKTLRDTTGETACFFKSEQHYRVCVAMAETRHALRREMHLGKIAPLHAGSAG
FT                   RVLLAWDPELMEAVLRDPLASITESTITTSEELAVAVKQTLRDGFAITVGEREDGASGL
FT                   SAPVFDSAAGLVGAVTISGPTLRMPLETCQEWVEPLLTTAEHMTRLIGGRFPGES"
FT   sig_peptide     complement(221556..221624)
FT                   /locus_tag="Achl_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.721) with cleavage site probability 0.496 at
FT                   residue 23"
FT   gene            complement(221699..222424)
FT                   /locus_tag="Achl_0196"
FT   CDS_pept        complement(221699..222424)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0196"
FT                   /product="Formiminotransferase-cyclodeaminase"
FT                   /note="PFAM: Formiminotransferase-cyclodeaminase; KEGG:
FT                   aau:AAur_0982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38198"
FT                   /db_xref="GOA:B8H939"
FT                   /db_xref="InterPro:IPR007044"
FT                   /db_xref="InterPro:IPR036178"
FT                   /db_xref="UniProtKB/TrEMBL:B8H939"
FT                   /inference="protein motif:PFAM:PF04961"
FT                   /protein_id="ACL38198.1"
FT                   /translation="MLRVTPFRLGEADYGHAPHMEEPEVTTQQSTVEDWTRALAESTGS
FT                   PGGGAGTGVMLAVAASLTSMVAGYTEPAADQQQAVDGIRDRARDLRRRALQLADEDATA
FT                   SRAFGAAFRLEKGPERDEAIRHASVAAAKASAVLGARAIDAIEDLAWLAHGGNKALVAD
FT                   VVVAFGALRAAVAGARTNVSFDLASLRSAGTTLEEVREQHPDLWSSVERLSGALERIDG
FT                   LAAAIDDRAAPTETVPTSK"
FT   gene            222667..223404
FT                   /locus_tag="Achl_0197"
FT   CDS_pept        222667..223404
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0197"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38199"
FT                   /db_xref="GOA:B8H940"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8H940"
FT                   /inference="similar to AA sequence:KEGG:AAur_0060"
FT                   /protein_id="ACL38199.1"
FT                   /translation="MVVVIHGGYWRSKYGAELGEPLARDLAEHGIAAWNLEYRRAGNGG
FT                   GWPGTFDDISAGIDHLAALAEPHALDLRSVVALGHSAGGHLAVWAAGREKVAEAGPGDR
FT                   DSLRGGGGVRLTGVVSQSGVLDLAGAERLNLSNGAVANLLGGPSSEFPVRHRLASPMAA
FT                   LPLDVPVYAVHAEADQDVPPEMSMAYVDATRGSVVPAHFVSVPGDHFALIDISSPAYLA
FT                   CRHLVCELLRDTEFGAARFSGRV"
FT   gene            223407..224339
FT                   /locus_tag="Achl_0198"
FT   CDS_pept        223407..224339
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0198"
FT                   /product="PfkB domain protein"
FT                   /note="PFAM: PfkB domain protein; KEGG: art:Arth_0109 PfkB
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38200"
FT                   /db_xref="GOA:B8H941"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8H941"
FT                   /inference="protein motif:PFAM:PF00294"
FT                   /protein_id="ACL38200.1"
FT                   /translation="MLTVIGEGLVDVVQRASGIEAHVGGSPLNVAVGLARLDHPVQFIG
FT                   RYGRDAYGDSVAAHLRASSVMLPLGPDELPTSVATALIDDDGAATYTFDLTWELPGIAD
FT                   RLGFMLQGTTLLHTGSIAAMLAPGATEVLAAVEYAHPHATISYDPNCRPSIIADVDYAR
FT                   RHAEKFVSLADVVKASDEDLAWLYPGQDVLESARRWLALGGSEGPAMVVVTRGGEGPWG
FT                   ITAAGEAAVAAPRVEVADTVGAGDSFMAALLSGLVDRGLDGAQNRKDLRELPAEALAEL
FT                   LAHAARAAAVTVSRPGANPPTRAEMNALP"
FT   gene            224439..224936
FT                   /locus_tag="Achl_0199"
FT   CDS_pept        224439..224936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0199"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG:
FT                   aau:AAur_pTC20243 MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38201"
FT                   /db_xref="GOA:B8H942"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H942"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACL38201.1"
FT                   /translation="MAPLGGSVRASTLEAAKRIDASDVLDALSEYRAAETAMLRRTRPI
FT                   MDRGANDVLALRYVREATLRGPGMRPTELAALLGLSSASITALIDRLVAGGVVVREPHP
FT                   SDRRASILRSTGLSEAAEVQALDDARRPIADLIESLDHDELETVLGFLVRMRRAMDEVA
FT                   RD"
FT   gene            225020..225454
FT                   /locus_tag="Achl_0200"
FT   CDS_pept        225020..225454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0200"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_3930 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38202"
FT                   /db_xref="UniProtKB/TrEMBL:B8H943"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38202.1"
FT                   /translation="MTAVAEPQSRNRDHLADVVALPLPESYGFNADPAEATEASTESGG
FT                   WMKAVALASAKLEQLQWELDAAEEDLCAALRGASASSVSAAALARAAGLSPEELDEYLR
FT                   RPALTDAPALPDGLGLPATAAMAPLAGPAHLPSLGLQAEA"
FT   gene            complement(225496..225717)
FT                   /pseudo
FT                   /locus_tag="Achl_0201"
FT   gene            complement(225730..225987)
FT                   /locus_tag="Achl_0202"
FT   CDS_pept        complement(225730..225987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0202"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   aau:AAur_pTC10237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38203"
FT                   /db_xref="GOA:B8H944"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H944"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACL38203.1"
FT                   /translation="MELNPTELTPVINRLKRAQGQLAAVTRMLEEGRDCKDVVTQLAAV
FT                   SKALDRAGFAIIATGLEQCIVQKDETMDRKELEKLFLSLA"
FT   gene            226111..226725
FT                   /locus_tag="Achl_0203"
FT   CDS_pept        226111..226725
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0203"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   aau:AAur_pTC10236 rhodanese-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38204"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR021309"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8H945"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACL38204.1"
FT                   /translation="MTSPSAAAVTALAPETLRSWITEHQDLVVIDVRSAAEFESMHIRG
FT                   SYNVPLPLLAEHTDELAARLGSRVVLVCQSGIRAEQARQRLAKSGIETAYVLTGGAPGY
FT                   AGAGGDVVKGKDRWDLERQVRLVAGSLVVLGLAGGKFVSPKIRTLAGVIGTGLTFSAAT
FT                   NTCAMGKAISAMPWNKAAKEPTRESAILGLPVSNKSTEAAA"
FT   gene            226725..227636
FT                   /locus_tag="Achl_0204"
FT   CDS_pept        226725..227636
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0204"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   aau:AAur_pTC10235 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38205"
FT                   /db_xref="GOA:B8H946"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B8H946"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACL38205.1"
FT                   /translation="MSLTLLLVLALSVVIGLSLGVLGGGGSILTVPILVYVAGFEAKEA
FT                   IAASLFVVGVTSAVSVISHARGGRVMWRTGLIFGAAGMAGAFVGGLLGGHIPGQILLIA
FT                   FAVMMVATSVAMLRGRKKKNDGAAEPVKHELPLGRVLLDGVVVGLVTGLVGAGGGFLVV
FT                   PALALLGGLPMSVAVGTSLVVIAMKSFAGLAGYLTTVQLDWGITLGVTAAAIVGSLIGS
FT                   KLAGKIPEAALRKSFGWFVLAMGTFVLIQQAPPGLQWPIAAGVAALTAATAATAGICWF
FT                   FIGSCPLRNRSGRRSSDIPSPA"
FT   sig_peptide     226725..226796
FT                   /locus_tag="Achl_0204"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.932 at
FT                   residue 24"
FT   gene            227658..227999
FT                   /locus_tag="Achl_0205"
FT   CDS_pept        227658..227999
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0205"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   aau:AAur_pTC10234 rhodanese-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38206"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8H947"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACL38206.1"
FT                   /translation="MGLISSLKKAFGKPYKTISVAGAKRLLSSGAALIDVRSAQEWRSG
FT                   RALQAKHIPLDRLQASTTGINKTRPVITVCASGIRSASAARALAEQGFEAYSVRGGMAA
FT                   WRQAGEPVR"
FT   gene            228049..228345
FT                   /locus_tag="Achl_0206"
FT   CDS_pept        228049..228345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0206"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG:
FT                   aau:AAur_pTC10233 rhodanese-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38207"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8H948"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACL38207.1"
FT                   /translation="MAEITITETDQRRATDNVLDVREDFEVAEGMIPGALHIPMGQLQA
FT                   RLGELDPAVPVIAVCRSGNRSAAVADALSGAGYKADTMAGGMTAWARAGLPTT"
FT   gene            228415..228777
FT                   /locus_tag="Achl_0207"
FT   CDS_pept        228415..228777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0207"
FT                   /product="thioredoxin"
FT                   /note="TIGRFAM: thioredoxin; PFAM: Thioredoxin domain;
FT                   KEGG: aau:AAur_pTC10232 thioredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38208"
FT                   /db_xref="GOA:B8H949"
FT                   /db_xref="InterPro:IPR005746"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8H949"
FT                   /inference="protein motif:TFAM:TIGR01068"
FT                   /protein_id="ACL38208.1"
FT                   /translation="MATIDITEHTFAQTLEGSDIVFVDFWAAWCGPCRMFAPTYGAAAE
FT                   RHPDITFAKVDTEAERGLAAAANITSIPTLMAFKDKTLVFSQPGALNATGLEEVIQAVK
FT                   ALDMDKASDDAGIQHA"
FT   gene            228960..230372
FT                   /locus_tag="Achl_0208"
FT   CDS_pept        228960..230372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0208"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; Rhodanese
FT                   domain protein; KEGG: aau:AAur_pTC10230
FT                   metallo-beta-lactamase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38209"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8H950"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL38209.1"
FT                   /translation="MLIERIYDEDLAQASYLIGCQAKGEAIVVDGRRDIAVYQDLAAKN
FT                   GMKIVAVTETHIHADYLSGTRELAAATGAKVYVSGEGGPDWQYEFDGERLYDGDAITLG
FT                   NITIKALHTPGHTPEHLSFLVTDGAFSDQPGYLLSGDFVFSGDLGRPDLLDEAAGGIDT
FT                   RFEGAKQLFASLRDKFLTLPDYVQVHPAHGAGSACGKALGAIPSSTVGYERLYAWWGPY
FT                   LAANDEQGFIDELLDGQPDAHAYFGRMKRENREGPAVMGERTPLPELSTGIVAAGLDED
FT                   TLTFIDTRSNSEVHEGTVVRSLNVPAGKSVASYGAWVVNPETDKNPLVLLASGQDQAMD
FT                   MWDHLVRVGIDNVAGYVTGIEELPTFTPKLIQPEELDGFDAAMVLDVRNKTEHTAGHIP
FT                   GSYQLSGGRVMWHLDELPANGTIVTYCQSGVRNSVAASALRRAGYDIVELDGSYAAWSM
FT                   WRQSRPNAVAAH"
FT   gene            230548..231837
FT                   /locus_tag="Achl_0209"
FT   CDS_pept        230548..231837
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0209"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   art:Arth_3829 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38210"
FT                   /db_xref="GOA:B8H951"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H951"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38210.1"
FT                   /translation="MPGSTRPENPAATRRPVLGLRQNLAQFMLLVAVNALVGGTLGQER
FT                   TVLPLLATEAFHLDLYTGALTYILAFGLSKAAMNYFAGTLSDKYGRKPVLVAGWLAALP
FT                   VPAMLILAPSWGWIVTANVLLGISQGLTWSTAVIMKMDLVGPRQRGLAMGFNEAAGYLG
FT                   VAATALATGYLATTYGLRPAPFLLGAAYIALGLGLTVLAVRETHHHAFAEASGTPAAPG
FT                   AAGAGLSTGQVFTLTSFRDRSLSAASQAGLVNNLNDGLAWGLFPVLFAGAGLGVGQIGI
FT                   IAAAYPAVWGAAQLVTGAASDRWGRKWFIAAGMLVQAAALAMVAAGSTFEAWLGAAVVL
FT                   GIGTAMVYPTLLASIGDVAHPAWRARAVGIYRLWRDAGFAAGALLAGLIADLYGIPVAV
FT                   AAVAGITAVSGIVVAVRMRGGDHRPAAALP"
FT   gene            complement(231840..232319)
FT                   /locus_tag="Achl_0210"
FT   CDS_pept        complement(231840..232319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0688 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38211"
FT                   /db_xref="GOA:B8H952"
FT                   /db_xref="UniProtKB/TrEMBL:B8H952"
FT                   /inference="similar to AA sequence:KEGG:Arth_0688"
FT                   /protein_id="ACL38211.1"
FT                   /translation="MMEIGGLPAHILLVHGVVVLAPLAGLMAVVFALWRRSRSYLAWPL
FT                   GVLAVVLVPLSVLTPEAGEQLEKAKPASDLVREHAEQGSFFRYVTVVFLLVAAAQILAA
FT                   FPSAVSRWQALRGAGRLLAARWLVPATSVLGVIAGLFLVYEAVVTGHSGSASVWS"
FT   gene            complement(232370..233092)
FT                   /locus_tag="Achl_0211"
FT   CDS_pept        complement(232370..233092)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0211"
FT                   /product="protein of unknown function DUF125 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF125
FT                   transmembrane; KEGG: art:Arth_1411 protein of unknown
FT                   function DUF125, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38212"
FT                   /db_xref="GOA:B8H953"
FT                   /db_xref="InterPro:IPR008217"
FT                   /db_xref="UniProtKB/TrEMBL:B8H953"
FT                   /inference="protein motif:PFAM:PF01988"
FT                   /protein_id="ACL38212.1"
FT                   /translation="MTELLKQHPNEPHDDSIAARLNWLRAGVLGANDGIVSVAATVVGV
FT                   AGVTNDVTPILIAGAAAVVGGAVSMALGEYVSVSSQSDSQRALIEKERQELHDDPDGEL
FT                   EELAAIYQAKGLTEATARTVAAELTEHDALGAHLEAELKIDEASVASAWHAAFASAIAF
FT                   TIGAVLPLLAILLPPAEIRVPLTFVAVVVALAITGTVSARIGGSSKRKATLRLVIGGAL
FT                   AMAFTYGVGLLLGTTGIA"
FT   gene            complement(233174..234124)
FT                   /locus_tag="Achl_0212"
FT   CDS_pept        complement(233174..234124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0212"
FT                   /product="peptidase metallopeptidase"
FT                   /note="SMART: peptidase metallopeptidase; KEGG:
FT                   aau:AAur_1049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38213"
FT                   /db_xref="GOA:B8H954"
FT                   /db_xref="InterPro:IPR001818"
FT                   /db_xref="InterPro:IPR006026"
FT                   /db_xref="InterPro:IPR024079"
FT                   /db_xref="UniProtKB/TrEMBL:B8H954"
FT                   /inference="protein motif:SMART:SM00235"
FT                   /protein_id="ACL38213.1"
FT                   /translation="MPKVRRSPSGRIPQWAIDEAFGRQAQQAPWRAPEPAPHNAGRPAF
FT                   GRAPRPHGPRKRRLLPALGVALVICLYFTPSFLSRVVLPFAAPYLPGATVPPPGYEAAS
FT                   SPLGTPPASTGSTAFVLQESPDPGQRFAAYDPCRPVHYVVRPDFAVPGGDALIRDAVAA
FT                   TSAATGLQFVYDGTSTEAPADEREAFQPDRYGKRWAPILITWSTPQESPGLAGDIAGDG
FT                   GSTFIQAPGQPMVLAAGQIRLDAPDLAGILASRPDGTEQVRAIIMHELGHVVGLDHVSD
FT                   PAQLMHADNVGVVDFAAGDRAGLALLGSGPCVPQL"
FT   gene            complement(234347..235528)
FT                   /locus_tag="Achl_0213"
FT   CDS_pept        complement(234347..235528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0213"
FT                   /product="aliphatic sulfonates family ABC transporter,
FT                   periplsmic ligand-binding protein"
FT                   /note="TIGRFAM: aliphatic sulfonates family ABC
FT                   transporter, periplsmic ligand-binding protein; KEGG:
FT                   art:Arth_3780 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38214"
FT                   /db_xref="GOA:B8H955"
FT                   /db_xref="InterPro:IPR010068"
FT                   /db_xref="UniProtKB/TrEMBL:B8H955"
FT                   /inference="protein motif:TFAM:TIGR01728"
FT                   /protein_id="ACL38214.1"
FT                   /translation="MAEPQDKSPQNPGNSTRIVAGQAAPKRPLGLKIGIAAAVLALVGG
FT                   GAAVASAVNANNASTAPTAEAAPAGNPAAELKLGYFGNVTHAPALVGVSKGFIKDELGD
FT                   TKLSTQVFNAGPAAIEALNAGAIDATYIGPNPAINSFVKSQGESINIIAGAAAGGAQLV
FT                   VKPEINSAADLRGKTLASPQLGGTQDVALRAWLTAQGYKTNVDGSGDVAINPTENAQTL
FT                   KLFQDGKLDGAWLPEPWASRLVLTAGAKVLVDEKDLWDGSLSGKPGEFPTTILIVNQKF
FT                   AADHPDTVKALLKGHAKSVEWLNGAAAGEKATVINAALKEAAGAELKADVIDRSLKNIV
FT                   FTVDPLAGTYQKLLADGVTAGTTKQADINGIFDLRALNEVTGEKTSAANLGKE"
FT   gene            complement(235708..236478)
FT                   /locus_tag="Achl_0214"
FT   CDS_pept        complement(235708..236478)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0214"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   art:Arth_2452 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38215"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H956"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38215.1"
FT                   /translation="MNPLFDLAGRTALVTGSSRGIGNALARALAEAGATVVLNGVNAER
FT                   LDAAEASMAADFAAGRIRSCAFDVTRDADAGRGVAWVEENVGPLDILVNNAGIQHRVPM
FT                   LDLDVEDWERVISTDLTSAFLVGRAAARAMVPRGRGKIINICSVQADLARPTIAPYVAA
FT                   KGGLRNLTRAMTAEWASSGLQINAIAPGYIHTEMTQNLVDDEQFNSWILGRTPARRWGT
FT                   PQDLAGPVVWLASDGSGFVNGQTIFIDGGMTVVV"
FT   gene            complement(236475..237386)
FT                   /locus_tag="Achl_0215"
FT   CDS_pept        complement(236475..237386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0215"
FT                   /product="2-hydroxy-3-oxopropionate reductase"
FT                   /EC_number="1.1.1.60"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: aau:AAur_2423 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38216"
FT                   /db_xref="GOA:B8H957"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H957"
FT                   /inference="protein motif:PRIAM:1.1.1.60"
FT                   /protein_id="ACL38216.1"
FT                   /translation="MTHGSVGFVGLGLMGAPMAANLAKAGWQVRAWNRSPAAVRDLELL
FT                   GGTGVEHVADLRGEPVIIFMLPDLPFIEESAAGLLAEWRKAPPAPGTLVVVMSSVSPVG
FT                   VQAFGLAVADASGGNASVLDAPVSGGTDGARRGTLAIMAGGSEAGFARALPVLESMGTA
FT                   VRRLGGLGAGSLAKACNQLVVGTTTAALAEAAELAERSGLDVHALFEVLSGGLAGSRVL
FT                   DQVGPRLAAKDYTPTGPAKFMRKDLSFVLESAGSAGTATPMASAGIALYTELVAQGLGD
FT                   QDLAVVRQAIANLGVPAGEATR"
FT   sig_peptide     complement(237327..237386)
FT                   /locus_tag="Achl_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.989) with cleavage site probability 0.680 at
FT                   residue 20"
FT   gene            complement(237383..238732)
FT                   /locus_tag="Achl_0216"
FT   CDS_pept        complement(237383..238732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0216"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: art:Arth_2458 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38217"
FT                   /db_xref="GOA:B8H958"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H958"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38217.1"
FT                   /translation="MTTRTKTPQTEADGAVVDPEQLRRATLASSVGSALEYYDFYIYGL
FT                   ASALIFGPLFFAPLGDSGAVIASFATYGVGFAARPFGGVVFGYIGDRFGRKMVLILTIG
FT                   LMGMASFAIGLLPTFEQAGMLGAVLLVALRILQGLGAGAEQAGATTLISEVAPRRRRGF
FT                   FASLPFVGIQLGTLLGAGTFALMALADKEVLQGWLWRVPFLASVILIVIAVFIRLKLKE
FT                   TPVFQELEKHKAVVKNPVGQIWKHSKKNVLVGIGLRMGENGNSSIYSALLVSFISMPAG
FT                   VFAGDKFIGPTGLLIAAGFAAVLVVTFGALSDRFGRVPVYRYGALFQAVIALPAFYLVT
FT                   LGNVTLVWVVMVVGIAIGVQSMLGPQCALLPELFGSQHRFTGVALSRELSAVLAGGFAP
FT                   MIGVALLAATNHSWLVPALYSLVLAGISFATTFFTPETNGRDLVVVEDAK"
FT   gene            complement(238912..239709)
FT                   /locus_tag="Achl_0217"
FT   CDS_pept        complement(238912..239709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0217"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: art:Arth_2459 transcriptional
FT                   regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38218"
FT                   /db_xref="GOA:B8H959"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H959"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL38218.1"
FT                   /translation="MADSRTPASPDKSGAASPAPAVTRAAAVLDALAASATGRLTLSDL
FT                   SREVGIPKSSTSNLLLALEEARLITRQGAEFTLGRKLVELGAAYLGRMDEVQEFYRYCE
FT                   QASVLSGETVRIAMLDGTSVIYLARYEGHPAVRLTSNIGDKMPVSLCAVGKALIARLNV
FT                   HDIEEMFPDDAELPVLTPKSLRTGAELKSQLREIREQGYAFEDEESTTGVVCLAVSVPT
FT                   RGAHGPSLGLSVTALKATYTPEQGSQMVKELKELAHSLGNPMG"
FT   gene            complement(239804..240541)
FT                   /locus_tag="Achl_0218"
FT   CDS_pept        complement(239804..240541)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0218"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   art:Arth_2555 fumarylacetoacetate (FAA) hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38219"
FT                   /db_xref="GOA:B8H960"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8H960"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL38219.1"
FT                   /translation="MRIARIKTASGALHAVERAGAWDHIIDPFEAPLRFTGGTTPAGEA
FT                   EFLAPVAPAVVVGIGHNLTLNDHPLPIQAWHKSVHTVAAPGDQIVAARGRGTVNAEGEL
FT                   AVVIGKQAAGLTAENALDHVLGYTCVNDVTNVDQNAVDERNFQGKAGVNYTPLGPWIET
FT                   ALPDPERAGIDVHINGVPRANSGTFNLPSTVVDCLVYVTSWLTLEPGDVVMTGAPGTAV
FT                   PVEPGDRVDIVVEGVGTLTSTVC"
FT   gene            complement(240561..241643)
FT                   /locus_tag="Achl_0219"
FT   CDS_pept        complement(240561..241643)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0219"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: art:Arth_2454 D-isomer specific
FT                   2-hydroxyacid dehydrogenase, NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38220"
FT                   /db_xref="GOA:B8H961"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H961"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL38220.1"
FT                   /translation="MLANRQYSEQMTSPKTVAIAVPLEAELVDQIRAIDPSVTVLYEPS
FT                   LLPPERFPADHAGDPAFQRTAEQEERYWAMLGRAEVLYGFPNESPEGLARIARDNPALE
FT                   WVHAMAAGAGGAVKASGLGQDVLQKFRITTSAGVHALPLAEFAALGILNGFKRSAELAQ
FT                   DQAAKTWPDLRVPTRLVNGSNLVVSGLGEIGLETARIARALGMNVSGTKRTIEPIEGIG
FT                   RVTDNAGLSALLATADAVVNTLPGTAYTEKLFNRELFAAMKPGTTFVNVGRGTVVDEEA
FT                   LLEALDNGQVGYACLDVFAVEPLPQDSPLWNHPRVMVSPHTSALSAAENRLITERFCSN
FT                   LRTFLDGGDLPHLVDTVHFY"
FT   gene            complement(241682..242992)
FT                   /locus_tag="Achl_0220"
FT   CDS_pept        complement(241682..242992)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0220"
FT                   /product="DNA-directed DNA polymerase"
FT                   /EC_number="2.7.7.7"
FT                   /note="PFAM: UMUC domain protein DNA-repair protein; KEGG:
FT                   art:Arth_3841 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38221"
FT                   /db_xref="GOA:B8H962"
FT                   /db_xref="InterPro:IPR001126"
FT                   /db_xref="InterPro:IPR017961"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:B8H962"
FT                   /inference="protein motif:PRIAM:2.7.7.7"
FT                   /protein_id="ACL38221.1"
FT                   /translation="MRTAVAKPALMRSMPQIAHVDVNCFYASAERAFDPSLEGRPLVVL
FT                   SNNDGCAVTRSPEAKALGIATGEPWFKLAPRAKEWGLVAKSSNYELYGDISARFMELLG
FT                   RYSAWLEVYSIDEAFLGVKGEADQLLPLGRTIRDAVRRNVGVPVCVGIAPTKTLAKLCN
FT                   KWAKNNPAFGGVCLWEAVPGDVRDSLLERLPVDEIWGIAGRLTKRLNVLGIFTVGDLVR
FT                   ADPVMIRDKFSVVLMRTVLELRGTPCIPMEEERIGRDQLIFSRSFATPVTSADGLRQVL
FT                   SIYGQQASARLSKHGLQAKVLTAFAATSPFRQQEQAYPSVCVSLPMPTADPLLLARAAH
FT                   ALLPHIRDGLKYAKAGIMLTDLRPSGNQPPLEPFENPHEERGIGPLLEDVSRRFGRGAI
FT                   GLGHAGIKSGLDWTMKRDMRSPRYTTHWDELPVVKAA"
FT   gene            complement(242989..243420)
FT                   /locus_tag="Achl_0221"
FT   CDS_pept        complement(242989..243420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0221"
FT                   /product="peptidase S24 and S26 domain protein"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   art:Arth_3840 UmuD protein. Serine peptidase. MEROPS family
FT                   S24"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38222"
FT                   /db_xref="GOA:B8H963"
FT                   /db_xref="InterPro:IPR006197"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B8H963"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACL38222.1"
FT                   /translation="MGVIVGPRVIDAGASLFSVLISPVAVAAGFPSPAQDYFDGRIDLN
FT                   AHLIKDITSTFVVRVTGNSMEGAGISDGDELIVNRALEPKDGSVVIAVLDGELTVKRLR
FT                   ITAAGIVLQAENPRYQDIKVSALSDLTIWGVATRCLHHV"
FT   sig_peptide     complement(243337..243420)
FT                   /locus_tag="Achl_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.951 at
FT                   residue 28"
FT   gene            243549..243899
FT                   /locus_tag="Achl_0222"
FT   CDS_pept        243549..243899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0222"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   rha:RHA1_ro03367 ArsR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38223"
FT                   /db_xref="GOA:B8H964"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H964"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACL38223.1"
FT                   /translation="MSTELTPVEAAACCSPLARQPLSEAEAEGIAPLLKALADPVRLRL
FT                   MSMVASHEGGEACVCDLNDAFELSQPTISHHLKILHEAGLLDREKRGVWVYYRARTGAL
FT                   QNLAALIGGQAP"
FT   gene            243896..244597
FT                   /locus_tag="Achl_0223"
FT   CDS_pept        243896..244597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0223"
FT                   /product="major intrinsic protein"
FT                   /note="PFAM: major intrinsic protein; KEGG: stp:Strop_0634
FT                   low molecular weight phosphotyrosine protein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38224"
FT                   /db_xref="GOA:B8H965"
FT                   /db_xref="InterPro:IPR000425"
FT                   /db_xref="InterPro:IPR023271"
FT                   /db_xref="InterPro:IPR034294"
FT                   /db_xref="UniProtKB/TrEMBL:B8H965"
FT                   /inference="protein motif:PFAM:PF00230"
FT                   /protein_id="ACL38224.1"
FT                   /translation="MSVLGRKAAAEFVGTAFLVMAVVGSGVMASRLSPNDAGLQLLQNS
FT                   LATGAALVALIVALQPVSASFNPVVTLVERALGLIDTGTAAALITAQVLGGLAGTVAAN
FT                   LMFGLDAVTLSAHVRTGPALWLGEVVATVGLLVVIFGTVRSGRADRVAFAVGGYITAAY
FT                   WFTSSTSFANPAVTIARTVTDSFAGIAPSSAPAFILTQLLGGAAGYVLVRLLYPTPATS
FT                   AVVTADRKVPA"
FT   gene            244594..245001
FT                   /locus_tag="Achl_0224"
FT   CDS_pept        244594..245001
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0224"
FT                   /product="Protein-tyrosine phosphatase, low molecular
FT                   weight"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: aau:AAur_pTC20058 arsenate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38225"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B8H966"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACL38225.1"
FT                   /translation="MSRKPSVLFVCVHNAGRSQMAAAFLTTLSKGAIEVRSAGSQPADK
FT                   VNPAAVDAMAELGIDMSAEIPKVLTTEAVKESDVVITMGCGDECPYFPGKRYEDWVLED
FT                   PAGKGVDSVRPIRDEIKGRVEALIASLVPAS"
FT   gene            245014..246375
FT                   /locus_tag="Achl_0225"
FT   CDS_pept        245014..246375
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0225"
FT                   /product="FAD dependent oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   aau:AAur_pTC20060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38226"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8H967"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACL38226.1"
FT                   /translation="MPTPESLPVAVIGAGPVGLAAAAHLLERGLEPLVLEAGPAVGSAI
FT                   RQWGHVRLFSTWQYNLDPASVRLLERNGWDAPRPTALPYGAQIVSDYLEPLAATPELQG
FT                   RIRTGARVTAVTRLGMDKGRSQGREQAPFLVRIEYDGGKVTELPARAVVDASGTWSTPA
FT                   PLGSSGLPAPGEPEARAAGLVTGPLPDVARDGFAGRRTLVVGSGHSAANMVLDLARVAR
FT                   ANPGTEVLWAIRAGTPAAAYGGGDKDQLPARGQLGTRLRTAVDTGAVQLFTGFHTVSLE
FT                   VQDDAVTVHAADGRSIQVDRVIPATGFRPDLSILSELRLDLDPAVEAPKALGPLIDPDF
FT                   HSCGTVPAHGANVLAQPEKDFYLAGMKSYGRAPTFLMATGYEQVRSVAAALAGDTAAAD
FT                   AVELQLPETGVCSTSVPGEAPAEDACCGAPAAVPLSIGFPTGLRHGRAGGTATL"
FT   sig_peptide     245014..245082
FT                   /locus_tag="Achl_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.659) with cleavage site probability 0.309 at
FT                   residue 23"
FT   gene            246460..247494
FT                   /locus_tag="Achl_0226"
FT   CDS_pept        246460..247494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0226"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; ATPase
FT                   associated with various cellular activities AAA_5; SMART:
FT                   AAA ATPase; KEGG: art:Arth_1867 AAA ATPase, central domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38227"
FT                   /db_xref="GOA:B8H968"
FT                   /db_xref="InterPro:IPR000641"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041627"
FT                   /db_xref="UniProtKB/TrEMBL:B8H968"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACL38227.1"
FT                   /translation="MAASRKPLDELRETLGHLADQLKLPGSERVDDLMGDLIGPKPGPA
FT                   RPLSEVQAELDSLVGLETVKEQVRALVALLQVQARRKAHGLPEVATSQHLVFLGNPGTG
FT                   KTTVARLLAEMYRAVGLLQKGHLVEVDRSGLVGQYVGQTAIKTDRVIRRALDGVLFIDE
FT                   AYALAPEDGRMDFGPEAIEVLLKRMEDHRHRLVVIVAGYPRLMEWFLLSNPGLRSRFAR
FT                   EITFPDYSVDALQTIFHQMLAQHEYMLEPGAEQMLRRIFTGLHASEDSGNARFARTLFE
FT                   QALNRQALRLSLDEGQSLDALDREAVMTLTADDIVEAALALGEEPEPEQETSAEPEKPR
FT                   WWRW"
FT   gene            complement(247603..248139)
FT                   /locus_tag="Achl_0227"
FT   CDS_pept        complement(247603..248139)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0227"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3182 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38228"
FT                   /db_xref="UniProtKB/TrEMBL:B8H969"
FT                   /inference="similar to AA sequence:KEGG:Arth_3182"
FT                   /protein_id="ACL38228.1"
FT                   /translation="MNRTKNGVLATAAAVLALGLAPGTAVAHGGSGHGGSDKGDDWRNN
FT                   DDQRRLVRVLRHVTDDYRWLENAEADGYKKITECIAKPGGGGAMGFHYAKQELIDDKTQ
FT                   ARKPEVLVYMPDRNGRYRLVAAEFISTAKNRPSIAGLKFEDGPFPGSFALHAWVWRDNP
FT                   DGMFAAFNPDLSCPK"
FT   sig_peptide     complement(248056..248139)
FT                   /locus_tag="Achl_0227"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.985 at
FT                   residue 28"
FT   gene            248418..249236
FT                   /locus_tag="Achl_0228"
FT   CDS_pept        248418..249236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0228"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase type 3; KEGG: art:Arth_0111
FT                   Cof-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38229"
FT                   /db_xref="GOA:B8H970"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8H970"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACL38229.1"
FT                   /translation="MRLVASDIDGTILGHDGKISPRTIRAFHACRDAGVELVFVTGRPP
FT                   RWLHPLEEQLGHTGRVICSNGAVVWDLEADHLVSAQTLAIDAVLEIRRIIKDLRPAALF
FT                   AAETLTGFHLEPGFIENESSELLAQFAPAPLRETLTADDAVVKFLAIVRDGTPDDFLAE
FT                   VAPAVEHLAAATHSSPGVAMLELSLPGVNKAVTLAEYAAALGIGAADVVAFGDMPNDIE
FT                   MLRWAGHGYAMASGHPEAIRAAGQQAPHFDDDGVAQVLEERLASLGVPHS"
FT   gene            249362..249610
FT                   /locus_tag="Achl_0229"
FT   CDS_pept        249362..249610
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rsa:RSal33209_1124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38230"
FT                   /db_xref="UniProtKB/TrEMBL:B8H971"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38230.1"
FT                   /translation="MARSAKHQMAEAPLRRATPAPHWKKLRQGDRVRVQLSPGFDAAGI
FT                   VDAITADHSAVWVHLDGGRGRTLLHCGDGVEIFPYGD"
FT   gene            249658..250488
FT                   /locus_tag="Achl_0230"
FT   CDS_pept        249658..250488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0230"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: art:Arth_0112 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38231"
FT                   /db_xref="GOA:B8H972"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B8H972"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACL38231.1"
FT                   /translation="MSLPFFDHAGADGAPLPIAMAHRGFSVDGLENSMAAFRAAAELGC
FT                   RYLETDVHTTSDGVLLLFHDGTLDRVTDGSGRVADLPAQDVAGARIGGREPIPTFEELV
FT                   TALPDVRLNLDVKDWGSVRSTVEAIERHGVHDRVLIASFSDRRRRAVLKQLSQPVAASA
FT                   GVVSNALFALLGPVVPGPAFRWLMRRVLRDVHALQVPVRYGAVPVVTAGFLRRAEILGL
FT                   VVHVWTINDPAEMRRLLDLGVAGIVTDRADLLRQVLEERGEWAGPRGAAENPNG"
FT   gene            250620..250865
FT                   /locus_tag="Achl_0231"
FT   CDS_pept        250620..250865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0231"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38232"
FT                   /db_xref="UniProtKB/TrEMBL:B8H973"
FT                   /inference="similar to AA sequence:KEGG:Arth_0121"
FT                   /protein_id="ACL38232.1"
FT                   /translation="MSTYHPENDPANPDKPGKDAPADVGAAQDNLEKQGSREAGGSPNP
FT                   DPAEGNITGLEPGGGVPPGETPPAEGQMSRDQGHSE"
FT   gene            complement(250888..251946)
FT                   /locus_tag="Achl_0232"
FT   CDS_pept        complement(250888..251946)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0232"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: art:Arth_3854
FT                   diguanylate phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38233"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B8H974"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACL38233.1"
FT                   /translation="MSVRVQAWGIIAAVLADTDPSGAAVRQRLSNSLDENPGVPERALL
FT                   EYLLETRRSDANTEETLESVRQLRIAPNSMPPKFAEQLDAIRSVSRISALLENQMLMTA
FT                   FQPIYGLAEKTVVGVEALSRFVSDDGAAAELWFAEAAAVGLGANLEFSALGSAAAAARD
FT                   LPTDLYVSLNISPTSCLDPRLPELFAHIDLPIDRVVLELTETIPDEEYAQFIAAINPLR
FT                   DKGLRIAVDDTHSGAGALSRMVHLRPDFLKVGRDVFGNVDNDGLQRALTTCLVDFTDQI
FT                   GTTLVAEGIETVGELKVLTELGIDAGQGYLLGRPSVRPQDWASWNTRQDADGLNRQLAE
FT                   PAGRSPQENEPA"
FT   gene            complement(252112..253653)
FT                   /locus_tag="Achl_0233"
FT   CDS_pept        complement(252112..253653)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0233"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   extracellular sensor"
FT                   /note="TIGRFAM: diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; KEGG: art:Arth_0113
FT                   diguanylate cyclase/phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38234"
FT                   /db_xref="GOA:B8H975"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B8H975"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL38234.1"
FT                   /translation="MFADNDPRLSQLLDHIVRIASGDLGSRVEVSPARDELDAIIMGTN
FT                   LLAEDLQIIYEELEQRVQVRTQLLHEAHLKMQKMAMQDPLTGLANRSALIDALRAALDA
FT                   DTASEEGPVILLMDLDAFKSINDSMGHTAGDQVLITVGQRVRNAVRATDVVARLGGDEF
FT                   AIVMPAVAPDQAAIVGHRILAALSEPIELPGKSVRCGASIGLSVGSPGQTPEEMLMEAD
FT                   VAMYASKAEGQNRLHRFEPGLLLVRRLRSQLVEDLRAAIRNDGLMLYYQPVVDLVSGRL
FT                   EGVEALVRWNHPTRGFIMPDEFIPLAEEAGLISELGNWVLRTAVQQLRAWIDDSLVDGD
FT                   FSVRINISATDLQSLQFIEDVRNVLRDTGVKPDQVVLELTEVAIVKGNELDRYSLAGLR
FT                   GLGVGIEIDDFGTGYSSISYLRRLPVDRVKVDRSLISGLGTDPGQPALVAAVLQLVRAC
FT                   GLEAVWEGVETAEQADILRELGCLSAQGYYFSRPVPPDDIPALLADQQESAHRQP"
FT   gene            complement(253674..255365)
FT                   /locus_tag="Achl_0234"
FT   CDS_pept        complement(253674..255365)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0234"
FT                   /product="multi-sensor signal transduction histidine
FT                   kinase"
FT                   /EC_number="2.7.13.3"
FT                   /note="PFAM: response regulator receiver; GAF domain
FT                   protein; ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: art:Arth_0116
FT                   multi-sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38235"
FT                   /db_xref="GOA:B8H976"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8H976"
FT                   /inference="protein motif:PRIAM:2.7.13.3"
FT                   /protein_id="ACL38235.1"
FT                   /translation="MVVASDTPEVPSAPRTVVVADPDAGRLAQNTSALRGAGYNVHAAG
FT                   DAANLAGLLAEGEPAAIIADAALLPGLETEVPVLVMVDLDDPWQTSLRPSGMHDCITKP
FT                   TSPRELVHRTTALIDQVARRRASRQDAEALREQLRLVSAAVRATNDPQEIARYVVEGFG
FT                   RTFKADHVRLETFEDNRVPRITAAWDSDGLEPLSDDDLPDEDSARRTADQLWAGAETLS
FT                   TDAGDADDAEPSREHADGGQAADGDAPASGIANAASTLAVPMGEGSSSLGIIWIASLDK
FT                   PRKWSRAELGLIQHVAGNAAHGLIQSHLISSQQQVVKQLQQLDKAKTDFLATVNHELRT
FT                   PLTSIMAYLDMIQESTEQPGSAEIHQMLDIVVRNTERLRTLIEDMLSVSRNGLDDTLMH
FT                   LTPVRLGHTLDLVASALRPLAKLQNVTIALDPVPDDPEILADEIQLQQVFTNLVSNAIK
FT                   FTPSGGRIEVGSESHAAADGSRWATVRVADNGIGISSDEIDHVFTRFYRASNAMSGAIP
FT                   GTGLGLAITKDIVARHGGTIDVASTLGAGTTVTVSLPLDADRSQSN"
FT   gene            255442..255816
FT                   /locus_tag="Achl_0235"
FT   CDS_pept        255442..255816
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0235"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_3237 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38236"
FT                   /db_xref="UniProtKB/TrEMBL:B8H977"
FT                   /inference="similar to AA sequence:KEGG:AAur_3237"
FT                   /protein_id="ACL38236.1"
FT                   /translation="MTHQPADHVKGDLSLDEGGILQLRWPRGASISEADAQSAMDRVNE
FT                   MCGSTRRPMLVDMATTEKVSRGARAVFGRPCQASRIALLGSSPVDKVMANFALGVSRLP
FT                   CPTRFFTSRTEAMTWLARDD"
FT   gene            255918..256781
FT                   /locus_tag="Achl_0236"
FT   CDS_pept        255918..256781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0236"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 12; KEGG: art:Arth_0118
FT                   methyltransferase type 12"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38237"
FT                   /db_xref="GOA:B8H978"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8H978"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACL38237.1"
FT                   /translation="MPNPAKPEKTGWRKYLMLPRLIRLSRSAPKDRPLAWDRYWAGITA
FT                   TGPGGEVLWDAGSDHEFLGYRDLILRHLDPALPVVDVGCGHGSFTRALAAHFPQAIGVD
FT                   ISAHAAALAAAEPGNPGNVSFEVRDMTAPGAGAGLVAGPANVFVRGVLHVLSPADQAAL
FT                   AENLRVLAGGRGTVFLAETNFQGNPVEYVTHLGATQRSIPAPLERAIRGLPMPGHFGPK
FT                   ERSRALPPASWELLEEGAAAIETNPVTGVEGQSRVPGYVAALRPRRPSGETPKHAGEDA
FT                   PLTGSS"
FT   gene            256886..257215
FT                   /locus_tag="Achl_0237"
FT   CDS_pept        256886..257215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0237"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38238"
FT                   /db_xref="UniProtKB/TrEMBL:B8H979"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38238.1"
FT                   /translation="MVSSLITQLGLLRPMERAAKVWQGERDTQQVAEMPRSTPWRLPGA
FT                   LRSDVSGGIARFRLSCLTGMSIHRHGRSPKSAMNRAAKGSHSLLGNPGLGGASAAPASL
FT                   HRRHR"
FT   gene            257268..257720
FT                   /locus_tag="Achl_0238"
FT   CDS_pept        257268..257720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38239"
FT                   /db_xref="UniProtKB/TrEMBL:B8H980"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38239.1"
FT                   /translation="MREIIPSGTLRGMLLPPTYGRHITDATAFTVLSVEIWATGLVVTI
FT                   QMAADGGPQPRINVQDHFGTEYTLRDSATLGSRNLQVFTPSVPPGTRSLTIRSADDAAA
FT                   RPVVTFAVPLMAVPDTGDSAGTAEASDAPGGNPDEGYTPQELRRPA"
FT   gene            257844..258968
FT                   /locus_tag="Achl_0239"
FT   CDS_pept        257844..258968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0239"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="PFAM: glycerate kinase; KEGG: art:Arth_0123
FT                   glycerate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38240"
FT                   /db_xref="GOA:B8H981"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B8H981"
FT                   /inference="protein motif:PRIAM:2.7.1.31"
FT                   /protein_id="ACL38240.1"
FT                   /translation="MRILIAPDKFKGSLTAAEAAAAIAEGALRVYPDAVATQFPIADGG
FT                   EGTLEAAVAAGYEERLNAVVGPILAPLGAAWAIRKDDAGKVTAVIETAQASGLAEMEPT
FT                   PDNALRAHSYGCGQLIAAALEAGATEIVLGLGGSAMSDGGSGALRALGLKPLDSAGNVV
FT                   PLGGGSLADVVSLDATGLDPRLSATTFRIAVDVRNPLYGPTGAAHVFSPQKGADDDAVE
FT                   LLDAGLRNWASVLREATGRDVNVAGAGAAGGFPASFLAFTDATLEGGFALVAGLTGLAG
FT                   ELAGADLVITGEGSMDSQSLTGKAPIALADAARERGIPVIVVAGRILVTLEDLTGHGVV
FT                   AAAQLLDVAPSPEDAIANAGKYLTWATTQVLEGA"
FT   gene            complement(258965..259300)
FT                   /locus_tag="Achl_0240"
FT   CDS_pept        complement(258965..259300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0240"
FT                   /product="regulatory protein LuxR"
FT                   /note="KEGG: cau:Caur_1917 regulatory protein LuxR"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38241"
FT                   /db_xref="GOA:B8H982"
FT                   /db_xref="UniProtKB/TrEMBL:B8H982"
FT                   /inference="similar to AA sequence:KEGG:Caur_1917"
FT                   /protein_id="ACL38241.1"
FT                   /translation="MRTALKSALLALLLLAAPALAAGVASASPAPAAVGTVAGTDAGAA
FT                   VPAGNTPTPSPGDTSSTGPANPGTGESTQSESTRVNYAPWVIGGIVVVVLIAALIWSRR
FT                   RNKPFVG"
FT   sig_peptide     complement(259217..259300)
FT                   /locus_tag="Achl_0240"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.552 at
FT                   residue 28"
FT   gene            complement(259342..260004)
FT                   /locus_tag="Achl_0241"
FT   CDS_pept        complement(259342..260004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38242"
FT                   /db_xref="GOA:B8H983"
FT                   /db_xref="UniProtKB/TrEMBL:B8H983"
FT                   /inference="similar to AA sequence:KEGG:Arth_0124"
FT                   /protein_id="ACL38242.1"
FT                   /translation="MRKWAKEHGLLLANFALFLVFFGGMILSGAASYSEDQQAHGEPAV
FT                   TVLQFLASGEFLEATFENWESEFLQMAMYVVLTIFLFQKGSSESKPLDKKAPQDEDPRH
FT                   ATIGKATPWPVKRGGIALGFYKHSLSILLFVLFLASFTMHGVGGAEAYSEDQQSHGQAA
FT                   VTFLQYLGTSRFWFESFQNWQSEFLAVAVLVGASVYLREKGSPESKPVAEPHYETGA"
FT   sig_peptide     complement(259900..260004)
FT                   /locus_tag="Achl_0241"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.997) with cleavage site probability 0.612 at
FT                   residue 35"
FT   gene            complement(260037..260549)
FT                   /locus_tag="Achl_0242"
FT   CDS_pept        complement(260037..260549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38243"
FT                   /db_xref="GOA:B8H984"
FT                   /db_xref="UniProtKB/TrEMBL:B8H984"
FT                   /inference="similar to AA sequence:KEGG:Arth_0125"
FT                   /protein_id="ACL38243.1"
FT                   /translation="MSGAEDYTGRTGRNETREEQLDRNWAELLQELRVLQTGVQILAGF
FT                   LLTLPFQSRFEDLDSFQETLYLANVVVAALTTAFILLPVSVHRRLFRKRLKETLVSSAD
FT                   SITKIALGGIALLSAGTAALVFDVTAGREAGLTAGGALMAVMVVLLVYVPIHLNRKADA
FT                   GKLDRKL"
FT   gene            260760..261674
FT                   /locus_tag="Achl_0243"
FT   CDS_pept        260760..261674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0243"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   art:Arth_0126 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38244"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H985"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38244.1"
FT                   /translation="MSGTNKQETGKQTDQPKDPRGGYHSGPFPEQEQKQPGLTAPMDPK
FT                   PDHGEASYEGNGKLEGKAALITGGDSGIGKAAAIAFAREGADVAISYLPEEEDDAQDTA
FT                   EWIRKAGRRALLFPGDGREEEFSTRIADEAASEFGRLDVVVLNAAYQKNRDSLESLPTE
FT                   EFDRVFKTNLYSLLWTARAAVPHLKAGASIITTASIQAFNPSPGLIDYAMTKAAQVAFT
FT                   KALAQELGPKGIRVNAVAPGPIWTPLIPATEWPDKLPSFGQDTPLERAGQPAELAAAYV
FT                   LLASEDGSYISGAVLPVTGGKGL"
FT   gene            261718..262074
FT                   /locus_tag="Achl_0244"
FT   CDS_pept        261718..262074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0244"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38245"
FT                   /db_xref="UniProtKB/TrEMBL:B8H986"
FT                   /inference="similar to AA sequence:KEGG:Arth_0127"
FT                   /protein_id="ACL38245.1"
FT                   /translation="MTQDNQHAAPETDPGGYGTPTAEQEMGGQNQQATQGSQGGQGADT
FT                   NEPQSDGGEQVARDVDLPSSAAEIDENNDDSKGSAPTSSEPGQEAAGVPDGSGNDLPQE
FT                   KSPKDDGGEEFNAG"
FT   gene            complement(262178..262645)
FT                   /locus_tag="Achl_0245"
FT   CDS_pept        complement(262178..262645)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0245"
FT                   /product="protein of unknown function DUF336"
FT                   /note="PFAM: protein of unknown function DUF336; KEGG:
FT                   aau:AAur_0712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38246"
FT                   /db_xref="InterPro:IPR005624"
FT                   /db_xref="InterPro:IPR010371"
FT                   /db_xref="InterPro:IPR038084"
FT                   /db_xref="UniProtKB/TrEMBL:B8H987"
FT                   /inference="protein motif:PFAM:PF03928"
FT                   /protein_id="ACL38246.1"
FT                   /translation="MSESARLLELRRQEEELVFPSFDQHDAWRLGSLIANHAIAENHGV
FT                   AIDIRRHNIVLFRCVLPGVTSDQQEWIRRKSNSVLRFEHSTAYLTEQFSDYDPTQGGWL
FT                   APEDYTLAGGSFPIRVQGAGVIGAITASGLTSDEDHQLVADGIRDYLQTLA"
FT   gene            complement(262642..263658)
FT                   /locus_tag="Achl_0246"
FT   CDS_pept        complement(262642..263658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0246"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; homoserine dehydrogenase NAD-binding; KEGG:
FT                   aau:AAur_0713 oxidoreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38247"
FT                   /db_xref="GOA:B8H988"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H988"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38247.1"
FT                   /translation="MTLSNGTSDGTIRWGILGTGFIAGLQTQDLNDNGFTVQAVGSRSV
FT                   DSSKAFAEQHGIATAHGSYEDLVADPLVDVVYIATPHPMHHANALLALNAGKHVLVEKS
FT                   FTMNAREAQDIVDLAESKGLVALEAMWTRFLPHMIRIRELIAEGAIGEVRKVVASHNQS
FT                   LPQDPAHRLNDPALGGGALLDLGIYPVSFAFDILGTPARITASASMTATGVDRQTAAIF
FT                   EYDGGPQALLDCELDAASANRAMVLGTTGWIDIEHTWYNPVPFTVHAVDGSVVERYEQS
FT                   VTSRGMQYQAAELERLVREGATAGTILPPSETVAVMAAMDQIRKHIGLSYEADRESA"
FT   gene            complement(263663..264547)
FT                   /locus_tag="Achl_0247"
FT   CDS_pept        complement(263663..264547)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0247"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0570 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38248"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="UniProtKB/TrEMBL:B8H989"
FT                   /inference="similar to AA sequence:KEGG:Arth_0570"
FT                   /protein_id="ACL38248.1"
FT                   /translation="MKRTLQPGQRSEVWIASVTGEAELLYSSDDVLFEAPNWTLDGAAL
FT                   VLNGDGKLWTLDVAGGHPVEVPLTGVPDLNNDHVLAPDGTGIFLSANDGHIYRASLAGG
FT                   AATRITGEDGTFHFLHGVSPDGRELAYVGIEAGDFTRPGRLMTIASNGGAAASVDVGPG
FT                   HCDGPEYSPDGKWLYLNTESFSTAPGHAQLARVRSDGTGFEQLLTSDSVDWFPHLSPDG
FT                   RLASYIRFPRGTQGHPADLPVAVVLVSTGDWTTPLQTWPLFGGQGTLNVNSWSPDSAHI
FT                   AFVAYPLPDSTKD"
FT   gene            complement(264544..265416)
FT                   /locus_tag="Achl_0248"
FT   CDS_pept        complement(264544..265416)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0248"
FT                   /product="protein of unknown function DUF1080"
FT                   /note="PFAM: protein of unknown function DUF1080; KEGG:
FT                   rba:RB3944 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38249"
FT                   /db_xref="InterPro:IPR010496"
FT                   /db_xref="UniProtKB/TrEMBL:B8H990"
FT                   /inference="protein motif:PFAM:PF06439"
FT                   /protein_id="ACL38249.1"
FT                   /translation="MADAEPKHDGFVPLFDGSTLAGWYSVPRVYGTEYPGGPLLLERFE
FT                   ALGLTPPVDPEKHPARWFAEDGVLVGEQDTPGSGYGGYLVTERAYGDFELVLEMRPDWP
FT                   ADTGVMLRRRPDSWEGFQVLVDHRPSGGIGGFFGNGLASFSAVPFAVDVALDADGRPAG
FT                   LVADDLATSVEPVTEEKRARLTYAADVGDFLKAWRWDGWNELRIRCVGALPVITTWING
FT                   IKIAELDTASLDSPNYNPSDVLEVLGTRGHIALEVHDNDSMFGEARWGKGAQCRWRNIR
FT                   IRELDREQL"
FT   gene            complement(265420..266421)
FT                   /locus_tag="Achl_0249"
FT   CDS_pept        complement(265420..266421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0249"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: AP endonuclease 2 domain protein; Xylose
FT                   isomerase domain protein TIM barrel; KEGG: aau:AAur_0715
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38250"
FT                   /db_xref="GOA:B8H991"
FT                   /db_xref="InterPro:IPR011418"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8H991"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL38250.1"
FT                   /translation="MPRPFTLFTGQWADLPLEEVAKLASGWGYDGLEIAVSGDHLDAWR
FT                   VDEPGYVESKLELLDKYNLKVWAISNHLKGQAVCDDPIDFRHEAIVGSRVWGDGEPEGV
FT                   RQRAAEELKHTARLARALGVDTVVGFTGSSIWQYVAMFPPVPEKVIDAGYQDFADRWNP
FT                   ILDVFDENGVRFAHEVHPSEIAYDYWTTQRTLEAIGHREAFGLNWDPSHMMWQGMDPVS
FT                   FIWDFKDRIYHVDCKDTKVRQTGRNTVLGSHLAWGDPRRGWDFVSAGRGDVPWEASFRA
FT                   LAAIGYDGPISVEWEDAGMDRLHGAPEALAALKKFDFPASQTSFDAAFSSKD"
FT   gene            complement(266424..267635)
FT                   /locus_tag="Achl_0250"
FT   CDS_pept        complement(266424..267635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0250"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; Oxidoreductase
FT                   domain; KEGG: aau:AAur_0716 putative myo-inositol
FT                   2-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38251"
FT                   /db_xref="GOA:B8H992"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H992"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38251.1"
FT                   /translation="MTTPAHPTATPAPPSLGVAAIGYAFMGKAHSNAWRNVASFFDVPA
FT                   FEQKVLVGRDATAVAEAATKYGWAEAATDWREVINRDDIHIIDICAPGWMHAEIAIAAL
FT                   EAGKHVLVEKPLANTLAEAELMTAAAAKARARGVQSMIGFNYRRVPALALARELIAEGR
FT                   LGTVRHVRAAYLQDWLADDQSPMTWRLRKETAGSGALGDIASHAIDQVLYLLGDQVTEV
FT                   TGRLHTFVPQRPGGKAAGDGLEDVTVDDAAWATLSLASGAIASVEVSRVATGQKNSLKL
FT                   EIYGDRGTILFDLENLNELGFLDATAPVREQGFRRILVNEPEHPYLEAWWPQGHIIGWE
FT                   HTFTHQVRDFLLAVRDQTPPSPSFEEGLNVQYILNAVEESAAAKSALIQLPGAAPETSP
FT                   TEGA"
FT   gene            complement(267667..268788)
FT                   /locus_tag="Achl_0251"
FT   CDS_pept        complement(267667..268788)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0251"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   art:Arth_0573 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38252"
FT                   /db_xref="GOA:B8H993"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H993"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38252.1"
FT                   /translation="MSFTPSARKGPVGVAVIGAGNISKQYLDNLTVFPDLKVLVIADLF
FT                   EDAAEARAKEYGIPEWGGPDKALNHPDVEIIVNLTIPAAHVEVATAAVNAGKHVWTEKP
FT                   FSLDRESGLGLLKAADAAGIRLGTAPDTFLGAGIQTALRLIQRGDIGTPLTAMTTFQTP
FT                   GPESWHPNPAFLFQHGAGPLFDMGPYYLTALVQAFGSIRKVAAVGSKAKEVRVIGSGPK
FT                   AGEEFTVEVPTHVSAMAQFESGASSHSVFSFESPRARMGFVEITGTEATISLPDPNYFT
FT                   GDIRLWRAGDEDWTTVPATGPANGRGMGALDMARAIRAGVPHRATGDLAYHVLDSMVSI
FT                   SESIDSGTFVNVESSAPASTALPEDWAPETATL"
FT   gene            complement(268785..269531)
FT                   /locus_tag="Achl_0252"
FT   CDS_pept        complement(268785..269531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0252"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: art:Arth_0574 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38253"
FT                   /db_xref="GOA:B8H994"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8H994"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL38253.1"
FT                   /translation="MSYSLQLYTLRNAIAEDLPGTIKKVAEIGFTQVEPYNFVATAKEL
FT                   GAALKENGLTAPSGHAPLLSQDQDEIFAAAKELGISTVIDPFLPAEHWQDAETIQATAA
FT                   KLNAAAKKGAEYGITVGYHNHAWELESSIEGRTALEYFESLLDPELVLEVDTYWVAVGG
FT                   QDPVDILTKLGDRVKFIHIKDGNLTTDTKAQQPAGQGKVPVLDVIAAAKSLEVGVVEFD
FT                   DYSGDIFDGISQSLAYLNAAAEGAKA"
FT   gene            complement(269574..270464)
FT                   /locus_tag="Achl_0253"
FT   CDS_pept        complement(269574..270464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0253"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: art:Arth_0575
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38254"
FT                   /db_xref="GOA:B8H995"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H995"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38254.1"
FT                   /translation="MSAVLHAHPESGPALGVAEGKPRKVLSEAGMRGRWWRFVLILVIT
FT                   AIVLVPIMVTVVLALTPAPNSTATGLTLENITGVFSKTLAGTWLQNSLITTLATVFVSV
FT                   AVAAPAGYVLSRGRSKAVSGYSLLLFVMQSLPIITSVVPLFILFAAMGLVDNLMGLTII
FT                   YVGSTMTVATWMMAAYFDSIPISLEEASWIDGCSVFGSFTKVVLRNSLPGILSTAIFAF
FT                   LLAWNDYLVAIVFLRSNEIFTLPMGVQSFFQQNNTDWSGVMALAVIMMLPPIIVFATLN
FT                   KYFSVGGIGGSLAGR"
FT   gene            complement(270464..271426)
FT                   /locus_tag="Achl_0254"
FT   CDS_pept        complement(270464..271426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0254"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: art:Arth_0576
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38255"
FT                   /db_xref="GOA:B8H996"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H996"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38255.1"
FT                   /translation="MSSTTAQSGLARARKGLAPGGAGGGSLNRKSKLSAQASRTFFWLL
FT                   LPSVILLVLIHGYPLFQAGVQATHDGNLIATGNFVGIENFQQVLSSPAFWKAAQFTLWF
FT                   TIVGVFGSWAVGLGLALLLRTKIPGGGTFKVLLLLPWVVPIVVSSTAWNWLVATPDSLI
FT                   PSLFRNLGLGTPLFLADPTLAAVTVMIFKVWVSFPFMMMMISAALASVDSTVYEAASMD
FT                   GASRFQQFTQITLPLIARSTYISWILMTIFCVNDFPTIYLLTGGGPVDATTSLVVLAYR
FT                   TVFQDFATGPGVAIAFLMTITLVIVSVILYRQIRKSSVE"
FT   gene            complement(271438..272754)
FT                   /locus_tag="Achl_0255"
FT   CDS_pept        complement(271438..272754)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0255"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: art:Arth_0577 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38256"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="PDB:4R2F"
FT                   /db_xref="UniProtKB/TrEMBL:B8H997"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL38256.1"
FT                   /translation="MNANTHQSRSFSRRGFLGLTAAAASVPLLAACGGGSASQGGGAGG
FT                   AIKFWDMPWATPAYNDAAKKIAEGFSGANSKATYQIIQWNNFYQTFSSAIASKTGPAVS
FT                   TGGGFQAFQFEEQGQIAYADKVIEKLKSNGQFDDFLPGVVEPFKTSKGYVAVPWQLDIR
FT                   PLWYRKSLFEKAGVGVPTDWASLLEAGKKLKGVGAVGFATGSGAGNNIGNHLMIMMMLN
FT                   NGGGVFTKDGELDVLNDRNVEAVEFLLELVSNGVIDPAAVSYTTDNLNAQWKDSKAAYG
FT                   MLTLGVPERVGDTSGDIVVASPIAGPHGDKAALIFPNNIMMYTNTPSQEASEEFVVYYL
FT                   GKLKELWQQKLMNALPVFKSITEMPEFTADPNNVKIVNEYVPIAKTFASQGTALSANLA
FT                   ALDGGQALNQFTQTVLTGKTDAKSALTAFDTGLKSVLKK"
FT   sig_peptide     complement(272662..272754)
FT                   /locus_tag="Achl_0255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.354 at
FT                   residue 31"
FT   gene            complement(272865..273692)
FT                   /locus_tag="Achl_0256"
FT   CDS_pept        complement(272865..273692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0578 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38257"
FT                   /db_xref="UniProtKB/TrEMBL:B8H998"
FT                   /inference="similar to AA sequence:KEGG:Arth_0578"
FT                   /protein_id="ACL38257.1"
FT                   /translation="MSATYSVAATPAAEEAGAVALAVASLPATFSPAADGAAAPDVAAI
FT                   AGGPGWTAEALHAIESGSRGVLVVNPVPEDTAQLSAAAEAADTAVVLDLRWASNPALVS
FT                   QDGGPDAREAFRSALGTAAMLDSVATAAPGTDPQRLLGEHLAALLEVTGTLDAVSLLQS
FT                   GTTGYTFSGRLANGAPMSAHGVLTAARPAGVDIRLCTADGGVSVRLPEPAAAWPAEVRV
FT                   TGPHGGLLLPTLYESAHRAAWRRLKEHLTAGTRPDDLIRFARLTDLYATFADT"
FT   gene            complement(273689..274792)
FT                   /locus_tag="Achl_0257"
FT   CDS_pept        complement(273689..274792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0257"
FT                   /product="oxidoreductase domain protein"
FT                   /note="PFAM: oxidoreductase domain protein; KEGG:
FT                   art:Arth_0579 oxidoreductase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38258"
FT                   /db_xref="GOA:B8H999"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8H999"
FT                   /inference="protein motif:PFAM:PF01408"
FT                   /protein_id="ACL38258.1"
FT                   /translation="MPSQTQPAGPPLGVGILGAGPVTQAIHLPALARLRDILEVRHIMD
FT                   VDESLAASVAARVGATSSSSMDALLGDDAVDIVAICSPHQFHAEQVIAACRAGKKAVLC
FT                   EKPFAMNAGEAARISEVSAETGVPIVVGAMHTFDPGWLAAERHCEDLPETAHTIRSSIV
FT                   LPPNARFEDFATEIVTRPAAGTPDYADIDVIKAMMQGGIMGLAIHDLPLVRRFTPDFKD
FT                   IQVLQARHVRPFGYAISLRTPTRTIELRAAMNSTWQPEWSFEAIADHSALRIDFTPSYV
FT                   QAGSATATFSRGTETTTFGPYSHNGYEGEWRELAELARGTKQPPSAQTLIDDLTFALAI
FT                   ADATVDSVAADHHRRPGPIAATAGASA"
FT   gene            274986..276206
FT                   /locus_tag="Achl_0258"
FT   CDS_pept        274986..276206
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0258"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: aau:AAur_0719 ROK
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38259"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A0"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACL38259.1"
FT                   /translation="MTPATGKLPAREADAGNLSRAGDLFQLLRDGQARTRAELALTTGL
FT                   ARSTVASRIDALIGSGLVGPAGEANSSGGRPPSRFAFKPEARVVLAVDVGATHVIVAVT
FT                   DLGGSILGERRFAQEVADGPAVVLGRVIAAGKELLAEAGRELGDLAGVGIGLPGPVEHD
FT                   TGRPVKPPIMPGWDGFDVVPYVQRQLPVPVLVDNDVNIMALGERTAHWPEHDNFLFIKV
FT                   ATGIGAGIISSGELQRGANGTAGDLGHVRVPRGDDVLCRCGNYGCLEALASGPAVANQL
FT                   QAHGLEAKTGSDVLRLVAEGNLQAIQALRQAGRDVGDVLATVVNLLNPSMIVIGGSVGE
FT                   AGEHLVAGIREVVYRRSLPLATTHLRIGISMAGGQAAILGASQMVTQHVLSPAVIEATL
FT                   AGNAIAG"
FT   gene            complement(276271..276858)
FT                   /locus_tag="Achl_0259"
FT   CDS_pept        complement(276271..276858)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0259"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: art:Arth_3341
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38260"
FT                   /db_xref="GOA:B8H9A1"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A1"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL38260.1"
FT                   /translation="MTPNKPRGPYAKGAERREQIIQTATDVFATDGFEGTALKRVAELV
FT                   GVREATLFHYFSGKQELLTAVLAERDRRGLADTPAKEAGLALMAPIAARNRTQPGLTTL
FT                   YAVASATASNPGHDSHGYFQERFASVVRALEDDIRERQAAGGVRSDVSANDLARLVVAV
FT                   SDGLQLQWLYDKDVDMAAGLTTFIDVLLKPPA"
FT   gene            276949..279447
FT                   /locus_tag="Achl_0260"
FT   CDS_pept        276949..279447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0260"
FT                   /product="Beta-glucosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: aau:AAur_0658 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38261"
FT                   /db_xref="GOA:B8H9A2"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A2"
FT                   /inference="protein motif:PRIAM:3.2.1.21"
FT                   /protein_id="ACL38261.1"
FT                   /translation="MNPTLPAAATVPAVGSPDAEARIRDLAESLTLEQQVQLLTGADVW
FT                   STHALPAIGLSRVVMSDGPAGVRGEDFDERHDSVSLPSSSALSATWSVDLARRYGQVLG
FT                   QEARRKGVHAVLGPTINLHRSPLGGRHFECMSEDPRLTATIAAGYVAGVQSMGVGATPK
FT                   HYLANEAETDRFTSDSVVDERPLRELYLAAFEDAVTEARAWLVMSSYNSINGTTASEND
FT                   LLETPLSTEWGFDGVVVSDWTGVRSVDAANAHQDLEMPGPVGHWGPKLLAAVGDGRVSR
FT                   TAILDKVVRILRLAARVGSLDGVSPAVTELPAPLNAPAVAREVAVRGAVLVRNKDGLLP
FT                   LDPAALGSVAVSGHNAEEARTQGGGSATVMPKQNISPLEGLREALPANVAISYHRGAKV
FT                   AEGLQAFPRTSLHNPVSNVPGLRVTFLAADGTELSGEDRLASHLIWFGIGIPEGAAAIR
FT                   METDWTAPSAGTHHLGLGTVGRIRLSLRGQEVFNGDIEDETEVLGAALFDPPKTVHAIE
FT                   TEAGERVRIEALFELPADQAIPFTAILLGEETVVADPQAEIDAAVEAARTADVAVVVVG
FT                   TSAAIESEGFDRKDLDLPGHQNRLVEAVAAANPRTVVVVNSGSPVLMPWLDKVGAVLLG
FT                   WFGGQEFGRAIADILLGAEEPGGRLPTTWPAALEDVPVLDTTPMDGKVVYSEGIHVGYR
FT                   AWLKQQAAGGAAPALPFGYGLGYTTFELCTPHASQAVPAGKDVVVHVPVRNTGTRAGRE
FT                   VVQVYLERPESAVERPVRWLAGYAGTHLAAGGTSSVEVRIPGRAFAHYDGGWQVEPGTF
FT                   RILVGRHSADGFQALDIDVR"
FT   gene            complement(279459..279762)
FT                   /pseudo
FT                   /locus_tag="Achl_0261"
FT   gene            279883..280770
FT                   /locus_tag="Achl_0262"
FT   CDS_pept        279883..280770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0262"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0513 response regulator receiver and
FT                   ANTAR domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38262"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38262.1"
FT                   /translation="MAAEPTGQVGWGPLPSPPEPVFDSKDVENYLWEVTHEFMRDVKGE
FT                   QRDIGWAATLFRLGKSHTLAASTEQAREADREQCSFADGPVMEAMRTGEFVLLSDLSRD
FT                   WRWPGYSSAAAAHGVQSVLSAPIASEGGASAAINLYAAAAHTFTSDDLVRCRTYVRQVA
FT                   GALRVVVRVGERAEATAGIAVVQSSLVLVDLAVRSLMNEYGLSREGALTFLQTQAVHHE
FT                   LDLRDAALNVVVPNAGMGRPGPAPAAPPPETYDGVTGFQPAPAGELGHASQGAPRAGAA
FT                   RKQRPRPTAGRRTA"
FT   gene            280767..281672
FT                   /locus_tag="Achl_0263"
FT   CDS_pept        280767..281672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0263"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   art:Arth_0269 lipolytic enzyme, G-D-S-L family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38263"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A4"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACL38263.1"
FT                   /translation="MITDDRGLNRTGEGQVLHPWHRFVALGDSYTEGIGDPEPRSLGGL
FT                   RGWADRAAEELSDGQPDFAYANLAVRGLLLRQILDRQLAPALALKPDLIAMSGGGNDIL
FT                   FKHGNPDKLAEKLDAAVGVLSATGATVLLYAGPDWGNTPVFSTIRGKVAVYNENIHTIG
FT                   ARHHCIMVDLWCLPELQHASMWDPDRLHLSPLGHHSVAVATLNALGVPHSLEPFQPKPL
FT                   PDQGWKHARAEDLVWARQYFVPWILRRILHPEDESLTAKRPQPGPIFGLGRPGPFPPGH
FT                   PVAGVNPGMTGGPATQGQAA"
FT   gene            complement(281669..282142)
FT                   /locus_tag="Achl_0264"
FT   CDS_pept        complement(281669..282142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0264"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hne:HNE_0309 major facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38264"
FT                   /db_xref="GOA:B8H9A5"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38264.1"
FT                   /translation="MRLPKSPPPANHRHVQQADLPAEQIYTLDPVPLSRVAGCVLAVLL
FT                   SGWMLAVPIALIDRLKDASGPGTAVLTGGIIAFALVTAGLGGFRFFNARDVRRRLSGAL
FT                   IAALAAAVTAAAASALLPEYGLLLAVPGLLAGVPALVALATDHRRHRAPGTGN"
FT   gene            complement(282243..283595)
FT                   /locus_tag="Achl_0265"
FT   CDS_pept        complement(282243..283595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0265"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM: Benzoate
FT                   membrane transport protein; Xanthine/uracil/vitamin C
FT                   permease; KEGG: art:Arth_0128 uracil-xanthine permease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38265"
FT                   /db_xref="GOA:B8H9A6"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A6"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACL38265.1"
FT                   /translation="MSMLGIKWKLHGTGKTIKPGHVVAPDERLAWPLTIGVGMQHVVAM
FT                   FGATFLVPIITGMPPATTLFFSGIGTLLFLVVTKGRVPSYLGSSFAFIAPITASQTQFG
FT                   IPGALGGVVLAGATLALVGAVVQKFGAGWINRLMPPIVTGAIVALIGLNLAPAAKQNFD
FT                   AAPITAVITLATIILVSVLFRGILGRLSILVGVVVGYLVAMLRGEVSYDKMDAAAWVGL
FT                   PHFQTPEFHIGVLGLFVPVVLVLVAENIGHVKSVAAMTGQNLDGVSGRALMADGAATVL
FT                   AGFGGGSGTTTYAENIGVMAATKVYSTAAYWVAGMFAILLSFSPKFGELIATVPPGVLG
FT                   GAATMLYGMIGILGVKIWVQNKVNFSNPVNLTTAAVALIIGIADYTWTIGDLKFTGIAL
FT                   GSAAALVIYHGMRAIAKARGTVAEPETEQGGLPPAVKSALNAATKRGPKKR"
FT   gene            283860..284465
FT                   /locus_tag="Achl_0266"
FT   CDS_pept        283860..284465
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0266"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: aau:AAur_0092
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38266"
FT                   /db_xref="GOA:B8H9A7"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A7"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACL38266.1"
FT                   /translation="MTIAHEEAVIDSAAVDAIFAQARTANSFTGEVTEEQAQAIYELTK
FT                   FGPTAFNSQPLRVTYVRSDEARATLVDTLSRGNQAKTASAPLVAILSYETDWAGKWDSF
FT                   LPGYNAPKAMYDADPALAASTGNNNAHLQAGYFILAVRSLGFAAGPMTGADFAAIDAAF
FT                   FPAGDQKSFLVVNIGQPGEEAWGAAKPKFSYDEAVRTV"
FT   gene            complement(284551..286224)
FT                   /locus_tag="Achl_0267"
FT   CDS_pept        complement(284551..286224)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0267"
FT                   /product="phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific"
FT                   /note="TIGRFAM: phosphoglucomutase, alpha-D-glucose
FT                   phosphate-specific; PFAM:
FT                   phosphoglucomutase/phosphomannomutase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; phosphoglucomutase/phosphomannomutase
FT                   alpha/beta/alpha domain II;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain III; KEGG: art:Arth_0131 phosphoglucomutase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38267"
FT                   /db_xref="GOA:B8H9A8"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR005852"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A8"
FT                   /inference="protein motif:TFAM:TIGR01132"
FT                   /protein_id="ACL38267.1"
FT                   /translation="MLGPMASRAGTVAQPQDLVDITALLDAYYDISPDLDDPGQRVVFG
FT                   TSGHRGSSLKASFNEKHIVAITQAIVEYRAAQGVTGPLFLAKDTHALSEPAQNSALEVL
FT                   AANGVQVLVDARHGYTPTPALSHAILTYNRNAGAGAPQADGIVVTPSHNPPQDGGFKYN
FT                   PPHGGPADSDATGWIANRANELLENGLRGVKRIPLADAQAADTTGKFDFLSSYVDDLPS
FT                   VLNLDAIRDAGVRIGADPMGGASVDYWGEIAERHHLDLTVVNPTVDPQWAFMTLDWDEK
FT                   IRMDCSSPSAMASLIQRMTVGADGSTAYDIATGNDADADRHGIVTPDGGLMNPNHYLAV
FT                   AIDYLYRNRSGWNPASVVGKTLVSSSIIDRVAESLGRKLVEVPVGFKWFVPGLLSGEGA
FT                   FGGEESAGASFNKLDGSVWTTDKDGILLALLGSEITAVTGKSPSQLYKGLTDQFGAPVY
FT                   ARIDAAATREQKSALGKLSPSDVTATELAGEAITAKLTEAPGNGASIGGLKVVTENAWF
FT                   AARPSGTEDVYKIYAESFKGEEHLKQVQAEAKALVDSVIA"
FT   gene            286486..287430
FT                   /locus_tag="Achl_0268"
FT   CDS_pept        286486..287430
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0268"
FT                   /product="NERD domain protein"
FT                   /note="PFAM: NERD domain protein; KEGG: art:Arth_0132 NERD
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38268"
FT                   /db_xref="GOA:B8H9A9"
FT                   /db_xref="InterPro:IPR011528"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9A9"
FT                   /inference="protein motif:PFAM:PF08378"
FT                   /protein_id="ACL38268.1"
FT                   /translation="MGAGDGAAEQSRLAAERVARLKRRLDAAERSTKAWDAGAVGERVV
FT                   ADKLSELAPHGWYVLHDVHWPGRPKANLDHVLVGPGGVVVVDSKNWTGEVRVASGVLWQ
FT                   GRYARTQAVEGALAQCAAVASVLAPPHRRLVRPLICMAAQPDLFGVTNSDVAVAGSQRV
FT                   VGAIEALPPVLDHQTVVGLYAHLGEELTHEQEPGITAFRNVRPGTVVRPAGGLPPAGPG
FT                   NAGPRTGNPGAGPRSPENQRAAGPDRSRSGSVSRHPAGRAIPAAGTGGAARTAAGRNRS
FT                   GKPQARGGTSAGRLALLAAFVIFAVYVLPFWTR"
FT   gene            complement(287390..288337)
FT                   /locus_tag="Achl_0269"
FT   CDS_pept        complement(287390..288337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0269"
FT                   /product="transcriptional regulator, ArgP, LysR family"
FT                   /note="TIGRFAM: transcriptional regulator, ArgP family;
FT                   PFAM: regulatory protein LysR; LysR substrate-binding;
FT                   KEGG: nca:Noca_4431 chromosome replication initiation
FT                   inhibitor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38269"
FT                   /db_xref="GOA:B8H9B0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR017685"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B0"
FT                   /inference="protein motif:TFAM:TIGR03298"
FT                   /protein_id="ACL38269.1"
FT                   /translation="MNLEHLRALMAVIDEGTFEAAADLLRVTPSAVSQRIKALEASTGQ
FT                   VLVRRRVPCIPTDAGSVLLRMARQVQVLEAEASTALGTATASRAVLPVAINADSLATWF
FT                   VPVLAVAATWQDTTLDLHVEDQGFSSQLLRQGDVMGAVTSDPVPVSGCRVELLGHMRYI
FT                   PVAAAALRQRFAKGNTVDWARMPVLKFNAKDNLQRGLLAARGVGQVPPTHTVPSSEGFL
FT                   AAIKAGLGWGMLPELQLGNELADGSLVLLGKNAHEDVPLYWQSWSLDSERLRRMGEAVR
FT                   DAGLGKLRTAAPENGRSAGSKLSASRTAGRRPQK"
FT   gene            288414..289004
FT                   /locus_tag="Achl_0270"
FT   CDS_pept        288414..289004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0270"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   krh:KRH_21290 putative amino acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38270"
FT                   /db_xref="GOA:B8H9B1"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B1"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACL38270.1"
FT                   /translation="MTGITGMLTGLALIVAIGAQNAFVLRQGVRREHIGLVVAVCMAGD
FT                   AALILGGTAGIGALVTRFPEALEVLRWGGAAYLAWFAVRSFISALRPSALAQGTPRSKG
FT                   SVVASTVALTFLNPHVYLDTVVLLGSLANQQGPDLRWVFAGGAVAGSIAWFSALGYGAR
FT                   ALSGVLGNPRTWRFLDLGIGIVMLGLAVKLVLH"
FT   sig_peptide     288414..288482
FT                   /locus_tag="Achl_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.556 at
FT                   residue 23"
FT   gene            289065..289637
FT                   /locus_tag="Achl_0271"
FT   CDS_pept        289065..289637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0271"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0096 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38271"
FT                   /db_xref="GOA:B8H9B2"
FT                   /db_xref="InterPro:IPR025241"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B2"
FT                   /inference="similar to AA sequence:KEGG:AAur_0096"
FT                   /protein_id="ACL38271.1"
FT                   /translation="MTDQPSQRPDSQWHNPSGSDGTPPAPPSGYEPPPFVPPQGSSAPG
FT                   SDIPPPPLYPGLSAQYGSNQYGGPQYGNDQYGNQYGGASPYARPDPYGQQGQYGQPAYY
FT                   GMQAEPKTLSIASMVCGIASVIMGWLMLPQLAAVITGHMALKREPAGKGMSITGLVLGY
FT                   LCLLGYGGFWLLLIIGLASYSSSSYGY"
FT   gene            complement(289743..290441)
FT                   /locus_tag="Achl_0272"
FT   CDS_pept        complement(289743..290441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0272"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: art:Arth_2015 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38272"
FT                   /db_xref="GOA:B8H9B3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL38272.1"
FT                   /translation="MEKTARLGLERVSRPRLYEQLVEQILAYIESAQLKPGDLLPAERD
FT                   LAERLGVSRATLAQALVALEVLGVIDVQHGTGAVLARRPSVASVIKGLREHRSRLPEIV
FT                   EARSTLEGKLAALAAARRTDEDLKAIDHALEVMATEISDGDRGTRGDELFHEAITAAAH
FT                   SSVLAQLMAFIAEMILETRMESLGQPGRPEQSLASHRRIADAIRDQDPEAAAEAMLAHI
FT                   ELVSDVELLR"
FT   gene            290577..291944
FT                   /locus_tag="Achl_0273"
FT   CDS_pept        290577..291944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0273"
FT                   /product="Dicarboxylate carrier MatC domain protein"
FT                   /note="PFAM: Citrate transporter; Dicarboxylate carrier
FT                   MatC domain protein; KEGG: art:Arth_2014 dicarboxylate
FT                   carrier MatC domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38273"
FT                   /db_xref="GOA:B8H9B4"
FT                   /db_xref="InterPro:IPR009827"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B4"
FT                   /inference="protein motif:PFAM:PF07158"
FT                   /protein_id="ACL38273.1"
FT                   /translation="MSAPVLSIIILAAMFLLATVLPLNMGALAFVGAFLLGALVLGMST
FT                   NEILANFPGGLFLTIVGVTYLFAIAQNNGTIDLLVRGAVRLVGSRVALIPWVMFAITAV
FT                   ITAVGALSPAAVAIIAPIALSFAGKYKISPLLMGMMVIHGAQAGGFSPIAVYGVTVNGI
FT                   IAKTDLAFSPTALFLSSLIFNIVIAVVLFAVLGGRALLSSRVGHFVEQAAEARMSVSVG
FT                   AKAGTDVAFKGFGSGMYGPRDPAGDGVAATRERSERIPQLVTIAGLVVLAVVALGFKMD
FT                   VGFVSITIAIVLALVSPAAQKGAINKISWSTVLLICGMLTFVGVLEEAGTIEFVSNGVA
FT                   GMGMPLVAALLICFIGAIVSAFASSTAILAALIPLAVPFLSTGDIGAVGVICALAVAAT
FT                   IVDVSPFSTNGALVLANAPEGVDKDKFYKQILGYSGIVIVAGPVLAWLALVVPGWL"
FT   sig_peptide     290577..290666
FT                   /locus_tag="Achl_0273"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.903 at
FT                   residue 30"
FT   gene            292004..293230
FT                   /locus_tag="Achl_0274"
FT   CDS_pept        292004..293230
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0274"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: art:Arth_2013 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38274"
FT                   /db_xref="GOA:B8H9B5"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B5"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACL38274.1"
FT                   /translation="MNAADRQQGPLAGHTVVDLSRALAGPHAGMMLADLGARVIKVENP
FT                   ETGDDTRGWGPPFVGPEDDLQSTYFMSCNRNKESISLDLKSSDGQAVLRGLLERADVVI
FT                   ENFRPGVMDRLGFSTAAMHGLNPRLVILSITGFGHDGPESQRSGYDQILQGEAGLMSLT
FT                   GSGPDDPQRVGVPIADLLAGMNGATGVLAALVERERTGQGKVVRTSLLASLIGVHAFQG
FT                   TRATVAGEVPQAQGNHHPSIAPYGLFNCKDGSVQISVGSEKLWASFAAAFGLDPAAPGF
FT                   ASNADRVRNRQEVIAAVERVFAEYGAVELLEKLNDAGIPAGKVRSLDEVYAWEQVASQG
FT                   LVVDVEHPLLGTVSLPGPPLRFFAQGDAAETTVKDHAAPPLLDADGGSIREWLGLVPVA
FT                   ATDAPAGAE"
FT   gene            293232..294749
FT                   /locus_tag="Achl_0275"
FT   CDS_pept        293232..294749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0275"
FT                   /product="carboxyl transferase"
FT                   /note="PFAM: carboxyl transferase; KEGG: art:Arth_2012
FT                   carboxyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38275"
FT                   /db_xref="GOA:B8H9B6"
FT                   /db_xref="InterPro:IPR000438"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B6"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACL38275.1"
FT                   /translation="MPTSEKVRHLSAAELLDAVVDDGSFTSWDVEPQQPPLSEEYAADL
FT                   ARARARSGTDESVLTGAGLIRGRRVALIVSEFSFLAGSIGHAAAERIVAAMERATVEGL
FT                   PLLAGTASGGTRMQEGTLAFLSMVKITAAVRAHRQAGLPYLVYLRHPTTGGVMASWGSL
FT                   GHINVAEPGSLLGFLGPRVYEALHGEAFPDNVQVAENLFSKGLIDGVVEPGKLAELVGR
FT                   ALDILMPRRASGSAAWPDAPATLAVRPAEVDAWTSIEISRQPRRPDLRQLLKYGASDAL
FT                   PLNGTGQGEKDPGLLLALARFGTQSCIVLGHARPLRKDAAGMGPGSLREARRGAKLAEE
FT                   LRLPLLTVIDTAGAALSQEAEEGGLAGEIARSLHELIGLESPSVSVLLGQGAGGGALAL
FT                   LPADRTIAAQHSWLSPLPPEGASAIVHRTTDFAPAMAQAQGVNVASLYANGLVDHVVDE
FT                   RHDASLEPREFCARMAHAIEYELASVAAVPVSQLVASRARKFRNLGS"
FT   gene            complement(294921..295361)
FT                   /locus_tag="Achl_0276"
FT   CDS_pept        complement(294921..295361)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0276"
FT                   /product="uncharacterized integral membrane protein-like
FT                   protein"
FT                   /note="KEGG: art:Arth_2421 uncharacterized integral
FT                   membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38276"
FT                   /db_xref="GOA:B8H9B7"
FT                   /db_xref="InterPro:IPR010445"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9B7"
FT                   /inference="similar to AA sequence:KEGG:Arth_2421"
FT                   /protein_id="ACL38276.1"
FT                   /translation="MSAGQTTPESNGRQEPGAGTPLPGLAGGADSTTPHGNAPSYSPDT
FT                   PAVGTAATAPGQAGKRQVTRTGVIWVAVVAALVLLILLIIFILQNQEQAMVKFLGLEGS
FT                   VPLGMALFIASVTGGVLVAAAGGARILQLRASAHRARVRQRR"
FT   gene            complement(295405..295584)
FT                   /locus_tag="Achl_0277"
FT   CDS_pept        complement(295405..295584)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0277"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fre:Franean1_4236 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38277"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9P3"
FT                   /inference="similar to AA sequence:KEGG:Franean1_4236"
FT                   /protein_id="ACL38277.1"
FT                   /translation="MRSAYVHAASLRMEYDGDAGAPGAAITLALCGQWEHPPPCPLAAH
FT                   HLKRPRLCCAEPRH"
FT   gene            complement(295664..295867)
FT                   /locus_tag="Achl_0278"
FT   CDS_pept        complement(295664..295867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0278"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38278"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9P4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38278.1"
FT                   /translation="MCYGYNKDFGRSDKKETSRKPEAKQETPAGTPEPRVKAQDYTFWA
FT                   FPSWRRSPTPRTPSAERSEERV"
FT   gene            complement(295991..296221)
FT                   /locus_tag="Achl_0279"
FT   CDS_pept        complement(295991..296221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0279"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38279"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9P5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38279.1"
FT                   /translation="MNAEYPTTTDAGTSGRVDENRPDLSNSNVREDLALTGRCALVHLP
FT                   SGRTCLLPLRHPGPCDFHGPAEAADVVSASQ"
FT   gene            complement(296341..297750)
FT                   /locus_tag="Achl_0280"
FT   CDS_pept        complement(296341..297750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0280"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: art:Arth_0135 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38280"
FT                   /db_xref="GOA:B8H9P6"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9P6"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL38280.1"
FT                   /translation="MPEELHSLSAVELRNALRGGQVSAVEAAEHFLARIEERNPLLGAF
FT                   ITVTAEQAIEQARASDALHVRSRAGELPLLHGMPLAFKDLTDVAGVVTTHGSAALDHKP
FT                   APADAPLVAQLREAGAVSLGKTQVPEFGLTAYSENRIAPPSRNPHAPSRSSGGSSGGSA
FT                   AAVAAGLVPLAPGTDGGGSVRIPAAACGLVGLKPGRGVVPSGESQGDPARLVVAGPLAR
FT                   TAADAALMMDALVPDSGHLAALEREPVKLRIGVTLDSPWSATFPFTPDQEALDALAAGE
FT                   RLLEHAGHTLGEAAIRYDNRYPDAFTTAWTAGVGSARISPHREVLLAPLTRTFRRRAQQ
FT                   RSPAKLSEALAFLRQFQHDTVAQYAEWDLMLMPALAQTPRPVGWFTGTGHGGERWPSAQ
FT                   WPGDADGDYRKQCEFAPWSSMINVCGLPAISLPVHWTGGTPGQGLPMGIQLVGPKGSEE
FT                   LLLQVGHQLGL"
FT   gene            297862..298188
FT                   /locus_tag="Achl_0281"
FT   CDS_pept        297862..298188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0281"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: aau:AAur_0100
FT                   putative rhodanese-related sulfurtransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38281"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9P7"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACL38281.1"
FT                   /translation="MSDFDSVPVNDVPDGAVILDVREDYEWVAGHAEGALHIPLDQIPA
FT                   RLEELDPDADVYVICRTGGRSFRAAQWLTGQGYTAINVSGGMDQWLESGKPLVSDNGLK
FT                   PMVL"
FT   gene            298188..299168
FT                   /locus_tag="Achl_0282"
FT   CDS_pept        298188..299168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0282"
FT                   /product="Prephenate dehydratase"
FT                   /EC_number="4.2.1.51"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: art:Arth_0138 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38282"
FT                   /db_xref="GOA:B8H9P8"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9P8"
FT                   /inference="protein motif:PRIAM:4.2.1.51"
FT                   /protein_id="ACL38282.1"
FT                   /translation="MPGAVPTYSFLGPEGTFTEAALMQVPGAGDAVRVPASTVNAALDA
FT                   VRESSADAAMVPIENSVEGGVTATLDAIAGGQELRIVREVLVPISFVLVARPGTRLGDV
FT                   RRVSTHGHAWAQCRLWMDQHIPGAEYVPGSSTAAAAMGLLEPDCHYDAAICAPLVAQEQ
FT                   PGLPVLAENIGDNPGAVTRFVLVSRPGKLPERTGADKTTVVVPLPEDRPGALMEILDQF
FT                   ATRGVNLSRIESRPTGQYLGHYFFSIDADGHVGDARVADALAGLHRISPATRFLGSYPR
FT                   ADRQPIEVQAHTSDRAFAASRNWVESILDTESLQVESGSGPSPTA"
FT   gene            299263..299481
FT                   /locus_tag="Achl_0283"
FT   CDS_pept        299263..299481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0283"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38283"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9P9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38283.1"
FT                   /translation="MSAGSSTENDGQGMIVNPKPSADNQDWDGDDADRADRLRFEEEQA
FT                   MIREQSEERAHAKHAAEAAKESKPDHH"
FT   gene            complement(299509..300588)
FT                   /locus_tag="Achl_0284"
FT   CDS_pept        complement(299509..300588)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0284"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region; KEGG:
FT                   art:Arth_0139 diacylglycerol kinase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38284"
FT                   /db_xref="GOA:B8H9Q0"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q0"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ACL38284.1"
FT                   /translation="MSDWILYLLIAVALAFAISSWWGVRRLKALHMRSAVAGEAYDPGL
FT                   EKQRVAVIINPIKARAAEARASIQRACLTAGWDEPVFYETTAEDPGFTQMQAALATKPD
FT                   VVLVGGGDGTVRVAAEALAHTEVAMGLIPLGTGNLLARNVDLDVADLHGCVQTALFGRQ
FT                   RTIDTARMAIENSRTGTYSEHVFLVIAGIGMDAEVLADTNDGLKKAVGWLAYTESGMRH
FT                   LPGRRKKVSISLDGNPEQVRNIRSVLFANCGLVPGGIDFIPQAMIDDGMLDVVVMSPRS
FT                   ALGWLLMYGKIMFKHSGKLPIMTVYRSGRIVIKCPEPMPTQLDGDTSGEATKLTVQVQP
FT                   GSLLVRVRGISGPDGGTAV"
FT   gene            300679..301959
FT                   /locus_tag="Achl_0285"
FT   CDS_pept        300679..301959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0285"
FT                   /product="seryl-tRNA synthetase"
FT                   /EC_number="6.1.1.11"
FT                   /note="KEGG: aau:AAur_0103 seryl-tRNA synthetase; TIGRFAM:
FT                   seryl-tRNA synthetase; PFAM: tRNA synthetase class II (G H
FT                   P and S); Seryl-tRNA synthetase, class IIa-like"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38285"
FT                   /db_xref="GOA:B8H9Q1"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002317"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR010978"
FT                   /db_xref="InterPro:IPR015866"
FT                   /db_xref="InterPro:IPR033729"
FT                   /db_xref="InterPro:IPR042103"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8H9Q1"
FT                   /inference="protein motif:TFAM:TIGR00414"
FT                   /protein_id="ACL38285.1"
FT                   /translation="MIDVKDLSENPDKFRASQRARGADESVVDAIISADSARRAALIRY
FT                   ENLRAEQNVFGKKVAQAKGEEKQALLAEVKELANSVKAASAEADAAQTKQEELLRTVPN
FT                   LVEDGVPEGGEDDYVVVKTVGTPREFPDFEPKDHLEIGELIGAIDMERGAKVSGSRFYF
FT                   LRGVGARLEMALLQMAMEQAIEAGFIPMITPTLVRPETMQGTGFDVKHDAEIYRLAEDD
FT                   LYLVGTSEVALAGYHADEILDFSAGPIRYAGQSSCYRREAGSHGKDTRGIIRVHQFNKV
FT                   EMFIYTTVEEAAAEHQRLLAWEEEMLAKCELPYRVIDTAAGDLGNSAARKYDCEAWVPT
FT                   QGAYRELTSTSNCTTFQARRLNIRERAVNAEGVAKGTRAVATLNGTLATTRWIVALLEH
FT                   HQNADGSVNVPKALQKYLGGLEVLPVL"
FT   gene            302141..303196
FT                   /locus_tag="Achl_0286"
FT   CDS_pept        302141..303196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0286"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0104 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38286"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q2"
FT                   /inference="similar to AA sequence:KEGG:AAur_0104"
FT                   /protein_id="ACL38286.1"
FT                   /translation="MEIPPGLIDTAAILRTGATTDALHRAFRAGQLVRIRRGFYVAAED
FT                   WLRARPSERFAWTTTAVARSVKGAVLCGQTAAVASGLPTLGTPPCVELTTALPGRSGIR
FT                   KSTLLVMGESGAAEEVRRTRSYPLRYRLGAVPEPIRSGEFVCSGLIGTTVNVLGSGELD
FT                   QALVVADGAARTLRRAGVLGPGDSLLSVPGIAAGISGLPSAAGRRRAERVAALASPLPE
FT                   SVGESYSRAVLEFLGFEQPELQHVFSDGAGFIARIDFWWPRQGVVGEFDGKGKYVEAAQ
FT                   RDAITAEEAVYREKLREDRIRALGHGFVRWRWADLVDPNKLRRKLLAAGLCPGVGAPAA
FT                   VSQGLVRRSEP"
FT   gene            complement(303350..303994)
FT                   /locus_tag="Achl_0287"
FT   CDS_pept        complement(303350..303994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0287"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   aau:AAur_3450 acetyltransferase, GNAT family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38287"
FT                   /db_xref="GOA:B8H9Q3"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q3"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL38287.1"
FT                   /translation="MRPAPTDSLSVQGPVRHRLQASDDEAAEPHGGRAGTLTVPTQALE
FT                   TAVIRAARESEYEAVGKLTFRGFGHHLPGARQPDAERLDLLVDAGARAAAGDLLVAEDA
FT                   TTGELLGTVTVLQHGSALARQAEPGEAEVRLLAVLPEARRRGLGWLLLDRAKELAVARG
FT                   AERIVLDTGVDNHGSQNLYERYGYVRRPDREKPRPAPKVQLAVFTLELASS"
FT   gene            304143..304580
FT                   /locus_tag="Achl_0288"
FT   CDS_pept        304143..304580
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_1389 RNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38288"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38288.1"
FT                   /translation="MDANPGPPATAARNEGAGGAAAGDAHRKDAAGLSADANVRQGSRR
FT                   RRGSSAKPRRSSGGKAARGHEDTANQGQDWHRLEAGQLVDVHLPEGFSFRGTVDAKTAD
FT                   SGVIWIRSDAGARRMFGHLEGVRLAGRTAASGTLAGRDAVP"
FT   gene            complement(305012..306544)
FT                   /locus_tag="Achl_0289"
FT   CDS_pept        complement(305012..306544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0289"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: rha:RHA1_ro00594 cystathionine
FT                   beta-synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38289"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q5"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACL38289.1"
FT                   /translation="MTVFESVLDGIGSTPLVRLRRLGAGLRPRIYAKLEFQNIGGSVKD
FT                   RAALSMVRAAERQGLLRPGGTVVEGTSGNTGIGLAMVAAQLGYRAVIFAPAATAAEKIR
FT                   LLRAYGAEVHLVADFVPRDHPGHLASRAAAFAAETPGAWLAQQYDNPANPAAHRHTTGP
FT                   EIWADTEGSVTHLVASVGTGGTLSGTGGFLKDASGGSVQVVAADPEHSRYGGGDGALKY
FT                   VEGAGHALHPESVEDIWPEAFDTNVVDRYLRVSDRDAIFTARRAACEEGLLTGATGGTA
FT                   LAAALNLAEGLDESHTIVVVLPDSGRNYLSTYFDDGWLASLGFLEPDSPQGTVRSLLPS
FT                   GDAGGQAAGVPLLPSGLAVGESIAHLRAQGLGPADPAFLVLDRGARHGSVHPREVLAAV
FT                   TLESLQALDSQAGPSAAALLAAVPYRAVGAGTPAPGAPGEDGASATEGDEVVGEAGAGG
FT                   DAANRGAAGAGSSVHEVLAVLVDGRITAAVPAGRRPGGKVADAAAGSATFSR"
FT   gene            306833..308440
FT                   /locus_tag="Achl_0290"
FT   CDS_pept        306833..308440
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0290"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aau:AAur_3442 putative transmembrane efflux protein (MFS)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38290"
FT                   /db_xref="GOA:B8H9Q6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38290.1"
FT                   /translation="MGRIAGTSTPPAAGTPSPRAALWLCLGAGFVTLLDQSVFVLAVPA
FT                   MAAGLHADSGQVQWILASYSLAFGVALVPAGRLGDLLGRRKLFIAGVAVFGAFSLLGGL
FT                   ASDPAVVIAARLLQGLGAGTLNPQVLGLLQDIFTGSGRAKALGYYAAAGGTAAVCGPLV
FT                   GGIILSAGDPALSWRLLFLVNVPLVLVLVPLALVYLPRAAPQPGQVRPGSTGTHGTDAA
FT                   SSASSSRIHDPSDAAPRRSAVDVPGAVLLGAVVVASLVPTIYGPGPVAVLWAGLGAAAV
FT                   LAFAGWEFSYHRRGRTPLLSPALVKSPGYLLGTVVALCQFGVGAAMAAVTSLYFLSGTG
FT                   LPPLAAAAILAPQAAGMLLASSLSWRFVARHGRTGIVAAIAAALACLPAKDWAVQAFDA
FT                   GAAAAIVAGVGLLQGVATGLVVAPNQTLTLAHAPQGAAGVAAGFYQLSQRFSAALCSAA
FT                   AAGMFLGQGASGGNAREAFHQGILLCCALLAAALLAGGADAVRIAMAGRKARAAVARSE
FT                   KESTTTALAPVPAEPADA"
FT   gene            complement(308437..308814)
FT                   /locus_tag="Achl_0291"
FT   CDS_pept        complement(308437..308814)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0291"
FT                   /product="Rhodanese domain protein"
FT                   /note="PFAM: Rhodanese domain protein; KEGG: aau:AAur_3443
FT                   rhodanese-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38291"
FT                   /db_xref="InterPro:IPR001763"
FT                   /db_xref="InterPro:IPR036873"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q7"
FT                   /inference="protein motif:PFAM:PF00581"
FT                   /protein_id="ACL38291.1"
FT                   /translation="MTTETETDTQLITAAEAAQLIAGGALLVDVRSDAGRNSTGAVPGA
FT                   LVVDRGRVDEDFGPESDERLAQVEGTDQKIVVFCGSVNGSGPFARKLELLGYANAVHVD
FT                   GGFPALRDAGVPTTGPVDAPN"
FT   gene            complement(308856..310202)
FT                   /locus_tag="Achl_0292"
FT   CDS_pept        complement(308856..310202)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0292"
FT                   /product="Luciferase-like monooxygenase"
FT                   /note="PFAM: Luciferase-like monooxygenase; KEGG:
FT                   fal:FRAAL4930 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38292"
FT                   /db_xref="GOA:B8H9Q8"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q8"
FT                   /inference="protein motif:PFAM:PF00296"
FT                   /protein_id="ACL38292.1"
FT                   /translation="MPTASPVPLSVLDLSPAPAGQSAGDALRNSIDLAVAAEDLGYRRF
FT                   WLAEHHLNPGVAGSAPHVLSALVAAATRTIRVGTAATILGNYRPLQVAENIGTLAAVYP
FT                   DRLDLGFGRSGQPSAPVADSTDAGRTTAEPAANAHGSGAGGAGAIAAGASGAAHSAGSA
FT                   GSGSAGAGSAGAGSAGSGSAGSGSAGADVPEQPGEGARVVDGLLVPAARRLFNSVLPRK
FT                   FRLQAELLGREPGDADNFESEVQDVIGFFTGRYRTRHGEEITVTPARGTAPQFWIHGST
FT                   AGPSARLAGKLGLPFGANYHVSPATVLDSVAEYRAHFKPSAALAEPYVTVSADVLVADD
FT                   KESARTLGAGYASWVHSIRTGHGAIPYPAPRDGGRLDAQATAPETGAPDLIRDRVETRF
FT                   VGGPAQVADQLRALQHATGAQELLITSIAHSQRHRVRSYELLAAEWGLS"
FT   gene            310522..311658
FT                   /locus_tag="Achl_0293"
FT   CDS_pept        310522..311658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0293"
FT                   /product="putative monooxygenase"
FT                   /note="KEGG: aau:AAur_3440 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38293"
FT                   /db_xref="GOA:B8H9Q9"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Q9"
FT                   /inference="similar to AA sequence:KEGG:AAur_3440"
FT                   /protein_id="ACL38293.1"
FT                   /translation="MSSRPPLAALKKETMASTPVPELRSKIVALELDGDGAHPAAWRRA
FT                   SHLPGALLGGGRIRETVQAADIAGFHLATFRDSRVLDAGSTGIAGRIDAVQRAAFAAPL
FT                   TRTLGLVPEAGTLFTEPFHVATQLASLDYSSHGRAGWLVSAANEPAEARSVGRQALAEA
FT                   DVLAEAAAVVEAGRRLWDSWEDGAVIRDAATGRYLDRDKLHYADFDGGRFSVKGPSIIP
FT                   RPLQGQLVVFAPADLVPAVEADVALAAAGSVDGLAAAATAAAAAGTPRTLVELDVVLDS
FT                   RGQSAKDRLAELDAYEPWLGGARYAGSAAGLVELLVELFRAADGVRLHPAVLDIDLPEL
FT                   AALVLPELRRAGVAAPRTGTTLRETFGLPRPANRYAAA"
FT   gene            311670..313097
FT                   /locus_tag="Achl_0294"
FT   CDS_pept        311670..313097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0294"
FT                   /product="putative monooxygenase"
FT                   /note="KEGG: aau:AAur_3439 putative monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38294"
FT                   /db_xref="GOA:B8H9R0"
FT                   /db_xref="InterPro:IPR011251"
FT                   /db_xref="InterPro:IPR016215"
FT                   /db_xref="InterPro:IPR036661"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R0"
FT                   /inference="similar to AA sequence:KEGG:AAur_3439"
FT                   /protein_id="ACL38294.1"
FT                   /translation="MSTHHRPAGNGQIQFGVFFQGVNHTTVWKTPESGSQTDFESFRRV
FT                   AQTAERGLFSAFFLGEGLRLREHLGRIHDLDVAGRPDAQTALAALAAVTTNIGLVATQN
FT                   TTYNDPADLAHRLASLDLLSGGRAAWNIVTTDNAWTGANFRRGGFLKHEDRYIRAEAFV
FT                   QTAKAIWDSWADGAIAGSRNAGRWLEEGSITPVRRKDASFDVDITGRLPRSSQHHPVLF
FT                   QAGDSPDGRDFAVRNADVIFSRHAELEDARKFREDIVARTLKAGRPADDVKIFPGQEFI
FT                   LGATEAEAEEKHQWVREQQVGPETAIAYLEQFWGRTLTGYDPDGPLPETDPIVDVTNPT
FT                   RGNAFHGASAKELAAQWRAEATEKGQSIRQFVAARSRLNGRGLVGSYDGIADKLAEYAR
FT                   TGAVDGFNITPWIVPGGLDEIVNELVPRLQDRGVYRTEYEGTNLRENLGLRAPLSRRAS
FT                   LNSGRNGAGLTESENVA"
FT   gene            313094..314770
FT                   /locus_tag="Achl_0295"
FT   CDS_pept        313094..314770
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0295"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: aau:AAur_3438 putative ABC-type
FT                   dipeptide/oligopeptide transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38295"
FT                   /db_xref="GOA:B8H9R1"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R1"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL38295.1"
FT                   /translation="MTRSNQPRLNQPLLNRPRSLPAGPLRRPAAVVGILGTAALLLSAC
FT                   GGGADAGTQQNADATPVSGGNLNFALSVDRGCIDPQQVGNNDAIAIARQTVASLTSQDP
FT                   QSGAIVPWLAEKFESNADATSFTFTLRTGATFADGTAIDAASVKTNFEAIKALGAKASL
FT                   GSTYLSDVSAITVKDPQTVVVDFSKPNAQFLQATSTFTLGLLSPSSASLSEADRCAGKF
FT                   SGSGPFSVKSYTVDKEAVLERRTGYSWPAATNTNTGEAYLDTVTFKIIPEAGNRTGSLQ
FT                   SGQIDATAAISAADITLFNGNGFWNETRANPGVVYNLYPNESTPKLKETAVRQAISKAI
FT                   NREEITTTLLTEKDQPAKGVLSHTTPYFKDFSGLLAHDPDGAKKLLEDAGWKEGTDGVR
FT                   EKNGEKLAFKVTYWQSPKEVLELVQQQLKAVGVDLQLKFTTIADVTAAQATKDYDFSYG
FT                   NLTRSDPDVLRTVFASTTARGGSNLREKLPVDDTLGEQAAALDKDARQKLVDQGQETLI
FT                   KDAHSIPLYELSTTISANEKVHGLAFEASSRLDFYDAWLSQ"
FT   sig_peptide     313094..313249
FT                   /locus_tag="Achl_0295"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.891 at
FT                   residue 52"
FT   gene            314767..315714
FT                   /locus_tag="Achl_0296"
FT   CDS_pept        314767..315714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0296"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_3437 putative
FT                   ABC-type dipeptide/oligopeptide/nickel transport systems,
FT                   permease components"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38296"
FT                   /db_xref="GOA:B8H9R2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38296.1"
FT                   /translation="MIRYVGRRLLQGAFVLWAAYTVSFLILYLLPGDAVSIMASGDEQN
FT                   SVDPALVAKLRSEYGLDRPLPEQYAIALFKALQLDFGVSIKNGVAATQAVSEVLPETIK
FT                   LAAAGFALSVLLGSALAIAASFSRNRWVRQLVASLPPLGIAVPTFWIGLLLLQFFSFRL
FT                   RLFPALGNDGAQSLVLPALTLAIPTSAVIAQLLIRSLHQTLGEPYIEQIRAKGASDALI
FT                   HFGHALRNAAIPTLTMLGILVGNLLAGAVVSETVFSRTGIGRLTVTAVNSRDIPVVQTL
FT                   VVLAAAIFVITSLVVDLIYPLVDPRINTAARTTA"
FT   gene            315723..316721
FT                   /locus_tag="Achl_0297"
FT   CDS_pept        315723..316721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0297"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_3436 putative
FT                   ABC-type dipeptide/oligopeptide/nickel transport systems,
FT                   permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38297"
FT                   /db_xref="GOA:B8H9R3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38297.1"
FT                   /translation="MSQQLLRDSPGPAVDTGDAASAPDPGSEAAAQPAARAGRTSVPAA
FT                   VGPGSAAPPAGAGLARTARGLLKSPGLVLAVLVIAVVILWAMIPGAFTHWPPDTGVPSA
FT                   RLKPPSAEHWFGTDSLGRDLFSRVVHGSATSLAATAVAVAVGLVAGSLLGLLAGFLRGW
FT                   VDDAIMRVMDVLLAIPSLLLSLALITVLGFGTVNIAIAVGIASVANFARIMRAESLRVG
FT                   SAVYVEAARSSGVRWHGILLRHVLPNAAGPVLALSALEFGMAVLSISSLSFLGFGAPPP
FT                   AAEWGSLVAGGRDYLVAAWWLVTLPGLVIAAVVLSTNRISHAFQDPERNRT"
FT   gene            316718..318415
FT                   /locus_tag="Achl_0298"
FT   CDS_pept        316718..318415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0298"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: aau:AAur_3435 putative peptide ABC transporter,
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38298"
FT                   /db_xref="GOA:B8H9R4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL38298.1"
FT                   /translation="MTATPAPDSPPTGTAEPLLKVEGLRVSYLVDGTPREAVHGVSFEV
FT                   NAGEVVAIVGESGSGKTTTAHAIINLLPGNARTDSGSVVFAGADLSRLTRKEWQGVRGR
FT                   DIGLIPQDPTASLDPLQKVGPQVAEALTIHRLRPKKEARRDAVRLLAESGIRDAESRAR
FT                   QYPHQFSGGMRQRVLIASALAARPRLVIADEPTSALDVTIQRQILDNIAALTAERGTAV
FT                   LLITHDLGVAADRADRIIVMRRGEIVETGAAAQVLGSPRHAYTRQLIAAAPGLSPQRLR
FT                   PAGEAVTGRATGDPADPGPSARPLVQARNLRKVFHLPRTAKGPRTLTAVNDVSVEILRG
FT                   ETLALVGESGSGKSTVARLLLRLDKPTSGSVTFDGEDLTTARGERLRQLRRRFQVVFQS
FT                   PYASLDPHFTVEDSVAEPLRAFGEGTPSDRRARVAALLDAVHLPADYGRRHPAELSGGQ
FT                   RQRVAIARALALRPELVVLDEAVSALDVSVQAQILALLSELQGQDGLSYLFISHDLAVV
FT                   QQISDRVAVMRGGELLEAGTTEAVLERPEHGYTRELISAVPGRRTLQA"
FT   gene            318798..319577
FT                   /locus_tag="Achl_0299"
FT   CDS_pept        318798..319577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0299"
FT                   /product="Cof-like hydrolase"
FT                   /note="TIGRFAM: Cof-like hydrolase; HAD-superfamily
FT                   hydrolase, subfamily IIB; PFAM: Haloacid dehalogenase
FT                   domain protein hydrolase; sucrose-6F-phosphate
FT                   phosphohydrolase; Haloacid dehalogenase domain protein
FT                   hydrolase type 3; KEGG: aau:AAur_0105 putative haloacid
FT                   dehalogenase-like hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38299"
FT                   /db_xref="GOA:B8H9R5"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R5"
FT                   /inference="protein motif:TFAM:TIGR00099"
FT                   /protein_id="ACL38299.1"
FT                   /translation="MVALDVDGTLVDHDGHMSPAVRESAQAVVEAGHEVMIATGRSLNA
FT                   TLPIIDKIGVERGYAVCCNGGVTLRLHPELDGGYEIIHKATFDPAPALRALRERLPSAK
FT                   YALEDADGNFLSTERFQDASFGVEAIGVDFQTMLDATAVRVVVFSTENTPEEFNEAIDH
FT                   IGLAGVTYSVGWTAWLDIAAAGVTKASALENLRLQLGIDPSRTVAVGDGRNDIEMLGWA
FT                   GRGVAMGQAPEEVIAIADEVTHSVYDDGAAHVLRSLL"
FT   gene            319664..320257
FT                   /locus_tag="Achl_0300"
FT   CDS_pept        319664..320257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0300"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: art:Arth_0069
FT                   broad-specificity phosphatase PhoE"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38300"
FT                   /db_xref="GOA:B8H9R6"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R6"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACL38300.1"
FT                   /translation="MEGMTLTTFALVRHGQTDWNAERRLQGSTDIPLNDVGRGQARDAA
FT                   AVLSPYEWDAVVSSPLSRAAETADLIAEGLGLTVSRRVPELTERSFGPAEGMQAGPELD
FT                   ALRIPGGFKGAESEDEAASRGLAALEALAEEFSGQRLLVVTHGTLLRVSLSRAIGETLP
FT                   SVDNAALNLAHHHAVDGWQLEYFNGEPVLAATAN"
FT   gene            complement(320315..320914)
FT                   /locus_tag="Achl_0301"
FT   CDS_pept        complement(320315..320914)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0142 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38301"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R7"
FT                   /inference="similar to AA sequence:KEGG:Arth_0142"
FT                   /protein_id="ACL38301.1"
FT                   /translation="MFTLTINQTDSRRDGDRVPQLLKDLRHIPARLDFDRSVEDEVQGI
FT                   VDCPGQAVEAALVALRSGQWYVGIGVGPVNEPLPNQIKDASGHGLIYARRAVDRLRNSK
FT                   ERVPVAVEGPLADIAHDAEAVLRLLGHIVRDRSGAEWRVLDLLTPGVRGQQKAVAQELG
FT                   ITTQAVSKAVARAQWNEEHAARPAAARLLALILEVR"
FT   gene            complement(320971..321534)
FT                   /locus_tag="Achl_0302"
FT   CDS_pept        complement(320971..321534)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0302"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_0127 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38302"
FT                   /db_xref="GOA:B8H9R8"
FT                   /db_xref="InterPro:IPR010432"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38302.1"
FT                   /translation="MTDVHGTAATQSRAEAALWKSARQRVKTLRNGTRVVDATVWRTVK
FT                   AWAVDFGIVVVLSIVAAVLAGSSVSGTAGKAAGAAAATWLIAPWLYGFCCAGGRSLGSL
FT                   ASQTEVVRISTGEAPGFWRAGWVMFARTVLFTVTVLVLILGTAEGSSPSGAEPKGRHLT
FT                   IDRRFPKLPAGAPEAAPYDHPVTA"
FT   gene            321712..324174
FT                   /locus_tag="Achl_0303"
FT   CDS_pept        321712..324174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0303"
FT                   /product="Phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="PFAM: D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; KEGG: art:Arth_0143 fructose-6-phosphate
FT                   phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38303"
FT                   /db_xref="GOA:B8H9R9"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9R9"
FT                   /inference="protein motif:PRIAM:4.1.2.9"
FT                   /protein_id="ACL38303.1"
FT                   /translation="MTGSTGNDVKGNGNAGQATAEQGTLGRGELELVDRWWRAANYLSV
FT                   GQIYLRSNPLLREPLKPEDTKSRLLGHWGTTPGLNFVYAHLNRVIRRDAAEMLFIAGPG
FT                   HGGPAVVANAWLEGTYSEIYGHVGNDEAGLAELFRQFSYPGGIPSHAAPESPGSISEGG
FT                   ELGYSLAHAYGSVLDNPQLVTAVVIGDGEAETGPLAASWHSHNFLDPAADGAVLPILHL
FT                   NGYKIANPTVLARMPQEQLEQLLRGYGHEPYFVTVQDPGKTGQAHQDFAGVLDQCLADI
FT                   RAIQAEHRGAGDVHNGAGDGTSGDHPGHRWPMIVLRSPKGWTGPRTVDGLQVEGTWRAH
FT                   QVPLSEVRTNGEHLKQLEEWLQSYRPEELFDGDGRLRAAVAEAAPTGDFRMSATPHANG
FT                   GVLRRALKLPPYRDYAVEVEAAGTERVSPMITLGSWIRDVIAQNMENFRLFGPDETASN
FT                   RLQNVYEVTDKVWQYRIDDADEHLARSGRVMEVLSEHLCQGWLEGYLLTGRHGVFNCYE
FT                   AFIHIVDSMFNQHAKWLKVHRRLPWRQPVPSLNYLLSSHVWQQDHNGFSHQDPGFIDHA
FT                   VNKKAEVIRVYLPPDANTLLSVMEHCLASTDCVNVVVSGKQPSPTWLGPADAANHCRRG
FT                   LGIWTFAGSEVAGGEPDVVLACAGDVPTVETVAAAELLRNGVPGLKVRVVNVVDLMRLQ
FT                   DESEHPHGLPGRDFDGIFTTDKPIIFAYHGYPALIHRLAYKRTNQEGLHVHGYQEEGTT
FT                   TTPFDMAMLNGIDRFTLAIDAIDRVPGLAEKYSLLRQELQDRRDSAREHTRTHGEDPEE
FT                   IRNWKLGG"
FT   gene            complement(324181..324948)
FT                   /locus_tag="Achl_0304"
FT   CDS_pept        complement(324181..324948)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0144 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38304"
FT                   /db_xref="InterPro:IPR007362"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S0"
FT                   /inference="similar to AA sequence:KEGG:Arth_0144"
FT                   /protein_id="ACL38304.1"
FT                   /translation="MRTLGVDLAAATKKTAVAVIEWSAGSLEKVSARLVHLALDVDDQT
FT                   IVDLFGTSDLTGVDCPVGWPDALIPFLTGHLDNVAAPVLAHDGIAGRRLLAYRDTDRFC
FT                   TARTGLIPLSVSADRLAHPAMRCAVIQAKIAALHGPQSRDGSGRLAEVYPAASLKIWGL
FT                   NGRGYKGRGTTETERLGALLEALQKQAPWLDLAGHEARLAASDDLFDAVVASLTARAVA
FT                   RRRTLLPDEAHAQAARSEGWIHLPDCALDALPD"
FT   gene            complement(324955..326241)
FT                   /locus_tag="Achl_0305"
FT   CDS_pept        complement(324955..326241)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0305"
FT                   /product="Carboxylesterase type B"
FT                   /note="PFAM: Carboxylesterase type B; KEGG: art:Arth_0145
FT                   carboxylesterase, type B"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38305"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S1"
FT                   /inference="protein motif:PFAM:PF00135"
FT                   /protein_id="ACL38305.1"
FT                   /translation="MTGWRDGDVLRATGIPYATAARFQPPAAAADWTDPFAATSLAPAC
FT                   PQGPVPFLDDVLGTRYGELPGSEDCQNLSITMPGDLGPGEKLPVMVWIHGGSYTTGSGD
FT                   LAIFDPARLVAENRVIVVSVTYRLGLFGFLATRTGRPANLGLLDQLEAFRWVQRNIAAF
FT                   GGDPGCVTAFGQSAGGDAIAHLMATSEAPSLFRRAIIQSAPLGIARGRARMNHAMGIAA
FT                   ESVTEETPAMEVVDREAQVAQVSRKFGMLAAMPFGTQYGHAPLPEEKDIAAAWDRSAPG
FT                   IDILIGHTSEEARLFLPRSPFLMRLLKVPGVGAAAVRAVDWVVTETVYGWASRKFASRH
FT                   KRAGGRAHRYLLSWHAPDNLFGAAHTIDLPLLLGNRGTWDGVGLIAGAPWEQVDMTGRA
FT                   VRALWAGFARGDDLGEAGAINNALHYRRA"
FT   gene            complement(326487..326975)
FT                   /locus_tag="Achl_0306"
FT   CDS_pept        complement(326487..326975)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0306"
FT                   /product="Inorganic diphosphatase"
FT                   /EC_number="3.6.1.1"
FT                   /note="PFAM: Inorganic pyrophosphatase; KEGG: art:Arth_0146
FT                   inorganic diphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38306"
FT                   /db_xref="GOA:B8H9S2"
FT                   /db_xref="InterPro:IPR008162"
FT                   /db_xref="InterPro:IPR036649"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S2"
FT                   /inference="protein motif:PRIAM:3.6.1.1"
FT                   /protein_id="ACL38306.1"
FT                   /translation="MKHDVTIEIPKGSRVKYEVDHETGRVRLDRVLFTSMQYPTHYGFF
FT                   ENTLGEDGDPLDALVLLQDFDLHPGVIVESRPIGVFNMTDDGGGDAKVLCVPVDARFDH
FT                   IQEVSDVSEFLIKEIEHFFTRYKDLEPGKWVKAEGWGDRAAAEAELEASIKRYVPTGH"
FT   gene            327131..328660
FT                   /locus_tag="Achl_0307"
FT   CDS_pept        327131..328660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0307"
FT                   /product="D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /note="TIGRFAM: D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase; PFAM:
FT                   peptidase S13 D-Ala-D-Ala carboxypeptidase C; KEGG:
FT                   art:Arth_0147 D-alanyl-D-alanine
FT                   carboxypeptidase/D-alanyl-D-alanine-endopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38307"
FT                   /db_xref="GOA:B8H9S3"
FT                   /db_xref="InterPro:IPR000667"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S3"
FT                   /inference="protein motif:TFAM:TIGR00666"
FT                   /protein_id="ACL38307.1"
FT                   /translation="MTKTTSAEAWHRRALKAAALGLPDRSAGPGKPWHLLLLAALLLVL
FT                   ALPAAALVVPGFVGPEPPAPAPEAPPWQREPSAVASPQGLAPLQSTAPVPDPAVLAARV
FT                   DPLLQADGGGTFTGIVQDALTGQVLFDRGGADGRVPASNMKLLTSVAALRALGPEHTFA
FT                   TRVVAGPAANQVVLVGGGDVLLGPGESKPGEVMGRAGLTTLAAQTVASLQANGATGEIK
FT                   VLLDDSLFTGPALNPAWQEGDVAAGEVAPVYPLAMNSARYDPAVTTGPRPQDAAQSAAE
FT                   EFASRLRAAGAAAGLAVAAGVERSPGAGSTKPTAGTERPEVLAEVQSATVASQVDLLLQ
FT                   ESDNYLAEVMGRMASIADGGPGSNDGATAAVSNQLAQAGIAAGPLTLVDVCGLAMGNQV
FT                   SAAQFAEVVRAITTGTDARLRAALDGFPVAGLTGTLDSRYGDESTVQGAGLVRAKTGTL
FT                   NTVLALSGYVVDADGRLLVFSFIGNGLTPGAAGNKVALDRAATALAGCGCR"
FT   sig_peptide     327131..327286
FT                   /locus_tag="Achl_0307"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.794) with cleavage site probability 0.705 at
FT                   residue 52"
FT   gene            complement(328662..328844)
FT                   /locus_tag="Achl_0308"
FT   CDS_pept        complement(328662..328844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0308"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38308"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38308.1"
FT                   /translation="MIPYRPIAPLTAGPKKGWKAVVAAVLVAALLGTTAPAAIAAEPPS
FT                   AAGPAYGVADSGEAR"
FT   sig_peptide     complement(328722..328844)
FT                   /locus_tag="Achl_0308"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 41"
FT   gene            329083..330213
FT                   /locus_tag="Achl_0309"
FT   CDS_pept        329083..330213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0309"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0148 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38309"
FT                   /db_xref="InterPro:IPR018766"
FT                   /db_xref="InterPro:IPR022454"
FT                   /db_xref="InterPro:IPR042271"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S5"
FT                   /inference="similar to AA sequence:KEGG:Arth_0148"
FT                   /protein_id="ACL38309.1"
FT                   /translation="MESTAAQSAPISSADAASLINWDLAASTAARLAPAGPDLKPVAIN
FT                   EAVDSLRRLADASVPHVHEITGLEAARDLRDSSVLVVDRASWAKANTQSFAVMLKPAMQ
FT                   KMLDNRRGSLSPSAASVSGAITGSQLGAVLAFLSSKVLGQYDPFAALAENSSAPAAGRL
FT                   LLVAPNIVSVERELNVTPEDFRLWVCLHEQTHRVQFAAAPWLRHHMLDQIDNLSGHLLG
FT                   NVDSLMDRASAAARSLKDRSASGNTPGRGAILDLLQDPEEKAAISHLTAVMSLLEGHAN
FT                   VVMDAVDASIVPSVKTIRQRFNDRGKDRGVVEKFIRSLLGLDAKMRQYSDGARFVRAVV
FT                   AVAGMEGFNRVWESADHLPTEPEIHDAKLWLERMGL"
FT   gene            330373..331428
FT                   /locus_tag="Achl_0310"
FT   CDS_pept        330373..331428
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0310"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: art:Arth_0149
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38310"
FT                   /db_xref="GOA:B8H9S6"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015262"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S6"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACL38310.1"
FT                   /translation="MLGDALAQAGYPAHVLVACSGGPDSMALAAVASYFARRGSIDSHP
FT                   VTVGAVVVDHQLQEGSGRVAADTAGALRELGLAPVDVHTVTVAGAGMGPEAAAREARHA
FT                   ALEAAAADQGAGAILLGHTLDDQAEQVLLGLARGSGTRSLAGMRPTRAGAGSAVLLRPF
FT                   LGLRRADTEEICEVEELDPWHDPTNTDPAFARSRTRVEVLPHLEEKLGPGVAESLARTA
FT                   SILQLDADYLEDVAESTYTSLVQWNGGEASLPEDALRDLAPAIRFRVIAKAAAGVGGQQ
FT                   PSYRRLVAAEALLRRQGSAGPVQLPGGVAAYRLSLAELEGPGTADRPGTGPREPARCGK
FT                   LVFRPQKPATH"
FT   gene            331459..332010
FT                   /locus_tag="Achl_0311"
FT   CDS_pept        331459..332010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0311"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /EC_number="2.4.2.8"
FT                   /note="KEGG: art:Arth_0150 hypoxanthine
FT                   phosphoribosyltransferase; TIGRFAM: hypoxanthine
FT                   phosphoribosyltransferase; PFAM: phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38311"
FT                   /db_xref="GOA:B8H9S7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S7"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACL38311.1"
FT                   /translation="MDSNDVQADLKHVLYTKEQIQQRITELAAQIDKDYEGRELLIVGV
FT                   LKGAVMVMADLARALHSHVSMDWMAVSSYGSGTQSSGVVRILKDLDTDLMGKDVLIVED
FT                   IIDSGLTLSWLKTNLESRGTASVEICTAFRKPTAAKVQIDVKYVGYDIPNEFVVGYGLD
FT                   YAEKYRNLDFVGTLAPHVYE"
FT   gene            332017..332388
FT                   /locus_tag="Achl_0312"
FT   CDS_pept        332017..332388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0312"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: sus:Acid_5268
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38312"
FT                   /db_xref="GOA:B8H9S8"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S8"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL38312.1"
FT                   /translation="MQLGGFSVGLAVQDLAASMEFYRKLGFTQYAGSPDQNWVIMKNGT
FT                   NNIGLFKGILEKNVLIFNPGWDQDAKPLESFTDVRELQEQLRAQGVPFAAEADAQTTGP
FT                   ASAILIDPDGNPVYLDQHV"
FT   gene            332427..333431
FT                   /locus_tag="Achl_0313"
FT   CDS_pept        332427..333431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0313"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; SMART: regulatory protein LacI;
FT                   KEGG: aau:AAur_0695 LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38313"
FT                   /db_xref="GOA:B8H9S9"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9S9"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACL38313.1"
FT                   /translation="MAAGVSATTVSHVLNDVTYARISPETRTKVKAAAEQLGYGPNRVA
FT                   QALRNRRTGVLGLVSEDVATTPHAGRIILGADDAARARGYTLMLINTAASAGPQSREGD
FT                   VEAVLERQVDGILYATMYHRVLDAPANLGKVPAVLVDAVTADGRFPSVVPDEYGGARTA
FT                   VRALLDAGHTRIGFINNVQDVPSTSERLRGFRDTLTAAGLDGGLAPVEASSSDAAGGYA
FT                   AAARILRRGHPPSGLFCYNDQMAMGAYRAAAELGLSIPGDLSVVGFDDQELVAGSLFPG
FT                   LTTVALPHYGMGAWAANHLIDALEGAGDGSSAGTTVLECPLVTRASVAAPRNP"
FT   gene            333596..335659
FT                   /locus_tag="Achl_0314"
FT   CDS_pept        333596..335659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0314"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /EC_number="3.6.4.3"
FT                   /note="KEGG: art:Arth_0151 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38314"
FT                   /db_xref="GOA:B8H9T0"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T0"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACL38314.1"
FT                   /translation="MKAKNFFKGPGIWIVVVVGLLLVAFATLAPGGASRIDTDKGLELL
FT                   AGTNVEQAKIFDGENRVDLTLKDDLEVDGQNKGKSVQFFFVDARATDVVKAVTDSKPAQ
FT                   GYTDQPIESNWFSGLLSLLIPVILLGALFWFLMTRMQGGGSKIMQFGKSKAKMVSKDMP
FT                   QVTFADVAGSDEAVEELQEIKEFLQEPAKFQAVGAKIPKGVLLYGPPGTGKTLLARAVA
FT                   GEAGVPFFSISGSDFVEMFVGVGASRVRDLFEQAKANSPAIIFVDEIDAVGRHRGAGIG
FT                   GGNDEREQTLNQLLVEMDGFDVKTNVILIAATNRPDVLDPALLRPGRFDRQIGVEAPDM
FT                   IGRDQILQVHAKGKPMAPGVDLKAVAKKTPGYTGADLANVLNEAALLTARSNANLIDDR
FT                   ALDEAIDRVMAGPQKRSRVMKEHERKITAYHEGGHALVAAALRNSAPVTKITILPRGRA
FT                   LGYTMVVPDNDKYSVTRNELLDQMAYAMGGRVAEEIVFHDPSTGASNDIEKATGTARKM
FT                   VTEYGMSERVGAVRLGQGGGEPFLGRDAGHERNYSDQIAYVVDEEVRRLIDQAHDEAYA
FT                   ILTENRDVLDSLALELLERETLNQAEIADIFRDIRKRDFREVWLSKESRPVQTAGPVES
FT                   QRERAEREAQEEAKQARLDEPLDAQPPHPQGVPEDAPFQGGVPESGPDTLRG"
FT   sig_peptide     333596..333676
FT                   /locus_tag="Achl_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.946) with cleavage site probability 0.683 at
FT                   residue 27"
FT   gene            335669..336313
FT                   /locus_tag="Achl_0315"
FT   CDS_pept        335669..336313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0315"
FT                   /product="GTP cyclohydrolase I"
FT                   /EC_number="3.5.4.16"
FT                   /note="PFAM: GTP cyclohydrolase I; KEGG: art:Arth_0152 GTP
FT                   cyclohydrolase I"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38315"
FT                   /db_xref="GOA:B8H9T1"
FT                   /db_xref="InterPro:IPR001474"
FT                   /db_xref="InterPro:IPR018234"
FT                   /db_xref="InterPro:IPR020602"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T1"
FT                   /inference="protein motif:PRIAM:3.5.4.16"
FT                   /protein_id="ACL38315.1"
FT                   /translation="MTSFDDDAVSASAAYPAEDGSAHAPHHKVDRPRIEAAVREILLAI
FT                   GEDPDRGGLIDTPKRVAKAYAEVFAGLHQDPADVLSTTFELDHEELVLVKDIPFYSTCE
FT                   HHLVPFHGVAHVGYIPSHDGRVTGLSKLARLVDIYARRPQVQERLTTEIVEALVRHLKP
FT                   RGAIVVVECEHMCMSMRGIRKPGAKTVTSAVRGQLHDPATRAEAMSLILGR"
FT   gene            336326..337246
FT                   /locus_tag="Achl_0316"
FT   CDS_pept        336326..337246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0316"
FT                   /product="dihydropteroate synthase"
FT                   /EC_number="2.5.1.15"
FT                   /note="KEGG: art:Arth_0153 dihydropteroate synthase;
FT                   TIGRFAM: dihydropteroate synthase; PFAM: dihydropteroate
FT                   synthase DHPS"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38316"
FT                   /db_xref="GOA:B8H9T2"
FT                   /db_xref="InterPro:IPR000489"
FT                   /db_xref="InterPro:IPR006390"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T2"
FT                   /inference="protein motif:TFAM:TIGR01496"
FT                   /protein_id="ACL38316.1"
FT                   /translation="MDSLAAAPGTGPATSPLPILRKPRPAARFEDLPTDRTLVMGILNV
FT                   TPDSFSDGGKHATADTAIAAGLRMFYAGADIIDVGGESTRPGADDVSPDEEQKRVIPVI
FT                   EALVKAGALVSIDTTHAVTAAAALKAGAAIINDVSGLTIEPEMAELVASSKAPYILTHR
FT                   RGDARTMNSLAEYTDVAGEVVAELAGVRDKLYAAGVSAEQIIVDPGLGFAKNDAHNWEL
FT                   LQNLEQLEALGHRVLVAASRKRFLGTLLTVAGKSAAPEERDGATAAITAISASRGAWAV
FT                   RVHDVGSSLDAVKVAARMAAVPKAP"
FT   gene            337261..337668
FT                   /locus_tag="Achl_0317"
FT   CDS_pept        337261..337668
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0317"
FT                   /product="dihydroneopterin aldolase"
FT                   /note="TIGRFAM: dihydroneopterin aldolase; KEGG:
FT                   art:Arth_0154 dihydroneopterin aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38317"
FT                   /db_xref="GOA:B8H9T3"
FT                   /db_xref="InterPro:IPR006156"
FT                   /db_xref="InterPro:IPR006157"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T3"
FT                   /inference="protein motif:TFAM:TIGR00525"
FT                   /protein_id="ACL38317.1"
FT                   /translation="MDRITLTGVTAVGHHGVFDFERREGQPFVVDAVLYLDFAAAALSD
FT                   DVSDTAHYGEVAQRITEWISGEPLNLIEALAVRIADGLLSEFGLQAVDITVHKPQAPIE
FT                   VPFGDVAVSVHRERPAAVSGGPVEPASGGTP"
FT   gene            337665..338210
FT                   /locus_tag="Achl_0318"
FT   CDS_pept        337665..338210
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0318"
FT                   /product="2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase"
FT                   /EC_number="2.7.6.3"
FT                   /note="KEGG: art:Arth_0155
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; TIGRFAM:
FT                   2-amino-4-hydroxy-6-hydroxymethyldihydropteridine
FT                   pyrophosphokinase; PFAM:
FT                   78-dihydro-6-hydroxymethylpterin-pyrophosphokinase HPPK"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38318"
FT                   /db_xref="GOA:B8H9T4"
FT                   /db_xref="InterPro:IPR000550"
FT                   /db_xref="InterPro:IPR035907"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T4"
FT                   /inference="protein motif:TFAM:TIGR01498"
FT                   /protein_id="ACL38318.1"
FT                   /translation="MNAVYTKAVLALGSNLGERNDTLSGAVADLVDPPEVRLLAVSPII
FT                   QTKAVGGPPGQPDFLNMVLTVETSLAPHELLEHCQAVENKHHRVREVRWGPRTLDVDII
FT                   TYGDVRSDDPVLTLPHPRAAGRAFVLYPWSLIDPAATLEGERISTLAARAADYGDLAPF
FT                   DGFGDFDGMPTAGAVTDR"
FT   gene            338207..338755
FT                   /locus_tag="Achl_0319"
FT   CDS_pept        338207..338755
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0319"
FT                   /product="conserved hypothetical membrane protein"
FT                   /note="KEGG: art:Arth_0156 conserved hypothetical membrane
FT                   protein with unknown function"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38319"
FT                   /db_xref="GOA:B8H9T5"
FT                   /db_xref="InterPro:IPR021517"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T5"
FT                   /inference="similar to AA sequence:KEGG:Arth_0156"
FT                   /protein_id="ACL38319.1"
FT                   /translation="MKPIDPLRLLLIGVILTVAGWAGTVITSRYGMATPVLPATALATM
FT                   GVIVAITLILGIRILRWRNSIKPNSTAKKTALDPLLAARTLILAQACAYAGTVLLGWHV
FT                   GIFLDQLRIWSFRSHQDIAWLALGMAGGGLVMIIVGLVVERFCKIPPEDGDTKGVDGKP
FT                   GRAPRGEAAGEGEYAYRGD"
FT   sig_peptide     338207..338275
FT                   /locus_tag="Achl_0319"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.855) with cleavage site probability 0.614 at
FT                   residue 23"
FT   gene            338736..339248
FT                   /locus_tag="Achl_0320"
FT   CDS_pept        338736..339248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0320"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: aau:AAur_0144
FT                   putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38320"
FT                   /db_xref="GOA:B8H9T6"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T6"
FT                   /inference="protein motif:PFAM:PF03703"
FT                   /protein_id="ACL38320.1"
FT                   /translation="MRTEAIDPPGIDWHRVSPKFVTVRLVQWAIGNLAAVVILSLPLVF
FT                   VLLEWWRWPPLWLAITVPAVTLVVALWRLVLIPRQVRAIGYAERDDDLLVRSGIFFQRT
FT                   MAVPYGRMQYVDVAVGPVERSLGLCTVKLHTASPGTNAHIPGLPEAEGARLREQLAARG
FT                   EARLAGL"
FT   gene            339371..340936
FT                   /locus_tag="Achl_0321"
FT   CDS_pept        339371..340936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0321"
FT                   /product="membrane-flanked domain protein"
FT                   /note="PFAM: membrane-flanked domain; KEGG: art:Arth_0158
FT                   membrane-flanked domain"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38321"
FT                   /db_xref="GOA:B8H9T7"
FT                   /db_xref="InterPro:IPR005182"
FT                   /db_xref="InterPro:IPR014529"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T7"
FT                   /inference="protein motif:PFAM:PF03703"
FT                   /protein_id="ACL38321.1"
FT                   /translation="MPAGSVPGASTPAADGAGRGITTPDDGWLRVHPASPFVRGWVALA
FT                   AIGFFFGRDIFERTLQGRPMFEDGFAGRVPWLVAGGGAVLLVAVLSFVLTWYFTKYQVS
FT                   GGYVRVNTGFLFRQQRQARLDRVQAIDIVQPLLARIFGLAELKFEVADAGESAVRLAYL
FT                   KIDDAQQLRATILARAAGIDEDAGNPGAPAPEAPEYPVLSVPPSRLIGSLLLSEQSLFV
FT                   VVGGVASVVLSAVTDNRAFYFYLIPAALGLAASYWNLFNKGYNFRAAISPDGIRLRYGL
FT                   LDTQAQTLPPGRIQALKISQPPLWRPFGWYRMQVNVAGYGLLENAGEASSRTTLLPVGK
FT                   LDDAMNMLALVLPDPGTSRPGEVFGAGLTGLDSDGGFVTTPRRARLLAPLGWRRNGFAA
FT                   TDTALLIRSGRWWRNLVLVPHQRTQSMALHQGPLARRFRVADLVLHTTAGPVVPRLTQA
FT                   GLDEARALFDEQSARARLARRRQTTEQWLRQVVPPTSGAESPATETGPFGNEAHQQQEG
FT                   PHHG"
FT   gene            340929..341822
FT                   /locus_tag="Achl_0322"
FT   CDS_pept        340929..341822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0322"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0159 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38322"
FT                   /db_xref="GOA:B8H9T8"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR018931"
FT                   /db_xref="InterPro:IPR019665"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037108"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T8"
FT                   /inference="similar to AA sequence:KEGG:Arth_0159"
FT                   /protein_id="ACL38322.1"
FT                   /translation="MAKPGRLGVGIIGAGKVGAVLGAALRAAEHAVVGVSAVSEASRER
FT                   AETLLPGVPILEVQDIVERAELVLLAVPDDALPGLVDGLAKLGAWQPGQLVAHTSGRFG
FT                   VGVLHPVRAAGAVPLALHPAMTFTGMSLDLTRLLDCTFGVTADAAMLPIAQALVVEMGA
FT                   EPVAIAEADRTLYHAALAHGSNHLVTLVAQSSQLLREVGVEQPERMLGPLLRATLENAL
FT                   ASGESALTGPVARGDVGTVEAHAQALREYDGGGHGDVLAAYLAMARATARRAEGRGLLK
FT                   AEQLEGLNQALESKED"
FT   gene            341825..342730
FT                   /locus_tag="Achl_0323"
FT   CDS_pept        341825..342730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0323"
FT                   /product="pantoate/beta-alanine ligase"
FT                   /EC_number="6.3.2.1"
FT                   /note="KEGG: art:Arth_0160 pantoate--beta-alanine ligase;
FT                   TIGRFAM: pantoate/beta-alanine ligase; PFAM:
FT                   Pantoate-beta-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38323"
FT                   /db_xref="GOA:B8H9T9"
FT                   /db_xref="InterPro:IPR003721"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR042176"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9T9"
FT                   /inference="protein motif:TFAM:TIGR00018"
FT                   /protein_id="ACL38323.1"
FT                   /translation="MAIKLVTTVAGLHAESARLLREKQGASQGLVPTMGALHEGHAALA
FT                   RTAVEQNDVVVASIFVNPLQFGDAVDLDRYPRTLEADLALLDAQGVDIAFAPLVEEVYP
FT                   GGEPLVRITSGRLGEKWEGASRPGHFDGALTVVAKLLHYGIPAAGRAGGVGLPAYRAYF
FT                   GQKDAQQLALVRRMVADLNFPVDIVGVPTVRSAEGLALSSRNRFLSDEEREAALVLSRA
FT                   LRLLEERANAHEPLDLESALAMVESQPLVTLDYFDVVDPATLEPLAENCRETPFRGEAL
FT                   ALIAAKVGPVRLIDNAPLSS"
FT   gene            complement(342812..344569)
FT                   /locus_tag="Achl_0324"
FT   CDS_pept        complement(342812..344569)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0324"
FT                   /product="HNH endonuclease"
FT                   /note="PFAM: HNH endonuclease; SMART: HNH nuclease; KEGG:
FT                   art:Arth_0370 HNH nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38324"
FT                   /db_xref="GOA:B8H9U0"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U0"
FT                   /inference="protein motif:PFAM:PF01844"
FT                   /protein_id="ACL38324.1"
FT                   /translation="MEGLRASKASLDALLLRDAQLDCAQDPDAEGEAAVVDVLERKSEL
FT                   RLQRLVFWKQLEAQIAAGKARDAADFAEFQEAMTPSEATGSERAFVEMSTTAEVAGVLT
FT                   LSPGAAAAFISQSRKVCAMPLVLDSLASGLMSWRHAVIVADETGCLAPESAEALVSHFF
FT                   DPDAPNRARGSAPGDLVTHLFRRKVRTWRERTYPQTVQERHVRCVADRRMEYRPDADGM
FT                   ASITLILPGDTACAIWNKTTAIARGLQGPGETRTLTQLRPDTAAALLLSAGPGSRAGNS
FT                   AGTSGPMDAGAAGTHPSGSDGSPETFEGRNIGGDMFAIDLSKVPYFVDLSKIPTPKADV
FT                   LVTIPLFTMLGSTDEPADLDGYGPIPAAMARKLVADGATSFYRVLVDPRDGAPLEIGRT
FT                   SYRLSEAMKRWIRMRDGHCTFPGCSSSSTDNDTDHLTAWQHDGTTGVSNLAQLCPKHHR
FT                   LKHNSGWTPTAATTTEPPGWTSPTGRHYPGQHPDPQPPHLPPALLEQKQPVTEDIRAAE
FT                   EPHAASHTAADTPLKTVREGEPASDHAPARDVGAAGESGATGELGVPAINQPDELSPLE
FT                   RALTDHLAA"
FT   gene            344935..345501
FT                   /locus_tag="Achl_0325"
FT   CDS_pept        344935..345501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0325"
FT                   /product="intracellular protease, PfpI family"
FT                   /note="TIGRFAM: intracellular protease, PfpI family; PFAM:
FT                   ThiJ/PfpI domain protein; KEGG: aau:AAur_0082 PfpI family
FT                   intracellular peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38325"
FT                   /db_xref="GOA:B8H9U1"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR006286"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U1"
FT                   /inference="protein motif:TFAM:TIGR01382"
FT                   /protein_id="ACL38325.1"
FT                   /translation="MSEHNIAGKKVAFLLTDGVEQVELTSPWQAVKDAGGEPTLVAPGS
FT                   GKLQGFNGTDKGDTFDVDLTVAEANASDFDALVIPGGVVNADHLRADKGAQSFTRSFFE
FT                   QHKPVASICHGPWVLIDAGVVSGRNVTSYFTLETDLKNAGANWTDEEVVVDQGLVTSRN
FT                   PDDLPAFNSKLVEEIAEGQHAGQTA"
FT   gene            345628..347100
FT                   /locus_tag="Achl_0326"
FT   CDS_pept        345628..347100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0326"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   art:Arth_0161 drug resistance transporter, EmrB/QacA
FT                   subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38326"
FT                   /db_xref="GOA:B8H9U2"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U2"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACL38326.1"
FT                   /translation="MSTEVSPNANGQPAQAAGTKPAVPEKMSRESVTIISTLLVATFVV
FT                   ILNETIMNVALQRLMVDLQVDAPTVQWLSTGFMLTMAVVIPTTGFILQSLSTRAVFMLA
FT                   MGLFAGGTALAAVAPGFEILLLARIVQAGGTAIMLPLLMTTILTLVPLAKRGAVMGNVS
FT                   IAISVAPAMGPTVSGLILEHFTWRFMFVFVLPVALAALAIGAKYLTNIGETEKTKLDFL
FT                   SVFLTVPAFGGLVYGLSQIGGGHGGQAGPSAGAVAALVIGVAALAVFVLRQVRLQKAEA
FT                   PLLDLRAFNFRMFTVSVLLMVVAMMALFGGVILLPLYLQEVRGLGSLETGLALLPGGLA
FT                   MGLLGPVIGRLFDKVGPLPLTVTGSILMVVTLWQFSMLDAGTAVAWIVTLHVGLSFGLA
FT                   LLFTPAFTTGLNPLPPHLYSHGSAIMSTTQQVAGAAGTALLVSIFSVVSATSGLVAGMS
FT                   AAFMTATVIAFAAVVLSAMMRKTEGSGHGPAH"
FT   gene            complement(347163..347999)
FT                   /locus_tag="Achl_0327"
FT   CDS_pept        complement(347163..347999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0327"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: art:Arth_0162
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38327"
FT                   /db_xref="GOA:B8H9U3"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U3"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACL38327.1"
FT                   /translation="MTRENIRTPDGGTLELFTTGADLASGGSGVVIVPPSMVTAADYTK
FT                   FAQKLSAALGRPVHTFNRRGRGSSSPQPEDYTLDVDIRDLDAVMKHTSSTDVFGHSFGG
FT                   AVALHAARTLPVERLAVYDPAVSVNQSVKADWIGEYETAIAAGDDDRALAVIQRGLEAP
FT                   GPLSSRMPLSMMTLANKLTAGTSEGKQQRELMRTGVREIKAIIAADMPAEPFLELPLET
FT                   LIVVGEKSPAYFGVACGQIHDVLSGSSYTILPGFGHDGVIKAPDKLVKELSDFYAG"
FT   gene            complement(348100..348954)
FT                   /locus_tag="Achl_0328"
FT   CDS_pept        complement(348100..348954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0328"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: art:Arth_0163
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38328"
FT                   /db_xref="GOA:B8H9U4"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U4"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACL38328.1"
FT                   /translation="MKEQVLPTHDGGRLALYSYGTEDAPGEKRVVLIGGAFLTALIYRP
FT                   FSIALAKGLGEGWAVDVYDRRGRGSSSPQPPGYSMATEIEDVRTVMDATGARNILGHSL
FT                   GGSVALNAVQEFTGTGYVPDKLAVYDAAVNIDGSIDIKWLDGFEKAVNDGKVGHALAHM
FT                   KKATSPGSAMARIPEPVLAGLMAVLSRTKVNKVFRQVMPSGVGELRAAYNEKDHARDFS
FT                   VLPAGTHFMAGGKSPSYYKVTAQRLHAAVPGSTFELSPKCFHGSIPAAVKELVADISAY
FT                   FTA"
FT   gene            349023..350561
FT                   /locus_tag="Achl_0329"
FT   CDS_pept        349023..350561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0329"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: art:Arth_0165 lysyl-tRNA
FT                   synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38329"
FT                   /db_xref="GOA:B8H9U5"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U5"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACL38329.1"
FT                   /translation="MIVTSQNTPTPKNAPEPLDASEQMRIRMEKRAKLLERGAEAYPVG
FT                   VERTHSLAEVREKYAHLEADETTGDVVGVTGRVVFVRNTGKLCFATLQEGGTDGKGTRL
FT                   QAMLSLANVGEEALADWKALVDLGDHVFIKGEVISSRRGELSVMAESWGMASKALRPLP
FT                   VLHAELNEETRVRQRYVDLMVRDEAREMVYTRAAITRSIRETLFRHRYVEVETPILQLV
FT                   HGGALARPFETHMNAFDQKMTLRIATELYLKRAVVGGIDRVYDMGRVFRNEGVDSTHSP
FT                   EFTTLECYEAWADQFVMAERIKEIILDAADAVGAGRTVQTEAGEINLDGDWAWLAVYPG
FT                   LSDAVGQEITPDTPLEVLRDIAAKHEVKVDPKWDAEKTVVELFGEIVEPTLLNPTFVYD
FT                   YPPSAQPLARPHREDGRLIEAWDLIIGGMERGTAFSELIDPVIQRERLTEQSRHAAAGD
FT                   DEAMQLDEDFLRALEYGAPPMGGIGLGIDRLVMLFTGAGIRETILFPLLKPEGH"
FT   gene            350564..350737
FT                   /locus_tag="Achl_0330"
FT   CDS_pept        350564..350737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0330"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0166 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38330"
FT                   /db_xref="GOA:B8H9U6"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U6"
FT                   /inference="similar to AA sequence:KEGG:Arth_0166"
FT                   /protein_id="ACL38330.1"
FT                   /translation="MEYVAVLLPSLVVGLLFWFAMKAVFNADKSERQAEARAQAEADAR
FT                   ADLGDRPDTGQN"
FT   gene            350880..351215
FT                   /locus_tag="Achl_0331"
FT   CDS_pept        350880..351215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0331"
FT                   /product="Lsr2-like protein"
FT                   /note="KEGG: art:Arth_0167 Lsr2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38331"
FT                   /db_xref="InterPro:IPR024412"
FT                   /db_xref="InterPro:IPR042254"
FT                   /db_xref="InterPro:IPR042261"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U7"
FT                   /inference="similar to AA sequence:KEGG:Arth_0167"
FT                   /protein_id="ACL38331.1"
FT                   /translation="MAQKVNIILVDDLDGGSADENVKFGLDGVNYEIDLSAANATELRS
FT                   SLERYVGAARKSSGGRAAAKAKAPAGSGRSHDSAQIRQWARDNGYTVNSRGRIQAEIQE
FT                   AYQKANS"
FT   gene            351729..354221
FT                   /locus_tag="Achl_0332"
FT   CDS_pept        351729..354221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0332"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; ATPase associated with various
FT                   cellular activities AAA_5; ATPase AAA-2 domain protein;
FT                   SMART: AAA ATPase; KEGG: art:Arth_0168 ATPase AAA-2 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38332"
FT                   /db_xref="GOA:B8H9U8"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U8"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACL38332.1"
FT                   /translation="MFERFTDRARRVVVLAQEEARMLNHNYIGTEHILLGLIHEGEGVA
FT                   AKALESLSISLDGVREQVQEIIGQGQQAPSGHIPFTPRAKKVLELSLREALQLGHNYIG
FT                   TEHILLGLIREGEGVAAQVLVKLGADLNRVRQQVIQLLSGYQGKETTGAGVGGGQPEGA
FT                   PAGSVVLDQFGRNLTQAARENKLDPVIGREQEMERVMQVLSRRTKNNPVLIGEPGVGKT
FT                   AVVEGLAQAIVRGDVPETIKDKQLYTLDLGSLVAGSRYRGDFEERLKKVLKEIRTRGDI
FT                   ILFIDEIHTLVGAGAAEGAIDAASILKPMLARGELQTIGATTLDEYRKHIEKDAALERR
FT                   FQPIQVKEPSVAHAIEILKGLRDRYEAHHRVTITDGALASAASLAERYISDRFLPDKAI
FT                   DLIDEAGARLRIRRMTAPPELKAMDERIAKLKMEKESAIDAQDFEGAAALRDKEQKMIS
FT                   ERSEKERHWKSGGMDDISEVDEDLIAEVLANSTGIPVFKLTEEESSRLLKMEDELHKRV
FT                   VGQDEAIKALSQAIRRTRAGLKDPKRPGGSFIFAGPTGVGKTELAKALAEFLFGEEDAL
FT                   ITLDMSEYSEKHTVSRLFGAPPGYVGYEEGGQLTEKVRRRPFSVVLFDEVEKAHADLFN
FT                   SLLQILEDGRLTDSQGRVVDFKNTVIIMTTNLGTRDISKSVATGFQSGTDTQTGYNRMR
FT                   ARVTEELKQHFRPEFLNRVDDVVVFPQLTQDEIIEIVDLFVTRLEKRLKDKDMGIELTS
FT                   AAKVLLATRGYDPAMGARPLRRTIQREIEDQLSEKILFGEIHPGDIVVVDVEGEGDDAK
FT                   FTFAGNAKPRIPEIAPSV"
FT   gene            354579..356732
FT                   /locus_tag="Achl_0333"
FT   CDS_pept        354579..356732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0333"
FT                   /product="peptidase S9 prolyl oligopeptidase active site
FT                   domain protein"
FT                   /note="PFAM: peptidase S9 prolyl oligopeptidase active site
FT                   domain protein; KEGG: art:Arth_0169 peptidase S9, prolyl
FT                   oligopeptidase active site domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38333"
FT                   /db_xref="GOA:B8H9U9"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9U9"
FT                   /inference="protein motif:PFAM:PF00326"
FT                   /protein_id="ACL38333.1"
FT                   /translation="MANQNPAIPDEQPLTPFHDLDHYLSIPRVGGLALSPDGTRLVTTV
FT                   STLNGKGTEFATALWELDPKGQKHARRITRSAKGEAGAAFAANGDVYFTSARPDPDSPE
FT                   EEPVNALWLLPADGGEARVVLSRPGGVSRVMTARNADATFVAADVLAGSADEEDDAERR
FT                   KSRKDKKVSAILHSEYPVRYWDADLGPAQPRIFAVEPGEDQAWGKPGTVDAAAPLALRN
FT                   LTPDAGPRLREADTVVSPDGRTVYSSYTKPLAKADSRSVLVAVDVASGSLKVLLDHEGM
FT                   SYFPGPVSPDGRTLVVVSESDSTPQQAPEIKLHLLDVSGSAGNAADAADGAAESAAGLR
FT                   PLAHDWDRWPKPAAWLPDGSALLATADDDGASPVFRISVPAAAAEVGVARVTQDAAAYS
FT                   DVVVSPEGRYAYALRSSYEFPAEAVRIDLATGETTRLPAPAERPSCPGRLERIAATAPD
FT                   GSRVPAYLALPEGASADDPAPLLLWIHGGPLGSWNAWTWRWNPWLLTARGYAVLLPDPA
FT                   LSTGYGQAFIQRGWGAWGKTPFTDLMAVSDAAVDRPDVDETRTAAMGGSFGGYMANWVA
FT                   GNTDRFKAVVTHASLWALDQFGPTTDASQYWLKEMTEEMALENSPHLHAEKISTPMLVI
FT                   HGDKDYRVPIGEGLRLWYELLSKSKLAADQDGQTAHRFLYFPDENHWILQPQHAKIWYG
FT                   VVESFLAKNVLGQDLDLPPELGL"
FT   gene            357030..357539
FT                   /locus_tag="Achl_0334"
FT   CDS_pept        357030..357539
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0334"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   art:Arth_0170 N-acetylglutamate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38334"
FT                   /db_xref="GOA:B8H9V0"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR010167"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V0"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL38334.1"
FT                   /translation="MTDAFHIRPARTSDVSAIKKLVAPLAEERILMAKETVAYYESLQE
FT                   FKIAESDDGEVIGCGALHVMWEDLAEVRTLAASGDWRGKGVGHVLVERLLEEARALGVA
FT                   RVFCLTFEVDFFKRHGFEVMADQSAVDPVVYSELLRSHDEGVAEFLDLARVKPNTLGNT
FT                   RMIRFL"
FT   gene            357832..358833
FT                   /locus_tag="Achl_0335"
FT   CDS_pept        357832..358833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0335"
FT                   /product="dihydroxyacetone kinase, DhaK subunit"
FT                   /EC_number="2.7.1.29"
FT                   /note="KEGG: art:Arth_0172 dihydroxyacetone kinase, DhaK
FT                   subunit; TIGRFAM: dihydroxyacetone kinase, DhaK subunit;
FT                   PFAM: Dak kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38335"
FT                   /db_xref="GOA:B8H9V1"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR012736"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V1"
FT                   /inference="protein motif:TFAM:TIGR02363"
FT                   /protein_id="ACL38335.1"
FT                   /translation="MKKLINDPKSVVAESVQGFGLAHADLVTINEDPTYITRKDAPVNG
FT                   KVGLVSGGGSGHEPLHAGYVGKGMLDAAVPGAVFTSPTPDQILPATLAVNSGAGVVHIV
FT                   KNYTGDVLNFETAAELAEAEGVSVRTVLVNDDVAVEDSLYTAGRRGVGGTVLVEKIAGA
FT                   AAERGDSLDDVASIGERVNANVRTMGVALSACTVPHAGQPSFDLADDEIEIGIGIHGEP
FT                   GRHRIPLENADGITDRLLEPVLADLNIGSGDKVLLFVNGMGGTPQSELYIVYRRAVQVL
FT                   KDKGATVERSLVGNYITALEMQGCSISVLRLDDELTELWDAPVHTAALRWGA"
FT   gene            358836..359468
FT                   /locus_tag="Achl_0336"
FT   CDS_pept        358836..359468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0336"
FT                   /product="dihydroxyacetone kinase, L subunit"
FT                   /note="TIGRFAM: dihydroxyacetone kinase, L subunit; PFAM:
FT                   Dak phosphatase; KEGG: art:Arth_0173 dihydroxyacetone
FT                   kinase, L subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38336"
FT                   /db_xref="GOA:B8H9V2"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR012737"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V2"
FT                   /inference="protein motif:TFAM:TIGR02365"
FT                   /protein_id="ACL38336.1"
FT                   /translation="MVLDAAWAVRWLNLCAEAMAEHRVELIELDRAIGDSDHGENMDRG
FT                   FQAVVAKLDEGAPETPGAAMKLTAMTLMSKVGGAAGPLYGTAFLRAATSLGDSAEIDPG
FT                   AWAAALAAARDGIVARGKAEPGDKTMVDAWTPAVDAARAAADGGSSDVLAVLVAAAEAA
FT                   EAGAVATDPLVARKGRASYLGERSAGHRDPGAVSSALILRAAVGAAA"
FT   gene            359465..360157
FT                   /locus_tag="Achl_0337"
FT   CDS_pept        359465..360157
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0337"
FT                   /product="dihydroxyacetone kinase, phosphotransfer subunit"
FT                   /note="TIGRFAM: phosphocarrier, HPr family;
FT                   dihydroxyacetone kinase, phosphotransfer subunit; PFAM: PTS
FT                   system fructose subfamily IIA component; phosphoryl
FT                   transfer system HPr; KEGG: art:Arth_0174 dihydroxyacetone
FT                   kinase, phosphotransfer subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38337"
FT                   /db_xref="GOA:B8H9V3"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR004701"
FT                   /db_xref="InterPro:IPR012844"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="InterPro:IPR036662"
FT                   /db_xref="InterPro:IPR039643"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V3"
FT                   /inference="protein motif:TFAM:TIGR02364"
FT                   /protein_id="ACL38337.1"
FT                   /translation="MTVSIVVVSHSEKIADGAVELAAQMAPNVSILAAGGTGDGRIGTS
FT                   LEKVMAALDKAAGGDGAVILADLGSAVMTAESALEFVDDPEKFLLADAPLVEGLVAASV
FT                   AAQGGADVDGVRRAAEAVRGPAQHIESGRQTVEEGSVTGRGPDFTGDFELINQAGMHAR
FT                   PAAKIAGGLSSLAADVTVNGVDGASMTALMTLAAGKGSVLHVEAWGADAERAVNYVGGL
FT                   VQAGFGEP"
FT   gene            360246..360413
FT                   /locus_tag="Achl_0338"
FT   CDS_pept        360246..360413
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0338"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38338"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38338.1"
FT                   /translation="MEQLHPEDNSPAIEVLDGQTTVEELLADLGFEWRPQYVGDPGQPA
FT                   GGQFSQPALF"
FT   gene            complement(360485..360973)
FT                   /locus_tag="Achl_0339"
FT   CDS_pept        complement(360485..360973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0175 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38339"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V5"
FT                   /inference="similar to AA sequence:KEGG:Arth_0175"
FT                   /protein_id="ACL38339.1"
FT                   /translation="MRTRGLLLALMTTAGLTAGCGPGAVACPAIAQATAVSVTVAADYA
FT                   PLVGTLHVKACQDGTCKEGPVELAPGSASIDQGCTPDGVCSATASPDGTKVGMLMLDTL
FT                   TESVMTVTASGTGADGSALPVRTLEFRPRADYPFGEQCGKFISASVTLDAAGLRDAQG"
FT   sig_peptide     complement(360893..360973)
FT                   /locus_tag="Achl_0339"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.477 at
FT                   residue 27"
FT   gene            complement(361078..361509)
FT                   /locus_tag="Achl_0340"
FT   CDS_pept        complement(361078..361509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0340"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0858 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38340"
FT                   /db_xref="GOA:B8H9V6"
FT                   /db_xref="InterPro:IPR021994"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V6"
FT                   /inference="similar to AA sequence:KEGG:AAur_0858"
FT                   /protein_id="ACL38340.1"
FT                   /translation="MRIILYIVWALFVVAAAFAMVHAIRKTRRQEQLMASWPKVQATVT
FT                   GSVAGWTSGGGGSSRSRRFFPTYQFTDPRGTLFMGKSEISTAAVPAPGSLIEVAYNPGD
FT                   PNESLQVSSAPRTTLGCLVPFFAVFAVALFWFISVFPLG"
FT   sig_peptide     complement(361438..361509)
FT                   /locus_tag="Achl_0340"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.981) with cleavage site probability 0.558 at
FT                   residue 24"
FT   gene            complement(361560..362486)
FT                   /locus_tag="Achl_0341"
FT   CDS_pept        complement(361560..362486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0341"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: helix-hairpin-helix motif; HhH-GPD family
FT                   protein; Endonuclease III HhH domain protein; SMART:
FT                   iron-sulfur cluster loop; KEGG: aau:AAur_0183 putative
FT                   A/G-specific adenine glycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38341"
FT                   /db_xref="GOA:B8H9V7"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR003651"
FT                   /db_xref="InterPro:IPR004036"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR023170"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V7"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACL38341.1"
FT                   /translation="MEFLHRRITGWFAETARDLPWRDPGCGAWGVLVSEIMLQQTPVVR
FT                   VLPVWEEWLKRWPTPAGLAAEPAGEAVRNWGRLGYPRRALRLHAAATAIVENHNGRVPD
FT                   TYTELLALPGVGSYTAAAVAAFAYGRRETVVDTNIRRVHARLVAGAALPAPALTAAEMR
FT                   LAASLLPDDDAASVRWNAAVMELGALVCTARAPKCADCPVKDSCAWRAAGEPPPSYVPK
FT                   GQAWHGTDRQVRGAVMAVLRLADAPVPAEMFLQPPADLGFAPEGIGVPLAALHRLNSAP
FT                   EQLERAMSGLLTDGLAEIHDGGYRLPA"
FT   gene            362722..363372
FT                   /locus_tag="Achl_0342"
FT   CDS_pept        362722..363372
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0342"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38342"
FT                   /db_xref="GOA:B8H9V8"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V8"
FT                   /inference="similar to AA sequence:KEGG:AAur_0184"
FT                   /protein_id="ACL38342.1"
FT                   /translation="MAPGSSGVPKASPAVYRRRRLFVGGALLMVIALVITGFAISGVLG
FT                   GASQQASSTVPTTAAPAASPEASAPPSAAPSASATPTPSATPGCNQNLVTISASTDKAA
FT                   YGDGENPRLTLKVTNGGTVACEVNLGTSQMEFLVTSGADRVFSSKDCQAASEDLEKTLA
FT                   PGASETANFTWQRNRTVEGCQAVAAKPGSGGAYYIFTAKLGSKASPKAVFQLN"
FT   gene            complement(363440..364516)
FT                   /locus_tag="Achl_0343"
FT   CDS_pept        complement(363440..364516)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0343"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: art:Arth_0190 protein of unknown
FT                   function DUF147"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38343"
FT                   /db_xref="GOA:B8H9V9"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9V9"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACL38343.1"
FT                   /translation="MARSPEESLRATLGRVAPGTPLRDGLERILRGRTGALIVLGSDRT
FT                   VDSICSGGFDIGIEFSPTRLRELAKMDGAIICDKDAGNILRAAVQLVPDSSIETQESGT
FT                   RHRTAERVAIQTGVPVVSVSQSMQIIALYVNGLRHVLEGSEKVLARANQALATLERYRA
FT                   RLDQVTSSLSALEIEAMVTVRDVAVTLQRQEMVRRISEEISQYVLELGEDGRLLSLQLD
FT                   ELTVGRGPGSDVIIRDYAGPDASPEDIDKAVSALLNLGPTELIDLGKISGIIGFAGGVD
FT                   TLDAIVQPRGYRLLSGLKAVPKAVADRLVDHFGGLQFLMAATIDDLMTVDGIGDQRART
FT                   VREGLSRMAEASLLDRFL"
FT   gene            complement(364781..365272)
FT                   /locus_tag="Achl_0344"
FT   CDS_pept        complement(364781..365272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0344"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgi:Mflv_3626 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38344"
FT                   /db_xref="InterPro:IPR009097"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W0"
FT                   /inference="similar to AA sequence:KEGG:Mflv_3626"
FT                   /protein_id="ACL38344.1"
FT                   /translation="MRSIELVFDDDTESAVRADWVRLAEAGLPSLAGHTGASNRPHLTL
FT                   AAGAELFVPPLHAFEGALPLSVDFSGVQVFAAGRDKYVLARSVVLTTPLRKVHQRLHRE
FT                   IGGAVPQTLPGAWTPHVTLARRLTGEQLGKAMDLLDLRLGGTIVAARLWDSTTRSVTGL
FT                   "
FT   gene            complement(365377..365583)
FT                   /locus_tag="Achl_0345"
FT   CDS_pept        complement(365377..365583)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0345"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38345"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38345.1"
FT                   /translation="MTTPGNPFHDPFASSSAPARMQEHSTGQGDAGPHPKGVQSAAELK
FT                   ALRAASLARVSKDLERMLRVRAR"
FT   gene            365725..367338
FT                   /locus_tag="Achl_0346"
FT   CDS_pept        365725..367338
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0346"
FT                   /product="peptide chain release factor 3"
FT                   /note="TIGRFAM: peptide chain release factor 3; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain 2 protein; KEGG:
FT                   art:Arth_0191 bacterial peptide chain release factor 3
FT                   (bRF-3)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38346"
FT                   /db_xref="GOA:B8H9W2"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004548"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR032090"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR038467"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W2"
FT                   /inference="protein motif:TFAM:TIGR00503"
FT                   /protein_id="ACL38346.1"
FT                   /translation="MSQDVLTPARINEIHKEAGRRRTFAVISHPDAGKSTLTEALALHA
FT                   KVIGTAGASSGKANRKETVSDWMQMEKDRGISISSAALQFSYRDTVINLLDTPGHADFS
FT                   EDTYRVLAAVDCAVMLVDAAKGLETQTMKLFEVCKQRNLPIITVINKWDRPGLDALALM
FT                   DEITERTGLQPMPLTWAVGISGDFRGVWDLRNDRFARFQRNNAGAQIALTEYFTPEEAA
FT                   ESQGSNWTDAVDEAGLVIESNLEFDVDAFHAGKATPILFSSAALNFGVKELLDALVDFA
FT                   PPAAPRPDVDGSPRPVESPFSGFVFKVQAGMNKAHRDHVAFIRVCSGVFERGMVVTQTR
FT                   TGKSFATKYAQQVFGREREVIDEAYPGDVVGLVNASSLRVGDSLFLEDSVEYPAIPLFA
FT                   PEHFQVARSKDPSKFKQFRRGIEQLEHEGVIQVLRSDVRGDQAPVLAAVGPMQFEVVED
FT                   RMAHDFSAPMRLERLPYSLARISTADAMPALANVPGAEVLLRSDGEYLALFNDVWALRR
FT                   IEKNHPDLTLVPIGTHNPAK"
FT   gene            367346..368581
FT                   /locus_tag="Achl_0347"
FT   CDS_pept        367346..368581
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0347"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: art:Arth_0304
FT                   3-oxoacyl-[acyl-carrier-protein] synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38347"
FT                   /db_xref="GOA:B8H9W3"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W3"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACL38347.1"
FT                   /translation="MTEPTTAQPRALVTGAGTINPLGASVAETWQALLAGESGITALEE
FT                   DWAGQLPVKIAGQVSVDLSQHLSTREMKRMDRCGQLALIAAREAWTQAGAPEVDPERFA
FT                   VVIGSAYGGLGSTIEQDRVLAASGPRKVSPHTLTRLMVNGPAAWVSIDLGARGGARTPV
FT                   SACASGAEAIVQAAEMIRSGAADVVIAGGVDASVNDLVISGFSQIRALSTRPGDPAEAS
FT                   RPFDGGRDGFVLSEGAGMVVLESEAHARARGAAVLGEVAGGAVTSDANDIVAADPAMQR
FT                   RVMQKALASAGMEPADIGFVHAHATSTPVGDRLEGQAISAIFGTEVPVTSTKGHTGHLL
FT                   GGAGALAAVVVLEALRTGQLPGTLNVEAVDAEVDLNVVTEPAFALAASARSGLVNAFGF
FT                   GGHSVALVISGA"
FT   gene            complement(368689..370103)
FT                   /pseudo
FT                   /locus_tag="Achl_0348"
FT   gene            complement(370285..371613)
FT                   /locus_tag="Achl_0349"
FT   CDS_pept        complement(370285..371613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0349"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: bra:BRADO1564 (D)-glucarate dehydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38348"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR034598"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W4"
FT                   /inference="protein motif:PFAM:PF01188"
FT                   /protein_id="ACL38348.1"
FT                   /translation="MSGQPTIAGVEVVPVAGHDSMLMNLSGAHGPFFTRNVVILTDSDG
FT                   RTGLGEVPGGEKIRTTIEEAGALLKGKPVARYRSLLRDIAAEFADRDAGGRGLQTFDLR
FT                   TTVHAVTAVESALLDLHGQFLGIPVAELLGDGQQRTSVPMLGYLFFVGDHKRTDLPYLV
FT                   EESPSDRWEELRRQEAMTPGAVVALAEAAQERYGFSDFKLKGGVLSGDDEVDVVTALAK
FT                   RFPDARVTLDPNGGWLLDDAIRLGKRMQGVVAYAEDPCGAEGRFSGREVMAEFRRATGL
FT                   KTATNMIATDWREMSHAIRSNAVDIPLADPHFWTMHGSVRVAQLCNEFGLTWGSHSNNH
FT                   FDISLAMFTHTGAAAPGEITALDTHWIWQDGQGLTKNPLQIKAGAIEVPAAPGLGIELD
FT                   REALERAHQLYLEHGLDARDDSIGMQYYIDGWSFDPKRPCLVR"
FT   gene            complement(371610..373223)
FT                   /locus_tag="Achl_0350"
FT   CDS_pept        complement(371610..373223)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0350"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: art:Arth_0036
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38349"
FT                   /db_xref="GOA:B8H9W5"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W5"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL38349.1"
FT                   /translation="MTLTGHSLIAGRTVAGEGKTTFGFNPATNEALEPAYTLLTEEQLA
FT                   TATAAAKDAYASFSTLDPETHASFLESIADNIEAIGDELLVRAGQETGLPAARLTGERA
FT                   RTTGQLRLFAAVVRQGDYRGVRIDPAIPDRAPLPRADIRQRQIPLGPVAVFGASNFPLA
FT                   FSTAGGDTASALAAGCPVVFKAHNAHPGTSELVGHAIAKAVTDNGLHPGVFSLIYGPGS
FT                   SIGQALVADPAIKAVGFTGSQSAGIALMKTAAARPEPIPVYAEMSSLNPVFVFDGALAG
FT                   DPESIDALAAAYVTAVTGSSGQLCTSPGLLFAPAGEAGDKFAAAVGRAVAASAGQTMLT
FT                   AGIAGSWNTGTGALSAADGVELIGQGTPGPTENAPAPAIFGTGVEQFTTNHVLHEEIFG
FT                   AASLVIRYTGAEDLLSAASRIEGQLTASLHLTEADYATAAPLIPVLEQKVGRIIVNGWP
FT                   TGVEVGHAMVHGGPFPATSDTRTTSVGTLAINRFLRPVAYQNIPQELLPAPLQDTNPWH
FT                   LNRRIDGDVVAAPQKAEVGA"
FT   gene            complement(373251..374165)
FT                   /locus_tag="Achl_0351"
FT   CDS_pept        complement(373251..374165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0351"
FT                   /product="5-dehydro-4-deoxyglucarate dehydratase"
FT                   /note="TIGRFAM: 5-dehydro-4-deoxyglucarate dehydratase;
FT                   PFAM: dihydrodipicolinate synthetase; KEGG: art:Arth_0037
FT                   5-dehydro-4-deoxyglucarate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38350"
FT                   /db_xref="GOA:B8H9W6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR017655"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8H9W6"
FT                   /inference="protein motif:TFAM:TIGR03249"
FT                   /protein_id="ACL38350.1"
FT                   /translation="MAKYTPNELADTLKEGLLSFPVTSFDANLQFDEENYRKHLAWQAS
FT                   FPVAGLFAAGGTGEGFSLTPAESERVVRTAVDEVGSRVPVLASAGGSTAQAIENAKAAE
FT                   AAGADGILLLPPYLTEADQAGLVEHVSAVCRATSLGVIIYNRANAIYKDTTVATLADRH
FT                   ANLIGFKDGVGDLEHDARVYAKLGDRLFYLGGLPTAETFALPLLQLGMSTYSSAMYNFV
FT                   PQFALDFYQDVRNQDRAAVNKKLNDFVIPYLDIRDRVKGYSVSIVKGGLDAIGRSAGPV
FT                   RTPLQNLAPQDLADLKALIATVS"
FT   gene            complement(374341..375225)
FT                   /locus_tag="Achl_0352"
FT   CDS_pept        complement(374341..375225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0352"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: art:Arth_0038 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38351"
FT                   /db_xref="GOA:B8H9W7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL38351.1"
FT                   /translation="MFTFDQLAGFIAVAEELHFGRAAERLNMTQPPLSRQIQKLEKIVG
FT                   AELLERDNRKVTLTSAGEAFLDEARRLMALAERAPVTARRIASGRSGVLRVGFTAASGF
FT                   SILGPLLGELAGIIPDVDIDLQELVTGEQLSGLLTGELDLGLARPPFDSETFDSHLLYR
FT                   ESMVVAVPAGHPLTLLARDITAEDFKDEPLIMHSPTQARYFYDLVVRMLPIRHANVVHT
FT                   VSQILTMVSLVAAGRGLAFVPHSATLLGIKDVEFLPLEAGRGEEVELHALWNRRITNPA
FT                   LARLLRDLEFAME"
FT   gene            375364..376374
FT                   /locus_tag="Achl_0353"
FT   CDS_pept        375364..376374
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0353"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   msm:MSMEG_0122 putative periplasmic solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38352"
FT                   /db_xref="InterPro:IPR005064"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR042100"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W8"
FT                   /inference="protein motif:PFAM:PF03401"
FT                   /protein_id="ACL38352.1"
FT                   /translation="MKHFPTRRAILGTASAFTLLALTACGGNVGGGAAAGNSSKFPSGP
FT                   VTLTVGQAAGGSTDLIARALAEGATKTLGSPMPVVNKPGANGALATKEVAGKAADGQEL
FT                   VLLTASLITITPLAVSADEAVNIDDLEIIAGLSQDDYVLVASQQSGFKSFKDVTGAGRN
FT                   VTFGTTGVGTGSQLAQTVLFKQANVKGTDVPFDSGKPALTAVLGNQVELATIQLGEAMP
FT                   QIEAGKVSPLLVFSEERNSFLPDVPSAKEAGYDVPVAQYRAVAAPKGTPQEVKDKLLAS
FT                   FQDTFKTDAYKEFNKKNLLTPKELSGEEVVTEWKGYAEKYKELVEKYDISLGGNK"
FT   sig_peptide     375364..375444
FT                   /locus_tag="Achl_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.511 at
FT                   residue 27"
FT   gene            376380..376964
FT                   /locus_tag="Achl_0354"
FT   CDS_pept        376380..376964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0354"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_0123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38353"
FT                   /db_xref="GOA:B8H9W9"
FT                   /db_xref="InterPro:IPR009936"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9W9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38353.1"
FT                   /translation="METTPAVSSGRDGSSAVTPAGGAGDAPNELPEALTPEQLAAQWEE
FT                   EKPPAAGPLANAASSLVVLGVGIGALVLSVAMGLGTLSAPQPGLWPFMASSVMVALGLF
FT                   QLILGRHNRDAEKFTRMSLAPLIGLATLATMVALMPVIGFEIPALILCVIWMKFLGGET
FT                   WRSTILVSVLVVVAFYAIFILALGTSIPHVF"
FT   gene            376974..378533
FT                   /locus_tag="Achl_0355"
FT   CDS_pept        376974..378533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0355"
FT                   /product="protein of unknown function DUF112 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF112
FT                   transmembrane; KEGG: msm:MSMEG_0125 integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38354"
FT                   /db_xref="GOA:B8H9X0"
FT                   /db_xref="InterPro:IPR002823"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X0"
FT                   /inference="protein motif:PFAM:PF01970"
FT                   /protein_id="ACL38354.1"
FT                   /translation="MDFLNPVINGFSVVLEPMNLLYCLVGVVIGMLIGVLPGLGPAATI
FT                   AILLPLTYGVEPVTAIIMLAGIFYGAQYGGTITSVLLRLPGEASSVVTVFDGYQMARQG
FT                   KAGTALGLAAIGSFIGGTAAIIGLTFLAPLVAGFALDFGPPEYSALAMLGILLVATISG
FT                   GSKVKALIAASVGLLLATVGRDIFTGESRFTFGSLQLADGIDFVPIAMGIFGLGEILYN
FT                   LEERHRAAKAPSKVSNVWPSKGELKHASGAIGRGSVLGFFLGILPGGGATIASMASYAM
FT                   EKKRAKQPERFGKGAPEGVAGPETANNAAATSSFIPLLTLGIPANATMALMFGALLIQG
FT                   VTPGPQLVEQEPELFWGVVNSMYIGNILLLIMSLPLVGIFVRILRVRAAILAPITALIT
FT                   LLGAYTINNSMFDVTLVVVFGVVGYLMKKFGFEPGPLVLAFVLGELLESSLRRSLLVFD
FT                   GDPTGFFTRPISATLLAVFVLVAVLPGIRSVIAKRKGTTAASASAGDGINNDGANNIKE
FT                   KV"
FT   gene            378530..378934
FT                   /locus_tag="Achl_0356"
FT   CDS_pept        378530..378934
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0356"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: aau:AAur_0701
FT                   universal stress family domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38355"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X1"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACL38355.1"
FT                   /translation="MSIIVGFVPTPAGEAALTAGIAEAQLRNQELFIVNSARQGALVDK
FT                   SVAPEDVLAEAAARATAAGIKATVIQPPYQHDLADEFLDVAREVDASLIVIGLRHRTQV
FT                   GKFILGSHAQQILMQADRPVLAVKADGGNF"
FT   gene            378952..379257
FT                   /locus_tag="Achl_0357"
FT   CDS_pept        378952..379257
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0357"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38356"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38356.1"
FT                   /translation="MYQRSPLRRIAARRGPARVAGPAEVPDWSRLGRGDDVEVLPPRGT
FT                   AVAGTIDMIAPDRSVFWMIRRDGGGRTMVCSGDDVSVAMVARAKAARPPQPEAGCP"
FT   gene            complement(379333..379821)
FT                   /locus_tag="Achl_0358"
FT   CDS_pept        complement(379333..379821)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0358"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: art:Arth_3569 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38357"
FT                   /db_xref="GOA:B8H9X3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X3"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACL38357.1"
FT                   /translation="MPVRSAGLLLYRRDTDGAGSNPELQVWIAHMGGPFWARKDSHAWS
FT                   IPKGEYGDSEDPLEAALREFAEEIGTPAPAAEYRPLGDFRQSGGKVITVFTAEQDFRPE
FT                   SIASNTFPLEWPRGSGRIQHFPEIDDARWFPLQAAREKLVKGQLPVLDALLTELGAAE"
FT   gene            379932..380201
FT                   /locus_tag="Achl_0359"
FT   CDS_pept        379932..380201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0057 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38358"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X4"
FT                   /inference="similar to AA sequence:KEGG:Arth_0057"
FT                   /protein_id="ACL38358.1"
FT                   /translation="MANIAEVMGRLTPEELDELHRLGPQGHLPRHLQDALDRAAGGPGS
FT                   GRGYYVPTGNVSSTGGPLLVLRSDVSSWLFSSHRDDPDQLPQHP"
FT   gene            complement(380276..381649)
FT                   /locus_tag="Achl_0360"
FT   CDS_pept        complement(380276..381649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0360"
FT                   /product="DNA repair protein RadA"
FT                   /EC_number="2.1.1.63"
FT                   /note="KEGG: art:Arth_0200 DNA repair protein RadA;
FT                   TIGRFAM: DNA repair protein RadA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38359"
FT                   /db_xref="GOA:B8H9X5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X5"
FT                   /inference="protein motif:TFAM:TIGR00416"
FT                   /protein_id="ACL38359.1"
FT                   /translation="MATKTSRASKAPAYKCAECGWTTVKWVGRCGECQAWGTVEETGTA
FT                   VARTTAATTVVEPARRIAEVDATTAAFLPTGVAELDRVLGGGLVPGAVILLAGEPGVGK
FT                   STLLLDVAAKFARTAQDVLYVTGEESAAQVKLRAERIDAVAESLYLSAETDLGQALGQV
FT                   EKIEPRLLIVDSVQTLSSADVDGSAGGVSQVREVAASIIAAAKRRNMTTLLVGHVTKDG
FT                   SIAGPRLLEHLVDVVCQFEGERHSRLRLLRAVKNRYGPTDDVGCFDLNENGIEGLTDPS
FT                   GLFVSRTKDPVSGTCITVTMEGRRPLLAEVQSLLAESPNSQPRRATSGLDSSRVSMLLA
FT                   VLQQRAGTQLHKDDSYVATVGGVKLSEPATDLAVALAVASAKARKPLPVRLIAFGEVGL
FT                   AGEVRPVPGINQRIQEAHRLGFTHAVVPASHTGPGPVPSGFSVREVEHLTEALSLLIG"
FT   gene            complement(381788..382915)
FT                   /locus_tag="Achl_0361"
FT   CDS_pept        complement(381788..382915)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0361"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0201 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38360"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X6"
FT                   /inference="similar to AA sequence:KEGG:Arth_0201"
FT                   /protein_id="ACL38360.1"
FT                   /translation="MAPAAGLSAGRHFLRGRFRTGIIRSRNSLVPAIQMTVCAVGAYAF
FT                   AEYVLGHSGPLFAATSSLIALGFSREPRLRRVLEVGLGCTIGIAVGDLLLHWLGSGIWQ
FT                   AAVVLLFSILLARFLDSGNIFTTQLALQSLLVVLLPAPSGGPFTRSIDAVVGGLCALLV
FT                   TILMPKDPRREPRKDVQNLLHELAEVLRECAEALAHSDSTKAWHALVRGRNCQPLVDGM
FT                   RHSLRASNEVARLAPAHRRHRDELDRLKESLDFIDLALRNSRVFARRLTSAINHAALSD
FT                   EATENIAEVLQETAAAIEELSLGLAETHDGVRRAHLRTARNELSEIALRLHPKLLEVQR
FT                   LEGETVVMLFRPLMVDLLEATGMDAQEARDVLPAL"
FT   gene            383183..384304
FT                   /locus_tag="Achl_0362"
FT   CDS_pept        383183..384304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0362"
FT                   /product="phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein"
FT                   /note="TIGRFAM: phosphate ABC transporter, periplasmic
FT                   phosphate-binding protein; PFAM: extracellular
FT                   solute-binding protein family 1; KEGG: aau:AAur_0195
FT                   phosphate ABC transporter, phosphate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38361"
FT                   /db_xref="GOA:B8H9X7"
FT                   /db_xref="InterPro:IPR005673"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X7"
FT                   /inference="protein motif:TFAM:TIGR00975"
FT                   /protein_id="ACL38361.1"
FT                   /translation="MKALRFGRHAAIAVIAAGALALTACGSDNATGTTPAGNQASSGPK
FT                   VTGTLTGIGASSTGAAMDAWKAGFASANQGATVQYSPDGSGAGRKAIIDGSAQFAGSDA
FT                   YLKDEELESSKAICGPDGAINIPVYISPIAVAFNIPNVTELKLDATTVAKIFRGQITNW
FT                   NDPAIAALNEGVSLPDLKVTPVNRSDDSGTTTNFTDYLASAAPEVWTDKSSGVWPASLQ
FT                   GENAKGTSGVVKTVTDTPGAVTYADDSAVGGKLGTASIKVGEEFVKISADAAAKAVEAG
FT                   KPVDGRSATDVSIKLDRKTTAAGAYPVVLVSYHVVCSAYDKQETVDLVKAFENYVVSDV
FT                   GQQAAADSAKSAPLSSSLAEKAQKAIDSIKVKS"
FT   sig_peptide     383183..383275
FT                   /locus_tag="Achl_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.599 at
FT                   residue 31"
FT   gene            384412..385344
FT                   /locus_tag="Achl_0363"
FT   CDS_pept        384412..385344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0363"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstC"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstC; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: art:Arth_0203
FT                   phosphate ABC transporter, inner membrane subunit PstC"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38362"
FT                   /db_xref="GOA:B8H9X8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR011864"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X8"
FT                   /inference="protein motif:TFAM:TIGR02138"
FT                   /protein_id="ACL38362.1"
FT                   /translation="MTATSLTSTQGAGRAGDKVFSGAALAAGCLILAVLFGVALFLVVQ
FT                   AIPALTAPAAEIQGGEGFFAYIWPIVIGTLIAAVIALVIATPIAIGVALFISHFAPRGL
FT                   AAGLGYVVDLLAAIPSVVYGAWGATFLAREISPAYNWLADNMGWLPIFQGPASATGKTI
FT                   LTAGIVLSVMVLPIITSLSREIFLQTPKLHEEAALALGATRWEMIKMSVLPFARPGIIS
FT                   AVMLGLGRALGETMAVALVLSSGALTASLIQSGNQTIAAEIALNFPEASGLKVSTLIAA
FT                   GLVLFVITLAVNMIARWIITRHKEFSGAN"
FT   gene            385345..386457
FT                   /locus_tag="Achl_0364"
FT   CDS_pept        385345..386457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0364"
FT                   /product="phosphate ABC transporter, inner membrane subunit
FT                   PstA"
FT                   /note="TIGRFAM: phosphate ABC transporter, inner membrane
FT                   subunit PstA; PFAM: binding-protein-dependent transport
FT                   systems inner membrane component; KEGG: art:Arth_0204
FT                   phosphate ABC transporter, inner membrane subunit PstA"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38363"
FT                   /db_xref="GOA:B8H9X9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR005672"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9X9"
FT                   /inference="protein motif:TFAM:TIGR00974"
FT                   /protein_id="ACL38363.1"
FT                   /translation="MTSTLTPVRSKRSALTKGQLPKYAPYIVLAAALIVGAAILALIGF
FT                   NAFGWGLVSALLFAVGLVSWSAAVEGSRKAKDRLATCLVVGSFLVALLPLVSVIWTVLV
FT                   NGVPGLLNPGFLSNSMNGVTGVYDNRAVEEGAPVLGGIYHALLGTVQITLLATVISVPV
FT                   GLLTAIYLVEYGNDGRLARAITFFVDVMTGIPSIVAGLFAAAFFFAVVGPGTKTGAVAA
FT                   VALSVLMIPVVVRSSEEMLKIVPNELREAAYALGVRKWRTILKVVIPTAISGIASGVTL
FT                   AIARVIGETAPILVTAGFATSINGNVFGGWMASLPTFIYTQILNPTSPANPDPSSERAW
FT                   GAALVLIILVMILNLAARLIARIFAPKAGR"
FT   sig_peptide     385345..385494
FT                   /locus_tag="Achl_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.836 at
FT                   residue 50"
FT   gene            386530..387309
FT                   /locus_tag="Achl_0365"
FT   CDS_pept        386530..387309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0365"
FT                   /product="phosphate ABC transporter, ATPase subunit"
FT                   /note="KEGG: art:Arth_0205 phosphate ABC transporter,
FT                   ATPase subunit; TIGRFAM: phosphate ABC transporter, ATPase
FT                   subunit; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38364"
FT                   /db_xref="GOA:B8H9Y0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005670"
FT                   /db_xref="InterPro:IPR015850"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y0"
FT                   /inference="protein motif:TFAM:TIGR00972"
FT                   /protein_id="ACL38364.1"
FT                   /translation="MSKRIDVKDLNVYYGDFLAVEDVSINIEAKSVTAFIGPSGCGKST
FT                   FLRTLNRMHEVIPGARVEGEVLLDGDNLYGNGVDPVTVRSQIGMVFQRPNPFPTMSIRD
FT                   NVLAGVKLNNKKISKGEADVLVERSLKGANLWNEVKDRLDKPGSGLSGGQQQRLCIARA
FT                   IAVEPQVILMDEPCSALDPISTLAIEDLINELKDQYTVVIVTHNMQQAARVSDKTAFFN
FT                   IAGTGKPGKLIEFGDTHTIFSNPVEKATEDYVSGRFG"
FT   gene            complement(387366..387773)
FT                   /locus_tag="Achl_0366"
FT   CDS_pept        complement(387366..387773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0366"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38365"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y1"
FT                   /inference="similar to AA sequence:KEGG:AAur_0298"
FT                   /protein_id="ACL38365.1"
FT                   /translation="MSTSNPRRPLPQPRQLGCATCGTENHVTIHSVTALDPAGGDLVTV
FT                   SYTCDACRQFQEHLAYATDVAAVLHQVRSMAQVIMFGDEYVHCGYPMAEAAFEIVRLGY
FT                   RTGGAGDDPGAVCLPTRVLRCRCGFQLEVPA"
FT   gene            complement(387941..388951)
FT                   /locus_tag="Achl_0367"
FT   CDS_pept        complement(387941..388951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0367"
FT                   /product="phosphate transporter"
FT                   /note="PFAM: phosphate transporter; KEGG: art:Arth_0206
FT                   phosphate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38366"
FT                   /db_xref="GOA:B8H9Y2"
FT                   /db_xref="InterPro:IPR001204"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y2"
FT                   /inference="protein motif:PFAM:PF01384"
FT                   /protein_id="ACL38366.1"
FT                   /translation="MTAVFFGAVVVLTAAFAFLNGFRDVSLSTALPVRNRALTPSVAVL
FT                   LAAFFNFVGALLSATLAVAVSQTWISLPSGTDGLAILVSGLLSACAWGLLMWWRGIPVP
FT                   STHTLVGGLAGAGVASLAVGGTGVGGADQSLLLQVVLPLLLSPLVAYSGAFLLVYPATW
FT                   AARHTQPSVVNQRFRRSQAIAAGAVAFGHGLQDGQRVSAVLLLALLAAGYSDGGNIPMW
FT                   VVLLSAVMIAAGTLFGGWRISHTIGYKLTRVDPLRGSVAQIYSALMLFVGALALHWPLS
FT                   TTHTVTSAVLGAGENQHFSVTNRKLVIRIVGLWVLTPLATAALAFVLALALSAAG"
FT   gene            complement(388953..389573)
FT                   /locus_tag="Achl_0368"
FT   CDS_pept        complement(388953..389573)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0368"
FT                   /product="putative Pit accessory protein"
FT                   /note="KEGG: art:Arth_0207 putative Pit accessory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38367"
FT                   /db_xref="InterPro:IPR038078"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y3"
FT                   /inference="similar to AA sequence:KEGG:Arth_0207"
FT                   /protein_id="ACL38367.1"
FT                   /translation="MKQLRLFPQEPAGLKLLSQMAQQIVLASGTLAEILGVSAADHAKL
FT                   VEDMHNHDAKSSELHYALLTHMRTSFVNPLPREDMYTLSRYLNEAMEKMDGAAELVALY
FT                   KLERLPKRAADQLEIISRQAELTVDAMRRLNNLDDLEDYWIEILRLTKRAERTHRVWVA
FT                   DMISDMKWAQYSRNRDVANQLVEVTKDMRRIATQVGSIIVKES"
FT   gene            complement(389867..390526)
FT                   /locus_tag="Achl_0369"
FT   CDS_pept        complement(389867..390526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38368"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y4"
FT                   /inference="similar to AA sequence:KEGG:Arth_0208"
FT                   /protein_id="ACL38368.1"
FT                   /translation="MSEQAGSKPYGGANRHHKPKPFAPIDFEPFAGGADPARVSEAAHL
FT                   AAQALVRHGRDSDDPVITERLVRLADEQGLEAIAEMWAESPARSLPGALWRLYALRAAT
FT                   VQDPERISVYFRAGKDTAQVSNVVAGVAEPPGADEMRTMADAILSGAFDGEFDVALERS
FT                   AAFCRVVALGQATLADGAEHANEAHASRLTRNSHQLVKTAEDLEHAANAWRLGELD"
FT   gene            390743..390818
FT                   /locus_tag="Achl_R0004"
FT                   /note="tRNA-Lys1"
FT   tRNA            390743..390818
FT                   /locus_tag="Achl_R0004"
FT                   /product="tRNA-Lys"
FT   gene            complement(390928..392109)
FT                   /locus_tag="Achl_0370"
FT   CDS_pept        complement(390928..392109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_2500 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38369"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y5"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_2500"
FT                   /protein_id="ACL38369.1"
FT                   /translation="MALDNAEPYTASPDTEAAAFRGALDITPGTGGTTIRRLPAWTQAQ
FT                   FGGDNPLAKANATPSGVRLEFLTDAAWLEVDLTFTRESADWRWRPLQAAVLNLTTSDGH
FT                   AESRHFHEGDVLETFPDGSSTLTPGAPSTARFEIPGPRQERTVTLWLPHRGSALIHGVR
FT                   SEAPLQPAPRTGPRWVHYGSSISQSSHAESPLGVWPVIAARNLGLDLYNLGLAGSAHLD
FT                   QFVARTIRDEPADLITVKVGINIINSASLRRRTFAPALHGFLDTVRDGHPWTPLVLISP
FT                   IFCPEHEDAPGPSRLVDGKFLATDLPRKPGDGLLTLRDARNILAEAVSERSTSDPNLHY
FT                   LDGLRLFGSGDAHLLPDLLHPDAEGYGLIGERFTDIAAGSPWLAAAAQAPVRS"
FT   gene            392380..393399
FT                   /locus_tag="Achl_0371"
FT   CDS_pept        392380..393399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0371"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: art:Arth_0219
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38370"
FT                   /db_xref="GOA:B8H9Y6"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y6"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACL38370.1"
FT                   /translation="MAKSSKGRMPRLEDVADVAGVSHQTVSRVINNHPNVSKATREKVE
FT                   AAIAQLGYRRNTAARSLVTRRSQTIGVLASELSQYGPANTLLGVEQAARDAGYFVSIAA
FT                   LREVNGAAIAGAVSHFLDQAVDGIAVLVPHAETLQALDALKIPVPVMAVGSLGNSEVSG
FT                   AMVDQRAGARLAVEHLIAQGHRRIGHVSGPAGWTDAAERAEGWREALHAAGLADDLLVE
FT                   GDWSAGSGYAIGRGLAAGRSATALFVGNDQMALGILRAFAEAGVRVPDDVSVVGFDDQP
FT                   ESGYFSPPLTTVRQDFEELGRRCLDTMLKEIEAGTGVSSTVVTPELVPRSSTAPPGNG"
FT   gene            393508..394341
FT                   /locus_tag="Achl_0372"
FT   CDS_pept        393508..394341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0372"
FT                   /product="lipoprotein"
FT                   /note="KEGG: art:Arth_0220 lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38371"
FT                   /db_xref="GOA:B8H9Y7"
FT                   /db_xref="InterPro:IPR025510"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y7"
FT                   /inference="similar to AA sequence:KEGG:Arth_0220"
FT                   /protein_id="ACL38371.1"
FT                   /translation="MRKRIFTAGIGAAAIAAAMALAGPASAAEGDAQLSVLHGVPGLTV
FT                   DVWVNGDRTLDDFTPGSLAGPLALPAGAYQIAITAADAADASAAVIGPVTVNLAANGNY
FT                   TAVANLDAAGKPTANLFTNDVSQIAAGKGKLTVRHTAAAPAVDVLAGGSAVVTNLSNPN
FT                   EQTLTLDPGTISASVAATGTTAPVIGPADVTVAEGTHTIVYAWGSLADKNLQLAVQNIE
FT                   GLHSAPGSVPGARDGSADASPAPAGLALGLGATAIALLLAGVGTARTVAARRARQ"
FT   sig_peptide     393508..393591
FT                   /locus_tag="Achl_0372"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 28"
FT   gene            394463..395194
FT                   /locus_tag="Achl_0373"
FT   CDS_pept        394463..395194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0373"
FT                   /product="peptidase C60 sortase A and B"
FT                   /note="PFAM: peptidase C60 sortase A and B; KEGG:
FT                   art:Arth_0221 peptidase C60, sortase A and B"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38372"
FT                   /db_xref="InterPro:IPR005754"
FT                   /db_xref="InterPro:IPR023365"
FT                   /db_xref="InterPro:IPR042001"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y8"
FT                   /inference="protein motif:PFAM:PF04203"
FT                   /protein_id="ACL38372.1"
FT                   /translation="MSGRTTTAGESRRRASVAVRTAAASAVLLLAACAPAGQSTAPSGT
FT                   PASTVASTPAAAPSAVPSAAPSAPASAAPAVQPGAAPTIPVHPATLGAVAADPAPTSIT
FT                   IAGTAIDMPVVPGGVSGEGAMEIPDAFDRAAWYRFGPAPGAAQGAAVIAGHIDTTSDRA
FT                   PFSALKSLAEGTAIRVGRDGAPDLTYRVVKVELMAKDRFDGGSLFRRTGPHELKVVTCG
FT                   GRWLDERMDYSDNVIVTAVPG"
FT   sig_peptide     394463..394579
FT                   /locus_tag="Achl_0373"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.409 at
FT                   residue 39"
FT   gene            395241..395822
FT                   /locus_tag="Achl_0374"
FT   CDS_pept        395241..395822
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0374"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   aau:AAur_0455 RNA polymerase ECF-subfamily sigma factor"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38373"
FT                   /db_xref="GOA:B8H9Y9"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Y9"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACL38373.1"
FT                   /translation="MTPPAQASHGWDDGLTASFLAGDERALAAAYREFAPLVHTLALRS
FT                   LADSSAADDVTQEVFIRVWRSRNTFRPEVARLPAWIVGITRNVITDAHSATAREARKAH
FT                   AVAGAGLAAGEADAGAEAAEVLADRLLLDGELERLGEPQGSIMKLAFYEDLTHEQISRK
FT                   LDLPLGTVKSHIRRSLTHLRSRLEVDHAAS"
FT   gene            395809..396573
FT                   /locus_tag="Achl_0375"
FT   CDS_pept        395809..396573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0375"
FT                   /product="putative transmembrane anti-sigma factor"
FT                   /note="KEGG: aau:AAur_0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38374"
FT                   /db_xref="GOA:B8H9Z0"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z0"
FT                   /inference="similar to AA sequence:KEGG:AAur_0456"
FT                   /protein_id="ACL38374.1"
FT                   /translation="MPHLDPEQLSLLALYGDWDDADGRQHLDVCPECAADYAALRRTVD
FT                   AVRTAPDTAGLSVPGPQVWAGIHRELGLADAVREDPLSGPGTKPAEAPAEAAPSNVAVF
FT                   GPRKKAWWQRTGTWIAAAAAVVLVAGGGIWASMRPAQPPQPTQLAQAQLTPLAQYSASG
FT                   SAKVVEAADGSRSLEVSLDKDEAKGYQEVWLIAPDLSRLVSLGVMASDSGTFQVPAGLQ
FT                   LADYPIVDVSDEPVDGNPAHSSVSIVRGTLTS"
FT   gene            complement(396563..397057)
FT                   /locus_tag="Achl_0376"
FT   CDS_pept        complement(396563..397057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0404 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38375"
FT                   /db_xref="GOA:B8H9Z1"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z1"
FT                   /inference="similar to AA sequence:KEGG:AAur_0404"
FT                   /protein_id="ACL38375.1"
FT                   /translation="MDSEATVRRPRPSLAWLLGPIATGLGWAAHVLGGGASPSALIVVA
FT                   LAALLGMAAAIGKPGRLPGWGLLLTAGITQQLLHFAFAAFSISTGFDAPSHGHGQSPAQ
FT                   DPGTATQGQGPVAHDLHLLLYLHMGAALLTLVITRQLDRLPARRIQRKPLDVRAGMQVR
FT                   K"
FT   gene            complement(397168..397800)
FT                   /locus_tag="Achl_0377"
FT   CDS_pept        complement(397168..397800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0377"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38376"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38376.1"
FT                   /translation="MPANASAVVANLTVTQPTSNGFISAYPTGSSKPNVSNQNYAQNQT
FT                   IPSLAVVPVGPDGTVTIANSSSGTVQIVADVFGYFLPGTPATSGAFVAVTPKRFLDTRT
FT                   FRGPVSSAENVPVKVAGVDGIPSSASGVWVNLTVTEPTRFGYFEARAHFATVSFTSNLN
FT                   FDRGQTIANMAYVPIGQDGKIEIQPLLNPVPRHETTHVIADVFGYTL"
FT   gene            398573..399232
FT                   /locus_tag="Achl_0378"
FT   CDS_pept        398573..399232
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0378"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: fre:Franean1_6643 deaminase-reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38377"
FT                   /db_xref="GOA:B8H9Z3"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z3"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACL38377.1"
FT                   /translation="MSLVRVHNFSVSLDGFGTGEGQQLEAPFGHAGSRLMEWAFGTRTF
FT                   RAMGLHGEGQASFGVDEAFASQWGTGVGVEIMGRNKFGPQRGPWEDKEWKGWWGDNPVF
FT                   HTPVVVLTHHPRPTLEMEGGTTFHFIDADPATALEKARELAPGLDVRIGGGADTVRQFL
FT                   EADLIDHMHIAVVPIILGRGERLWDGLEGLDERFDIESTTSPAGVVHMVFTRRGSR"
FT   gene            399351..401084
FT                   /locus_tag="Achl_0379"
FT   CDS_pept        399351..401084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0379"
FT                   /product="L-ribulokinase"
FT                   /note="TIGRFAM: L-ribulokinase; PFAM: carbohydrate kinase
FT                   FGGY; KEGG: art:Arth_0222 ribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38378"
FT                   /db_xref="GOA:B8H9Z4"
FT                   /db_xref="InterPro:IPR000577"
FT                   /db_xref="InterPro:IPR005929"
FT                   /db_xref="InterPro:IPR018484"
FT                   /db_xref="InterPro:IPR018485"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z4"
FT                   /inference="protein motif:TFAM:TIGR01234"
FT                   /protein_id="ACL38378.1"
FT                   /translation="MNTADSAEACVIGVDYGTLSGRAVVVRVRDGKELGSGVFDYPHAV
FT                   ITDALPRDIAGDGGTRLPGEWALQVPNDYRDVLRIAVPAAVADAGIDPAAVVGIATDFT
FT                   ACTMVPTRADGTPLNEVPGFANRPHAYVKLWRHHAAQPQADRINRLAAERGEAWLPRYG
FT                   GLISSEWEFAKGLQLLEEDPEVYAAMDHWVEAADWIVWQLCGTYVRNACTAGYKGIYQD
FT                   GHYPSEDFLAALNPQFKDFVSTKLEHAIGRLGDAAGYLTAEAAAWTGLPEGIAVAVGNV
FT                   DAHVTAPAAKAVDPGQLVAIMGTSTCHVMNGAELREVPGMCGVVDGGIVPGLWGYEAGQ
FT                   SGVGDIFGWFTKNGVQPEYHQAAATAGLGIHEYLTALASGQAIGEHGLIALDWHSGNRS
FT                   VLVDHELSGVILGQTLATTPEDIYRALLEATAFGTRTIVEAFRDAGVPVKEFIVAGGLL
FT                   KNKLLMQIYADATGLQLSTIGSEQGPALGSAIHAAVAAGHYADIREAAAAMGSEPGEVY
FT                   TPIPENVAAYEELFREYKALHDYFGRGSNDVMHRLKAIQRKASGITSEAAVTGVPVEVS
FT                   A"
FT   gene            401081..401776
FT                   /locus_tag="Achl_0380"
FT   CDS_pept        401081..401776
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0380"
FT                   /product="class II aldolase/adducin family protein"
FT                   /note="PFAM: class II aldolase/adducin family protein;
FT                   KEGG: art:Arth_0223 L-ribulose-5-phosphate 4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38379"
FT                   /db_xref="InterPro:IPR001303"
FT                   /db_xref="InterPro:IPR036409"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z5"
FT                   /inference="protein motif:PFAM:PF00596"
FT                   /protein_id="ACL38379.1"
FT                   /translation="MSAALLEAIALTRADVCALHAELTRYGLVVWTAGNVSARVPGTDL
FT                   MVIKPSGVSYQDLAPDQMVVTDLYGTPVSGNGEGGWGNPALSPSSDTAAHAYVYRHMPE
FT                   VGGVVHTHSTYATAWAARGEAIPCVLTMMSDEFGGEIPVGPFALIGDDSIGHGIVETLK
FT                   NSNSPAVLMQNHGPFTIGKDAKSAVKAAVMCEEVARTVHVARQLGDPLPIDQGHIDSLY
FT                   ARYQNVYGQ"
FT   gene            401826..403346
FT                   /locus_tag="Achl_0381"
FT   CDS_pept        401826..403346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0381"
FT                   /product="L-arabinose isomerase"
FT                   /EC_number="5.3.1.4"
FT                   /note="PFAM: L-arabinose isomerase; KEGG: art:Arth_0224
FT                   L-arabinose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38380"
FT                   /db_xref="GOA:B8H9Z6"
FT                   /db_xref="InterPro:IPR003762"
FT                   /db_xref="InterPro:IPR004216"
FT                   /db_xref="InterPro:IPR009015"
FT                   /db_xref="InterPro:IPR024664"
FT                   /db_xref="InterPro:IPR038583"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z6"
FT                   /inference="protein motif:PRIAM:5.3.1.4"
FT                   /protein_id="ACL38380.1"
FT                   /translation="MSTAANNSLDGYEVWFLTGSQHLYGEDVLKQVAAQSQEIATQLNS
FT                   ASAVPVRIVWKPVLTDSDAIRRTALEANSDDSVIGVTAWMHTFSPAKMWIQGLDLLRKP
FT                   LLHLHTQANRDLPWADIDFDFMNLNQAAHGDREFGYIQSRLGIARKTVVGHVSNPEVAR
FT                   QVGAWQRAAAGWAAVRTLKLTRFGDNMRNVAVTEGDKTEAELRFGVAVNTWSVNELADA
FT                   VHGAAESDVDALVAEYEDLYEVVPELRAGAARHESLRYGARIELGLRSFLEANGSAAFT
FT                   TSFEDLGALRQLPGLAVQRLMAAGYGFGAEGDWKTAILVRAAKVMGAGLPGGASLMEDY
FT                   TYHLEPGAEKILGAHMLEVCPSLTATKPRLEIHPLGIGGKEDPVRLVFDADASPGVVVA
FT                   LSDMRDRFRLVANAVDVVPLDQPLPNLPVARALWEPKPNFATSAAAWLTAGAAHHTVLS
FT                   TQVGMDVFEDFADIARTELLTIDEGTTIRQFKKDLNWNAAYYRLAGGL"
FT   gene            complement(403350..404342)
FT                   /locus_tag="Achl_0382"
FT   CDS_pept        complement(403350..404342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0382"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: ANTAR domain protein; KEGG: aau:AAur_0357
FT                   ANTAR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38381"
FT                   /db_xref="GOA:B8H9Z7"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z7"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ACL38381.1"
FT                   /translation="MHARQVSPNFPGQRTRVLSGAGDEEAFETKASPPAVAGPLLSSRL
FT                   HGPRPAAGLPTIAPRTVTQATGSDGSQAMLLDLVTGADSLTDSLDSLVAAAVRSVAGAQ
FT                   QAGTPQQAGAQIECAVVLTQPRRSPAITGTSRDAERMMAWEQQAAEGPTSEVLAGGHPV
FT                   AVLQRHGDFRWPRYCSELQVAGFGSVLGIRLRLDGAGDAASSGPAGDAADAETHAALAF
FT                   FAPDSKAFPLQVIAEARAFAGLASRSLRMALDLHTARSMASDLRSALDSRTSINVACGV
FT                   IMAQNRCSYHEAFSILAKASSHRNIKVRRIAEDILERLPEGPPQSHFGH"
FT   gene            404661..406196
FT                   /locus_tag="Achl_0383"
FT   CDS_pept        404661..406196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0383"
FT                   /product="Alpha-N-arabinofuranosidase"
FT                   /EC_number="3.2.1.55"
FT                   /note="PFAM: alpha-L-arabinofuranosidase domain protein;
FT                   KEGG: art:Arth_0226 alpha-N-arabinofuranosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38382"
FT                   /db_xref="GOA:B8H9Z8"
FT                   /db_xref="InterPro:IPR010720"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z8"
FT                   /inference="protein motif:PRIAM:3.2.1.55"
FT                   /protein_id="ACL38382.1"
FT                   /translation="MFFVATPEPATAKVTLDPAFTVGPVRRRTFGAFVEHLGRCVYTGI
FT                   FEPDHPDADEDGFRRDVLGLTRELGVSTVRYPGGNFVSGYRWEDGVGPKDQRPVRLDLA
FT                   WHSTDPNLVGVDEFAAWSAKAGVEPMMAVNLGTRGIQEAMDLLEYCNIDGGTELSDQRR
FT                   ANGAPDGYGIRMWCLGNEMDGPWQIGHKNALEYGRLAADTARGMRMIDPDLELVACGSS
FT                   GPTMDTFGEWERVVLSETYELVDLISAHQYFEDFGDLQEHLAAGHKMDAFIKNIVSHID
FT                   HVKSVKKSTKQVNISFDEWNVWHMSRAESKAPSGKDWPVAPVLLEDTYTVADAVVVGDL
FT                   LVTLLKNTDRVHSASLAQLVNVIAPIMTEPGGRAWKQTTFHPFALTSRHAAGTVLQLAV
FT                   ESPLVSGGTTENVAALSAVATFDAEKGEAVVFAVNRSATDALTLDAAVAGLGNVRVLEA
FT                   LTYANKDPYWQASADDSTSVEPAENVTVKADGGRLTAELPAVSWSMIRLAVGS"
FT   gene            406257..406844
FT                   /locus_tag="Achl_0384"
FT   CDS_pept        406257..406844
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0384"
FT                   /product="HhH-GPD family protein"
FT                   /note="PFAM: HhH-GPD family protein; KEGG: art:Arth_0249
FT                   HhH-GPD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38383"
FT                   /db_xref="GOA:B8H9Z9"
FT                   /db_xref="InterPro:IPR003265"
FT                   /db_xref="InterPro:IPR011257"
FT                   /db_xref="InterPro:IPR017658"
FT                   /db_xref="UniProtKB/TrEMBL:B8H9Z9"
FT                   /inference="protein motif:PFAM:PF00730"
FT                   /protein_id="ACL38383.1"
FT                   /translation="MDGMELHITGDPAADKLLSEDAFALLTGMLLDQQVTMESAFAGPE
FT                   KIRTRIGSVSPEAIAGHDPQAFVEMFKERPAVHRFPGSMAARVQALAEAVQSDWNGDAT
FT                   AIWTQGDPSGAEVLKRLKALPGFGDQKAKIFLALLGKQRGLQAPGWREAAGHYGEDGSY
FT                   LSVADIVDPESLVKVRASKQAAKAAAKAGKEG"
FT   gene            406844..407848
FT                   /locus_tag="Achl_0385"
FT   CDS_pept        406844..407848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0385"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: art:Arth_0228
FT                   transcriptional regulator, LacI family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38384"
FT                   /db_xref="GOA:B8HA00"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA00"
FT                   /inference="protein motif:PFAM:PF00532"
FT                   /protein_id="ACL38384.1"
FT                   /translation="MAVTMNDVAKAAGVSLKTVSNVLNNYEFIRPATRQRVEDAIAELG
FT                   YEANLTARSLRSGKTSMLGLVLSDLSAPYYAELASKLMDAATKHGYRVLVEQSAAEGAA
FT                   ELNALQGPFRQLTDGLLFTPLSISADAIAERAGTKPLVMLGEHIMDPRFDLVTMKNEEA
FT                   AAALTSHLLAGGRRRIAVIGATPEESTGTAGLRLNGYRTALKNAGIPFDPALVAPAEWR
FT                   RDTGAAAVAGLLEAGVEFDAVFGLNDVLALGALHELLIRGVRVPQDVAVAGFDDVDEAR
FT                   FASPSLTTVSPGMDEIAERSMALLLDRIAGRETADAGVHVKAEFQLKIRESAP"
FT   gene            407922..408944
FT                   /locus_tag="Achl_0386"
FT   CDS_pept        407922..408944
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0386"
FT                   /product="GTPase EngC"
FT                   /note="PFAM: GTPase EngC; KEGG: sen:SACE_7050
FT                   ribosome-associated GTPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38385"
FT                   /db_xref="GOA:B8HA01"
FT                   /db_xref="InterPro:IPR004881"
FT                   /db_xref="InterPro:IPR010914"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030378"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA01"
FT                   /inference="protein motif:PFAM:PF03193"
FT                   /protein_id="ACL38385.1"
FT                   /translation="MTERTDLVMLGWTPDDEESFLEQTEAQIARVVIVHGGHAEVMSAS
FT                   GTENVTETVLFSSTLDTTPVAGDWVAVLQGTIVEVAPRRTSMARPDPGGNRTQVLAANI
FT                   DLILVVVAADPIPSLNAIERMQVMAWDSGATPVLVLTKADQCSDLDEVLEHVAPVSSGL
FT                   ETIVTSITDGRGLSLLHDRVENLTTTMLGASGAGKTSLLNALHGTDAATAPVRRDGQGR
FT                   HTTTTRRLFPMPWGGVMLDIPGIRSLALQAGQEGISDTFADISELSYHCRFSDCLHERT
FT                   AGCAVAAAVADGRLSARRLDSWLAVQRELSFQERRRDPAAMAEQRKRWKQATKMSRKSR
FT                   "
FT   gene            complement(408945..410195)
FT                   /locus_tag="Achl_0387"
FT   CDS_pept        complement(408945..410195)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0387"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rha:RHA1_ro04995 major facilitator superfamily multidrug
FT                   resistance protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38386"
FT                   /db_xref="GOA:B8HA02"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA02"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38386.1"
FT                   /translation="MKGLGFTGPFEIAGFPRLFTAALVSGLGGSLVPIAFALESHRLEP
FT                   SGWGLTVVLLSLWSGRFIGVFAVQRIRPARNPVRVMILSDLVRFIAQAGLLGWILTLGT
FT                   DSPPTGAITALSISSGVYGIALAFFQPARFTVIPRLIPLEQRGRVNAWLSVLGDVFAIS
FT                   GPLLGSLVFLSLGFQAILLIDSIGFLVGIVVLAGLRLSRSPSQTTPEASASNGNKRIRA
FT                   KLPPGINTGLATWLFVALTIGLLGTAGPTLVIEQNSAATWAVTAAFMAAGSLVGSASSL
FT                   LGFLKRVPWKYLHLLCCLSIATQLLCFLLVPLPVLLWAVGFLGAALTTASGIQWDTLGQ
FT                   SIGDDDQVHTFAVRDQIVNTVGVPAGMLFFGVAGAADATFLISAGVAGAVALMGVVITF
FT                   APQPTAETPRPLPTPVS"
FT   gene            complement(410201..410596)
FT                   /locus_tag="Achl_0388"
FT   CDS_pept        complement(410201..410596)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0388"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38387"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA03"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38387.1"
FT                   /translation="MSMHLTIAFEGFGGKPFQELADDAARTQLVRRRGSGLPFSINTRL
FT                   IDAATPARLAVSHVPRRSEGSAELRVWSGAGQLAVPARFEDVLHLLAKRPATTPAQASE
FT                   ACGIDETEMLQFWAFGFENGLLHNPAQ"
FT   gene            complement(411180..412130)
FT                   /locus_tag="Achl_0389"
FT   CDS_pept        complement(411180..412130)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0389"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mab:MAB_1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38388"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA04"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38388.1"
FT                   /translation="MDLSHELGVAIDRALTSQTSEPRYRVFKDGTLDYRACNQVARRWK
FT                   AGAGKPQDQLREIAGNGAVLALNDVAAWNDNIRRCLTEDSRPLPATVSGDDVVTTDVYA
FT                   FVSTAAGWTAFGAHVDFEHSIILDLDGAGRDVVTWPEGARYGQRMNDAKAFFGISMDWK
FT                   EWLADSTRYRLAPGDIAVIRARQPHIFHANGPGMFLGISTVGHNTSSLGSSVSELAAGA
FT                   ALVPKHDSDLVSRITNAAVPPPVRLVDSVDLEVTPDGLRSHGKYVALSSTERNLFTANT
FT                   AANIVAAFGAASPPAIRTVIAKLVMIGAAIVHPNT"
FT   gene            412662..412964
FT                   /locus_tag="Achl_0390"
FT   CDS_pept        412662..412964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0390"
FT                   /product="urease, gamma subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: art:Arth_0241 urease, gamma subunit; TIGRFAM:
FT                   urease, gamma subunit; PFAM: Urease gamma subunit region"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38389"
FT                   /db_xref="GOA:B8HA05"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8HA05"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACL38389.1"
FT                   /translation="MHLMPREQEKLMIVVAADLARRRQSRGLKLNYPEAVAIISYELIE
FT                   GARDGRTVADLMSYGTTILTREDVMEGVPEMIHDVQIEATFPDGTKLVTVHDPIR"
FT   gene            412974..413327
FT                   /locus_tag="Achl_0391"
FT   CDS_pept        412974..413327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0391"
FT                   /product="urease, beta subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: art:Arth_0242 urease, beta subunit; TIGRFAM:
FT                   urease, beta subunit; PFAM: Urease beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38390"
FT                   /db_xref="GOA:B8HA06"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8HA06"
FT                   /inference="protein motif:TFAM:TIGR00192"
FT                   /protein_id="ACL38390.1"
FT                   /translation="MIPGEYVLRPEPVTANAGRDAIELSVTNTGDRPVQVGSHFHFAEA
FT                   NAALDFDRAAARGRRLDIPAGTAARFEPGDSRSVRLIELAGSREVFGLSNAVNGKLDGG
FT                   PHPGVPATERGAK"
FT   gene            413324..415081
FT                   /locus_tag="Achl_0392"
FT   CDS_pept        413324..415081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0392"
FT                   /product="urease, alpha subunit"
FT                   /EC_number="3.5.1.5"
FT                   /note="KEGG: art:Arth_0243 urease, alpha subunit; TIGRFAM:
FT                   urease, alpha subunit; PFAM: amidohydrolase; Urease
FT                   alpha-subunit domain protein; Amidohydrolase 3"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38391"
FT                   /db_xref="GOA:B8HA07"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8HA07"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACL38391.1"
FT                   /translation="MSFEIPRRQYADLYGPTTGDKIRLADTELFLEIEKDLTVYGEEVV
FT                   FGGGKVIRDGMGQNGQATRDEDIPDTVITNAVILDHSGIYKADVALRDGHIFRIGKAGN
FT                   PQITDGVDIVIGASTEIIAGERKILTAGGIDTHIHFISPDQVATALTSGVTTMIGGGTG
FT                   PAEGTKATTVTPGKWHIHRMLQAAEAFPMNIGLFGKGHASAVEPLAEQIRAGAIGLKVH
FT                   EDWGSTTSSIDMSLTVADEYDVQVAIHTDTLNECGFVEDTIRAINGRVIHTFHTEGAGG
FT                   GHAPDIIKIAGMPNVLPASTNPTLPYTRNTIEEHLDMLMVCHHLNPDIPEDVAFADSRI
FT                   RAETIAAEDVLQDMGIFSITSSDSQAMGRVGEVITRTWQVADKMKKQRGILAADGGMDL
FT                   GADGSASAHGSAGSDNFRLKRYVAKYTINPALAQGIADTVGSVEEGKFADLVLWDPAFF
FT                   GVKPELVLKGGQIAYALMGDANASIPTPQPRTMRPMFGAFGKAVQQTSITFLSKAAIDA
FT                   GVPEELGLEKLIRPVSGIRNLTKADLKYNDATPDIQVDPETYQVTVDGEDVTCEPADVL
FT                   PMAQRYFLF"
FT   gene            415111..415596
FT                   /locus_tag="Achl_0393"
FT   CDS_pept        415111..415596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0393"
FT                   /product="UreE urease accessory domain protein"
FT                   /note="PFAM: UreE urease accessory domain protein; KEGG:
FT                   art:Arth_0244 urease accessory protein UreE"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38392"
FT                   /db_xref="GOA:B8HA08"
FT                   /db_xref="InterPro:IPR004029"
FT                   /db_xref="InterPro:IPR012406"
FT                   /db_xref="InterPro:IPR036118"
FT                   /db_xref="InterPro:IPR036675"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8HA08"
FT                   /inference="protein motif:PFAM:PF02814"
FT                   /protein_id="ACL38392.1"
FT                   /translation="MIIDKVLGNLHDLPENDLAAYTGLHREKVVLPSAQLVKRIQRATT
FT                   DHGNEIGIRLASGSGDLRDGDILHVADTNMIVVSVLPTDVLVIAPRTIHEMGVTAHSLG
FT                   NRHLQAQFFDADSEYGAAVMVCAYDHTVEDYLTHAGVPYTRQERVLPVPFRHAEHSH"
FT   gene            415732..416415
FT                   /locus_tag="Achl_0394"
FT   CDS_pept        415732..416415
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0394"
FT                   /product="Urease accessory protein UreF"
FT                   /note="PFAM: Urease accessory protein UreF; KEGG:
FT                   art:Arth_0245 urease accessory protein UreF"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38393"
FT                   /db_xref="GOA:B8HA09"
FT                   /db_xref="InterPro:IPR002639"
FT                   /db_xref="InterPro:IPR038277"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA09"
FT                   /inference="protein motif:PFAM:PF01730"
FT                   /protein_id="ACL38393.1"
FT                   /translation="MGAPFVSGYQLALQQLVDSALPTGAFAHSLGFETYIDGGLVFDEE
FT                   SFRIWLSAFIGQQLSYSDGLAIRFLYEGGELGELDALLSASLLPREVREASLKMGGRLL
FT                   EIGAEVFPSAGLSLYRDLVATGRADGHQPLAFAVVARSLGVPLQEALAAYLFATVTSLT
FT                   QNAVRAIPLGQNAGQRILRKAHNDVAAAIDVIAHLTPDDFGAVSPGLEISQMRHERQRA
FT                   RMFMS"
FT   gene            416446..417060
FT                   /locus_tag="Achl_0395"
FT   CDS_pept        416446..417060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0395"
FT                   /product="urease accessory protein UreG"
FT                   /note="TIGRFAM: urease accessory protein UreG; PFAM:
FT                   cobalamin synthesis protein P47K; KEGG: aau:AAur_0219
FT                   urease accessory protein UreG"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38394"
FT                   /db_xref="GOA:B8HA10"
FT                   /db_xref="InterPro:IPR003495"
FT                   /db_xref="InterPro:IPR004400"
FT                   /db_xref="InterPro:IPR012202"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA10"
FT                   /inference="protein motif:TFAM:TIGR00101"
FT                   /protein_id="ACL38394.1"
FT                   /translation="MTEPIKIGIGGPVGAGKTQLVERLTRHMSGDISMAAITNDIYTIE
FT                   DAKILAANGILPEDRIIGVETGGCPHTAIREDTSMNTAAIDELKARHPDLQVIFVESGG
FT                   DNLSATFSPELVDFSIYIIDVAQGEKIPRKAGQGMIKSDLFIINKTDLAPHVGADLSVM
FT                   ERDSKEFRGNKPFCFTNLKTDEGLENVIQWIRHDVLMLDLA"
FT   gene            417057..418022
FT                   /locus_tag="Achl_0396"
FT   CDS_pept        417057..418022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0396"
FT                   /product="Urease accessory protein UreD"
FT                   /note="PFAM: Urease accessory protein UreD; KEGG:
FT                   art:Arth_0247 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38395"
FT                   /db_xref="GOA:B8HA11"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA11"
FT                   /inference="protein motif:PFAM:PF01774"
FT                   /protein_id="ACL38395.1"
FT                   /translation="MSTTAESSSALDSPGPATAGDRGRARSAVPATPRPLSPASADRPA
FT                   MGRLELRVAVRGQRSVAEHQYHQGALRVLRPHYLDDSGQVCYVMVNPGGAYLGADLFLL
FT                   DVEVQDGADLLLTTQSATKVYRTPGSFAEQRMAVRLGEGARLELMPDQLIAYREASYRQ
FT                   RTSVTLRPSSSLVMGEVVTPGWSPDGAAFRYEEVRLRNEIHIETDGGTQLLALDNLLIR
FT                   PPLGDVTGLGFMEGFSHLGSLVVVDARVDQALADELHHLTAGHDARTGISLTRTVAGTT
FT                   GLVLRSLSNSTGELNRLLAACANHLRVRWHGQGPLNLRKH"
FT   gene            418022..419065
FT                   /locus_tag="Achl_0397"
FT   CDS_pept        418022..419065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0397"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   aau:AAur_0222 putative high-affinity nickel-transport
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38396"
FT                   /db_xref="GOA:B8HA12"
FT                   /db_xref="InterPro:IPR004688"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA12"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ACL38396.1"
FT                   /translation="MTALANIATLYRDRETLPFRTRLLATFGAVAALHVAAVVLLVAGS
FT                   ATAGAPLALGLVLTAYVAGVKHSYDWDHIAAIDNSTRKFVAQRKDPVSVGFAFSLGHSS
FT                   VVVLAGLLVVAGAAVIGQFMEEGTTGNHVLGLIGSGVSGLFLLAMGLFNGSAFLRAAQV
FT                   YRRVQDGAAVRDEDLDSKGFVARLLARPLARVQRPRNIYVIGFLFGLGFDTATTIGLLV
FT                   TTTAASLAGVSPVALMALPLAFTAAMTLCDTVNGVAMMRMYRSAIHSPQRRLGFNAVVT
FT                   GVSALSALFIAVITLGGFANAAFGLGDPLTSWLGEIDLGEAGLLLVAAFLAVWGGAALA
FT                   SRQPRNN"
FT   sig_peptide     418022..418168
FT                   /locus_tag="Achl_0397"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.874) with cleavage site probability 0.768 at
FT                   residue 49"
FT   gene            complement(419135..421057)
FT                   /locus_tag="Achl_0398"
FT   CDS_pept        complement(419135..421057)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0398"
FT                   /product="secreted protein"
FT                   /note="KEGG: kra:Krad_3740 secreted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38397"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA13"
FT                   /inference="similar to AA sequence:KEGG:Krad_3740"
FT                   /protein_id="ACL38397.1"
FT                   /translation="MPLSLRPDSPSPLPPQRRHHPGTIAASTAFLIGFAIAGGTVPAQA
FT                   AAPAVKPGVQAPASPPPAPAQQNPFGSNTYVFDPSMPVAQIQATVDAIAAQQVDDEMGT
FT                   KRYSLLFKPGTYGTPEEPLIVQVGYSTEVAGLGAAPTDVTINGHVDVYNRCLTADNCIA
FT                   LNNFWRSLSNLTINVTGLEGCRSSANFWAASQASPMRRVNITGGNLSLMDYCTAGPQYA
FT                   SGGFIADSKTGAVINGSQQQYLVRDSSIGSWSNGVWNQVFSGVTGAPADSFPVPPYTVL
FT                   DTTPISREKPYLTVDPAGQYSVFVPSVRQDSAGTTWENGPTQGRSIPLAEFYIAKPGDS
FT                   VQAINSQLARGKNLILTPGVYDIDRSIEVKRAGTVVLGLGMATLTAVNGSVPLTVADVP
FT                   GVDIAAVTVDAGEVNSPALMRVGKASPGAGGGPASSAVHSDPANPTTLHDVFFRIGGPH
FT                   VGKASVSLEVNSDNVLLDHIWAWRADHGNGVGWDTNTGRNGVIVNGNNVTATGLFVEHY
FT                   QQYNVIWTGENGRTVFFQNELPYDAPNQAAWQHDGVLGWAGYKVADPVETHELWGGGSY
FT                   VYNNVDPTIHATRGFEVPVTPGVKLHSLLTVNLGAGTLDHVVNDTGAPVSTDAVGIPSY
FT                   VADFG"
FT   sig_peptide     complement(420920..421057)
FT                   /locus_tag="Achl_0398"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.985 at
FT                   residue 46"
FT   gene            421350..422642
FT                   /locus_tag="Achl_0399"
FT   CDS_pept        421350..422642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0399"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cmi:CMM_0086 putative sugar ABC transporter, binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38398"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA14"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL38398.1"
FT                   /translation="MKNPSKFSVLSAAAACLAVSLTACGSSSPGKSDVNGATGSEAVTL
FT                   TVGTFNEFGYEALFKEYEAQNPNVTIQHKKAATTNEARDNLTTRLAAGSGLSDIEAVEV
FT                   DWLPELLQYPDRFADLADPAVEGRWLDWKAQAATTADGKLLGYGTDSGPEAVCYNSELL
FT                   RKAGLPTERGEVAKMLGTSWDSYFDAGKKFKAANPGSAWFDSAGAIYQGMSNQLEKVYE
FT                   EEDGSVIATENQQVKDTYKQVLKASTEDGLSAHLKQWSDDWASGFQTGAFATTLCPGWM
FT                   LGVIEGNAAGVTGWDVANVFPGGGGNWGGSYLTVPTQGAHQAEAKKLAAWLTAPEQQIK
FT                   AFTAKGTFPSQKEALESSELLGQTSKFFDGAPTGEIFAERAKAVDVTPFKGTKYFAIND
FT                   AMQQALARVDVDKSDDAASSWDKFVTAVKSL"
FT   sig_peptide     421350..421427
FT                   /locus_tag="Achl_0399"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.817 at
FT                   residue 26"
FT   gene            422645..423640
FT                   /locus_tag="Achl_0400"
FT   CDS_pept        422645..423640
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0400"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cmi:CMM_0085 putative sugar
FT                   ABC transporter, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38399"
FT                   /db_xref="GOA:B8HA15"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA15"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38399.1"
FT                   /translation="MAVTDRVTPQASPSPSPGAGRDGGNVRRLAFSQQVSRWDVKLSPY
FT                   LYVSPFFLLFAVTGLFPLVYTAWVSLHNWNLIGGQGKFTGLENYAFVVAQPYFWNAVGN
FT                   TFSIFILSSVPQVVVALVVAAVLDANLRARTFWRMGVLVPFVVAPVAVGLIFNNLFADQ
FT                   FGLINEMLKALGLDPVRWHSDPVASHAAIATMVNFRWTGYNALIFLAAMQAIPRDVFEA
FT                   ATIDGAGRLRQFFSVTVPMLRPTIIFVVITSTIGGLQIFDEPRVFDQSGLGGADRQWQT
FT                   LTMYIWELGWGQRNFGRASAVAWLLFLIIVLIALLNFVITKRIASQEGRK"
FT   gene            423652..424548
FT                   /locus_tag="Achl_0401"
FT   CDS_pept        423652..424548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0401"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_0086 putative ABC
FT                   transporter sugar permease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38400"
FT                   /db_xref="GOA:B8HA16"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA16"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38400.1"
FT                   /translation="MIEQTAGKGAARAAARRGGGNRRTGFGAGRRPGFPTYGFLGAVLL
FT                   ASIFPLYWSFLVGSHDNTVLSRGIPLLPGGNFLANAAKVFDSIPFWKAMGNSLIVSGVT
FT                   AASVVVFSTLAGFAFAKLRFRGSRALLVFVIATMAVPTQLGVVPLFIVMSKLGWTGSLW
FT                   AVIIPGLVTAFGVFWMTQYLRDALPDELIEAARMDGASMIQTFLHIGFPAARPAAAMLA
FT                   LFTFVATWTNFFWPFIVLDPSNPTLPVALQLLQAAHFVDYSVVLAGAVLATVPLLLLFI
FT                   AAGRQLVSGIMQGAVKG"
FT   gene            424545..426029
FT                   /locus_tag="Achl_0402"
FT   CDS_pept        424545..426029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0402"
FT                   /product="beta-galactosidase"
FT                   /EC_number="3.2.1.21"
FT                   /note="KEGG: msm:MSMEG_5142 beta-glucosidase A; TIGRFAM:
FT                   beta-galactosidase; PFAM: glycoside hydrolase family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38401"
FT                   /db_xref="GOA:B8HA17"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA17"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ACL38401.1"
FT                   /translation="MSSTQRPFPEDFLWGTATAAYQIEGAAHAEGRGDSIWDVFARLPG
FT                   AVADGHNGDMACDHYRRYRQDVALMGRLNMKAYRFSTSWARCMPDGVTPNPDGIAFYSR
FT                   LVDELLAAGITPWLTLYHWDLPQALEDNGGWANRDTAYRFADYAALMHSVLGDRVRIWT
FT                   TLNEPWCSAFLGYAAGIHAPGRQEPRAALAAAHHLLLGHGLAAAELRRRDTEASLGITL
FT                   NLTVSDPRDPGSESDRDAARRIDGQFNRIFLDPLFRGEYPADVLADVAHLGMADLVQDG
FT                   DLELIATPLDLLGVNYYHGESLTKDLAGAQEQAAPETTSVPGQATRAVASPFVAADGAR
FT                   SVRRGLPVTGMGWEVQPEGLRRLLNRLHTEYTGPAGIPIYITENGAAYDDVPDATGFVD
FT                   DQDRLGFFAAHLDAVHRAIADGVDVRGYLAWSLLDNFEWSFGYHQRFGMVRVDYCTQDR
FT                   IPKASALWYSSVASGNALPAGSSPVPPPARGVVLSV"
FT   gene            426029..427081
FT                   /locus_tag="Achl_0403"
FT   CDS_pept        426029..427081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0403"
FT                   /product="transcriptional regulator, LacI family"
FT                   /EC_number="5.1.1.1"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG:
FT                   fre:Franean1_5463 LacI family transcription regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38402"
FT                   /db_xref="GOA:B8HA18"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA18"
FT                   /inference="protein motif:PRIAM:5.1.1.1"
FT                   /protein_id="ACL38402.1"
FT                   /translation="MNANSSRPAPAAAGRPSPTLEDLALAAGVSRSTASRAINGGSKVS
FT                   AQAQAAVDAAIVALGYTPNRAARSLVTRRAGSVALVIPEPDARVMMDPYFAAVIMGVNE
FT                   ALRETDLQLVLLMSRAGDDSARTIRYLRGGHVDGAIVVSHHRADDWVESLGATGLPTVF
FT                   IGRPWDTESGIPYVDLDNFEGGRLAARHLSGAGRSKLATIAGPTDMTAAVDRLQGWLQG
FT                   LREAGLQPGPVIHGDFTTAGGADAAARLLAEAPDVDGIFAASDLMALGVVDTLRQKGRQ
FT                   VPDEVAVVGFDNHSLQAANGLGLTTVAHPMADIAAAAGKLLVDAIANPGELPEPVIYPA
FT                   ELVVRGSSAA"
FT   gene            complement(427119..427568)
FT                   /locus_tag="Achl_0404"
FT   CDS_pept        complement(427119..427568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0404"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="KEGG: art:Arth_0071 transferase hexapeptide repeat
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38403"
FT                   /db_xref="GOA:B8HA19"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B8HA19"
FT                   /inference="similar to AA sequence:KEGG:Arth_0071"
FT                   /protein_id="ACL38403.1"
FT                   /translation="MSAKFESVEDDAGKVTRYVRHANGGGFVSPGAVVAESARIGPMTY
FT                   VEHGAVIGANCRIGHGSWVDREAKIGARTVIGDGVRIGRATVIGNRVHIGSHSRIGSSV
FT                   LVEHGVHLDSDSTVTDGSEVLAGAHSRLARAKHRPHRKTGGGLAA"
FT   gene            complement(427662..428321)
FT                   /locus_tag="Achl_0405"
FT   CDS_pept        complement(427662..428321)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0405"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: art:Arth_3959 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38404"
FT                   /db_xref="GOA:B8HAE3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAE3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL38404.1"
FT                   /translation="MAGLTAPLLGLQKKSLREQALSALRTAITSGELAPGRHLVETELS
FT                   EMLQISRGTLREALRQLEQEGLLSAGPRGRLSVRHLDEKEIRDIYAVRAALESLAARTL
FT                   CELADRQHVTESLHAAIDAMGSATGGTLEERIESDLEFHRTLCRLTGNETLLHSWESLE
FT                   GSIRMSIMFAGLEKGVSNMSVDRHRDIVAAIDTGDAGLARKTILEHMDTAAANLVS"
FT   gene            complement(428437..429468)
FT                   /locus_tag="Achl_0406"
FT   CDS_pept        complement(428437..429468)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0406"
FT                   /product="Transketolase central region"
FT                   /note="PFAM: Transketolase central region; Transketolase
FT                   domain protein; KEGG: art:Arth_3958 transketolase subunit
FT                   B"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38405"
FT                   /db_xref="GOA:B8HAE4"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033248"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAE4"
FT                   /inference="protein motif:PFAM:PF02779"
FT                   /protein_id="ACL38405.1"
FT                   /translation="MSTTTEAPDTAAAAATPAKPKLKTSAMIASFADPGQKTASAPFGH
FT                   ALVKAAQENDRIVGLTADLGKYTDMHIFAKAFPERFFQMGMAEQLLFGAAAGLAETGLV
FT                   PFASTYSVFAARRAYDFLCLDAAEPNLNVNIVGGLPGLTTGYGPSHQATEDMAIFRGMP
FT                   NLTIVDPCDSVDIEQAVPQLAASEGPTYLRLLRGNVPTVLDEYGYTFELGKAKVLRGGN
FT                   DVVFISSGLMTMRALQAAKALAAHNVDVAVVHTPTIKPFDAETVLKEINTDRLAVTLEN
FT                   HSVVGGLFETVASAVVTAGVGKRVVPIGLPDQFLDAGALPTLHDRYGLATDRIVTKVLA
FT                   ELG"
FT   gene            complement(429465..430388)
FT                   /locus_tag="Achl_0407"
FT   CDS_pept        complement(429465..430388)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0407"
FT                   /product="Transketolase domain protein"
FT                   /note="PFAM: Transketolase domain protein; KEGG:
FT                   art:Arth_3957 transketolase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38406"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAE5"
FT                   /inference="protein motif:PFAM:PF00456"
FT                   /protein_id="ACL38406.1"
FT                   /translation="MPTDTVQETPQGQTLQEQTRQAAVTPERVDKISAAAYRIRHHALN
FT                   MGEVQGQGYVGQALGAADMLATVYGDQLNFRAEDPHWEARDRFLLSTGHYAIGHYAALA
FT                   EAGIVPVAELETYGSDDSRLPMSGMSTYTPGMEISGGSLGHGLTIAVGMALGLRYQGSG
FT                   ARVFNFLSDGELDEGSTWEAAMGAHHHQLGNLTAMVDINALQADGKTDTVLRTEPVTEK
FT                   WESFGWYTQRVDGNDVGALLAAFDNAASQAAAIGRPSVILCDTKVGRGVPLLEDREKAH
FT                   FMRIEEHEWQVCREQLTAGYEGKASA"
FT   gene            complement(430422..431816)
FT                   /locus_tag="Achl_0408"
FT   CDS_pept        complement(430422..431816)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0408"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: art:Arth_3956 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38407"
FT                   /db_xref="GOA:B8HAE6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAE6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38407.1"
FT                   /translation="MLTVDSGDFLRPLFEREPNMSKEALTMRGPVHGTKDARRVAIGSG
FT                   VGAVIETYDFIGFGTAAALYFGTAFFPTGDPVTGTLAAFATLGVGFAARPLGGIIGGHL
FT                   GDKVGRKPVLVTSLILMGVATFLIGLLPTYAQVGLLAPALLVFVRIVQGLAFGAEWGGA
FT                   ILMSYEHAPWKSKGKYTGIVQAGFPVGLLLANLVFLVSVNLGGELAWRVPFLASIVLVA
FT                   VGLIIRSKVPESPVFDEVKDSGDIVKSPIVEVLKTDWRNIVKGIGLRVAETAGYAVSIT
FT                   YMISYLHTEKLADKTETLVALCIASAIGIFATAAWARLTDKIGRRPLYIWSCAFAVLFA
FT                   VPMFLMVNTGLFIAIILTIVISYAVCQNSLAGAQGAWFPELFQAKTRASGASLAYQISA
FT                   MVSGFTPFITTLLFVSFGWMGPAMLFGLYAAVGLWAAVATRETWGKRERELAEEATKST
FT                   PNTVNA"
FT   gene            431945..432769
FT                   /locus_tag="Achl_0409"
FT   CDS_pept        431945..432769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0409"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: art:Arth_3955 xylose isomerase domain protein TIM
FT                   barrel"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38408"
FT                   /db_xref="GOA:B8HAE7"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAE7"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL38408.1"
FT                   /translation="MFHSSLGCSSISFRHQDLGAALRTIKELGFEEIDLGALPGVCDHV
FT                   PHELDKAAVAAVSAQVNASGLRVRSVNGDIGDLNAVLDDDAQAARQRHLDALLTLTSNI
FT                   GAKALVLPCGALTHESVRSEREDLDLIAAQLLGAGQRAAKFGVELWTESLHFLRFCWNL
FT                   ERAGLLADRLAGSGVGIVMDFSHIVASGEDIQDYLDFHAGRISHVHLRDAVPGNINLSI
FT                   GNGQADFAGGLERLAAQGYAGHFSLELETRDVTNDERPAAAAKAASFITDLL"
FT   gene            432911..433684
FT                   /locus_tag="Achl_0410"
FT   CDS_pept        432911..433684
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0410"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: aau:AAur_4134 short chain
FT                   dehydrogenase/reductase family oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38409"
FT                   /db_xref="GOA:B8HAE8"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAE8"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38409.1"
FT                   /translation="MTTIQRTAVLTGATSDRGIGITTARRYAREGWAVVILDLDGEKSA
FT                   KVAAEIGNEFNVPAFGHEIDVANEASVTAAQAAVASEVAAGNLPPVGALANIAGITSPV
FT                   PFLETTLELWHKVMDVNATGTYLVSKAFLPDMIENGWGRIVNMSSVSAQRGGGVFGKVP
FT                   YSAAKAAILGFTKALARELGTTGVTVNAITPGAVDTNIRVGSTDEQEAAINAGIPLGRN
FT                   ATTEEVASVITFLSSEDSAYLTGTVVDINGGSHMH"
FT   gene            433731..435494
FT                   /locus_tag="Achl_0411"
FT   CDS_pept        433731..435494
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0411"
FT                   /product="Glycerone kinase"
FT                   /EC_number="2.7.1.29"
FT                   /note="PFAM: Dak kinase; Dak phosphatase; KEGG:
FT                   art:Arth_3953 glycerone kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38410"
FT                   /db_xref="GOA:B8HAE9"
FT                   /db_xref="InterPro:IPR004006"
FT                   /db_xref="InterPro:IPR004007"
FT                   /db_xref="InterPro:IPR036117"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAE9"
FT                   /inference="protein motif:PRIAM:2.7.1.29"
FT                   /protein_id="ACL38410.1"
FT                   /translation="MTKIFNDPSDFAEEALAGFCDIHSGLVRQVSGGAVRRYRPARPKV
FT                   AVLAGGGSGHYPAFAGLIGTGFADGAVVGNIFTSPSAQQAYSVAKAAESGAGVVFTYGN
FT                   YAGDVMNFGMASERLAAEGIAVENVLVTDDIASAPPSDIDKRRGIAGDFTVFKVMGAAA
FT                   ETGADLAEVVRLGRKANSLTRTIGTAFAGCTFPGAESPLFSLPEGQMGLGLGIHGEPGL
FT                   HDTDLPSAKELGQELVARVLAETPSGAGERIAVILNGLGSTKHEELFVLWAAVAPLLRG
FT                   AGYTLVMPEVGELVTSLDMAGVSLTVTWLDDELEALWVAPAETPAYRRGTASAEAGALS
FT                   GEETYDGGASASAYVATDASRGYAAACVGALAAAQASLHGAEERLGRMDAIAGDGDHGR
FT                   GMVRGVDAAAAAATAAYGLGAGAGDVLAAAGDAWADKAGGTSGVLWGAGLRAFGETVGN
FT                   TTVPGSSELAAGVAAFADRIVELGKAEIGDKTMVDALLPFTSFLSSQVAQGTAPEDAWA
FT                   AAAREAAAAAEATAQLLPLKGRARPLAEKSLGTADPGATSLAMVFGVMGPHFAGNIPAA
FT                   QDNASRESIGA"
FT   gene            435491..435982
FT                   /locus_tag="Achl_0412"
FT   CDS_pept        435491..435982
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0412"
FT                   /product="ribose 5-phosphate isomerase"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase; PFAM:
FT                   Ribose/galactose isomerase; KEGG: art:Arth_3952
FT                   ribose-5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38411"
FT                   /db_xref="GOA:B8HAF0"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF0"
FT                   /inference="protein motif:TFAM:TIGR02133"
FT                   /protein_id="ACL38411.1"
FT                   /translation="MSTEGQAMGLRLIVGADEAGVDYKDRVLEDLRNDPRVSEVIDIGV
FT                   NRGDSPEDFTRPYPYVGIAAGEMIRDGAADRAILFCGTGIGVAIAANKVEGIRATAAHD
FT                   SFSVERSVLSNDCQVLTMGQRVVGIELARRLAKEWIGYTFDPGSASAGKVKVLSDFESC
FT                   "
FT   gene            435997..436266
FT                   /locus_tag="Achl_0413"
FT   CDS_pept        435997..436266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0413"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aau:AAur_0488 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38412"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38412.1"
FT                   /translation="MDSYPYSEWARLIGVPVEVRLGHRTVRSGVVDNAMPDSSAVWLAG
FT                   DAAGGRELFTAADGYELWISPRQLGGTLCYKMAASQLQGAPRLG"
FT   gene            436266..436706
FT                   /locus_tag="Achl_0414"
FT   CDS_pept        436266..436706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0414"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38413"
FT                   /db_xref="InterPro:IPR019587"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF2"
FT                   /inference="similar to AA sequence:KEGG:Arth_3265"
FT                   /protein_id="ACL38413.1"
FT                   /translation="MITVAGSVETKLSAEKAFAFLSEFENTSKWDPGTPVMDKITPGPV
FT                   AVGHKYHAEAEFRGKRQKLIYEVIELTGSHIKLRGENKTVVSFDSIDVSPNGAGSVVKY
FT                   TAEFSIKGPAKIIQPLLKPLFMQLRDPALKGLRDTLNSLAAA"
FT   gene            complement(436684..438243)
FT                   /locus_tag="Achl_0415"
FT   CDS_pept        complement(436684..438243)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0415"
FT                   /product="Carboxylesterase type B"
FT                   /note="PFAM: Carboxylesterase type B; KEGG: bsu:BSU34390
FT                   para-nitrobenzyl esterase (intracellular esterase B)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38414"
FT                   /db_xref="GOA:B8HAF3"
FT                   /db_xref="InterPro:IPR000997"
FT                   /db_xref="InterPro:IPR002018"
FT                   /db_xref="InterPro:IPR019826"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF3"
FT                   /inference="protein motif:PFAM:PF00135"
FT                   /protein_id="ACL38414.1"
FT                   /translation="MKLASSNGGTFRGTTLAVDGTPVHRFLGIPYAQPPSGDLRFHPPA
FT                   ALPGWTGEVDATGYGPAAPQNPDAADPGEAPLAWSEDGCLNLNVWTPDTGGPARPVMVW
FT                   IHGGAYVTGANSDGMYDGARLAAATDTVVVAINYRLGALGFLHLAHLLGEGFGDSSNLG
FT                   LLDQLEALRWVRDNIAGFGGDPHNVTLFGESAGAAAIGTLLGMPASEGLFRRAIMQSGT
FT                   AERFRTPEVSARVTAEFLRLCGLDESTAGEMAALPAERLLAAQQRMQERIAAENYAVPL
FT                   PFQPAVGTPSLPEPPLDAVRNGLNSGVDLLVGTNLNEGSFAVEMRPDLPDDPGYPDRAA
FT                   AVLSAGGLPGDCAPEYAEALAGVLKREPRGKELLEAAIADSVYRQPSNNLLDARLRPAG
FT                   SAGHGGTFAYLFTWPSPAMGGKLGSCHTLDIPFVFRHLDSPDAAYLTRGKAPQALSDAM
FT                   SGAWAAFARNGTPAQPGLAWPEYGQRRHTMVLNDPPRLEADPRSGIRMFFAANQVRQQP
FT                   VS"
FT   gene            438350..439102
FT                   /locus_tag="Achl_0416"
FT   CDS_pept        438350..439102
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0416"
FT                   /product="ANTAR domain protein with unknown sensor"
FT                   /note="PFAM: GAF domain protein; ANTAR domain protein;
FT                   KEGG: aau:AAur_pTC20242 ANTAR domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38415"
FT                   /db_xref="GOA:B8HAF4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR005561"
FT                   /db_xref="InterPro:IPR012074"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF4"
FT                   /inference="protein motif:PFAM:PF03861"
FT                   /protein_id="ACL38415.1"
FT                   /translation="MVDTGVSGGEVFADVAAHVQDLVLQSPDVVRLLDSLALYAVARLG
FT                   SVGRELFCGISVSRPKKPTAAAASDTKARMLDQLELKYGQGPADSAVGSGSTIHVSDLR
FT                   EETRWPDYAAAATHQGACSVLAMPLQLEGEDRGVLVLYSGQPDAFGPDAVAMAEAFTEQ
FT                   AAKGLALTLRMAKLQDTKDGLSAAMQTRTVIDLATGAIMAQNRCSQDDAFKVLREASNS
FT                   RNMKLRDVASLVVSSVAGGAKTITYFDE"
FT   gene            complement(439087..439377)
FT                   /locus_tag="Achl_0417"
FT   CDS_pept        complement(439087..439377)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3243 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38416"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF5"
FT                   /inference="similar to AA sequence:KEGG:Arth_3243"
FT                   /protein_id="ACL38416.1"
FT                   /translation="MDEADQQALTGAVIRLHNLDIGALWLDYVALGGDASEQDIRNYSL
FT                   EAGALPEKERDALSQAVNESCAEAELVVRAPYSSSPLTVLPVEPKDPYSSK"
FT   gene            439478..440194
FT                   /locus_tag="Achl_0418"
FT   CDS_pept        439478..440194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0418"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: rha:RHA1_ro06011 ABC
FT                   transporter, ATP-binding component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38417"
FT                   /db_xref="GOA:B8HAF6"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF6"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACL38417.1"
FT                   /translation="MDPGTYPIRRLVENPGNVLDRGRWPADLPVVAQILENGLDLAPAT
FT                   ILVGENGSGKSTLVEAIALAYGLSPEGGSTGARHSTRPTESVLAGHLQLVRNAGATRRG
FT                   YFLRAETMHGFFTYLENNPGGPDAAFHDMSHGESFLELAVSRFRGRGLWVLDEPESALS
FT                   FSGCLSLLAILKDLLAEGNSQVVMSTHSPLLAALPGAQILEAGPWGLRERAWEDLDLIT
FT                   NWRNFLDSPQRYLRHI"
FT   gene            complement(440247..441344)
FT                   /locus_tag="Achl_0419"
FT   CDS_pept        complement(440247..441344)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0419"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: aau:AAur_0063 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38418"
FT                   /db_xref="GOA:B8HAF7"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF7"
FT                   /inference="similar to AA sequence:KEGG:AAur_0063"
FT                   /protein_id="ACL38418.1"
FT                   /translation="MAGRPGSTGIACPARRVVSGKSLAAAPHAGAVAFIHWKAPGSVAA
FT                   GRAEQKAFARDAGRDSGESVPQWIGWGRAYFALQSLAGALWWAAVAVSPTVRTATLGNL
FT                   DPALVAVFDIPLFVVGSAAAAAGGRAAAAVVAAWSTIVTIALGAYATVTMQAGTGVLIM
FT                   AAAAAGSTAALCLACWGRIPVEWIIRGPFAFRPARQRDARFHVAATFGQIIIFWGFFLG
FT                   LLPLFLDFLERRWGLAADFPQAAGAAGLVILVLASALGIWSAISMSTVGKGTPLPAAMA
FT                   TTLVVAGPYRWIRNPMAVAGVVQGAAVGFMLHSWFVVGYAVLGSLVWNYAVRPLEEADL
FT                   KARFGSAFEAYREAVPCWLPSFRRV"
FT   gene            441405..442241
FT                   /locus_tag="Achl_0420"
FT   CDS_pept        441405..442241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0420"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: nar:Saro_2406 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38419"
FT                   /db_xref="InterPro:IPR001910"
FT                   /db_xref="InterPro:IPR023186"
FT                   /db_xref="InterPro:IPR036452"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF8"
FT                   /inference="similar to AA sequence:KEGG:Saro_2406"
FT                   /protein_id="ACL38419.1"
FT                   /translation="MDMIRVEPKCRVIIDNDWAGDPDGLVGLAHHALSAANRIVAVTAS
FT                   LTNPMFGPPEGRAVAGADLAAELLRVLKLTAPSTVHAGPDAPFTGQPRESAAARAIIAA
FT                   AAAPAGAGLPLILVCAGPLTNVADALLLEPAIASAFTLAWVGGAEVNGDEYNYFTDPAA
FT                   AEFVLGNQDLAVWQFPAETYRRIVAPVAELDQLFRTAGPAGTWLWELFHGLDVPDFVKF
FT                   GPLWCLGDSAPLVVTGLDDVTSTFTEAGTHPVRRTYTAVDTRLIMADFAAKLRLQG"
FT   gene            complement(442297..443556)
FT                   /locus_tag="Achl_0421"
FT   CDS_pept        complement(442297..443556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0421"
FT                   /product="glycoside hydrolase family 1"
FT                   /note="PFAM: glycoside hydrolase family 1; KEGG:
FT                   cau:Caur_0360 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38420"
FT                   /db_xref="GOA:B8HAF9"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAF9"
FT                   /inference="protein motif:PFAM:PF00232"
FT                   /protein_id="ACL38420.1"
FT                   /translation="MTNQFPQDFLWGVATAGHQVEGNNVNSDTWFLEQLPGSMFSEPSG
FT                   DAVDHYHRYREDIALIAELGFTSYRFSLEWARIEPAEGQFSVAALDHYKRVLEACVEHG
FT                   LTPVVTFHHFASPLWLLQSGGWEGARTAELFARYCDRAMTHLGHLIGVACTLNEPNLPW
FT                   LLESFGIGGEAPENRGSVPVWAAAAERLGVDPSSVAPFQFCSTEAGFAVKLASHQAATA
FT                   VIKAHRPDLRVGWTLANSDIQSIPGGEAIADKVRRDVNERFLEASRGDDFVGIQTYGRT
FT                   VYGPEGHAPAPDGVETNQMGEEIYPQGLEATIREAARIAGIPVIVTENGLATEDDTQRL
FT                   AYLQTAVEGVASCLADGIEVGGYIAWTAFDNYEWVFGYRPKFGLIAVDRTTQERTPKES
FT                   AHWLGSFAREHAASQVAQPA"
FT   gene            443774..445327
FT                   /locus_tag="Achl_0422"
FT   CDS_pept        443774..445327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0422"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: fre:Franean1_0426 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38421"
FT                   /db_xref="GOA:B8HAG0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG0"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL38421.1"
FT                   /translation="MKLLTTTARGSAAVLTGALLMGSLAACGGGSQQAATVDKSTLTIG
FT                   VESDSASFGYDPIRVADAQRQFMEGLYDTLLDLQPDGTAGPGLATKFDYNADSTVLTLT
FT                   LKDGVTFTDGSTLDAALVKANFDRRTDTALSTYSAIAKGGAQEIASVDVVSPTQVAITF
FT                   AKPQPGFEKNLTSTMGMIVGKTGVADTASLATTPDGSGPYTLDPSTVKGNKYVMVKNEK
FT                   NDDAADYAYSKIVFNVIMDPQARANALVSGQADVAQLTSPTVDFAKSKGVGVSRIGGTV
FT                   QTMVSFDKTGKTAPAFASEKVRQAIQYAINRQALVDALHKGDIPTWNALPKDSAGFTAD
FT                   LEKTFAYNPEKAKSLLAEAGYPNGFEFTIIAGAQTQTDLQAVQKDLAAVGITMNVKMAA
FT                   STDEAFAAVATTPLGYAPLGWDNPIGLMYGAILNGFTNVQKATDDQLSAATGEAAAAKD
FT                   DAARKTALTKMNTRLVESGWLIPLFESLSNWGYNTKKVQEVQFAGTNAYPLLSSYKPTN
FT                   "
FT   sig_peptide     443774..443878
FT                   /locus_tag="Achl_0422"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.847 at
FT                   residue 35"
FT   gene            445390..446331
FT                   /locus_tag="Achl_0423"
FT   CDS_pept        445390..446331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0423"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: fre:Franean1_0427
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38422"
FT                   /db_xref="GOA:B8HAG1"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG1"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38422.1"
FT                   /translation="MALFVAKRLLMALATVLVVAVLAFLLVHAMPGSPGAVSLGAGASQ
FT                   DAIDQLNQQLGWNDPLFSQFFRWLGDAVQGNLGVSLIDGRSVSADLADRLPVTASLAAG
FT                   ATVLSAILGIALGVTAAVRGGLLDRAIGGFVGLLVALPAFWVGIILVYLLAVQSSVFPA
FT                   TGYVPFEVSPQDWALSLALPVITLAVGGAAFIARQTRASMLEALQQEHIRTLRATATPT
FT                   WKILYIHALRYASLPIVAGIALQFIGLFGGSVIAEQLFAMPGLGQAVQTSVSTHDAPAV
FT                   QGVVVIATVVVVAVNLVLELATKFLDPKLRAS"
FT   sig_peptide     445390..445479
FT                   /locus_tag="Achl_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.923 at
FT                   residue 30"
FT   gene            446400..448439
FT                   /locus_tag="Achl_0424"
FT   CDS_pept        446400..448439
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0424"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: azc:AZC_3043 oligopeptide/dipeptide ABC
FT                   transporter ATP-binding protein; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38423"
FT                   /db_xref="GOA:B8HAG2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG2"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL38423.1"
FT                   /translation="MPRSGKAALARFSRHRLFGSPGAVAGMLWLAALVIASLTAPLWLP
FT                   FKTEDQDFTAVLSGPTAAHWLGTDELGRDILSRIFAAAAGTLGTSLITVIVGVGLGTLL
FT                   AMAAAGAERTEAVISRITEIMMSLPGTVIILAVIGAVGTNIPLIMAILGVLMSAGIYRV
FT                   ILGQAKSLQSQLYVDAAKVDGLSPVGISVRHVLPGLANTIVVQAALIFAVGMLIQAGLA
FT                   FIGFGPPLPQPSWGGMIQGASQHVYDAPWMMVPTGAVLALTVLSANAIGNALGKAPNAA
FT                   APHLPSAAARRQRAKSAAAVAAAPAPNDAEAQEATENGTLSVRNLSVGVDGTGAGKGVA
FT                   LVTGVSFDVAPGTVLGLVGESGCGKTMTALSLLGLLPSGVSVSGGQIRWNGRNLAAATD
FT                   KDMEGIRGRDIALISQEPMRALDPMFTVGYQLTAAIRRLRGMGKAEARTEARNLLEKVG
FT                   IVDAQRILKTYPHQISGGMAQRVAIALALSGQPRLLVADEPTTALDVTVQAEILSLLRA
FT                   LVKDTGMSVVMVTHDLGVVADICDQVAVMYAGQVVENGKTAAILDNPRHPYTLALLAAD
FT                   PHANDADNMPERLATIQGQVPQPKDWPTGCRFAARCQFAGSACTDPVPLLASGTGEGLV
FT                   RCVKADQLAVEGMDWLATDVPAARLLPVSTATPQHSTVIEKDLA"
FT   sig_peptide     446400..446519
FT                   /locus_tag="Achl_0424"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.856) with cleavage site probability 0.447 at
FT                   residue 40"
FT   gene            448436..449443
FT                   /locus_tag="Achl_0425"
FT   CDS_pept        448436..449443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0425"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: bbt:BBta_4864 oligopeptide ABC transporter
FT                   ATP-binding protein; TIGRFAM: oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38424"
FT                   /db_xref="GOA:B8HAG3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG3"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL38424.1"
FT                   /translation="MSTTVTERPDSARPHGATPMLEVKELVVRYGRGRKAAAAPAAVDH
FT                   VSFSIAPGETVGLVGESGSGKSTIGKAILGLQKVSGGSISYQGRDITSAGAGQRRALGG
FT                   ELRAVFQDPNSSLNPRNTVGTSLAEPLWLRGVSGAEARAKAEDMLERVGLPREAVDRYP
FT                   SQFSGGQRQRISVARALICDPQLVVCDEAVSALDLSTQAQVLNLLADLRDERGLSYLFI
FT                   AHDIAVVQFLAQRVVVLYRGEVMESGPAAAVTENPKHPFTQALVAASPVPRPAEQAARR
FT                   EARESLGVRTGAAAVPGPGGCPFRLRCPLATELCATERPALRRVGTADVACHYA"
FT   gene            449512..451803
FT                   /locus_tag="Achl_0426"
FT   CDS_pept        449512..451803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0426"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: kra:Krad_0119 alpha-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38425"
FT                   /db_xref="GOA:B8HAG4"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG4"
FT                   /inference="protein motif:PFAM:PF05592"
FT                   /protein_id="ACL38425.1"
FT                   /translation="MTSTSWLAAMITPEQDFDGAPLLRREFTLDDGHGAVAKATLRATA
FT                   LGVYEASINGVPVGPDVLSPGWSSYEWRLRYRSYDVTAVITPTSVIGVELGNGWYRGRL
FT                   AWHGLSNLYGSELGFFGQLDIEFADGHVQTVASDTTWQAGPSATTVNDLYDGQTIDARR
FT                   LQAGWAEPGFARDGAQGADWTGVRELAFDAGRLAEPVGPPVVRTGVVRPVEVFTSPGGK
FT                   TLVDFGQNLVGWLRFTVQGEAGRTITVRHAEVLEDGELGARPLRSAKATDTFILSGGRD
FT                   SFEPTKTFHGFRYAEVTGWPGTLTADDLEAVVVHSYLERIGTFECSNDLVNQLHRNIVW
FT                   GLRGNFLDLPTDCPQRDERLGWTGDIAVFAPTAAYLYDVKGFLQDWLLDLATEQKAQDG
FT                   LVPITVPDVLKYCPQPAEFPAPESSALWSEASVWVPWALWEAYGDLGVLQKQYESMAAH
FT                   TRRVEGLLSANGLWDSGFQFGDWLDPDAAPDQPWAAKADTAVVATACMYRTARLTAQAA
FT                   GLLGKHDDEAHFNALAARVRNAFAEHYVAASGTIRSDCTTVYALAIAFDVLLTPELREF
FT                   AGNRLAELVRDNGYRVSTGFAGTPFITHALTDTGHVNEAYRLLLEEGCPSWLYPVTMGA
FT                   TTVWERWDSMLPDGTINPGEMTSFNHYALGAVADWMHKAIGGIRPLEPGYSRVLIQPQP
FT                   GEGISWARTSLKTPHGEVRAAWTLDGGEFRLEATVPDGVAADVVLPDGSRHGVTGGTHR
FT                   FEARVGVLVN"
FT   gene            451875..452726
FT                   /locus_tag="Achl_0427"
FT   CDS_pept        451875..452726
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0427"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: pen:PSEEN2266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38426"
FT                   /db_xref="GOA:B8HAG5"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG5"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACL38426.1"
FT                   /translation="MSDSPIAVDWETARATNRDNWEDRVPLHEEAYGIGALDDPGYLTP
FT                   VVRADLEALAPYVPDGTVAGLDVCHLQCHIGTDTVSLARAGARVTGLDFSPSALASAAG
FT                   LAEKLGQEVAWVEADVLQARAAVSGDFDLVYTSIGTITWLPDLAQWASQVAELLKPGGT
FT                   FYIRDGHPALYAVDEDAEGLQLRYPYFNRGEAQVWDEESTYVGDGKVAHSRTYQWAHPL
FT                   SDILNSLIGAGLQVLRLDEGTTLPWKFSPRMVDVPDGYAWPEAERDLVPCTYTVVARKP
FT                   QA"
FT   gene            452786..453250
FT                   /locus_tag="Achl_0428"
FT   CDS_pept        452786..453250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0428"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_1970 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38427"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG6"
FT                   /inference="similar to AA sequence:KEGG:Arth_1970"
FT                   /protein_id="ACL38427.1"
FT                   /translation="MPYTVDFKNVSTVGLESSPVADALAGLRANEARYYKTKYGHDFTV
FT                   APAEEDPETLAYIHNILATERDLVIASKPLEVSSFEVGGLRMAYVFYESGLSINVMYGI
FT                   EEGGKRAVGFKLSDGMEVPEELASSFNFARQKSKLAGTTRGSYFVIKGLY"
FT   gene            453313..455658
FT                   /locus_tag="Achl_0429"
FT   CDS_pept        453313..455658
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0429"
FT                   /product="twin-arginine translocation pathway signal"
FT                   /note="KEGG: nar:Saro_2411 twin-arginine translocation
FT                   pathway signal"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38428"
FT                   /db_xref="GOA:B8HAG7"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR016518"
FT                   /db_xref="InterPro:IPR027414"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG7"
FT                   /inference="similar to AA sequence:KEGG:Saro_2411"
FT                   /protein_id="ACL38428.1"
FT                   /translation="MLWYRGPAEKFVESLPVGNGLAGATLRGLAGGERIQINEGSAWSG
FT                   PTDRSAPPLDPAEGTARLHAVREAVDAGDVRRAEELLLAFQGTHSQAYLPFAVLSVDAE
FT                   GTAAPADGPARWLDLRTGVAGHRYLLDGAEARHRTFASHPDAVIVHDIAFSAPADLRIG
FT                   IAPDKITATGMDAVTRDWGTELRLGLLLPADVAPAHEQADHPVVYGHGSRAGAVHAGVA
FT                   TDGDAGFARGVLAIRGATFVRIVVATGTVLNHPFARHANTADDADALAGLLSARIAGVL
FT                   EEEAVEPALQRHLADHARLYSRVTLELGGGPAAAAGKPTDERIRAFETDKSDSALMALL
FT                   FHYGRYLLIASSREGGFPANLQGIWNEELQAPWSSNYTININTQMNYWPALTTSLAECH
FT                   EPLLRLVDTLARTGAAAAGLYGARGWVAHHNTDPWGHPFAVGAGKGNAMWASWAMGGTW
FT                   LAEAVWRHYAFTGDLARLEKSWPALEGACLFALDWITGEPGSGTHTSPSTSPENRFVAD
FT                   DGGPAAVGRSATMDVSLLRALCGSARQAAAVLGAPVPWLDEFTRKVAALPQPAIGSRGE
FT                   VLEWSFPATEHEPEHRHTSHLAGLFPLRDWSPEATPELAAAAARTLELRGPESTGWAMA
FT                   WRLGLWASLGNAGKAEESLHLALRVAGDGLAERGGVYPNLFTAHPPFQIDANFGTTAGI
FT                   AEMLVQSDAAAIRLLPALPAAWGDGSVRGLRTVGGIGVDLRWSGGVLRSAVLRSSAAVR
FT                   RDIVWNGRRISVELAGGADLELTADSFS"
FT   gene            455741..457234
FT                   /locus_tag="Achl_0430"
FT   CDS_pept        455741..457234
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0430"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   sco:SCO0118 xylosidase/arabinosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38429"
FT                   /db_xref="GOA:B8HAG8"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG8"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ACL38429.1"
FT                   /translation="MHTNPILSGFNPDPSIVSTPDGYYLATSSFEYLPGLPVYHSEDLA
FT                   DWELVGHVATREEQVRLTNVPTPGGVWAPTLRYRDGVFYLIVSVFLGGRGCVVFTATDP
FT                   AGPWSDGTAIGAVDGIDPDLAWDADGTAYVTFARHPDAIQQVRVDLATGEALEQPRALW
FT                   SGSGLYSPEGPHLYRRGGWWYLIAAEGGTDRGHAVTVARSRRPDGPFESAPHNPVLTAA
FT                   GTGSPVQNTGHADLVELPDGGTAMVLLGVRPVGLTQAFSPLGREAFITRVEWKDGWPHA
FT                   QLPEVDGTRPELVEYHFTHGAGLDHPAWIGVRRMPAEFTAPTSKGLLVTGDGSTMGSPR
FT                   PCFLAQRQRHLGMEFRAVLSVAAGSGGVAVRNAEDNWFGIEASQGQDCDGVRITARAVV
FT                   AGFDRTWDVTVPAGDVELAIVTSPPPSDFSAGAVGGDRIRLTARAAGTGVSSDEVLLAE
FT                   LDGRHWAFETAKAFTGRAFGVYAVDGEVLVRRVSYRGDD"
FT   gene            complement(457259..457726)
FT                   /locus_tag="Achl_0431"
FT   CDS_pept        complement(457259..457726)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0431"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_3620 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38430"
FT                   /db_xref="GOA:B8HAG9"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38430.1"
FT                   /translation="MELLWEIAGWGGAVAILSAYLTVSMGWLKAGKAFQTANLVGASAF
FT                   IINGAFHGAWPSVATNVAWCLISAVALLRMRAAGGSAGSDAPAVQLPGVPDTTGQLAVI
FT                   EPRVSGPHPIETRAVEAGAAGTYYAEPHTAEPYAACTAPAAAPVRQGAVAI"
FT   gene            457827..458750
FT                   /locus_tag="Achl_0432"
FT   CDS_pept        457827..458750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0432"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: art:Arth_3621 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38431"
FT                   /db_xref="GOA:B8HAH0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL38431.1"
FT                   /translation="MNLDPRRLLVLLAVARTGGVLAAADELRITPSAVSQQLSKLEHET
FT                   GQALVLRTPKGSVLTPAGLAMAEAGEEIERALTVARERMESGANIEGVVRIGGFTSFVR
FT                   TVVIPRLPEWRNQFPQLQIRIVEDDYPALMRLLRQRQLDAVVVELDSTTAEQRTLAAGM
FT                   IEEPLLDEPWKLVVPTGALLTTENVDLGRLPLPWLGVEQSAANAAVVGRLRHSTGIFSE
FT                   TVHQYQETLTALALVAAGEGVAIVPTLALAGVIQDGVEVLDVPGLGTRRIVLRRFAGRR
FT                   PTSTPLDTVARLLRESAAAFDTRSAS"
FT   sig_peptide     457827..457895
FT                   /locus_tag="Achl_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.706 at
FT                   residue 23"
FT   gene            458888..460039
FT                   /locus_tag="Achl_0433"
FT   CDS_pept        458888..460039
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0433"
FT                   /product="sodium/hydrogen exchanger"
FT                   /note="PFAM: sodium/hydrogen exchanger; KEGG: art:Arth_1886
FT                   sodium/hydrogen exchanger"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38432"
FT                   /db_xref="GOA:B8HAH1"
FT                   /db_xref="InterPro:IPR006153"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH1"
FT                   /inference="protein motif:PFAM:PF00999"
FT                   /protein_id="ACL38432.1"
FT                   /translation="MSFFQLSLIAAVALLGPLLAFPRKWHLPMVLGQLLAGIAIGRTGL
FT                   GLVDSSDPTFTFVADVGFALVMFVAGTHVPVRDRAIRPALAGGALRAAVAAALAAGVGT
FT                   AIAFAFGTGHAPLYIVLLASSSAALVLPIIDSLRLAGPKVLTTTAQVAVADIACIVALP
FT                   LAVDPPNAARAAVGAAAVAACSVALFFVLRWLELSGTRGRVHDVSEDRKFALELRIQLA
FT                   LLFALSGLAVAGHVSVMLAGFSFGLVVAAVGEPRRLAHQLFAVSDGFLGPVFFVWLGAS
FT                   LDLRALAGTPGMVLLGLCLGAGTLLVHGSLRLLGQPLPLAVLSASQLGVPVAAAAIGTQ
FT                   LDLLEPGEASALILGALITIGASAAAGSRAARAFSRNAPATPG"
FT   sig_peptide     458888..458950
FT                   /locus_tag="Achl_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.989 at
FT                   residue 21"
FT   gene            complement(460044..460898)
FT                   /locus_tag="Achl_0434"
FT   CDS_pept        complement(460044..460898)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0434"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: sen:SACE_2823 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38433"
FT                   /db_xref="GOA:B8HAH2"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH2"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL38433.1"
FT                   /translation="MTLSPDTETHTGTPNTAAPARGKRPKQGEPVIDRALSLLAVFSDR
FT                   RRALTLSELARHADMPAPTALRLISRLVAWGALERLDDGRYVVGVRLWEVASLSPRGHG
FT                   VREIALPYLEDLFEVTRHHVLLAVRDNEQAVLIERLSSKDATEVAYRVGGRAPLRSTAV
FT                   GLVLLAGADQQFQETIMAKPPEKEPGVAEMPEGQLRRTLSDVRRTGIAMIRRSHPSMTV
FT                   SVASPVFDAQGSVVAALSIVVPDGSTPPNVLAPAVRAAARAVSRNLGHQAAVSADVRTH
FT                   SRG"
FT   gene            461058..463790
FT                   /locus_tag="Achl_0435"
FT   CDS_pept        461058..463790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0435"
FT                   /product="alpha-L-rhamnosidase"
FT                   /note="PFAM: alpha-L-rhamnosidase; alpha-L-rhamnosidase
FT                   domain protein; KEGG: rha:RHA1_ro03902
FT                   alpha-L-rhamnosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38434"
FT                   /db_xref="GOA:B8HAH3"
FT                   /db_xref="InterPro:IPR008902"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR013737"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016007"
FT                   /db_xref="InterPro:IPR035396"
FT                   /db_xref="InterPro:IPR035398"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH3"
FT                   /inference="protein motif:PFAM:PF05592"
FT                   /protein_id="ACL38434.1"
FT                   /translation="MTAPARLRAEHLREAMGLAVREPRLSWTPPAATAGQTAYRIMADN
FT                   GWDTGRIASAESGGIAYGGPALDSRSRFDWRVRTWNVDSDGTETASDWSESMPVELGLL
FT                   HPSDWTGQWISPGEEAVSPPGERPGYALTRTFTLPAAPDKARAYATAHGIYELFINGQR
FT                   VGDQQLTPGSTSYNTTLQVQAYDVTALLTAGLNTIRAVLTDGWYRGTFGYTRDADMYGT
FT                   HTAFLAQLELESEAGRQVIGTDPSWLVSATEVISADLMAGQRVDFRAYDTGSAPSAGKA
FT                   PGVRAAVVRPGSFGALTGPLAPPTRVTEELAPVSITRLRNGHQVVDFGQNIHGWVRLAA
FT                   LGGPGETVTLEYGEALGRDGDVTRDHLRPHDFRVPGAFLDAGQVDTVTASGAPGEVFEP
FT                   RHTSHGFQFVSVRGLATDLRPRDVTACLVRTDLERIGTFHCSDERLNKLHGIVEWSFLG
FT                   NSCEVPTDCPQREKAGWTGDWQLFVPTAAYLYDVTGFTRKWLRDVRADQWDNGVIANIS
FT                   PSPGPAITSAEFMGFTNGSSGWGDAIVMVPWEAYLATGDASILAENWDAMNRWLGFVRT
FT                   TAETRRHAARATQAPVPADHEKYLWDTGFHFGEWMEPDGPGPDLFASRTADNGIVATAY
FT                   YRHTTDLMARIARALGLAAEAADLARLSDAIRDAWATEYLDESGRVTVASQANCVRALA
FT                   FQLAGTEHRAAVTTQLVELIRDAGTHLGTGFLATPYLLPVLADHGHLGLAYELLMQDSE
FT                   PSWLAMVDRGATTVWELWNGLDAGGAPHQSLNHYSKGAVVSFLHRYTAGLRQAPGSAGW
FT                   NRIIIEPRPGAGLTSAATSHQGPHGPITVAWTLSTDALGPDEMTADGVLTLTADIPSGT
FT                   TAEILLPGQPAAVVGPGHHVFSAATGGDTAHPELMRSTL"
FT   gene            463787..464809
FT                   /locus_tag="Achl_0436"
FT   CDS_pept        463787..464809
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0436"
FT                   /product="Esterase/lipase-like protein"
FT                   /note="KEGG: hch:HCH_01563 esterase/lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38435"
FT                   /db_xref="GOA:B8HAH4"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH4"
FT                   /inference="protein motif:COG:COG0657"
FT                   /protein_id="ACL38435.1"
FT                   /translation="MTVDRAADVLDPSRPDVSRPDVSRPDVSRPGGRDVPPFPVYDAPG
FT                   TPEAASDASCVHREVTYARAIGFRPLKMDIWLPRQASGPTPLVLWVHGGAFQLGDRREL
FT                   PPTFAPDSVFRLLNEAGIACATADYRHSLEAPFPAQLHDLKAALRYLREFAAELNIDPD
FT                   RFGAWGESAGGHLVALLGLTGNRPDLDGGLGAQGHSAGVSAVVDFYGVSSLADIPPMHS
FT                   PEDLFPPALTAAVPPGMTLQPEYMLVGGSDAPDLLAAASPVSYVTEDAAPFLLVHGDSD
FT                   GLVPHSQTDLLAAALAEAGVEYEVVTVKGGDHCFFGAEDQMDSILALAVGYLSGKLGTP
FT                   "
FT   gene            464806..465759
FT                   /locus_tag="Achl_0437"
FT   CDS_pept        464806..465759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0437"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: kra:Krad_4309 alpha/beta hydrolase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38436"
FT                   /db_xref="GOA:B8HAH5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH5"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACL38436.1"
FT                   /translation="MTPRETAQQAARQVPGAPAAGFAEYLASPEGPRFLNPDAERSSGP
FT                   DVPIRTVTAEGRHGPVAIRIYGEAPGADTPALVWLHGGGFVSGSVDIPESDYLARVLAG
FT                   LGTPVLSVDYRLARDGVSYPIPHDDALAGWFWARKNATSLGLDPDLLCLGGAGAGGNLA
FT                   VGAALYLIDAGKPLPAKLLLAYPFLHAELPPPAAGLDGEVMAGLPRHLRFTLEDCIRTA
FT                   ENYVGGPVSMAPSYAMPGYADPAGLPPTALLACEYDDARGSAELFAASLEQAKVPVNYF
FT                   LAEGGVHGHLNHTAGLPEGKAALDFLASELRAAGER"
FT   gene            465829..467109
FT                   /locus_tag="Achl_0438"
FT   CDS_pept        465829..467109
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0776 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38437"
FT                   /db_xref="GOA:B8HAH6"
FT                   /db_xref="InterPro:IPR000805"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022790"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH6"
FT                   /inference="similar to AA sequence:KEGG:AAur_0776"
FT                   /protein_id="ACL38437.1"
FT                   /translation="MSDHSSTEQESTRSRLFFSRARDWALPVAAVLAAAGIGVAGISSG
FT                   LANRDRPAGETPATSAVPADLPSCPVTDGKALAPASGVLFGINSDLDTKPLATYAAELG
FT                   HKPAVAVSYVDFPYGDQDRDRLKDTAAKVRADGRILLLTLEPKQDLGSVTPEVAAALAQ
FT                   DLAGINAAGVPVIVRFGHEMNGFWFPWAQQPLEYKAAFTRVADAVHAGAPGSAMMWAPS
FT                   YAGGYAYPGRQYGVEAGSPDFAALDTNNDGALNTADDPYAPYYPGDDAVDWVGLSLFHW
FT                   GSTYPWGENEVPEAGKFAGQLTGNYNGANGDERSLPDFYAEYAVNHNKPLAIPGTAALY
FT                   NPGAGGAPETAIKQAWWEQVFSPQTREQFPQLKMLNWFEWDKDEAEVGGRIDWTVTSTP
FT                   ALRDSFAAALPGWLEYGGGTGCGAGGS"
FT   gene            467241..467621
FT                   /locus_tag="Achl_0439"
FT   CDS_pept        467241..467621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0439"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_2013 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38438"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH7"
FT                   /inference="similar to AA sequence:KEGG:AAur_2013"
FT                   /protein_id="ACL38438.1"
FT                   /translation="MDGTGSNEKVVQRLIQCINDRHIEVMDELFHDDAVMHWPQSGEYV
FT                   RGAENRRGIYNAFPQLPTITPRRLTSGGNLVVAEASLDYGGPVYETVFIFEFRDGRIAT
FT                   ETAYWSEAFPAPEWRSQWAEIG"
FT   gene            complement(467618..468787)
FT                   /locus_tag="Achl_0440"
FT   CDS_pept        complement(467618..468787)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0440"
FT                   /product="Glycerate kinase"
FT                   /EC_number="2.7.1.31"
FT                   /note="PFAM: glycerate kinase; KEGG: nfa:nfa27590
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38439"
FT                   /db_xref="GOA:B8HAH8"
FT                   /db_xref="InterPro:IPR004381"
FT                   /db_xref="InterPro:IPR018193"
FT                   /db_xref="InterPro:IPR018197"
FT                   /db_xref="InterPro:IPR036129"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH8"
FT                   /inference="protein motif:PRIAM:2.7.1.31"
FT                   /protein_id="ACL38439.1"
FT                   /translation="MAAATAKTVLIAPDKFKGSLTAAEVAEALADGIRSAASVTGQSAG
FT                   IRCELLPLADGGDGSVDAAVAAGFARRSCTVSGPTGRPVQAGIAFDGVTAVVEVANTCG
FT                   LGLLPHGTLEPLDASSRGFGEAVLTALGLNPARIVLALGGSASTDGGMGMLTALGFTFR
FT                   DSHGRVLASSGRNLAAISSVDVRPVPELAGTELIVASDVSNPLAGPDGAPAVFGPQKGA
FT                   TVGDIAALDQGLGNLVAALGQAGMGSAAELAAHPGAGSAGGIGFACLLLGARQVSGADY
FT                   FLDLLDFDARREPCDVVITGEGSIDEQTLAGKLPAAVARRSGNRAVLAVAGRSLLPRER
FT                   WADLPLDRVYALSDYTELDSSRDPELSAALLRRIGREIGQDLGQNAGPA"
FT   gene            complement(468790..470271)
FT                   /locus_tag="Achl_0441"
FT   CDS_pept        complement(468790..470271)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0441"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   rha:RHA1_ro04802 C4-dicarboxylate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38440"
FT                   /db_xref="GOA:B8HAH9"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAH9"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL38440.1"
FT                   /translation="MDHITTAPGTQAPAKTRWYKQLYFWVLTAIVIGILTGWLAPAAGI
FT                   AMEPIGTTFINAMKMLIGPIVFLTIVGGIASVADLKKVGMTGLKALTYFQVGTICAMVF
FT                   GLVAINLFRLGDGVNADAASLKTTDSAAKLIDAGAHQEWWQFLTHIIPDSIIAPFVEGD
FT                   ILQIIFIAVIFGIALNALGKVGAPVLDGVQRLTGVMFKILAFIMKAAPLGAFGAMAYAV
FT                   GKYGVSSLTSMGGLIALFYVTSILFIVVVLGSVMAFLKLNIFKMIRHFKEEYLLILGTS
FT                   SSEPALPGLMRKLEHAGVKKETVGLVVPTGYSFNLDGAAIYLSLAALYIAQATNTDLTI
FT                   GQQLGLLAVMLLTSKGAAGVAGGGFIALTATLTTIGTIPAAGIMLIFGIDKFMSECRAV
FT                   VNFTGNAVATLFIAWWDRSLDADRTRRVFNGESVEPLQAEDPLHVNEVTDTDEDLVEYG
FT                   HHSSKDQEPDGSAPRHAADAGHTSADRRPAYSETV"
FT   gene            complement(470391..471488)
FT                   /locus_tag="Achl_0442"
FT   CDS_pept        complement(470391..471488)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0442"
FT                   /product="tartrate dehydrogenase"
FT                   /EC_number="4.1.1.73"
FT                   /note="KEGG: rha:RHA1_ro04803 3-isopropylmalate
FT                   dehydrogenase; TIGRFAM: tartrate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38441"
FT                   /db_xref="GOA:B8HAI0"
FT                   /db_xref="InterPro:IPR011829"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI0"
FT                   /inference="protein motif:TFAM:TIGR02089"
FT                   /protein_id="ACL38441.1"
FT                   /translation="MSTTQTFSIASIPADGVGKEVVSAGRRVLDALAGSSNGKFAFDWT
FT                   EFPWGSEYYAKTGLMMDPKGLEALKDFDAIYFGAVGWENVPDHVSLWGLRLNITQNFDQ
FT                   WANIRPVKFLPGVQSPLRKADTTELDWVVVRENSEGEYAGLGGRNLSGRGPGNEVALQT
FT                   ALFTEKGCERIMRFAFELARTRTVKKVSSVTKSNAQQYGMVLWDEVFNRVALDYPDVQT
FT                   ESVLVDAMSAKFILKPEDLSVVVASNLNADILSDLGSALAGSLGLAASANLNPERRFPS
FT                   MFEPVHGSAPDIAGKGISNPIGAIASAALMLDHFGLHEEARKVEAAIEAATGSGHLTRD
FT                   VGGEANTEDVTEAIIKALTLSPATV"
FT   gene            complement(471653..472558)
FT                   /locus_tag="Achl_0443"
FT   CDS_pept        complement(471653..472558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0443"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rha:RHA1_ro04804 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38442"
FT                   /db_xref="GOA:B8HAI1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL38442.1"
FT                   /translation="MPKELHVDTRKLKYFLAVVDHGGFNRAAEHLLIAQPSLSQTIAGL
FT                   EKELGVPLFHRIGRRVVLSDAGKELVGPARVVMRDLDAAQSAVQSLRGIRSGRLDIITM
FT                   PSPGIEPLTSMISDFTLSYPSVRLNVSAAFTPEEVVESVRSGSTEIGLAGSPTAIRVPG
FT                   VEVLELERQPLILIVNPHADAFGNVKAIQREDLGGHRLIASQRGSLMRGLVDDALASGI
FT                   NAEIVVEVAHRTSILPLVLAGVGHAVMPSSWAPTAHKAGLRTLLIEPVSHLEVAILSRK
FT                   EGLTPAAAAFLKVAELHVTA"
FT   gene            complement(472610..472870)
FT                   /locus_tag="Achl_0444"
FT   CDS_pept        complement(472610..472870)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0444"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mkm:Mkms_5703 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38443"
FT                   /db_xref="GOA:B8HAI2"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI2"
FT                   /inference="similar to AA sequence:KEGG:Mkms_5703"
FT                   /protein_id="ACL38443.1"
FT                   /translation="MMYWDGSMGTWGYVLSGLSFILFWGAVIAAIVLFARSATAGRHGS
FT                   GGDGGTYSVAEHLLAERFARGEIDESEYMARLAVLRRGRSA"
FT   gene            473068..474072
FT                   /locus_tag="Achl_0445"
FT   CDS_pept        473068..474072
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0445"
FT                   /product="Bile acid:sodium symporter"
FT                   /note="PFAM: Bile acid:sodium symporter; KEGG:
FT                   art:Arth_0102 bile acid:sodium symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38444"
FT                   /db_xref="GOA:B8HAI3"
FT                   /db_xref="InterPro:IPR002657"
FT                   /db_xref="InterPro:IPR004710"
FT                   /db_xref="InterPro:IPR038770"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI3"
FT                   /inference="protein motif:PFAM:PF01758"
FT                   /protein_id="ACL38444.1"
FT                   /translation="MLEATKSQKSPEGAPLNPALAAESRIARVAVTVFPLLVVAAGIAG
FT                   YLLPGTFKPMGAAVPFLLGIIMFCMGLTLTPPDFAAVAKRPWAVALGIVAHYVIMPGAG
FT                   WLIANALNLEPELAVGLILVGCAPSGTASNVMAFLAKGDVALSVAVASVSTLIAPIVTP
FT                   LLVLFLAGSYLNIDAGGMVVDILNTVLLPVVAGLLARLFLKKLVDKVLPALPWASAVVI
FT                   SLIVAIVVAGSASKIVAAGGIVFLAVVLHNGFGLGLGYLAGKLGRLDDKARRALAFEVG
FT                   MQNSGLAATLATAHFSPLAALPSAVFSLWHNISGAIVAAWLARRPLKDTPAPQ"
FT   gene            474174..475196
FT                   /locus_tag="Achl_0446"
FT   CDS_pept        474174..475196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0446"
FT                   /product="3-Oxoacyl-(acyl-carrier-protein (ACP)) synthase
FT                   III domain protein"
FT                   /note="PFAM: 3-Oxoacyl-[acyl-carrier-protein (ACP)]
FT                   synthase III domain protein;
FT                   3-Oxoacyl-[acyl-carrier-protein (ACP)] synthase III; KEGG:
FT                   aau:AAur_1998 3-oxoacyl-(acyl carrier protein) synthase
FT                   III"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38445"
FT                   /db_xref="GOA:B8HAI4"
FT                   /db_xref="InterPro:IPR013747"
FT                   /db_xref="InterPro:IPR013751"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI4"
FT                   /inference="protein motif:PFAM:PF08541"
FT                   /protein_id="ACL38445.1"
FT                   /translation="MVGNATFRHTNTALLSVSSVEAPRIVSSVDFDRRLASTLQRLKFP
FT                   PRLLERVAGITHRRWWAPGTSFDDAAIEAGAKALAEAGVEASEVGLLINTSVTRRNLEP
FT                   SVAVKIHHGLGLPSSAMNFDLANACLGFVNGLTLAANMIDSGQIKYAVIVNAEDAEATQ
FT                   EATLARLQRPETTREDFNREFATLTLGSGAAAAVLGPADGHPGAHRLVGGVMRAGTEHH
FT                   ELCVGGIDGMNTDTKGLLDGGLQLVVDAWHEAQPEWDWATMDRYVTHQVSNAYTQAIID
FT                   AIDLDPTKVPITFPHWGNVGPASLPMTLAAESQSLEAGDRVLCMGVGSGLNTAMIEIVW
FT                   "
FT   gene            475190..477973
FT                   /locus_tag="Achl_0447"
FT   CDS_pept        475190..477973
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0447"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: alpha/beta hydrolase fold; AMP-dependent
FT                   synthetase and ligase; KEGG: aau:AAur_1999 hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38446"
FT                   /db_xref="GOA:B8HAI5"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI5"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL38446.1"
FT                   /translation="MVAAAWPGVDPQWSRELAVPSTSGADEPGTVRHWHVLDNGAQLEA
FT                   RGLTPEGTLLCVHGNPTWSYLWRTLLAAGSDPAHPWRVVAVDQLDMGFSERTGTFRRLA
FT                   DRVNDLGDLTTALGLDGPVVTVGHDWGGVISLGWALAHQDQLAGVVLTNTAVHQPSTSK
FT                   IPPALRLALHPAVHQWGTVTSDAFLRVTHSLAHPPLAADVHAAYMAPYRGASRRSGVGN
FT                   FVADIPVDEFHPSFAALAGVAEGLRGLTVPALMLWGPRDPIFSDRYLKDLIGRLPHAKV
FT                   HRFEGAGHLVAEDRDIATPVFEWLAAREGAGSASGLGGEGSDAAADTSAAPTGDPGIEA
FT                   GSATPETAASPAAPEAAGFRPLWTLLDEQAAGPAGTGSAVVEMAPSGAAARSLSWQQLE
FT                   QRIADLAAGLEQAGVQRGSRVSLMVPPGVDLTVALYACLRLGAVVVVADAGLGTKGLSR
FT                   AVKGATPDFIIGIDKALAAAAALGWPGRRISAGTLPGARRRLLGAETSLSELARSGAGR
FT                   KAAEHADALDPDALDPDALDPDAPAAVLFTSGSTGPAKGVLYTHRQLAAMRDTVANTFG
FT                   IRAGSNLVAGFAPFALLGPALGAVSVTPAMDVTAPRTLTARTLAEAAKAIDATVVFASP
FT                   AALRNVVATREDLDEAGLKALARVELLLSAGAPVPEPLLAEVQQLVPAASLHTPYGMTE
FT                   ALPVTDISLEQIREADAETAAGTLQGGGNGVCVGKPVHGARLAIIPLAADGTASGTTPV
FT                   TDAGVTGEILVSAPHVKDSYDRLWLTQRESAGIPGWHRTGDVGHFDAAGGLWVEGRLAH
FT                   VVSAPGAAVTPVGAEQAIERLDSVRLAAVTGVGPAGTQAVVAVVETVPPTRTAGPAEPA
FT                   LAASVRAAARTAGVEISAVLAVPAQPTDIRHNAKIDRTRLSRWATRVLAGGRPGKP"
FT   gene            477970..478941
FT                   /locus_tag="Achl_0448"
FT   CDS_pept        477970..478941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0448"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; NmrA family protein; Male sterility domain;
FT                   KEGG: aau:AAur_2000 putative dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38447"
FT                   /db_xref="GOA:B8HAI6"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI6"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL38447.1"
FT                   /translation="MKVLVTGASGMLGGTVARLLVREGHTVTTLQRRPSGVDGATDLCG
FT                   SITDARVLKDAVRGQDGIIHLAAKVSFTGRAAEFDEVNIEGTRLLLEAAREAGVPDFVF
FT                   VSSPSVANSGAAIVGLGAGPADPEHAHGDYARTKGAAELLALAADSPGFRVAAVRPHIV
FT                   WGPGDTQLVERVLARAAVGRLPLLDAGAALIDTTYVENAASAMVAALERMEKVHGQAVV
FT                   VSNGEPRPVGELIAGICAAGGVAAPSWAVPGAVARGIGAVVEKIWLWAGRTEEPPMTKF
FT                   LAEQLSTAHWFDQRRTRELLDWTPAVSLDEGLAKLAAHYQPR"
FT   gene            479019..479984
FT                   /locus_tag="Achl_0449"
FT   CDS_pept        479019..479984
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0449"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: sat:SYN_00679 lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38448"
FT                   /db_xref="GOA:B8HAI7"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI7"
FT                   /inference="protein motif:PFAM:PF07859"
FT                   /protein_id="ACL38448.1"
FT                   /translation="MTQPTPGGLSGSQHGIITGQNGAVHMESTTTAGRILRGIEFARPD
FT                   GGAPLLLDLYLPVADPARRTGAPHPAVVHFHGGGWRTGERSSLGPTVDGFGLSPIEQLV
FT                   DAGFVVASADYRLTDTVTFPAQLHDAKAAVRWLRTHAAAYNVDPGRIYAWGDSAGGHLA
FT                   SLVGLTGGSAAFTDDGGTDPADSVAAVVAWYPPTDLVRMGAQARPDAVARADDPGSREA
FT                   LLIGAQPADAPDKARAASPLAYVHAGAPPFLLIHGTADRFVPAAQSAGLAGALEDAGAA
FT                   VELLLLDGADHMWATPDGSSAAAETATAATLDFLRRQSEH"
FT   gene            480043..480942
FT                   /locus_tag="Achl_0450"
FT   CDS_pept        480043..480942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0450"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rha:RHA1_ro03909 fumarylacetoacetate hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38449"
FT                   /db_xref="GOA:B8HAI8"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI8"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL38449.1"
FT                   /translation="MQFIGINRNGEPWAAALAGSRVLPLATVADFWADPEGWQDKAVTV
FT                   VAGGASQAGAEGNDASDAGAWLERDSVTEVPLVPASARVICVGLNYKAHVAEGSFKDQE
FT                   LPPYPTLFARWTASLSVGGVPVPVPAGEAGLDWEGEVAAYVGRRVESADEATAADSVFG
FT                   YSTFNDITSRKAQKLTSQWTLGKNGDFSGPLGPLVSRDEVGDLRDGLQVRTLVNGLEAQ
FT                   NGNTRDMIFSVPAIISLISQTFTLHPGDVIATGTPEGVGYARTPQWLLQPGDTVVVEIE
FT                   KLGSLTTPVGDISLRSRA"
FT   gene            480942..482795
FT                   /locus_tag="Achl_0451"
FT   CDS_pept        480942..482795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0451"
FT                   /product="monooxygenase FAD-binding"
FT                   /note="PFAM: monooxygenase FAD-binding; KEGG:
FT                   rha:RHA1_ro03910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38450"
FT                   /db_xref="GOA:B8HAI9"
FT                   /db_xref="InterPro:IPR002938"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAI9"
FT                   /inference="protein motif:PFAM:PF01494"
FT                   /protein_id="ACL38450.1"
FT                   /translation="MDTLQGTFPRIFPVTDAADIPDTAQVLIAGGGPSGLFLALDLASR
FT                   GVASTVIEPRTGVDHTRPRAKTTNARTMTHLRRLGLAGALRDASPLPVDYAQDVIFCTG
FT                   LTGLAAHELRRFRNAFQLVPGRYRPQPEGGQQVPQPVLEEVLRAAAAENPLVTFVTGWS
FT                   VTQVEIAGVSAGAGEDTAAQGAVVVIADASGTSRTIAAGYVIGADGGSSAVRRSLGIRL
FT                   EGGSAALSNISILFRSESLASAITLDPAVQYWVVGAETSGMVGPMDLAGTWWAIVQGVD
FT                   PALTVSMQDAGAMVRALVGAEVDIEVLATDPWTARMLLAPEYSRDTVFLVGDAAHLNPP
FT                   WGGHGFNTCIGDAANLAWKLAATINGWGGSALLASYGQERRPVAARTIGDAARNGKALA
FT                   YHFADPELAASGPAGDAARRAAREALAVKQSEFDSLGLVLGYAYTDSPLVVPDGLPVPP
FT                   EDPIHYVPSASPGSLLPHAWLAESYSLYSALGPGFTLLADAGALGRVPADEAFAPVVEA
FT                   AARQGIPVTVAAVGLTEAGTRLSEMWGAEAVLVRPDQHVAWRGNSAEAAAAALSLAAGR
FT                   LPGAPQETAATGPEHVPATEIPDFPAADFPARSTRANAVIP"
FT   gene            482773..484008
FT                   /locus_tag="Achl_0452"
FT   CDS_pept        482773..484008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: msm:MSMEG_2481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38451"
FT                   /db_xref="InterPro:IPR021889"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ0"
FT                   /inference="similar to AA sequence:KEGG:MSMEG_2481"
FT                   /protein_id="ACL38451.1"
FT                   /translation="MPTPSFRDYLFAPDHPRVAEIRGLNARDYAEAAKTDSFAGPMIEG
FT                   WQKLYPQPFTGITSDGVRRGGLFPLAAARPGEEAPTADMVAAARKLLGTLTPEQARKLS
FT                   YAVDAPEWQSWANPEFMQHDTGLRLDELGGPARDAILGVVEASLSGQGFELVRNLMRIN
FT                   GFLGELVELPLLMNEFSYNFALYGEPSETEPWGWQLFGHHAALNCLVAGTQLVISPVFM
FT                   GAEPDMIDAGPHRGVKVFKERIALARQLMGALPAELRSRAVSYGAMVDPAMPEGRIHPG
FT                   DERHLGGCFQDNRVIPYEGILVADMPAEARELLDAVVDDFIGYLPDGPRAARRREIQEQ
FT                   YGETYFSWIGGWEGEDAFYLRLQSPVVVLELDHHTGVFLSNDEPAPFHMHTVVRTPNGN
FT                   DYGRELVRQATP"
FT   gene            484150..484347
FT                   /locus_tag="Achl_0453"
FT   CDS_pept        484150..484347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0453"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38452"
FT                   /db_xref="GOA:B8HAJ1"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38452.1"
FT                   /translation="MDIERIVYLGVIAVIVAVAWFVLVPRTASTSEGLLYAFLAVGAAA
FT                   ALRLWFTAAVRRRELKKHLQ"
FT   gene            complement(484412..485482)
FT                   /locus_tag="Achl_0454"
FT   CDS_pept        complement(484412..485482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0454"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   rha:RHA1_ro03906 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38453"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ2"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL38453.1"
FT                   /translation="MSLSVEEMNKQLPVANALPGEAVPYYMASGEGARYEINGQLVTVI
FT                   ARAADTGGIFSAAYISGGMGAESPFVSHAIEHKTLYVFDGILHVWLPGESRILTPGDSV
FT                   VIPPNTPHAYRMASHYTRFLNWMTPGGGEAYYERVGTPIDSHVPPVRPGHKASLQEQAE
FT                   VGAEFGITFPDVERVAPSFKHDAGLPPTQSPYFLSTGEGERLVSYQTMFTYLSRPANTG
FT                   SNYFAVHTKGAKSPYIPLHFHSEHTENFLCTEGRMWLYANGREVLLTKGDFLHAPAGTI
FT                   HSFAFDAHNTQMVGFLTPSVFNGFFEYFNKPTEDYMYTEGGEPYMDMEGFGRAQAEMDL
FT                   TVVGPPPQRRAALDIP"
FT   gene            complement(485604..487319)
FT                   /locus_tag="Achl_0455"
FT   CDS_pept        complement(485604..487319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0455"
FT                   /product="Acetyltransferase (isoleucine patch
FT                   superfamily)-like protein"
FT                   /note="KEGG: aau:AAur_2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38454"
FT                   /db_xref="GOA:B8HAJ3"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ3"
FT                   /inference="protein motif:COG:COG0110"
FT                   /protein_id="ACL38454.1"
FT                   /translation="MNPQPDLSFDYSPWTFQANATAAQREAQLERQQALAGKDGITIGD
FT                   AAYVSPLAMVDPDSLALGDESLIAAHAYLTGDLRIGSNCTVNAFTVVRGTVSMGDGVRI
FT                   GAHTSILGFNHSMDPSQPVFRQPLTSKGIVLGDDVWIGSNAVVLDGVTVGSHAVLAAGA
FT                   VVTKDVPDWAVVGGNPARFIRDRRTPRKAASGQGAAANGEGILRERLASFAGTARADAP
FT                   AIIARSWQQEASGTGGFGEGRYVDRPGAAATVRAHCDAVEIADLLLRAAPPQLSRDAHV
FT                   DRLASLQDPRTGLVPEYGPDGLPAAGELAFGNGAATYHVLSVGYALDLLGSGFKHPIHA
FT                   VAGTGPADLAERLNALPWRKEAWESGAWVDAWGTAEYWNLARTAEGPGSTGTLEALFGW
FT                   LLTRVNSAAGTWGTPSADTRLKVVNGYYRLTRGTFAQFGLPVPHPEQLIDTVLEHGADP
FT                   RYFAAGRQNACNVLDVVHPLWLARKQVTHREADIKAWASTQLDHALGQWHPGQGMAFSA
FT                   APESGQQNLPGLQGTEMWLSIIWYLADLLGHSEALGYRPRGVHRPEPAFLLPTL"
FT   gene            complement(487316..488242)
FT                   /locus_tag="Achl_0456"
FT   CDS_pept        complement(487316..488242)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0456"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: sma:SAV_5310 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38455"
FT                   /db_xref="GOA:B8HAJ4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL38455.1"
FT                   /translation="MQYLPEGRPVLTVSTLGAPGEGLGTVLGWLAANGVSGVELRLAPG
FT                   EIAAPAMTRQERARLRSEVADAGVAITGLASYIRVADPAPDELVVGALEAALFLAADLG
FT                   APTVRVFPGAPTEPADYQEVPRTTAARHEVDALAARRLTAVGRLAEELDVFPALETHDS
FT                   HPRGQDIAAILAQVEGRVGAVWDLMHPWRVGEGLEDTWNVLAPWLISGLGSVQVKDAGL
FT                   PASRTPVPIGDGTLPVDGFARLLRDRGYTGLLCLEWEKAWHPDAVRLDTALESTKAWYL
FT                   RHWPDRPPADNSRNQPAPARDTVVETP"
FT   gene            complement(488304..489665)
FT                   /locus_tag="Achl_0457"
FT   CDS_pept        complement(488304..489665)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0457"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0270 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38456"
FT                   /db_xref="InterPro:IPR039469"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ5"
FT                   /inference="similar to AA sequence:KEGG:AAur_0270"
FT                   /protein_id="ACL38456.1"
FT                   /translation="MKHATLLQPHRTAFTVRINDNGAWCWFQDERALIDPANNTLLVGS
FT                   VAAPEGLGGAERGGNIEVAVLDLATGQSQVHVLHERLESDDHNAPALLIRPDGRYVAMY
FT                   ARHKTDNYSRWRVSVRPHDASEWEPEQVFDWTELAGGRGATYSNLHWLEAESRVYNFVR
FT                   AINDDPTMLVSGDDGTTWSYGGKLFTRPKVGYVNGYTRYWGNGVDRIDLITTDHHPRDF
FT                   NNSIYHGFIRGDALHDAEGQVVSKPLLGSTGINQDTLTTVFRAGTEIDGDILTHAWTAD
FT                   LRGQGNQLAAIISCRANDVNGPLQREQRLDVDDHRLLYARFDGTDWALHPLAVAGPGLL
FT                   PHEQDYTGLGAVDPNNLDQVYISAPVHPGTGEATDHYEIYRGRTADGGASWSWTAVTEN
FT                   SGMDNLRPIVVPGDPSVHAVLWFRGSMSSSQAYTAEVVGRVSRLNESDRTAQTR"
FT   gene            complement(489762..490061)
FT                   /locus_tag="Achl_0458"
FT   CDS_pept        complement(489762..490061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_3581 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38457"
FT                   /db_xref="InterPro:IPR025242"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ6"
FT                   /inference="similar to AA sequence:KEGG:Arth_3581"
FT                   /protein_id="ACL38457.1"
FT                   /translation="MAVDYDAPRVTPEDEPNVAIEELKAEKPGRREAAPDVDETDLADS
FT                   FELPGADLSHEELQVQVVPVQADEFTCMSCFLVHHRSQLAREKDGKKYCRECES"
FT   gene            complement(490272..490826)
FT                   /locus_tag="Achl_0459"
FT   CDS_pept        complement(490272..490826)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0459"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_3910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38458"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ7"
FT                   /inference="similar to AA sequence:KEGG:AAur_3910"
FT                   /protein_id="ACL38458.1"
FT                   /translation="MPAHHAFHPTAAAAATHSGGSPRGAYRYRGSARPDPAAARVGEIR
FT                   DLLEQQRQMISLRSSRLRALFSELNERVAQAVCDGVKVTTIAQAAGVPVTTIRGIGLGR
FT                   DGLYPSGLPAEEQLRSISRLADEVTAVEAARAAVERHRVQVLAAARKQRLLDDYQLASA
FT                   SGLKHDEIRKMTRGVNTGPEA"
FT   gene            491147..492355
FT                   /locus_tag="Achl_0460"
FT   CDS_pept        491147..492355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0460"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   aau:AAur_3909 aspartate aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38459"
FT                   /db_xref="GOA:B8HAJ8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ8"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACL38459.1"
FT                   /translation="MPEFVPASRVTRIKSSPSVAAAARVRELKAEGRRILDLTVGEPDF
FT                   DTPQHIKDAAIAAIGRGETKYTSVTGTPELQRAILQTLERKTGQPYTPAEITIGGGGKQ
FT                   VIFTAFMATLDAGDEVVIPAPYWVSYPDMVLANEGTPVIVPCSEETGFKLTPEVLAAAL
FT                   TDRTKWVILNTPSNPTGAVYSRDELAGLAAVLREHPSVHVLTDEIYDEIHFGAEPITSL
FT                   VAVAPELKDRVLVTNGVSKAYAMTGWRLGYAGGPATLVAAINKLQSQMSSCPSSVSQAA
FT                   AAAALTGDQSFVRESVAVYRERRDAAVAGLNAIEGLHCATPDGAFYAYVNCGGVIGKTT
FT                   PGGQLIANDEDFTLYLLDAASVAVIQGSAYGVGPYFRISYATGLPVIEESIAAIEKSVL
FT                   ALS"
FT   gene            492418..493113
FT                   /locus_tag="Achl_0461"
FT   CDS_pept        492418..493113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0461"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   aau:AAur_3908 putative demethylmenaquinone
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38460"
FT                   /db_xref="GOA:B8HAJ9"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAJ9"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ACL38460.1"
FT                   /translation="MIHVKTKFDKPSEDAIERLSKFSSATVHEAQGRKGALSSKIKPID
FT                   RSMSFCGPAVTVVCAPRDNLMLQVAIHYAQKGDVVLVAAGEFEEAGTFGDVLGNAMKAK
FT                   GVAAMVTDSGVRDTKDLIELGLPVFSGSVCIKGTVKETIGPINHPLVFGDEIVYPGDVL
FT                   LGDADGVVVVRKDEIEEVIKLSQARVDAEDELIRLYKAGGTTIELCKLTDVLKAKGLLV
FT                   EDAELEPAL"
FT   gene            complement(493185..494387)
FT                   /locus_tag="Achl_0462"
FT   CDS_pept        complement(493185..494387)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0462"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   mgi:Mflv_0382 integrase catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38461"
FT                   /db_xref="GOA:B8HAK0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025246"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK0"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL38461.1"
FT                   /translation="MPAGYVFGDAVRDGFFALLRQGASISETCRVSGLWSSTVRHWVRR
FT                   MGPVEMSRGKREGPVGAPFPDGAPGSGRLSLSERAVIMVRPRDGWSYAAIGRELGRDRS
FT                   VIWREARRNCCEDGTYQSDVAQLKAGQNARRPKEHKLAHKPLARFVESAMDEGWSPQLC
FT                   SLVLARAFPDDERMQISHETIYQAIYVQGRGHVRQDLYRQLSTGRAKRVSDGRGRGRNN
FT                   SPFKDALKIPERPAEAADRAVPGHWECDLILGSVASNSAIGTCVERSTRYTMLLHLPNG
FT                   HSADEVARAMITAFAELPADLRKTLTYDRGIEMARYAQIQIAIDADVYFCDPHSPWQRG
FT                   TNENTNRLLRHWFAKSTDLSVHTAKDLKRVQDSLNNRPRPTLGLATPKQKFNELLLAAA
FT                   A"
FT   gene            complement(494554..494796)
FT                   /locus_tag="Achl_0463"
FT   CDS_pept        complement(494554..494796)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0463"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0267 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38462"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38462.1"
FT                   /translation="MKKITTLQYRKSSDRRIQLKASTGSHCPTNGFWRPEDGPASDPVF
FT                   VFEGSMMPPGKRGSTMWYLDDSQAGPPSHLLPGMN"
FT   gene            complement(494933..495883)
FT                   /locus_tag="Achl_0464"
FT   CDS_pept        complement(494933..495883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0464"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: aau:AAur_3906 nitrogen
FT                   assimilation regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38463"
FT                   /db_xref="GOA:B8HAK2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL38463.1"
FT                   /translation="MDTRKLAYFVKIVDSGSITKAAAALHVAQPALSQQVSSLETELKQ
FT                   RLLIRSKQGVEPTAAGHTLYRHSQTILRLVEQARLDVAASGAAPSGRVSIAIAPYSMAS
FT                   SLTPRIISEVNRRYPDIVLHLTEIYGGVLSEAIKNGRLDMALIYEPGPIRGVQFTTLIV
FT                   EDLYLIVNAGRELPVGPDAGTITLEEASTLGLFLPEQIHTLRQVVQAGIEGKGLKLHLV
FT                   GEVESVPSLTRLLRSDLGATILPKSAADALFHEEDFRVLRIVDPALQCKIALCTPDHEP
FT                   LSEAGSAVLLVLKEMLQEMLRSKYQPLSDGARETP"
FT   gene            496284..497069
FT                   /locus_tag="Achl_0465"
FT   CDS_pept        496284..497069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0465"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: aau:AAur_3905
FT                   putative LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38464"
FT                   /db_xref="GOA:B8HAK3"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK3"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACL38464.1"
FT                   /translation="MPTVDLVADLGEGFGAYSIGDDKALLDIVSSANIACGFHAGDPDI
FT                   MDATVAECVRKGVGIGAHPSFPDLRGFGRRAMDLTADEVRNDVVYQLGALTAFAAYHGG
FT                   SVSHLAPHGRLGNLVATRADYAQAVADAAVRVDPNLIVLAQDGELATAAADRGLQVAIV
FT                   GIADRAYQEDGTLVPRSQPGAVIHDPSAIVERTVRMVCEGLITTASGTDLAIQADTILL
FT                   HGDNPGAVELARLIRSELIAAGVTVAPLAQVLAAKQKVS"
FT   gene            497072..497803
FT                   /locus_tag="Achl_0466"
FT   CDS_pept        497072..497803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0466"
FT                   /product="Allophanate hydrolase subunit 1"
FT                   /note="PFAM: Allophanate hydrolase subunit 1; KEGG:
FT                   aau:AAur_3904 putative allophanate hydrolase subunit 1
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38465"
FT                   /db_xref="GOA:B8HAK4"
FT                   /db_xref="InterPro:IPR003833"
FT                   /db_xref="InterPro:IPR010016"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK4"
FT                   /inference="protein motif:PFAM:PF02682"
FT                   /protein_id="ACL38465.1"
FT                   /translation="MPAPTTAAPAALEIHESGDAALRVVATSGNPEADWATVHSLAGWL
FT                   ATAGVDGVHGAVPTYDSVLVEFDPYLTSARQVRAFVLLAMRQLDFTGATVREPRRFDVP
FT                   VVYGGSYGPDLDRVAEQQGLDAADVIARHTEKTYVIRCLGAPAGSPMMDGPDFPFPVPR
FT                   LKDPRLSVPAGAVSVAGRQAVIAPATAPGGWCVIGQTPLTVLDATREPLVPYVPGDELR
FT                   FYAIPEKDFEDLAGKFLEARP"
FT   gene            497800..498813
FT                   /locus_tag="Achl_0467"
FT   CDS_pept        497800..498813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0467"
FT                   /product="Allophanate hydrolase subunit 2"
FT                   /note="PFAM: Allophanate hydrolase subunit 2; KEGG:
FT                   aau:AAur_3903 allophanate hydrolase subunit 2"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38466"
FT                   /db_xref="GOA:B8HAK5"
FT                   /db_xref="InterPro:IPR003778"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK5"
FT                   /inference="protein motif:PFAM:PF02626"
FT                   /protein_id="ACL38466.1"
FT                   /translation="MTGSLVILQPGHSVVTDLGRTKGPAFGLPVNGALDQFSAKAANIL
FT                   AGNPDNEPLLELTALDFRMRATTDLLIAVTGAPLDLTVGGRDCSQWEPVSVRAGETVAV
FT                   RGIRTGLRAYIAVRGSFPAPTLLGSCAPDTVVGFGLKLVEGTELATQKTTAPITQPHYG
FT                   LPLFRLGLAKPDFTTHPVIDVTDGPDVAEFGNTADLLFTSQYTVSPRSNHIGLRLGGAL
FT                   PERQLTSEVLSRGVPVGAIEVPSREELLVLHRGRGVTAGYPVLAVVTSRSLDVLSQARP
FT                   GHTITFRKTTVADATATHRAACLELDRLRSTIHTVFGLLGIGAGERWHELSPASGS"
FT   gene            498855..500195
FT                   /locus_tag="Achl_0468"
FT   CDS_pept        498855..500195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0468"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: aau:AAur_3902 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38467"
FT                   /db_xref="GOA:B8HAK6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38467.1"
FT                   /translation="MSTSTNAVTPQNDRLTAKQTRKVVTAGCVGIFVELYDNGIFAFMA
FT                   GTLALVFLAPGNPDNALLFVFAGYAVSFFVRPLGAVVCGYLGDRIGRQKLLVFVIMLIS
FT                   VATAGIGLLPPYAAIGIAAPILLVLLRLVQGFSVGGEAAGAMTFLAEHAPEGKRGVITS
FT                   YAQIASFAALLTGTLVAFSMSPWLTQAAIDGGGFGSFAWRIPFLVAIPMGIIGWYIRKA
FT                   ISDTPNFEKLKEEGGLSKNPLKEALASPVHRRAMLLALFIPLMNGSGYYVLFSYMPTFL
FT                   KGKQLNFTIGEALLVTACSLVVICIAIPFMGALSDRLGRKKVIAGSAIAMAVLGIPSYA
FT                   LIATGQMGLAILGACIMAVVFAGHTAVIHILLVELFPTRVRYSAYGVGYNISSALFGGT
FT                   APLLMTWLIAETNNIYMPAFYAVITALGTLAAVSTVKDRAHEPLRDA"
FT   gene            500278..501033
FT                   /locus_tag="Achl_0469"
FT   CDS_pept        500278..501033
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0469"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; Male sterility
FT                   domain; KR domain protein; KEGG: rha:RHA1_ro03292 short
FT                   chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38468"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK7"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38468.1"
FT                   /translation="MSFSDYTTALVTGASTGMGAAITERLTKRGLTVHAVARNKERLAD
FT                   LADRTGAVPHVVDLTDTAALAAVVRDLNVDVLVNCAGVSRPGNILDSSEQDIDELVDVN
FT                   LRGLLQLTRLVLPGMVERDLGHIVNISSIAGTYNFYGHTVYHATKAAVHQISRQLRNDT
FT                   VGKRIRVTEICPGRVETEIFGRNMGGSPEAMEEAWKTYYEGYESLTTDDIVNALDYAIE
FT                   TPRHVNVGMLELMPTFQVPGGLTFDRRED"
FT   gene            501106..502092
FT                   /locus_tag="Achl_0470"
FT   CDS_pept        501106..502092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0470"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding; KEGG: rsa:RSal33209_1041 D-3-phosphoglycerate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38469"
FT                   /db_xref="GOA:B8HAK8"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029753"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK8"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL38469.1"
FT                   /translation="MQLIRTVSFPEPQLLADLSPLPEGLRGVVWDMQGEPDAAHGSIDG
FT                   VILPYINAGAVLGNLDKVQDLKFVQTQSTGFDGVREAAGPGAAVANASGVHAAATAELA
FT                   VGLILAKLRGIDQAVRDQATENWAPQRRQSLADRRVLLLGIGGIGQELARRLEPFEVTV
FT                   TRVGSTERTDEHGQVHSSAQLETLARDHDILVSVLPLNDNTHHLVNEQVLAALPDGALV
FT                   VNVGRGPVIDTDALTAEVVSGRLQCALDVVDPEPLPKGHPLWSTDNALITPHVGGNASA
FT                   FEPRILKLLKRQLEALAAGETPANLVQQGPFQQASSQQVSSPQGASA"
FT   gene            502089..502859
FT                   /locus_tag="Achl_0471"
FT   CDS_pept        502089..502859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0471"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   art:Arth_2452 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38470"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAK9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38470.1"
FT                   /translation="MSALFDLTGRVALVTGSSRGIGSSLARALAYAGATVVLNGVNAER
FT                   LKEAETALAADFPPGRITSVAFDVTDGDAAAQSIAWIEENVGPLDILVNNAGIQHRVPM
FT                   LDLDVADWERVISTDLTSAFLVGREAARHMIPRGRGKIVNICSVQTDLARPTIAPYVAA
FT                   KGGLRNLTRAMTAEWAASGLQINGIAPGYIHTEMTQNLVDDEQFNSWILGRTPAHRWGT
FT                   PQDLAGPVVWLASSGSDFVNGQTIFIDGGMTVVV"
FT   gene            502859..503965
FT                   /locus_tag="Achl_0472"
FT   CDS_pept        502859..503965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0472"
FT                   /product="Alcohol dehydrogenase zinc-binding domain
FT                   protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   art:Arth_2451 alcohol dehydrogenase, zinc-binding domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38471"
FT                   /db_xref="GOA:B8HAL0"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL0"
FT                   /inference="protein motif:PFAM:PF00107"
FT                   /protein_id="ACL38471.1"
FT                   /translation="MPGNTFQDTATEELPASGPALVAHAAGDLRIDDVPLAEPAEDQAV
FT                   VEVLYGGICGSDLHYWLHGAAGESILKDPLVLGHEISGVVVRAAANGEGPQAGIAVAVH
FT                   PATPGPGAAKYPADRPNLSPGCTYLGSAARHPHTDGAFSRFVNLPVRMLRPLPEGIDLR
FT                   TAALIEPASVAWHAVSRAGDVRGKTALVIGSGPIGALAVAVLKRAGAAHITAVDLHAKP
FT                   LEIAAAAGADHVINAADTAAIEAVEADVVIESSGNHHGLASAIRGAVRGGTVVMVGLLP
FT                   TGMQPLPISLAITRELDLKGSFRFNDEIDEVIAALADGSLHIDPVITHEFPLSDALHAF
FT                   EVAKDSTNSGKVLLSFSGGGSAQEAGGQ"
FT   gene            503962..504564
FT                   /locus_tag="Achl_0473"
FT   CDS_pept        503962..504564
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0473"
FT                   /product="carbohydrate kinase, thermoresistant glucokinase
FT                   family"
FT                   /EC_number="2.7.1.12"
FT                   /note="KEGG: cmi:CMM_2271 putative
FT                   gluconokinase/dehydrogenase; TIGRFAM: carbohydrate kinase,
FT                   thermoresistant glucokinase family; PFAM: shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38472"
FT                   /db_xref="GOA:B8HAL1"
FT                   /db_xref="InterPro:IPR006001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL1"
FT                   /inference="protein motif:TFAM:TIGR01313"
FT                   /protein_id="ACL38472.1"
FT                   /translation="MTTQVPPLVVMGVSGCGKSTVGALLAGRLGVPFLDGDDFHPAANK
FT                   EKMAAGIPLTDSDREPWLARIGHLLAGQDPVGPGPAGKNPVGSGAGAAGNYDGGTPVAP
FT                   IVACSALKRSYRDLLRAAAPDVVFVHLSGSPETIAARMDARAHEFMPRTLLESQLATLE
FT                   ALESDEAHILGDIALDPGALVDAIVHKLRSRAGETAA"
FT   gene            504631..505335
FT                   /locus_tag="Achl_0474"
FT   CDS_pept        504631..505335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0474"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: oan:Oant_3360
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38473"
FT                   /db_xref="GOA:B8HAL2"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL2"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL38473.1"
FT                   /translation="MPADVSAQPDAPALSVAASAPSTAASASEASAATPSARPPARQLL
FT                   LEAAARLFYAQGVGATGIDTITAAAGVAKKSLYNNFASKADLVAAYLEARHEEWLDLYR
FT                   ARVAIAATPSEQVLAVFDAYLDHANFAYEHGFRGCGLLNAAAELPVGHPGRLAVRQHKE
FT                   EVEHLLATHVAAYQADRPAPAASPDASERTAGLARHLSFLLEGAMARAGLEGDDSQLRD
FT                   AKRIAQQMLAGL"
FT   sig_peptide     504631..504714
FT                   /locus_tag="Achl_0474"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.913) with cleavage site probability 0.638 at
FT                   residue 28"
FT   gene            505332..506477
FT                   /locus_tag="Achl_0475"
FT   CDS_pept        505332..506477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0475"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: pmr:PMI2231 transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38474"
FT                   /db_xref="GOA:B8HAL3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL38474.1"
FT                   /translation="MTGGPGAVLPAPGVSGHAGHANAPLWGALFVVAASILWGTTGTAA
FT                   TLAPGVSPLAIGAVAMGVGGLLQALLAARAIRRQWSGIRRRWRLVTVGAVAVAVYPLAF
FT                   YSSMHLSGVAVGTVVSIGSAPVAAALIERFADRKPLTRRWIAGAFLGVGGAALLSFAGH
FT                   SPATAGTAAGTNAAGEWGSTAGILLGLLAGGTYALYSWAAHRLIGGGIPSRAAMGSIFG
FT                   VGGLLLMPVLAVTGAPLLSSWANFSVGAYMALVPMFAGYILFGWGLARVRASTATSISL
FT                   LETVVAAVLAVLVVGERLPALGWLGAAVVLGSLFILTPRTRRATQPADPVDGTRSGPKP
FT                   GGPAETAQLVPEPVGPAETTDSATETAGTQPANAARGHVAR"
FT   gene            complement(506494..506793)
FT                   /locus_tag="Achl_0476"
FT   CDS_pept        complement(506494..506793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0476"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: aau:AAur_3578 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38475"
FT                   /db_xref="GOA:B8HAL4"
FT                   /db_xref="InterPro:IPR021401"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL4"
FT                   /inference="similar to AA sequence:KEGG:AAur_3578"
FT                   /protein_id="ACL38475.1"
FT                   /translation="MPMSEEERRLLKELELGLIADDPHLAMELLSGYPSRRIPPGLVPG
FT                   SLVCLLAFAIIAAGIGSRELAAVVVGAMLLVLGGCLLLNRPASGRGPQRGRATG"
FT   gene            complement(507034..508080)
FT                   /locus_tag="Achl_0477"
FT   CDS_pept        complement(507034..508080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0477"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: art:Arth_3948
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38476"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL38476.1"
FT                   /translation="MSLSELRVFGRSGTPISQLTLGTMNFGEGAGGPHGAPTGADESIR
FT                   IIHTALDSGITAIDTADVYSQGESEQVVGRALRGRRDDVFLATKFHGQMSANPAHSGNS
FT                   RRWITQAVEGSLRRLQTDRIDLYQAHRPDYNTDVLETITTLNDLIRQGKILYYGTSVFT
FT                   PAQLVEAQWLANTNHLIPPLGNQVPYSMLVRGNERDVLPIAQQYGLGVLAYGPLAGGWL
FT                   SGSFTFEAGKAPTRVHSLPGRYDISGPASERKLLAADALARLADKLELSLVDLSIGFAL
FT                   THPAISSVIIGPRNEEHLQAYLGAADVRLSEPVLDAIDDLVPPGTNFVERDAGAIVPSI
FT                   EFAELRRR"
FT   gene            508437..510629
FT                   /locus_tag="Achl_0478"
FT   CDS_pept        508437..510629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0478"
FT                   /product="4-alpha-glucanotransferase"
FT                   /EC_number="2.4.1.25"
FT                   /note="KEGG: art:Arth_2153 4-alpha-glucanotransferase;
FT                   TIGRFAM: 4-alpha-glucanotransferase; PFAM: glycoside
FT                   hydrolase family 77"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38477"
FT                   /db_xref="GOA:B8HAL6"
FT                   /db_xref="InterPro:IPR003385"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL6"
FT                   /inference="protein motif:TFAM:TIGR00217"
FT                   /protein_id="ACL38477.1"
FT                   /translation="MTASDQQHVLRRNAPAELPAVDAHLLQQLADAHGVGTSFQGWDGL
FT                   PHAVSLETLTKVLGALGVPAHTEEQIRAGLAEAELAPWRKTLPPAVVIQQGEPAQVPVH
FT                   IPDGAAVSLRISLEGGAGSVEAAQQDVWVQPRDVDGVAMGRATFALPPDLPLGWHTLHA
FT                   EAGSVTATATLVVTPARLDTARDLEERRGWGLATQLYSVRSKRSWGIGDFADLADLAAI
FT                   SGARGADYVLVNPLHAAEPVPPVQPSPYSPSTRRFFNPIYIRIEAVPELAYLRPRKRAA
FT                   LEKLREEVAGLNRDAERLDRDAVYAAKLQALELLYHTRRSPSRQAAFDEFCRISGSGLD
FT                   DFALWSAIREDAAPDDPMWTDPAFSLDSQEAQALRARLEDRIGFHRWLQWICDEQLENA
FT                   QQAALRSGMRLGVVHDLAVGVDHSSADAWTLKGVLTPGTSVGAPPDMYNQQGQDWGQPP
FT                   WHPSRLAEAGYQPFRNMLATVLRHAGGIRVDHILGLFRLWWIPSGNAPGDGAYVKYDHE
FT                   ALIGILALEAHRAGAVVIGEDLGTFEPWVRDYLAARGILGTSILWFEYDGDSPLAPEKY
FT                   RTQALSSVNTHDLPPTAGYLAGDHVALRSYLGLLERSEAEERAQHNASLEKMFALLRER
FT                   GYLTGSGSGGDAEEQTIEALHLLLSQTPSVLLGVALVDAVGERRVQNQPGTTEALYPNW
FT                   QVPLAGPDGKPVFLDDLPANARFNSLLAAVEEALHG"
FT   gene            510733..511602
FT                   /locus_tag="Achl_0479"
FT   CDS_pept        510733..511602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0479"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; NmrA family
FT                   protein; KEGG: aau:AAur_3963 putative NAD dependent
FT                   epimerase/dehydratase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38478"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL7"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACL38478.1"
FT                   /translation="MLGGQVVTALLDRGKPVRALVRPGSDASRLESLGVDIARGDMMDP
FT                   RSLDQAMAGADAVITSAAGYTKHRKGDSPATDTAGNANLAEAAARAGVRRFVLTSILTC
FT                   DETPEVPHFWHKKLMEDKLEGLGVPFVALRPGAFLDQVTRFSGDPVTKGKLTWFGSPNV
FT                   PLTFVLTPDLAGYLADAVDAPGVDGERIDIGWDRPVRMKDVADMMGQLSGSKVGVRSVP
FT                   LRVLKTAGVVLGRVNPTVPDMASMMGWFQTGRYVANTTRQRAVFGPPPTAEDAIRRLLG
FT                   ILGHPVDR"
FT   gene            complement(511613..514666)
FT                   /locus_tag="Achl_0480"
FT   CDS_pept        complement(511613..514666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0480"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; alpha amylase
FT                   all-beta; SMART: alpha amylase catalytic sub domain; KEGG:
FT                   art:Arth_0256 alpha amylase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38479"
FT                   /db_xref="GOA:B8HAL8"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL8"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACL38479.1"
FT                   /translation="MPSRARTRNGAGARRAAVGLLAATIAISTASLPAQAAPASKDPAS
FT                   AAQHSLRAPVTDENFYFVMADRFSNGSTANDQGGLGSDPMVSGFDPTKKGFYNGGDLAG
FT                   LRNKIDYIQGLGTTSIWLTPSFKNKPVQPEDKSAGYHGYWVTDFTQIDPHLGTNAELKA
FT                   LIDEAHARGMKVYFDIITNHTADVIGYGDNNERKGYVFKDKVPYKTADGQAFDDRDYAG
FT                   TDAFPKLDAGTSFPYKPVLEPGEEDLKVPAWLNDPTLYHNRGDTTFTGEDSFYGDFFGL
FT                   DDLFTEHPTVVNGMKDIYKNWIRDSGVDGFRIDTMKHVNDEFWQDFGPDVLNYAKEQGK
FT                   DEFFMFGEVFDTSKSFTSQFTTRNRMQAVLDFPFQDAARNFASKGQDAGTLQQFFAGDD
FT                   WYTDADSNAYQLPTFLGNHDMGRIGSFIAADNPGATDSEKVARDRLAHELMYFSRGNPV
FT                   VYYGDEQGFTGPGGDQDARQTLFASQVPEYLDDDLLGTDATHATDNFSTAHPLYTGIRE
FT                   LAALTKEHPALRNGAQQGRYASDGPGIYAFSRTDAKDQREYVVALNNSEQPQTAQVPTY
FT                   IAKRNYTRIYGDAAAKAKTSDAGTLTVTVPPLSAVVYQSSGRIPHSKSAPAVALQQPAP
FT                   AAGDNGRIQVTADVGGTSFYEVTFEAKQAGGNWTPIGTDDAAPYQVFHDVAALDAGTSV
FT                   EYRATVLDNGGHTATSQARSAGVPAPVLTLQQPAEGSNVQGAVELSATADPEKSSNVVS
FT                   FQRSVSGGEWTPVGTDSSSPVYSATDDISALADGTTVQYRALMSGPGFSVVSGTRTVTV
FT                   GEAPQPDSVAVAGSLNKAMGCAADWDPTCAQAQLVLDPADRIWRLQADLPAGTYEYKAA
FT                   LNGNWDTNYGADGQPAGQNIILNHPGGPVTFRYDNSTHLLSATYAAQQPGAVAAAGSMD
FT                   SELGCAADWDPACDQAQLTLDPASLIWKLTYPDLPAGSYEFKAALDRSWNVSYGAGGAS
FT                   PGANIALKHDGGPVTFRYDHFTHVITAG"
FT   sig_peptide     complement(514556..514666)
FT                   /locus_tag="Achl_0480"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 37"
FT   gene            complement(514952..516022)
FT                   /locus_tag="Achl_0481"
FT   CDS_pept        complement(514952..516022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0481"
FT                   /product="putative ATP/GTP-binding protein"
FT                   /note="KEGG: aau:AAur_0227 putative ATP/GTP-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38480"
FT                   /db_xref="InterPro:IPR011048"
FT                   /db_xref="InterPro:IPR015943"
FT                   /db_xref="InterPro:IPR019405"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAL9"
FT                   /inference="similar to AA sequence:KEGG:AAur_0227"
FT                   /protein_id="ACL38480.1"
FT                   /translation="MTPASGTSATVGQAPHTAIIWTGAYTPDGGGRAEGIGALRANGDG
FT                   SLEWLGTAVEAQSPSFVAVHPTLPVVYAVAEQRRMIQAYRHVGDHTLEPLGAPWPAGEA
FT                   TCHVAADPQGRFVTATCWGDGQVLLYELDADGGITERFAASPSVDPHSAHSPAELRQSR
FT                   AHTSLMLQDGRVMTTDLGHDTLRIWTYKPGTGLVPDHEVVLPFGSGPRHLALHPGGNVF
FT                   VVSEYSIEVFVVRPEAGTFELVFRGPATLGGARDGDSAAEICLGPGSAFAYAGVRGSNR
FT                   ISVLKVVGSGSELLPVQDLDSGGDWPRHHLVRGPWLHVAHERSDNVATFALGTGLPGPV
FT                   VHNVKTPSPTSLVPNG"
FT   gene            516268..517113
FT                   /locus_tag="Achl_0482"
FT   CDS_pept        516268..517113
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0482"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   methyltransferase small; KEGG: art:Arth_0257 modification
FT                   methylase, HemK family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38481"
FT                   /db_xref="GOA:B8HAM0"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM0"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ACL38481.1"
FT                   /translation="MADALRAAGCVFAEEEALLLLEHAVSPDELADCVRRRVAGLPLEY
FT                   ILGWAEFDGHRMAVRPGVFVPRRRTELLVRLAAGLMSGEGNLLKGVFPADSTFAGAAAV
FT                   QGSLRSASFDGVVVDLCCGSGAVGAALARRFPRAELHAVDIDSVAVECARSNVEAVGGH
FT                   VHTGDLFDALPCSLRSRVHILAVNAPYVPTEAIKTMPPEARVHEPLLSLDGGTDGLDFH
FT                   RRVAAGAKDWLAPHGCVLIETSEQQAGGTAALMAATGLSVTTVRSEDLDATVVVGSAHK
FT                   "
FT   gene            complement(517285..519186)
FT                   /locus_tag="Achl_0483"
FT   CDS_pept        complement(517285..519186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0483"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_1427 HNH endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38482"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38482.1"
FT                   /translation="MEAIGEQLSESQDSSALLPLGFGRSSHLSTGRNAGPNLRTAAHDA
FT                   GPQVRTAAHDAGPQVRTAGHDAGPQVRTAAHLRPVPGYLLPDQSADQPLDLPLDLSSLT
FT                   ARVAAAAVAAREALPTAGYVTAATFAADVEELSRCAEYLQLIAAGAVEHTRTRAIADAE
FT                   TNRRARRTARVSSWDTHGTEILNETDTNWPAATGAAAATPAECTAATPVMLSSPADDGC
FT                   RNTAEFLRLRLRIPIREARRRLTLARQTLPGTALTGEPVPPSHEHLAATLAPAESGTGQ
FT                   PATIDTPPHTITAPAVSSHAATVITATLERLQHHTTPETLRGIERHLTSAATTADPDFL
FT                   THLAQRLTETIDADGTEPSEEALRHTQGAFIRKPLHGLHRVEIFATTDQYEHLLTAMNI
FT                   ATNPRTTTPNTTTNGEGIAWGRHPRRQTPTTQTCMRQAPAAVRAAGIRYHPSRTWNAAA
FT                   DPNNNSTASSPPLKPPSPPTNSLPPAATGPKSLPPSTTAISSPGIPNATHQPRVASSSP
FT                   VPSPPPPCAKSPATPTSSPPSWAPIAKSSTSDAKPGFSPQPNASPSPPATKAVPFPTAL
FT                   SPHPGAKHTTSPIGRMAAIPTPPTAHSFARTITTSSTKNTGPSPPQTAPQPSSRRHI"
FT   gene            519445..519630
FT                   /locus_tag="Achl_0484"
FT   CDS_pept        519445..519630
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0484"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38483"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38483.1"
FT                   /translation="MAGRERGKTVREDSEEPGNDAAGNADSVAPEKAEEVDTLQPARRV
FT                   PGINGYDPTQWPDARP"
FT   gene            complement(519886..520284)
FT                   /locus_tag="Achl_0485"
FT   CDS_pept        complement(519886..520284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0485"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0260 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38484"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM3"
FT                   /inference="similar to AA sequence:KEGG:Arth_0260"
FT                   /protein_id="ACL38484.1"
FT                   /translation="MKNKLLLGVGVAVGYVLGSRSGRAAYDKLKARAAGVWDSKPVQDK
FT                   VTVATETIKEKAPDVADQLTEAARRAGTVLGSALHRDDSSGKSTPSSHDTSPTAGESGG
FT                   LGGDHIPAHSTHPETTNLGTTSEGNTKS"
FT   sig_peptide     complement(520210..520284)
FT                   /locus_tag="Achl_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.948) with cleavage site probability 0.743 at
FT                   residue 25"
FT   gene            complement(520408..520674)
FT                   /locus_tag="Achl_0486"
FT   CDS_pept        complement(520408..520674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0486"
FT                   /product="Transglycosylase-associated protein"
FT                   /note="PFAM: Transglycosylase-associated protein; KEGG:
FT                   aau:AAur_3922 putative integral membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38485"
FT                   /db_xref="GOA:B8HAM4"
FT                   /db_xref="InterPro:IPR007341"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM4"
FT                   /inference="protein motif:PFAM:PF04226"
FT                   /protein_id="ACL38485.1"
FT                   /translation="MGFIAFLILGLIAGAIAKAILPGRQGGGWIITMVLGVVGALLGGW
FT                   IGGALFGGGLQEFFSLQTWLLAILGSLIVLAIYGMVTKRGARR"
FT   sig_peptide     complement(520615..520674)
FT                   /locus_tag="Achl_0486"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.725) with cleavage site probability 0.451 at
FT                   residue 20"
FT   gene            complement(520806..521639)
FT                   /locus_tag="Achl_0487"
FT   CDS_pept        complement(520806..521639)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0487"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: art:Arth_0262
FT                   2,5-didehydrogluconate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38486"
FT                   /db_xref="GOA:B8HAM5"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM5"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL38486.1"
FT                   /translation="MTFAPVIALNDGYSIPQIGLGTWPLDDDQAAAAVVRAVEAGYRHI
FT                   DTAVKYGNERGVGNGIKACGADRGELFITTKLDGEFQGNDRAVEGLEGSLQRLGLDYVD
FT                   LLLIHWPLPGRDQFISTWKTFERLQAEGKVRSIGVSNFKPAHLERLMAETDVVPAVNQV
FT                   QLTPAVTRVAAREFHAKHGIATESYSPLGGSGAGILGAPVLGRLAEKHGRTPGQVVLRW
FT                   HIQNGLVTIPKTANPDRMRENLDVFDFVLDPQDLAELAILDEGPGAGNDSDVTGH"
FT   gene            complement(521700..524255)
FT                   /locus_tag="Achl_0488"
FT   CDS_pept        complement(521700..524255)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0488"
FT                   /product="FG-GAP repeat protein"
FT                   /note="PFAM: FG-GAP repeat protein; KEGG: bha:BH1114
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38487"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR034641"
FT                   /db_xref="InterPro:IPR041624"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM6"
FT                   /inference="protein motif:PFAM:PF01839"
FT                   /protein_id="ACL38487.1"
FT                   /translation="MNPSKASARLLSVATLGLALTVGCLAAPASAVGPSPSKPGAPGIQ
FT                   LDYLDRGLVAAKTSEGVFLSWRLLGNEATGSSATGLTGTDFNVYRDGQKLATVTDSTNY
FT                   QDPAGTAASKYQVRAVVGGVELDESATATSWGGNLKDIPLKKPADGVTPTGQAYTYSAN
FT                   DTSVGDVDGDGQYEFVVKWDPNNSKDVSQVGYTGNTYVDTYKADGTLLHRIDLGVNIRS
FT                   GAHYTQMLVNDFDGDGRAELMMKTAPSTKTTNYNADGSVAAESFITMLRSDINAGYSNS
FT                   DDYRMSAADYYQHMVKTFQGWTEHPEVKAGNWPATLEEAFGIAPKYKYPLSKADAEALT
FT                   DYFMDVYAPSRSARNNLRAFEGFIVSGPEYLTVFEGATGKELKTVAYQPGRTDDGMLWG
FT                   DYAMARIEPGNRVDRFLAGVAYLDGKKPAAVFARGYYTRTTLATYTWDGANLSPVWNVD
FT                   SGFTPMTNPFNDSPHGRDGTDPTYGKLTTQGFHSLSAADVDGDGKQEIVYGSATLDDDG
FT                   SLLYSSFDTLPTGSAAPGTEARLGHGDAMHVADIDPNRPGKEIFTVHEGATYAPYGYAM
FT                   RDAATGEVLFGAYSGKDTGRGMIGDVDPSVPGLENWAIGMQSADGRKLSSTSPGTNMSI
FT                   RWAADMTTQLVNGSGDQTPTIDDWKRGRLLTADGTRTNNGTKGTPSLVADILGDWREEL
FT                   VVRTADSSALRIYLSTEVTTHKLYALMHDPQYRAEVARQNTTYNQPSYTDFYLASDMKF
FT                   GNVPLRAAWLPGSVKALQNAVEDLVESGEIAGPVASQLTAAIQQAQKAVVDRDAAKAGQ
FT                   AIQRFVKFLDQQKNPDKVSDTARAVLTHNAGNVLRAFGQ"
FT   sig_peptide     complement(524160..524255)
FT                   /locus_tag="Achl_0488"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.915 at
FT                   residue 32"
FT   gene            complement(524479..525531)
FT                   /locus_tag="Achl_0489"
FT   CDS_pept        complement(524479..525531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0489"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; KEGG:
FT                   art:Arth_0263 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38488"
FT                   /db_xref="GOA:B8HAM7"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM7"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL38488.1"
FT                   /translation="MIPPSAAGTPPVAGAPAGTVAPRSILFIGGTGVISAAAAEHAVAL
FT                   GHRLTILNRGRSTRPVPDGAEVLHADVRDVAAVREVLGGREFDAVADFISYTPDQTQAG
FT                   LELLRGRTGQYVFISSASAYQKPPTRLPILESTPLKNPFWQYSRDKIACEELLFRAYRD
FT                   EDFPLTVVRPSHTYDRTKIAMVGGWTDIHRMRAGLPVMVHGDGTSLWTLTHSRDFAKAF
FT                   VGLLGRPQAVGESYTITSDEYLPWNQIYRLFARAAGVAEPELVHVASETIAAHSPELGP
FT                   NLLGDRSHSVVFDNTKIKSLVPDYTATIPFADGAREIVQWYDANPELQHVDQSYMQLTD
FT                   KLTAWARSGA"
FT   gene            complement(525528..526499)
FT                   /locus_tag="Achl_0490"
FT   CDS_pept        complement(525528..526499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0490"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: art:Arth_0264
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38489"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM8"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL38489.1"
FT                   /translation="MQYTHLGRSGLQVSRLCLGTMNFGPQTEEADAHSIMDSAQENGIN
FT                   FFDTANVYGGAGHRGWTEEIIGRWFAKGGERREHTVLATKLYGTMTDRPNESKLSALNI
FT                   RRALDASLKRLQTDYIDVYQFHHIDRNTPWDEIWQAIEVAVQQGKILYSGSSNFAGWHI
FT                   AQAQEAAHRRNYTGLVSEQSIYNLFRRELELEVIPAARQYGLGLIPWSPLQGGLLGGVL
FT                   KKERDGVRRTEGRALETLKKHEDQIRQYEDLADDLGHEPGDVALAWLLHQPAVTAPIVG
FT                   PRTQEQLDAAIRALDVTLDEDALKRLDDIFPGHKTAPEDYAW"
FT   gene            complement(526513..527334)
FT                   /locus_tag="Achl_0491"
FT   CDS_pept        complement(526513..527334)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0491"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: aau:AAur_0231
FT                   putative 2,5-diketo-D-gluconic acid reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38490"
FT                   /db_xref="GOA:B8HAM9"
FT                   /db_xref="InterPro:IPR018170"
FT                   /db_xref="InterPro:IPR020471"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAM9"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL38490.1"
FT                   /translation="MSELTLNNGVTIPQLGLGVFQVPPEDTQRIVEDAFEAGYRHIDTA
FT                   AGYRNEAGVGAAIAATGIPREDIFVTTKLRNGEQGKAQEAFQNSRKALGLDFVDLYLIH
FT                   WPVPSQGLFVQAWKELERLYDNKQVRAIGVSNFLSDHLDTLLESSETVPAVNQIELHPS
FT                   YQQADLAAKCRSLGIEVEAYSPLGQGGDLNGNAVTAIADAHGATTAQVVLAWHLASGNI
FT                   VIPKSVDPGRMRENFAASSLTLSDDELAAITALESGARIGSDPAVASFTQM"
FT   gene            527525..528433
FT                   /locus_tag="Achl_0492"
FT   CDS_pept        527525..528433
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0492"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   aau:AAur_0232 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38491"
FT                   /db_xref="GOA:B8HAN0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN0"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACL38491.1"
FT                   /translation="MVNMGQSAEFGKFLKAMRSRLTPEDAGAGPTTGARRVPGLRREEV
FT                   ARLAGVSTDYYVRLEQGRNIHPSRTVLDAVSRALRLDSSEHAHMMDLLENCAANPRAAG
FT                   PAAQGVRPGLRQLLEAVGDVPALLLGRRSDVLAGNRMAYLLFTDFPSLPAAERNLTRWL
FT                   ILDPAARELFRDWKTLAAEAAGALRLDVGRHPNDPQANQLVGELAVNSEQFRQWWAGHR
FT                   VASRSAGIVRLHHPTVGDLELNFESLALPDDPDQVLRVYSAKPGSPSSDALALLGSLGA
FT                   GEAPSERERTAEVPPANLAES"
FT   gene            528550..528759
FT                   /locus_tag="Achl_0493"
FT   CDS_pept        528550..528759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0493"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0225 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38492"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN1"
FT                   /inference="similar to AA sequence:KEGG:AAur_0225"
FT                   /protein_id="ACL38492.1"
FT                   /translation="MKRIALLKERQAAPAGTASTSTGSHCPVSGLWSPDHDPHTVLSFF
FT                   EGHVFPAFDGVPTVWRRRSLGQAY"
FT   gene            complement(528856..529068)
FT                   /locus_tag="Achl_0494"
FT   CDS_pept        complement(528856..529068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0494"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   aau:AAur_0233 putative protein of unknown function
FT                   (DUF1458)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38493"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN2"
FT                   /inference="protein motif:PFAM:PF07311"
FT                   /protein_id="ACL38493.1"
FT                   /translation="MSNHTYSISEIVGTSTEGVDDAVRNGIAKASQTLRNLDWFEVKEV
FT                   RGHLEDGKVADWQVTIKIGFRLEEQ"
FT   gene            complement(529131..530414)
FT                   /locus_tag="Achl_0495"
FT   CDS_pept        complement(529131..530414)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0495"
FT                   /product="Pectate lyase/Amb allergen"
FT                   /note="PFAM: Pectate lyase/Amb allergen; KEGG: tfu:Tfu_0153
FT                   pectate lyase/Amb allergen"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38494"
FT                   /db_xref="GOA:B8HAN3"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN3"
FT                   /inference="protein motif:PFAM:PF00544"
FT                   /protein_id="ACL38494.1"
FT                   /translation="MSLPLSIMVAAVVALAGPLPAAPLDGAQLSPASPDLGRQVLAAGD
FT                   GWASADGGTTGGSGAAPGNVHEVSTRDELAAAVAGNEPKIVYVKQGFNANTAPDGSAIT
FT                   CEDYATGGYSLEAYLAAFDPAQWTGPAAGPLEDARKASSAKQRERVRVNVGSNTTIVGV
FT                   GDVQLTGFTLNIDNVDNVIVRNLHISDAYDCFPGWNGDTWKTEWDNVVVSGSTHVWLDH
FT                   LTLDDGETADAAQPRYFGELFLRHDGLLDVVRQADLVTISWSRLVGHDKSLLWGNGDGA
FT                   TADRGKLRVTLHHNELVDLEQRAPRVRFGQAHVYNNVYRVTDPGHYQYSWGAGVESSII
FT                   ARNNTFELAEGVPAAQIIRNFGGTGIDESGTWVNGRQVNVLDAYNAANPEAALAPEVSG
FT                   AAGPHLRIEPAPAARERVSREAGSGQGS"
FT   sig_peptide     complement(530364..530414)
FT                   /locus_tag="Achl_0495"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.983) with cleavage site probability 0.517 at
FT                   residue 17"
FT   gene            complement(530454..532514)
FT                   /locus_tag="Achl_0496"
FT   CDS_pept        complement(530454..532514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0496"
FT                   /product="Pectinesterase"
FT                   /EC_number="3.1.1.11"
FT                   /note="PFAM: Pectinesterase; Pectate lyase/Amb allergen;
FT                   KEGG: aau:AAur_0237 putative pectinesterase/pectate lyase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38495"
FT                   /db_xref="GOA:B8HAN4"
FT                   /db_xref="InterPro:IPR000070"
FT                   /db_xref="InterPro:IPR002022"
FT                   /db_xref="InterPro:IPR006626"
FT                   /db_xref="InterPro:IPR011050"
FT                   /db_xref="InterPro:IPR012334"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN4"
FT                   /inference="protein motif:PRIAM:3.1.1.11"
FT                   /protein_id="ACL38495.1"
FT                   /translation="MSLRRFLGAATAVVLLSSLASAPATAAPPLQGSAAAASPVQAPSV
FT                   QAPSVLAPAVLAPSSLSEGNGPLWKQTPDGFASLPGNGLAGTTGGQAGRIVTASTIAQL
FT                   QEYASAAEPLVIFINGSLTAADYVKIPVAANKSFIGTGAGAEVVNAGFKLINVSNVIFR
FT                   NFTVRDSYIPGDWDGKRPDNDRDGIQLDTSHHVWVDHMKFERMGDGLIDTRKDSDYLTY
FT                   SWNVFADNNKALGVGWTANAVTKMTIHHNWIRNTTQRNFSLDNTAAAHVYNNYLQDVGQ
FT                   YGMMGRNNAKVVLEGNYFTAVQDPIVAKDPATQVVNRDNVFDSTRGRKDNVGAAFDPAA
FT                   YYSYTKDNAAAVPGIVSAGAGPRENNAPNKAANITVALDGTGDFGSLQAAIGSIPAGST
FT                   QPRTITVKPGTYREVVNVWADRPNLTIQGATANPADVVITYDLPANGAKFFGGTWGAVG
FT                   SATLTVSAPGTTVRNLTVENAYDEAANGPSQALAVRSVADKVVFDGTRFLGNQDTYLAD
FT                   TSGRDATARTYLKNCYIEGDVDFLYGRGTAVFDGCTIHSLDRGSDTNNGYVVAPSTKNS
FT                   NPYGFLIVNSTLTSDAAPGTVSLGRPWFASSDPDAHPMAVIRDSVLGSHIAVQGWADMS
FT                   GHAWTEGRFAEYRNTGPGAYVNGFHPQLSDDDAAKFTADAFLGDWTPAGRG"
FT   sig_peptide     complement(532434..532514)
FT                   /locus_tag="Achl_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(532608..533528)
FT                   /locus_tag="Achl_0497"
FT   CDS_pept        complement(532608..533528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0497"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_0238 putative
FT                   ABC-type sugar transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38496"
FT                   /db_xref="GOA:B8HAN5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38496.1"
FT                   /translation="MALLESPPTSASKPGKPAKQRKQADPEDALTGTPGTRFSRHLILC
FT                   LVGLVMLYPLLWLVSSSFKPSNDIFRQLGLWPENWDFSNYAEGWTALNQPFHVYLINSM
FT                   IVVVFSIIGNIFSCALAAYAFARMEFTGRKLFFALMLGTLMLPGHVLLVPQYIIFSQLG
FT                   WLDTYLPLIVPNFMATNAFFIFLMVQFMKALPKELDDAAQIDGCGPFRTFLRVILPLCV
FT                   PAMATTAIFTFISTWNEFFGPLLYIQNQDLYTVPLALRAFMDSEGQSMWGPMFAMSVVS
FT                   IAPIIGFFIAGQKYLINGIATTGLK"
FT   gene            complement(533539..534492)
FT                   /locus_tag="Achl_0498"
FT   CDS_pept        complement(533539..534492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0498"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: aau:AAur_0239 putative
FT                   ABC-type sugar transport system, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38497"
FT                   /db_xref="GOA:B8HAN6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL38497.1"
FT                   /translation="MSVLTKQAPGAAASLAAGPPNRRKQGTPRRRNQRSGYLFLLPWFL
FT                   GMLFTIIPFFASLYLAFTDYNLFTEPNFVGLANFQAMTEDPRLWQSLKVTFIYTFVSVP
FT                   ISLAVALLIALVLNRGLRGLAIYRSVYYLPSLLGGSVAIVMLWRYIFGNEGIVNGLLGV
FT                   FGIAGPAWVTDPNFSLSTLIVLNVWTFGSPMVIFLAGLRQVPTMYYEAASIDGASRWRQ
FT                   FRNITIPLISPIIFFNLIMQLIGSFQTFTQGYVMSGGTGGPADSTLFYNLYLYQKGFTE
FT                   FEMGYASAMAWLLLMIIAIFTAINFIASKFWVFYDN"
FT   gene            complement(534523..535827)
FT                   /locus_tag="Achl_0499"
FT   CDS_pept        complement(534523..535827)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0499"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: tfu:Tfu_1702 sugar-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38498"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN7"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL38498.1"
FT                   /translation="MKKTATTGFSRRIFLGAAITAAGLGLSGCAGGGSPAAGGNVELNF
FT                   VYWGDANRAKMTDAAIKIFEEKNPGITIKSEYQDSGPYADKLATRFAGGNPPDVLNMAN
FT                   RSLLEYAQRGTLADLKELPELNLDKIPETVLSRGEVDGKLYGLATGVTTIGMVVNKAIT
FT                   DQAGVTIPDDKTWSWEDYAKFATEVTQKTGGKVYGAGYDVSTETGPILFARQRGEDFYT
FT                   EDNKLGVSEDTIREWFQYSVDLRNAGGYPPAGFFEQIGGSAAQSYLAKGTVASQIIPIN
FT                   NYKAYNEAAGGNVVLLRMPGETTEKRRGYSADPSMLWSIAAKSKHPKEAAKFVDFLIND
FT                   ADGAAETLTQRGVPINPDVADAIKSKLGADDTKFVQLVADLQKDELPPAYVYPKGASVV
FT                   ADTLKQLATEVEFGRVTPADAAKTFLEKSNAAINK"
FT   sig_peptide     complement(535729..535827)
FT                   /locus_tag="Achl_0499"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.386 at
FT                   residue 33"
FT   gene            536136..537008
FT                   /locus_tag="Achl_0500"
FT   CDS_pept        536136..537008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38499"
FT                   /db_xref="InterPro:IPR029475"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN8"
FT                   /inference="similar to AA sequence:KEGG:AAur_0241"
FT                   /protein_id="ACL38499.1"
FT                   /translation="MPTPDLAPARLLTLVPGSGVAPASAPRPYFHPVRSLSGTVLTDVA
FT                   PADHIHHLGLSVAFPDLNGTNFWGGSTYTQDRGPVVLPNHGNQALDGWTEEGARSTGTV
FT                   LWTSRHGTLLAEERRSVEVSAHPVPGSWSLSLTSVMVPAGNVAALEVSSSAVKGRSGAG
FT                   YGGIFWRFPSDSSAIRVFSAAGAGADAAHGSRSPWLAISTVTGGAPVTVVLSQDAPVRP
FT                   WFIRSEGYLGVGPAVAWSEKAVADAAHPLVQSLHAVIHDAAVESPDQALHLLEHHPAIR
FT                   TPSHPDRTS"
FT   gene            537005..538582
FT                   /locus_tag="Achl_0501"
FT   CDS_pept        537005..538582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0501"
FT                   /product="glycoside hydrolase family 43"
FT                   /note="PFAM: glycoside hydrolase family 43; KEGG:
FT                   aau:AAur_0242 xylosidase/arabinosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38500"
FT                   /db_xref="GOA:B8HAN9"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR023296"
FT                   /db_xref="InterPro:IPR041542"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAN9"
FT                   /inference="protein motif:PFAM:PF04616"
FT                   /protein_id="ACL38500.1"
FT                   /translation="MTSRNAVPVYANPVLNADWPDPDAVQVRGTYYLVASSFNRVPGLP
FT                   ILKSRNLVDWEHAGHALLQLPQGSHFSLVRHGGGVWAPALRYHDGRFWIFYPDPDHGIF
FT                   VLSAEKAEGPWTAPHLLYAGRGLIDPCPLWDDDGQAYLVHGWAKSRIGVKNRLTVHRMS
FT                   PDAGKLLDHGTAVIDGEDLPGYTTLEGPKFYKRDGWYWIFAPAGGVATGWQAVFRSRSP
FT                   FGPYEERRVLEQGNSPVNGPHQGAWVTSPRGEDWFLHFQDRGPYGRVVHLQPMGWDEDG
FT                   WPWMGEQASDGGPGTPVASHPYPRGTSPQDVAPPASDDFSSPWLGPQWHWQANPRHSWS
FT                   FQPGGGRLILRPQANDPVNLRELPNVLAQILPGTPSTFTTSLELQDVPVGTRAGVVVLG
FT                   QEYAWLGIVRTADGFVLGSGTGGEGPSEQAPGRSISLPAARVELQIRTDGTPRSTFAWR
FT                   LGPGEPWEVQGWNFGVVQGKWIGAELGIFATSPLGSREDGSVIVGPVRVDTAPVRRATA
FT                   PQLAAATT"
FT   gene            538579..539613
FT                   /locus_tag="Achl_0502"
FT   CDS_pept        538579..539613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0502"
FT                   /product="transcriptional regulator, LacI family"
FT                   /note="PFAM: regulatory protein LacI; periplasmic binding
FT                   protein/LacI transcriptional regulator; KEGG: aau:AAur_0243
FT                   LacI family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38501"
FT                   /db_xref="GOA:B8HAP0"
FT                   /db_xref="InterPro:IPR000843"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP0"
FT                   /inference="protein motif:PFAM:PF00356"
FT                   /protein_id="ACL38501.1"
FT                   /translation="MTPRTAPLTATPRPKIADVAAAAGVSVPTVSKVLNGRTHVSEATR
FT                   AKVQQALDELDYSKRNAAAAQPGMLQLVVNNFDSPWVLATMEGVEAAADRLGYAVAYVR
FT                   AEHVTADRWRKLREPSVNRLDGVMLLAPRSGSRLVTLARSLKIPAVAIDPEGAEGLDIP
FT                   SVSPASFSGALAAVGHLLSQGHRRIGIITGRKHSPGHGRARYAAYAAALHEAGLPVLPE
FT                   LVRDGDFSIESGMRLGADLLDLAERPTAIFTGSDLQALGVMNAAAQRSLQVPGDLSIVG
FT                   FDDIAQAALTSPPLTTVRQPLAQLATMAVGMLIEQQDGQGAVPAALEVATELVVRGTTA
FT                   PPAS"
FT   gene            complement(539623..540327)
FT                   /locus_tag="Achl_0503"
FT   CDS_pept        complement(539623..540327)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0503"
FT                   /product="GntR domain protein"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: art:Arth_0271 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38502"
FT                   /db_xref="GOA:B8HAP1"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP1"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL38502.1"
FT                   /translation="MARKSLVGVVADELLDRIIDGEFPPGSTVPGEHELSARHEVSRMT
FT                   VREAMKTLQAQQILSVERGRGTFVNPLNRWTSLEAVLRAASEGKNEAEASVQLIELRRM
FT                   LETGACELAAGRISEADTESLFAYIAAMKAAHAINDVASFVEADLAFHDVILRASGNVF
FT                   VSVLFEPLHRVLEKRRAETSAVPAIQEHAIGHHQNIAEALQSGDATRSRLAMDAHMQQT
FT                   LDDLKNLVLPAK"
FT   gene            540501..541976
FT                   /locus_tag="Achl_0504"
FT   CDS_pept        540501..541976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38503"
FT                   /db_xref="InterPro:IPR010737"
FT                   /db_xref="InterPro:IPR031475"
FT                   /db_xref="InterPro:IPR037051"
FT                   /db_xref="InterPro:IPR042213"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP2"
FT                   /inference="similar to AA sequence:KEGG:Arth_0272"
FT                   /protein_id="ACL38503.1"
FT                   /translation="MTLEADVLAAYPADFPIPAALVAGTLAASNAETPRVLVVLDDDPT
FT                   GTQSVADLPVLTQWDVEDFTWAFSQSKPAVYVLTNTRSLDPAEAAARNEEVVRNALAAA
FT                   GGVKVGFVSRSDSTLRGHYPLEPDVIAATVGEVSGEATDGVVLVPAFPDAGRITIGGVH
FT                   YMRGTGEAAGTLVPVSETEFAKDASFGFATSVMAEYVEEKSKGRFTADSVIVLDLNIIR
FT                   AGSAAQDPAISAKAIADAIEGATNSTPIVADIVTENDFRALALGLEEAERRGKKLLYRV
FT                   GPPFVRGRIGQEVRTALTAEEAYEGNTPSTAGGLIVVGSHVGVTTRQLNVLTAEHSSAR
FT                   IIEIDVEKLLADPTDAATHLDQTVDTVVEALRGGDVIVHTSRLLIKTDDAAESLRIART
FT                   VSAAVVAVVNRTLKTFPPRFVIAKGGITSSDVAAHGLEIRHGIVRGPMLPGIVSLWEPV
FT                   DGPAKGIPYIVFAGNVGDDDSLAQVTRKLSNTF"
FT   gene            542066..542965
FT                   /locus_tag="Achl_0505"
FT   CDS_pept        542066..542965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0505"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: UDP-glucose/GDP-mannose dehydrogenase;
FT                   6-phosphogluconate dehydrogenase NAD-binding; KEGG:
FT                   art:Arth_0273 6-phosphogluconate dehydrogenase,
FT                   NAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38504"
FT                   /db_xref="GOA:B8HAP3"
FT                   /db_xref="InterPro:IPR002204"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP3"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACL38504.1"
FT                   /translation="MTSNYTVTVLGLGAMGLPMATRLASQVTVHGFDIAEPRLKLAEEA
FT                   GIATFGTAREAAKGADAVLLAVRNGEQLNDVLFGENGVASVLEPGAVVILGSTVGTEAI
FT                   PATVEKLAAYGVELVDAPLSGGPKRAGEGDLLIVVGASPEAREKAAPALELLASTLTVV
FT                   GDKPGDGQALKTVNQLLCGVHIAAAAEALALADALGLDQAKTLAALEAGAAGSFMLSNR
FT                   GPRILEAYNEEGAEVLSRLDIFVKDMGIVGKATRAAGLAAPVAAAAEQLYLLGQAQGLA
FT                   AADDSAVIKVVAPAKRTN"
FT   sig_peptide     542066..542140
FT                   /locus_tag="Achl_0505"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.991) with cleavage site probability 0.917 at
FT                   residue 25"
FT   gene            543116..544582
FT                   /locus_tag="Achl_0506"
FT   CDS_pept        543116..544582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0506"
FT                   /product="gluconate transporter"
FT                   /note="TIGRFAM: gluconate transporter; PFAM: Gluconate
FT                   transporter; Citrate transporter; KEGG: aau:AAur_0256 inner
FT                   membrane permease YgbN"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38505"
FT                   /db_xref="GOA:B8HAP4"
FT                   /db_xref="InterPro:IPR003474"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP4"
FT                   /inference="protein motif:TFAM:TIGR00791"
FT                   /protein_id="ACL38505.1"
FT                   /translation="MNHLISPLMVRAADAPAIKPAVELGTPLLLTIAALGIAVLLVMII
FT                   RFKIQAFVALLTVSILVAVASQIPLKDVFTVVANGVGSTMGKVALLIALGAVLGRMIEV
FT                   SGGVQSLAAHFTEKLGAKRVAVALTAVGFLVAIPVFFEVGVIVLVPIVYAFAKIAKVHP
FT                   VKFGLPMAGIMLSIHVAVPPHPGIVAGAGVFGADIGLITLISLAICIPLGFLSYWVASI
FT                   MNRKEYELLPSVKAQVEEFGSDSLVKVGHDGPGASAIAPPRPGLIIFLIAAPIVQILLG
FT                   TLGTLTIPKDNSWYGLAAFIGNPFFALLVAVALSFFLLAVRRNWSLKETGEIFEGALPP
FT                   IASILMVVAAGGVFGEVLRTSGIGAALSQTLDHLGLPVIALGFVISLALRAAQGSATVA
FT                   IVTTTGLLTSAVMEGGYSPAQIAVIVIAIGFGALGLSHVTDAGFWTVVRYYGLTVSDGL
FT                   RTWTVLTTVLGLAGFALTFVAWILVGGLGV"
FT   gene            544582..545457
FT                   /locus_tag="Achl_0507"
FT   CDS_pept        544582..545457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0507"
FT                   /product="ketose-bisphosphate aldolase class-II"
FT                   /note="PFAM: ketose-bisphosphate aldolase class-II; KEGG:
FT                   art:Arth_0275 fructose-bisphosphate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38506"
FT                   /db_xref="GOA:B8HAP5"
FT                   /db_xref="InterPro:IPR000771"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP5"
FT                   /inference="protein motif:PFAM:PF01116"
FT                   /protein_id="ACL38506.1"
FT                   /translation="MRTRLDHLVTSALQQGSAVPAFTCYDFTTALAVVGAAEESGRGVI
FT                   LLVAPKTAATPNGLRLIAALRGLADAASVPVAVQLDHATDLAVMADAVAAGADSVLADG
FT                   SSLPYEENIALVVSARELLAANGHPDVVLEAELGGLAGDEDRAFSADQPADQSGVAVAG
FT                   LTDSAQVEDFVARTGAQLLAVAVGNVHGKYKGEPQLRWDVLQDIAVRTHLPLVLHGASG
FT                   IPAEELVKAAAMNVGKVNFNTELRTGVLATLQEQLPAHRADGENLQALLGHWNRSAGEF
FT                   AGATLATLTR"
FT   gene            545504..545908
FT                   /locus_tag="Achl_0508"
FT   CDS_pept        545504..545908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0508"
FT                   /product="protein of unknown function DUF1304"
FT                   /note="PFAM: protein of unknown function DUF1304; KEGG:
FT                   art:Arth_0276 protein of unknown function DUF1304"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38507"
FT                   /db_xref="GOA:B8HAP6"
FT                   /db_xref="InterPro:IPR009732"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP6"
FT                   /inference="protein motif:PFAM:PF06993"
FT                   /protein_id="ACL38507.1"
FT                   /translation="MILASLLFAFLAAALHVFIFTMESLTWTKPATWKRFSIESQENAE
FT                   ITKPLAYNQGFYNLFLAVGALIGAGLVVFGADGSAQDVAGWTLIFASCGSMLLAALVLA
FT                   LSGRKYLRAAITQGATPLLAVVPGLLAVSL"
FT   sig_peptide     545504..545569
FT                   /locus_tag="Achl_0508"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.889) with cleavage site probability 0.338 at
FT                   residue 22"
FT   gene            546030..547385
FT                   /locus_tag="Achl_0509"
FT   CDS_pept        546030..547385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0509"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38508"
FT                   /db_xref="GOA:B8HAP7"
FT                   /db_xref="InterPro:IPR002656"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP7"
FT                   /inference="similar to AA sequence:KEGG:Arth_0277"
FT                   /protein_id="ACL38508.1"
FT                   /translation="MGTAGGLSGNLRTGTAGRDPVIDLVRFACLALVVVGHCMMVSPAL
FT                   HADGTVTTQNTLAEQHWFEPVIWIFMVMPLFFVTGGMTGLEAWRRLSANGGTAALFIRA
FT                   RLLRLVRPATALLAVMFLGLGAAQLLGVHPQVTGLMAAGAGMPLWFLAAYLAAQLNIPL
FT                   LAALHRRAPWLTFLLLTALVVAVDCLRGTLPLLANINLLFLWCAVQQLGFLIADGKLAG
FT                   LPRSGLAAVALAANVVLGAVTGLGLYPGNMLVNLNPPNLTLLLLGVSQAALMEAARPVL
FT                   EGVASWPWLSRVLQIAGARSLTVYLWHLPLLVAMSGLLLVAPFPKPESGTPEWWWARAV
FT                   VLPALLLLLLPVIAAFGRLEDTPTATPGSGAKPAAVGAAVVVVFLPVADAALGGLTLAL
FT                   LGTGAAFFALTQLILGAVPWRSPVPGHRTAAAGTRRRAGRRRGRKGIASGVK"
FT   gene            547401..547730
FT                   /locus_tag="Achl_0510"
FT   CDS_pept        547401..547730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0510"
FT                   /product="acetyltransferase-like protein"
FT                   /note="KEGG: art:Arth_0278 acetyltransferase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38509"
FT                   /db_xref="GOA:B8HAP8"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP8"
FT                   /inference="similar to AA sequence:KEGG:Arth_0278"
FT                   /protein_id="ACL38509.1"
FT                   /translation="MTENTLSTEDRFAPDVTLRRNDAEHRYELLVGGRLAVQSFFRDLP
FT                   GHIDFTHTETGQDFEGRGLGKVLAHFALDDVVATGKRVIPHCPFISSYLRKHEGYEQFV
FT                   DWPEG"
FT   gene            complement(547851..548165)
FT                   /locus_tag="Achl_0511"
FT   CDS_pept        complement(547851..548165)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38510"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAP9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38510.1"
FT                   /translation="MTTATEHRLPASGERTKPAGNTAEPLDLGLLVTLNSRMHCRMPMQ
FT                   RIDPQELPVREPVYVDGTGVLPAGPGSAPGTVVTYRCACGFTLDDPAFSATVSDRALAS
FT                   "
FT   gene            548497..550131
FT                   /locus_tag="Achl_0512"
FT   CDS_pept        548497..550131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0512"
FT                   /product="Pyridoxal-dependent decarboxylase"
FT                   /note="PFAM: Pyridoxal-dependent decarboxylase; KEGG:
FT                   art:Arth_0285 pyridoxal-dependent decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38511"
FT                   /db_xref="GOA:B8HAQ0"
FT                   /db_xref="InterPro:IPR002129"
FT                   /db_xref="InterPro:IPR010977"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ0"
FT                   /inference="protein motif:PFAM:PF00282"
FT                   /protein_id="ACL38511.1"
FT                   /translation="MPLMPRLDETQVDHSARQDLAHRDPARQDLNAVPQGEDFGSRVEL
FT                   ALGATNHLLNARNSPRYVAQVLQGVTAVATKLERTTQPFTGVGPADMRTRVGAVDLDTP
FT                   LPDTAAALQELEDVYLRDAVYFHDSKYAAHLNCPVVIPALVGEAILSAVNSSLDTWDQS
FT                   AGATMIERRLIDWAAERLHLGAAADGIFTSGGSQSNLQALLIARNHAVAGLRQDPALAG
FT                   LRLPALLDTLRIFTSEDSHFSVQKSASMLGLGFDAVITVPCSADHRMDPAALATAMAEA
FT                   HGAGLTAMAVVATAGTTDFGAVDPLAELAALARAYGAWFHIDAAYGGGLMVSGRYRHLL
FT                   DGSGLADSVTVDFHKTFFQPVSSSALLVREAAMLRHITYYADYLNPESAALADIPNQVD
FT                   KSIQTTRRFDALKLWLTLRIMGADAIGALFDEAIDLAARVGSVLEADDDFELAAAPQLS
FT                   TLVFRYRPVLDSGARLSDEDADALNPAIRAAIFASGKAVVAGTKVGGRHYLKFTLLNAE
FT                   ATLGDITDIITLLRSTGAGLLQKETTA"
FT   gene            550128..551504
FT                   /locus_tag="Achl_0513"
FT   CDS_pept        550128..551504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0513"
FT                   /product="L-lysine 6-monooxygenase (NADPH)"
FT                   /EC_number="1.14.13.59"
FT                   /note="KEGG: art:Arth_0286 L-lysine 6-monooxygenase
FT                   (NADPH)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38512"
FT                   /db_xref="GOA:B8HAQ1"
FT                   /db_xref="InterPro:IPR025700"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ1"
FT                   /inference="protein motif:PRIAM:1.14.13.59"
FT                   /protein_id="ACL38512.1"
FT                   /translation="MSTPTNGTIFDFAAIGVGPFNLGLAALTEPVEGLNGVFLEQRDSF
FT                   DWHPGMMLEPAHLQVPFMADLVTMADPTSPYSFLNFLKQTGRLYRFYIRENFYPLRAEF
FT                   NQYCQWVAGQLPSVRFGTAVQEVAYDDGVYRLSVSGPDGPEVLSARRLVLGTGTSAFVP
FT                   AAAQGILAAAAAGTGGVAFHNADYLARKAELQQQRSITILGSGQSAAEIYYELLQEADA
FT                   YGYQLNWVTRSGRFFPLEYTKLTLEMTSPEYVDYFHGLPPGQRDHLNKTQKNLYKGINS
FT                   DLIDAIYDLLYTRSLSGMVDTQLLTHSTLTAAEWDPAAGTHRLHLEHGEQGTSYTLDSE
FT                   AVVLATGYGYREPAFLAGVQDRIARDGSGRFAVDRNYGTGVEPGEIFVQNAELHTHGFV
FT                   TPDLGMGAYRNSCIIREMAGREVYPVERTIAFQQFGAPPSVPGVQPDPAAGNVTVEVPA
FT                   "
FT   gene            551501..552091
FT                   /locus_tag="Achl_0514"
FT   CDS_pept        551501..552091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0514"
FT                   /product="aceytltranferase"
FT                   /note="KEGG: art:Arth_0287 aceytltranferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38513"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR019432"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ2"
FT                   /inference="similar to AA sequence:KEGG:Arth_0287"
FT                   /protein_id="ACL38513.1"
FT                   /translation="MRFTFRCVDPVADTPLLHSWVTQPYAAFWGMLSATETDVIDEYAK
FT                   IQASGHHHALLGLDGGVPAFLMEEYLPASSPLAAAYPVLPGDAGMHLLVAPPSGDPEAG
FT                   FTTAVMDAVLHRLFARPEVERVVVEPDARNTKIHALNERFGFLPAGVVGLPDKDALLSF
FT                   CTRAGYLAARETLTPLKTTATTRTEDLQGAAAL"
FT   gene            552088..553965
FT                   /locus_tag="Achl_0515"
FT   CDS_pept        552088..553965
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0515"
FT                   /product="IucA/IucC family protein"
FT                   /note="PFAM: IucA/IucC family protein; KEGG: art:Arth_0288
FT                   IucA/IucC family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38514"
FT                   /db_xref="GOA:B8HAQ3"
FT                   /db_xref="InterPro:IPR007310"
FT                   /db_xref="InterPro:IPR022770"
FT                   /db_xref="InterPro:IPR037455"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ3"
FT                   /inference="protein motif:PFAM:PF04183"
FT                   /protein_id="ACL38514.1"
FT                   /translation="MTVQLESTATAPGAAAAAPHLEGRRWDAANRHLLRKALAEFSHER
FT                   ILTPEPVPVPVPGAPEANTYRLTSADGSHEYRFTARILELEHWSISAGSIRHIQDGTEA
FT                   PLDVLEFITVFHEALGINLQMLPVYLEEVSSTLASHAYKQWAGQPTAGELAAGVTGGRD
FT                   VAADFQAIERSMTEGHPCFVANNGRLGFGVSDYLAFAPETGAPVQLEWIAVHRSHAVVS
FT                   TSSGLDYAAHLDAELGPLAGRFTTELVLQGLDPDQYFFMPVHPWQWENKLTVTFAAEIA
FT                   RQRIVHLGTGTDSYQAQQSIRTFFNTSQPSRNYVKTAMSVLNMGFMRGLSPQYMKATPA
FT                   INDWLRKLITADAALQQRGFTMIGEIAAIGYHNRTYEAASASGSPYRKMLSALWRESPL
FT                   PLLEDGQQLTTMAALLHVDSAGKPMVSALIERSGLAPEDWLRRYFEAYLVPLVHCLYNY
FT                   ELAFMPHGENVILVLENGVPVRAIMKDIAEEIVVMGDRLDLPEEVARIRADIPDGEKVL
FT                   AIFTDIFDCIFRFLAALLDEDGTLPQEAFWRTSAEAVRDYQAQHPELAGQFSRHNLFAA
FT                   DFELSCLNRLQLRNNQQMLDLTDPSGGLQMAGRLANPLARFAGETTGQA"
FT   gene            554011..554802
FT                   /locus_tag="Achl_0516"
FT   CDS_pept        554011..554802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0516"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: art:Arth_0289 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38515"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ4"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38515.1"
FT                   /translation="MTQTTSRTTALVTGASAGLGAEFARQLAAEGCHLVLVARNRSRLE
FT                   EAAAELERRYGATAEVLPADLTDDAAVAAVVERLSDPQRPVGILVNNAGIGLLHNFEDN
FT                   PVEEEKKHLKLHTETALVLSHAALKGMLDRGEGRIINVASIAAFLPRGTYSAAKAWLLS
FT                   FSRWANLAYRTRGIKVTAVCPGFTHTEFHDRMGMDKSVAPKWTWLAAERVVREGLADNA
FT                   KGKAVSIPSKRYKVVAALARVAPPRLMAGPPRKPQQERGGT"
FT   sig_peptide     554011..554085
FT                   /locus_tag="Achl_0516"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.952) with cleavage site probability 0.416 at
FT                   residue 25"
FT   gene            complement(554752..555843)
FT                   /locus_tag="Achl_0517"
FT   CDS_pept        complement(554752..555843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0290 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38516"
FT                   /db_xref="GOA:B8HAQ5"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ5"
FT                   /inference="similar to AA sequence:KEGG:Arth_0290"
FT                   /protein_id="ACL38516.1"
FT                   /translation="MERVLLHVRALHRLEPANADHLAALRVALSVAVPSLLLLAAGRPD
FT                   LIIYAVFGALTGMYGRSEPHQLRILHQSQAALVLLGGVSVGVFLSANHIHSWALVAIEA
FT                   ALAGLGSLYSDRVRLKPNGPFFGILALGACASVPMAVPWYAALLIAVGSAAFAVLVGFA
FT                   GWVRRRRWQRGAVRIAPASQPVGHRAMLIHAARYVLAVGAAGTIGVLTGSGHPHWAMAA
FT                   AAVPLGGADLPSSVRRGIHRIVGTFVGLAVTAVVILPAPWTLPGLFPGQQAVVLALLVI
FT                   LFQFTTELFMTRHYGLAMVSFTPVILLMTQLAAPADPGVLILERAIETLVGALVGIAVV
FT                   VAVRRQGSRSPALLLGLARRARH"
FT   gene            complement(555963..557543)
FT                   /locus_tag="Achl_0518"
FT   CDS_pept        complement(555963..557543)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0518"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: art:Arth_0291 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38517"
FT                   /db_xref="GOA:B8HAQ6"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ6"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /protein_id="ACL38517.1"
FT                   /translation="MPTDQSNTDSSAGARNARGTEPAAVKAAKKPKLLPRRRLKESDVN
FT                   VVDQPMLKKALGGTIVGNTMEWYDVGVFGYLITTMGPVFLPESDPTTRNLFLLGTFAAT
FT                   FIARPLGGVVFGWLGDKVGRQKILATTLMIMAASTFAVGLLPGYAQIGLWAAALLVLLK
FT                   VIQGFSTGGEYAGATTFVSEYAADKRRGFFASFLDLGSYMGFAMGAALVSVLQLTLGQD
FT                   TMEDWGWRIPFLLAGPLGLIAVYFRSKIEESPQFQATLDAQEENAKNATEGDTAAAKGP
FT                   VGIIKAYWRPIVVAMVVVAAANTAGYALTSYMPTYLTTSKGYDEVHGTLLTIPVLVVMS
FT                   LCIPLTGKLSDRIGRRPVLWVGAVSTIVLAIPAFLLIGVGEVWSTLAGLALVAFPVTFY
FT                   VANLASSLPAQFPTSSRYGAMGIAYNFAVAIFGGTTPFIVELLIKSTGNDMMPAYYLMA
FT                   TSLVGAVAIYFLKESANRPLPGSMPSVDTEAEARELVKTQDENPLINVDELPFDTHPHH
FT                   DGGKAPVNA"
FT   gene            558110..558367
FT                   /locus_tag="Achl_0519"
FT   CDS_pept        558110..558367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0519"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aau:AAur_0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38518"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ7"
FT                   /inference="similar to AA sequence:KEGG:AAur_0282"
FT                   /protein_id="ACL38518.1"
FT                   /translation="MADENRKSHLNPELADHLAAALDTPDLPAAATTAPGAMPRQNSWP
FT                   DGNGKRRHPKDRGSSHGRMGHEASVAAVHRTGKPQMPHSS"
FT   gene            complement(558520..561006)
FT                   /locus_tag="Achl_0520"
FT   CDS_pept        complement(558520..561006)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0520"
FT                   /product="DNA polymerase LigD, ligase domain protein"
FT                   /EC_number="6.5.1.1"
FT                   /note="KEGG: art:Arth_0294 DNA ligase (ATP); TIGRFAM: DNA
FT                   ligase D, 3'-phosphoesterase domain protein; DNA polymerase
FT                   LigD, polymerase domain protein; DNA polymerase LigD,
FT                   ligase domain protein; PFAM: DNA primase small subunit; ATP
FT                   dependent DNA ligase domain protein; ATP dependent DNA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38519"
FT                   /db_xref="GOA:B8HAQ8"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR014144"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="InterPro:IPR014146"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="InterPro:IPR033649"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ8"
FT                   /inference="protein motif:TFAM:TIGR02779"
FT                   /protein_id="ACL38519.1"
FT                   /translation="MAGRELTLTNLDKIIYPETGTTKADVLAYYAAVAHVLIPAAANRP
FT                   ATRKRWVNGVGTAEKPGEVFFQKNLEDSAPDWLPRAAITHKDRTIHYPMVNDPAVLTWF
FT                   GQINSLEIHVPQWRVDSQGTQLNPDRLVLDLDPGEGAGLADCREVALLARAILQDVGLA
FT                   PVPVTSGSKGIHLYAPLDGTQTSDQISEFARELARALESDHPDLAVSDMKKTLRKGKVL
FT                   VDWSQNNAAKTTIVPYSLRGRPTPMVAAPRTWREISSPRLKHLDYQEVLRRVQDGKDPF
FT                   AAVVRAAGTLDDGDGGTGTAQDGTHDGHPRLAKYRAMRDPKATPEPFSGAPRGGDAFVI
FT                   QEHHASRLHWDLRLEHEGVLASWALPKGVPESGGKNHLAVQTEDHPMDYLTFHGTIPKG
FT                   EYGAGDMTIWDTGTYELHKWINGKEVIVTLTGSEGGGLGGTRKVALIHTGRGQGSDAEK
FT                   QWLIHLMDKEDQGARRRHAPSSAEPAGSAEDVGSAGKSGDASNEQAGAKQVSPDDVRPM
FT                   MATAGVPSDLLGSDWQVELKWDGVRAILVADESSVRIFSRNGNDVTRTYPELTDRRCWP
FT                   EQPFVADGEIIAVGPSGRPDFGLLQGRMKLTRAADVVKAQKALPVRLMLFDLLHDGGTD
FT                   LRRLPLRARRQRLEQFFQPSDCPVELSMVLEDPVEHIMDSARELGLEGVMAKRTDSRYV
FT                   SGQRTRTWIKLKTERTQEVVVGGWRPGKGGRQETVGSLLVGIPDGNKLQYVGRVGSGFS
FT                   GRELAELRQTVEQLARKTSPFHEVPRPDSADAHWVTPQLVGEVTYGEWTGPGRLRHPRW
FT                   RGWRLDKDPSEVVRED"
FT   gene            561071..562252
FT                   /locus_tag="Achl_0521"
FT   CDS_pept        561071..562252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0521"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   art:Arth_0295 DNA end-binding protein Ku"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38520"
FT                   /db_xref="GOA:B8HAQ9"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAQ9"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACL38520.1"
FT                   /translation="MRAIWKGAIAFGLVNVPVKVYSATEDHDISLHQVHNADGGRIRYQ
FT                   RRCEVCGQVIDYSDIEKAFEEDGRTVVLSKDELKAIPAENSHEIEVVQFVPSEQLEPMM
FT                   FEKSYYLEPDSKSPKAYVLLRRALEDTDRVAIVQYALREKTRLGALRIKDDVLVLQSLL
FT                   WPDEVREANFPSLDADIRISAQERDMSAALVESMAADFEPESFTDDYQVQLRKLIDAKL
FT                   EQGESLDTDETFGVEAGEGGKGEVIDLMEALKRSLDRKRGGAAAASGAADSEEEEASDD
FT                   DGSEDGEKSAKPARKSSGSRSPGTGTAAASKTSASKATDTKTGTRSTAAKSTASKSVAA
FT                   KGTSTRSTAAKSTGTQSTAAKTAAGKSTGTKAAASKSTEKPAAKSTTRARKPA"
FT   sig_peptide     561071..561139
FT                   /locus_tag="Achl_0521"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.633) with cleavage site probability 0.626 at
FT                   residue 23"
FT   gene            562398..563240
FT                   /locus_tag="Achl_0522"
FT   CDS_pept        562398..563240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0522"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: art:Arth_1059
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38521"
FT                   /db_xref="GOA:B8HAR0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL38521.1"
FT                   /translation="MNDQTDAAEADRALKQKHRAMWASGDYPALADEMLLELGAILVEA
FT                   CGVRSRHRVLDVAAGSGNAAIPAAMMGAKVVASDLTPELFEAGRREAGNRGVSLEWKEA
FT                   DAEALPFDDASFDVVMSCLGAMFAPRHQTAADEILRVCKPGGNIGLLSWTPEGFIGRMF
FT                   AIMKPFAPPPPPGAQPAPLWGSEDHVRELLGDRVTDVAVRKQALAVRSFHQPGDFVRYF
FT                   KSHYGPTIAVYKYIGADADKVKELDKALTDLAESFGDAHGDTPFQMEWEYLLFTARKA"
FT   gene            563242..563673
FT                   /locus_tag="Achl_0523"
FT   CDS_pept        563242..563673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0523"
FT                   /product="Activator of Hsp90 ATPase 1 family protein"
FT                   /note="PFAM: Activator of Hsp90 ATPase 1 family protein;
FT                   KEGG: art:Arth_2422 activator of HSP90 ATPase 1 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38522"
FT                   /db_xref="InterPro:IPR013538"
FT                   /db_xref="InterPro:IPR023393"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR1"
FT                   /inference="protein motif:PFAM:PF08327"
FT                   /protein_id="ACL38522.1"
FT                   /translation="MPGDFTSTSSATIDAPPDRVWNVITDPAAAREFMFGAELETDWAE
FT                   GSPITWSGEWEGKPYQDKGKVLEVDPGRKLVHTHFSALSGDEDVPENYHTLTWTLQDRD
FT                   GGTHLTLAQDNNPSEEAASHSKGMWDKLVADVKAIAERP"
FT   gene            complement(563870..564148)
FT                   /locus_tag="Achl_0524"
FT   CDS_pept        complement(563870..564148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0524"
FT                   /product="phosphocarrier, HPr family"
FT                   /note="TIGRFAM: phosphocarrier, HPr family; PFAM:
FT                   phosphoryl transfer system HPr; KEGG: aau:AAur_0293
FT                   phosphocarrier protein HPr"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38523"
FT                   /db_xref="GOA:B8HAR2"
FT                   /db_xref="InterPro:IPR000032"
FT                   /db_xref="InterPro:IPR001020"
FT                   /db_xref="InterPro:IPR035895"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR2"
FT                   /inference="protein motif:TFAM:TIGR01003"
FT                   /protein_id="ACL38523.1"
FT                   /translation="MPERTATVASRVGLHARPAAIFAEAAGEFDLDITIAREGEPADEA
FT                   MDAASILSLMSLGASHGDVVVLRAEGAGADDALERLVQILETDHDAE"
FT   gene            complement(564215..566257)
FT                   /locus_tag="Achl_0525"
FT   CDS_pept        complement(564215..566257)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0525"
FT                   /product="PTS system, fructose subfamily, IIC subunit"
FT                   /note="TIGRFAM: PTS system, fructose-specific, IIB
FT                   subunnit; PTS system, fructose subfamily, IIA subunit; PTS
FT                   system, fructose subfamily, IIC subunit; PFAM:
FT                   phosphoenolpyruvate-dependent sugar phosphotransferase
FT                   system EIIA 2; phosphotransferase system EIIC;
FT                   phosphotransferase system PTS fructose-specific IIB
FT                   subunit; KEGG: aau:AAur_0294 PTS system, fructose-specific
FT                   family, IIABC components"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38524"
FT                   /db_xref="GOA:B8HAR3"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR003352"
FT                   /db_xref="InterPro:IPR003353"
FT                   /db_xref="InterPro:IPR003501"
FT                   /db_xref="InterPro:IPR004715"
FT                   /db_xref="InterPro:IPR006327"
FT                   /db_xref="InterPro:IPR013011"
FT                   /db_xref="InterPro:IPR013014"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="InterPro:IPR036095"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR3"
FT                   /inference="protein motif:TFAM:TIGR01427"
FT                   /protein_id="ACL38524.1"
FT                   /translation="MTQLITTELVELDRNLGNDPEAVIRHLASKVAATGRATEVEGLFA
FT                   DAYAREQKTATGIPGGIAIPHCRSAAVVEPTLAMARLSPKVDFGAKDGPADLVFFIAAP
FT                   DGADQAHLKLLSKLARSLIKKDFTAALRNASSEAEIVELVDGALADKPAAHASPAPADA
FT                   APAAAAAASVSAGAGPAAAGPKRLVAVTACPTGIAHTYMAADSLVAAAQEAGVDLQVET
FT                   QGSSGAKPLDPAVIAAADAVIFAVDVDVRGKERFAGKPVINAPVKRGIDEPAKMVQEAL
FT                   AAADDPHARRVPHFGAEEQAEQAAAEKGEHIGQKLKRALLTGVSYMIPFVAGGGLLIAL
FT                   GFLLGGYDITGVADKVVLENSFGNLPEGGLAIYLGAVFFKIGALSMGFLVPALAGYIAY
FT                   AIADRPGIAPGFVAGAVSGFMGAGFLGGIVGGLLAGYIAHLIGTWQVARWLRGLMPVVI
FT                   IPLLASIVASGLMFLVLGGPIAGLTTALNSWLSGMTGASAVVLGIILGLMMCFDLGGPV
FT                   NKVAYAFAVAGLSAGSATNQAPWQIMATVMAAGMVPPLAMALATVLDKKLFSLAERENG
FT                   KAAWLLGASFISEGAIPFAAADPLRVIPASMLGGALTGALTMAFNVTSQAPHGGIFVFF
FT                   AIGNVLMFIVSIIAGTVVSALAVVALKRWAAPKTTATVESVPATV"
FT   gene            complement(566260..567252)
FT                   /locus_tag="Achl_0526"
FT   CDS_pept        complement(566260..567252)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0526"
FT                   /product="1-phosphofructokinase"
FT                   /note="TIGRFAM: 1-phosphofructokinase; PFAM: PfkB domain
FT                   protein; KEGG: art:Arth_0300 PfkB domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38525"
FT                   /db_xref="GOA:B8HAR4"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR017583"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR4"
FT                   /inference="protein motif:TFAM:TIGR03168"
FT                   /protein_id="ACL38525.1"
FT                   /translation="MIVTFTANPSLDRTVALPGPLERGEVQRAVSVTQESGGKGVNVSR
FT                   ALVASGLESLAVLPGADTDPVLAGLRATSVPFVSLPIDEPLRTNVALTEPGGVTTKINE
FT                   PGPVLDDNQQEALLKLLLESSRGAGWVVLAGSLPPGFPSDFYATAARRLRSAADSESSG
FT                   HTPLIAVDSSGQPLAAALTGGAEGMPDLLKPNAEELAELAAAAGFATAAADELEADPAA
FT                   AAEAASAVVRSGVGAVLATLGSKGAVLVTADGAWLATHPPVAAVSTVGAGDSALAGYLL
FT                   AHSQGAAPADCLRQAVAHGAAAASLPGSTVPAVHQTTPEAVTITALRKD"
FT   gene            complement(567249..568055)
FT                   /locus_tag="Achl_0527"
FT   CDS_pept        complement(567249..568055)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0527"
FT                   /product="transcriptional regulator, DeoR family"
FT                   /note="PFAM: regulatory protein DeoR; Helix-turn-helix type
FT                   11 domain protein; KEGG: art:Arth_0301 transcriptional
FT                   regulator, DeoR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38526"
FT                   /db_xref="GOA:B8HAR5"
FT                   /db_xref="InterPro:IPR001034"
FT                   /db_xref="InterPro:IPR014036"
FT                   /db_xref="InterPro:IPR018356"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR5"
FT                   /inference="protein motif:PFAM:PF08220"
FT                   /protein_id="ACL38526.1"
FT                   /translation="MFAEERQQKIAELVAGSGRVSVTLLAERFRITTETVRRDLATLEN
FT                   AGTVRRVHGGAVAADRFSTTEESVTERAIRRPDQKSRIAEAALALIPRNSPGSVLIDGG
FT                   TTTEVLADMLARRTAVELSESGGAGTELVAITHAVPIAGRLSSVPGIALHILGGRVRGI
FT                   TQVAVGQATVDAAARIRPDIAFLGTNGIHPTFGLSTPDPEEAAVKAAFVHSARRIVVLA
FT                   DSSKLDAETLVQFASLKDLDTLITDSEPGPELAAALEEADVDVVIA"
FT   gene            complement(568317..568574)
FT                   /locus_tag="Achl_0528"
FT   CDS_pept        complement(568317..568574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0302 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38527"
FT                   /db_xref="GOA:B8HAR6"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR6"
FT                   /inference="similar to AA sequence:KEGG:Arth_0302"
FT                   /protein_id="ACL38527.1"
FT                   /translation="MRIGSSIFLIALGAILAWAVAPGLIPFVDQALVGYILIAVGVIGL
FT                   IASLVLASPGRTRRVSETRSVVDPNTGERITRNESRDGTI"
FT   sig_peptide     complement(568515..568574)
FT                   /locus_tag="Achl_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.983 at
FT                   residue 20"
FT   gene            568838..569473
FT                   /locus_tag="Achl_0529"
FT   CDS_pept        568838..569473
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0529"
FT                   /product="phospholipase/Carboxylesterase"
FT                   /note="PFAM: phospholipase/Carboxylesterase; KEGG:
FT                   art:Arth_0305 phospholipase/carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38528"
FT                   /db_xref="GOA:B8HAR7"
FT                   /db_xref="InterPro:IPR003140"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR7"
FT                   /inference="protein motif:PFAM:PF02230"
FT                   /protein_id="ACL38528.1"
FT                   /translation="METVVWSKPEDQRAGTPLLVMMHGYGTDESRMVRLFEYLPAEFTF
FT                   AALRAPMPIGDHYGWFLLDYFLANDFADVISVTGTVQGWINSVRGQHTSVSLMGYSQGM
FT                   AMASTLLRLHPRDYAAVVGLSGFVLDNDLLALTDEFDARPPFFWGRDKADLVINEDATA
FT                   YTGEWLETHTLLTARTYPGMGHAMSKAEMADVGAFLRHYVLRGGAAGA"
FT   gene            569769..570542
FT                   /locus_tag="Achl_0530"
FT   CDS_pept        569769..570542
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0530"
FT                   /product="beta-phosphoglucomutase family hydrolase"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; beta-phosphoglucomutase family hydrolase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   art:Arth_0307 beta-phosphoglucomutase family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38529"
FT                   /db_xref="GOA:B8HAR8"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR8"
FT                   /inference="protein motif:TFAM:TIGR02009"
FT                   /protein_id="ACL38529.1"
FT                   /translation="MNNSAHEAPANEPSAATDPGNTAWTGASAILFDLDGVLTPTATVH
FT                   EQAWKELFEGFLAGHPEVQGYRESDYFDHIDGKPRFDGVRDFLASRSIELPEGPLDDDP
FT                   ANITVQGLGNRKNRIFNDIVSTGVAPFEGSVRFLEAALDRGLKVAVVSSSRNAPAVLAA
FT                   AGLSHHFPVVVDGVVAAREGIPGKPSPATYAYAARLLELPSEECVVVEDAVSGVQAGQA
FT                   GQFHSVIGVDRGAGRETLLEAGATLVVNDLGELLP"
FT   gene            570669..573014
FT                   /locus_tag="Achl_0531"
FT   CDS_pept        570669..573014
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0531"
FT                   /product="Kojibiose phosphorylase"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase family 65 domain protein;
FT                   glycoside hydrolase family 65 central catalytic; KEGG:
FT                   art:Arth_0308 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38530"
FT                   /db_xref="GOA:B8HAR9"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAR9"
FT                   /inference="protein motif:PRIAM:2.4.1.230"
FT                   /protein_id="ACL38530.1"
FT                   /translation="MAIISADRERFPNTPWQLVETRHEPGNAGTLETLFSLGNGHLGIR
FT                   GAHWAAADAELPGSFINGLHEIWDIKHAENAFGFARTGQRILYIPDANNFTVVVDGESL
FT                   GLAESEVLDYRRSVDFSTGIYECRITWQCRSGSVVTTTERRALGYESRGSLGLSLEVAA
FT                   DRDISLDVTSSVVNRQDQPVEDHSAHDPRRAGRHAGRVLLPLRLDGGDGSLRLSWEAAE
FT                   SKQRVGLAVDHWTSAGHQPFETVVDQDDSSVRYVLAVSPGEPFRLEKSVSYAAGRTMQD
FT                   EGVDAAAVAEAGLRSVADVFAESEAHYRGYWATSDIVVDGGEPELQQAIRWNLFQLAQA
FT                   TARANVAGIPAKGVTGSGYEGHYFWDQEVYLLPYLTYTNPDGARQVLEFRHAMLPEAKV
FT                   RAKELSVDGALFPWRTINGLEASAYYAAGTAQFHIAAAIAFATNRYLWATGDSAFREGM
FT                   GAELLMETARMWISLGFFGKDGLFHIHGVTGPDEYTAVVNDNLYTNVMARFNLRAAAAL
FT                   DHPGVTQEERQLWGAAANLMHLPFDSRMQVHSQDNDFMTLEPWDWTTPRSKYPLLLHFH
FT                   PLVIYRHQVLKQADTVLAMFLQWQDFTAGEKQRAFDFYDPITTGDSTLSACVQGIMAAE
FT                   VGYSGEALKHFTNAVFIDLDDTHGNTIDGVHIASTGGVWSSLVCGFAGLRDQGPVPYFD
FT                   PRLPEEWDGLTFHLRISGRLLLVRLSSGAITLTVQEGDPLDVNVRGQVVSVGSDPVRVE
FT                   LEPVAEPEPTVFPSGLPTASIPVVLANS"
FT   gene            complement(573027..574313)
FT                   /locus_tag="Achl_0532"
FT   CDS_pept        complement(573027..574313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0532"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: protein of unknown function DUF894 DitE; major
FT                   facilitator superfamily MFS_1; KEGG: art:Arth_0310 major
FT                   facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38531"
FT                   /db_xref="GOA:B8HAS0"
FT                   /db_xref="InterPro:IPR010290"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8HAS0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL38531.1"
FT                   /translation="MPAPKALRPFVHREYRVLIAALAISIFGSGMWAVAMVYQVIHLGG
FT                   GPLELSLVAAAGSVGLVAFVLAGGIAADRVPQRRLIIAVEGANLAVIATISGLAMAGWL
FT                   QLWHVAAGAFVLGVGAAFFFPAYSAILPRILPAEDLLAANGMEGTMRPVLQQAAGPAVA
FT                   GILVAALSPSHAVTGVAACHLLAFFVLNFLGQHALATPPEGAGHEDGRRKSTFVQDLRE
FT                   GVSYTIRTPWLLWTLIWACISVLFLIGPIEVLLPFLVRDQLGGDSSMFGFLLAVMGVGA
FT                   ALGSLVTASLRLPRRYLTVMMVSWGVGSLPIAAVGLMDNFWLIAAALFIWGATGSVGMV
FT                   IWGTLLQRRVPSHLLGRISSLDFFVSLALMPVSMALAGPAAEVLPIWLIFLVAGVVCPI
FT                   MAVIASAAARMPRDELAHPLDAAPEAAVS"
FT   gene            complement(574436..575479)
FT                   /locus_tag="Achl_0533"
FT   CDS_pept        complement(574436..575479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0533"
FT                   /product="lipoic acid synthetase"
FT                   /note="KEGG: art:Arth_1604 lipoyl synthase; TIGRFAM: lipoic
FT                   acid synthetase; PFAM: Radical SAM domain protein; SMART:
FT                   Elongator protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38532"
FT                   /db_xref="GOA:B8HB47"
FT                   /db_xref="InterPro:IPR003698"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR031691"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB47"
FT                   /inference="protein motif:TFAM:TIGR00510"
FT                   /protein_id="ACL38532.1"
FT                   /translation="MLNPNKGNNTMTLAPEGRKLLRIEQRNAATPVERKPEWIKAKVQM
FT                   GPEFVQLKNLVKKEGLHTVCEEAGCPNIFECWEDKEATFLIGGSECTRRCDFCQIDTGK
FT                   PSPVDRFEPTKVARSVQSMALRYATVTGVARDDLEDEGVWLYAETVRKIHELNPGTGVE
FT                   LLIPDFSGNPDHIKAICDSAPEVFAHNVETVPRIFKRIRPAFRYERSLDVITQGRNLGM
FT                   VTKSNLILGMGETREEISEALADLHEAGCDLITITQYLRPSERHLPVDRWVKPQEFVDL
FT                   QHEAEEIGFLGVMSGPLVRSSYRAGRLWATAMRKKGRDIPAELAHIADGIQDSGTTRQE
FT                   AATLLAG"
FT   gene            complement(575473..576930)
FT                   /locus_tag="Achl_0534"
FT   CDS_pept        complement(575473..576930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0534"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="KEGG: art:Arth_0768 L-serine dehydratase 1; TIGRFAM:
FT                   L-serine dehydratase 1; PFAM: serine dehydratase alpha
FT                   chain; serine dehydratase beta chain"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38533"
FT                   /db_xref="GOA:B8HB48"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB48"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ACL38533.1"
FT                   /translation="MAVGVFDLFSIGIGPSSSHTVGPMRAAAVFAEELKASGVLSAVAS
FT                   LRVDLYGSLAATGHGHGTMTAVLLGLEGFHPELILPGEVEERLAAIAETGMLHLAGAGG
FT                   GDGVKLPYGVGDMVLRPLTVLPRHTNGMTFTVTDAAGEVLHAATFFSVGGGFIVREGEE
FT                   DAALQELEESKKELPLPFRTAAELLAHCAETGLGVSDVMLVNEKSSRAGEEIRAGLLHI
FT                   WSVMEACVATSLKREGVLPGGLKVRRRAPDWFDRLKKECARPGEDSQDRDFTDWDFHDP
FT                   KYWQEWVNLVALAVNEENASGGRVVTAPTNGAAGIIPAVLYYALHFAPGMEKATQEDRE
FT                   AVVARFLLAAGAVGVLYKEQASISGAEVGCQGEVGSASSMAAAGLAEVMGGTPAQVENA
FT                   AEIAMEHNLGLTCDPIGGLVQVPCIERNAIAAAKAINAAKMALWGDGTHRVSLDEVIIT
FT                   MRETGKDMSDKYKETAMGGLAVNVVEC"
FT   gene            complement(577009..578313)
FT                   /locus_tag="Achl_0535"
FT   CDS_pept        complement(577009..578313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0535"
FT                   /product="Glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; KEGG:
FT                   aau:AAur_4004 serine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38534"
FT                   /db_xref="GOA:B8HB49"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB49"
FT                   /inference="protein motif:PRIAM:2.1.2.1"
FT                   /protein_id="ACL38534.1"
FT                   /translation="MSAAAEVTAFEQVVSPSLNADLSVQDPEIAAKIDDELGRQRDGLE
FT                   MIASENHTAAAVMQAQGSVLTNKYAEGYPGKRYYGGCEHVDVIEQLAIDRVKALFGAEF
FT                   ANVQPHSGAQANASVMHALIKPGDTIMGLNLAHGGHLTHGMKINFSGKLYNVVPYQVRE
FT                   DTHTIDMAEVERLALETKPQLIVAGWSAYARQLDFAEFRRIADLVGAYLMVDMAHFAGL
FT                   VAAGLHPSPVPHAHVVTSTTHKTLAGPRGGIILSNDADIAKKINSAVFPGQQGGPLEHV
FT                   IAGKAVAFKIAASAEFKERQERVLAGSRILAERLVQPDVTAKGISVISGGTDVHLVLVD
FT                   LRNCELNGQQAEDRLAAIDITVNRNAVPFDPRPPMVTSGLRIGTPALATRGFGEAAFRE
FT                   VADIIAEALIADADLSGLRHRVEALAKAHPLYPGL"
FT   gene            complement(578310..578693)
FT                   /locus_tag="Achl_0536"
FT   CDS_pept        complement(578310..578693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0536"
FT                   /product="glycine cleavage system H protein"
FT                   /note="TIGRFAM: glycine cleavage system H protein; PFAM:
FT                   glycine cleavage H-protein; KEGG: aau:AAur_4005 glycine
FT                   cleavage system H protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38535"
FT                   /db_xref="GOA:B8HB50"
FT                   /db_xref="InterPro:IPR000089"
FT                   /db_xref="InterPro:IPR002930"
FT                   /db_xref="InterPro:IPR003016"
FT                   /db_xref="InterPro:IPR011053"
FT                   /db_xref="InterPro:IPR017453"
FT                   /db_xref="InterPro:IPR033753"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB50"
FT                   /inference="protein motif:TFAM:TIGR00527"
FT                   /protein_id="ACL38535.1"
FT                   /translation="MSKVAAELKYSAEHEWIAVDGSGPAGIGISAVAADALGDIVYVDL
FT                   PEVGSIVTAGETCGEVESTKSVSDLYSPVTGEVTEINDGVVSDPALINSDPYGAGWLFK
FT                   VSVTEEGPLLSAEEYAAANGGEL"
FT   gene            complement(578782..579930)
FT                   /locus_tag="Achl_0537"
FT   CDS_pept        complement(578782..579930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0537"
FT                   /product="glycine cleavage system T protein"
FT                   /note="TIGRFAM: glycine cleavage system T protein; PFAM:
FT                   glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: aau:AAur_4006
FT                   glycine cleavage system aminomethyltransferase T"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38536"
FT                   /db_xref="GOA:B8HB51"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006223"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR022903"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB51"
FT                   /inference="protein motif:TFAM:TIGR00528"
FT                   /protein_id="ACL38536.1"
FT                   /translation="MTENYTALYEQHKKAGASFTDFGGWQMPLKYSSELAEHHAVRTAA
FT                   GLFDLSHMGEVWVTGPDAAAFLDYALVGKLSAIAVGKAKYSLICDTDGGIIDDLITYRL
FT                   PAGADGTAKYLVVPNAGNAKVVAEALQERAAGFDVTVQDASAETSLIAVQGPAAEAILL
FT                   ALVPAGQHSLVTELKYYAAVEVGITVNGAVQDLLVARTGYTGEDGFEIYAGNLEAAALW
FT                   EALLAAGEGSGLIPAGLAARDSLRLEAGMPLYGNELSRRVNAYAAGLGPVVSLAKESDF
FT                   VGKEALAALKAAGVGSTVGQKLVGLKGTGRRAARGHYPVLKDGSLIGEVTSGQPSPTLG
FT                   YPVAMAYVDVEFAEAGTLVDVDLRGKPERFEVVALPFYKRQK"
FT   gene            complement(580004..582895)
FT                   /locus_tag="Achl_0538"
FT   CDS_pept        complement(580004..582895)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0538"
FT                   /product="glycine dehydrogenase"
FT                   /EC_number="1.3.1.74"
FT                   /note="KEGG: aau:AAur_4007 glycine dehydrogenase; TIGRFAM:
FT                   glycine dehydrogenase; PFAM: glycine cleavage system
FT                   P-protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38537"
FT                   /db_xref="GOA:B8HB52"
FT                   /db_xref="InterPro:IPR003437"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020581"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB52"
FT                   /inference="protein motif:TFAM:TIGR00461"
FT                   /protein_id="ACL38537.1"
FT                   /translation="MPRHPGRPDLEFLMTIQSLPTSFVDRHIGARRQADVDAMLKAVGY
FT                   DSVDGLVDVAVPASIRQETALKLQDALSEVEVLAELRRLAGKNKTAVQLIGQGYYDTIT
FT                   PAVIRRNILEAPAWYTAYTPYQPEISQGRLEALLNFQTMVQDLTALPVANASLLDEATA
FT                   VAEAVLLMRRANKNKDAKDGKTVLDADCLPQTIAIVKGRAEALGFEVEVADLSTGLPEG
FT                   AINGIVLQQPGVSGRVWDQGAVIAEAKERGALVTVAADLLALTLITPPGEQGADIAVGS
FT                   TQRFGVPLFFGGPHAAYMAVQKGMERTLPGRIVGVSKDNAGAPAYRLALQTREQHIRRE
FT                   KATSNICTAQALLAIVSSFYAVYHGPDGLKAIAEDVHHKARTLATALTAMGRELVTDSF
FT                   FDTITVRVPGKAAKVISAAEARGINLRFVDADTVGVSIDETTTAATLSAVAVAFGAGPV
FT                   GDAQGFELPESVLRTSGYLEHPVFNTHRSETQLLRYIRKLSDRDLALDRTMIPLGSCTM
FT                   KLNATAEMEAISWPEFASIHPFAPDSQTEGWRELITGLEADLTEITGYDQVSIQPNAGS
FT                   QGELAGLLAIRGYHHSRGDQQRNVCLIPASAHGTNAASAVLAGMKVVVVATAADGTIDH
FT                   ADLYAKIEANKDVLSCIMITYPSTHGVYDGDVTEVCDAVHAAGGQVYVDGANLNALVGL
FT                   AQPGKFGGDVSHLNLHKTFCIPHGGGGPGVGPVAAKAHLAPFMPGDANKAAHEDGHGVA
FT                   ISAARFGSAGVLPISWAYVKLMGGAGLTDATKSALLAANYVAARLNEFFPVLYTGEGGL
FT                   VAHECILDLRELTARTGVTAEDVAKRLIDFGFHAPTLAFPVAGTLMVEPTESEDLAEID
FT                   RFIDAMITIHAEIEQVAAGDFSLEASPVRNAPHTAAAVVSSDWDRAYPREQAAFPVASL
FT                   RQDKYFPPVGRIDGAAGDRNLVCSCPPLEAFEN"
FT   gene            583608..585149
FT                   /locus_tag="Achl_0539"
FT   CDS_pept        583608..585149
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0539"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   aau:AAur_0842 putative D-serine/D-alanine/glycine
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38538"
FT                   /db_xref="GOA:B8HB53"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB53"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACL38538.1"
FT                   /translation="MAIHPHASNGEPPQNGAAGTAARSEPPHLERQLTNRHIQLIAIGG
FT                   AIGTGLFMGSGKTISAAGPSVIFVYMIIGFMLFFVMRAMGELLLSNLNYKSFSDFAADL
FT                   LGPWAGFFTGWTYWFCWVITGIADVIAIAGYSKELWPGLPLWIPGLATVAILLLLNLAT
FT                   VKAFGETEFWFALIKIIAIAALIIVGLFMIFTGFQSDAGTASFTNLWSHGGFFPNEFMG
FT                   FVAGFQIAVFAFVGIELVGTTAAEAKNPERTLPKAINAIPVRVLLFYVGALIILMAVTP
FT                   WTQFAAGHSPFIGMFSLAGLGAAATVVNLVVLTSAMSSANSGIYSTSRMVFGLAQEGDA
FT                   PGIFSRLSSRKVPSNALFLSCVLLLSGVVLMYAGQDVGKAFEMVTTVSAVCFIFVWSVI
FT                   LASYIAFRKRRPHLHAASKFKMPGGIPAVWVVYAFFAFVLWALTTQPDTLAALLVTPIW
FT                   FLVLGVAWAILRRRPAHLARFEVFRAELRADEQAAAGGQDRKESAREEAARSPRS"
FT   gene            585361..586167
FT                   /locus_tag="Achl_0540"
FT   CDS_pept        585361..586167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0540"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0312 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38539"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB54"
FT                   /inference="similar to AA sequence:KEGG:Arth_0312"
FT                   /protein_id="ACL38539.1"
FT                   /translation="MAKRSNPAVRIAQETAHNAVFDKDGKPKPGVHNMLLKAVEIQRPL
FT                   VLAYIRRLQKKHPQATAAQLAGILERDYLRAVTGGGAIVGATAVVPGVGTVASLGLSAA
FT                   ATVGFLEATALYATSLAELHGIRLTNPEKASTMVMAIMLGEEGTALLGTLSGQMAGNGA
FT                   GATKQWGSVLSKSLPMPGFSTIRNRIQRAFLKNLLKRQGTALLGRALPFGIGAVVGGAG
FT                   NLVMGRAVVANAKEAFGPMPDSLPGELTAAGTTDNQLEGNTFGSQR"
FT   gene            586151..586900
FT                   /locus_tag="Achl_0541"
FT   CDS_pept        586151..586900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0541"
FT                   /product="LamB/YcsF family protein"
FT                   /note="PFAM: LamB/YcsF family protein; KEGG: aau:AAur_0364
FT                   putative LamB/YcsF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38540"
FT                   /db_xref="GOA:B8HB55"
FT                   /db_xref="InterPro:IPR005501"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB55"
FT                   /inference="protein motif:PFAM:PF03746"
FT                   /protein_id="ACL38540.1"
FT                   /translation="MDLNADLGESFGSWTMGDDARMFQLVTSANVACGFHAGDPVTMLD
FT                   SCRAAYELDVTVGAHVGYRDLAGFGRRSLDTSFDELFGDVLYQLGALDGVAHAVGASVD
FT                   YVKPHGALYNRLVHDAEQASAVVAAVNAYDPGLPILGLPGSELLKQAQDAGHPVFVEAF
FT                   VDRAYRADGTLVPRSEEGAVLHDVDAIVERAVRLATKGEVVATDGTVVQVRPDSLCIHG
FT                   DTPGAVEMAAGVRAGLEAAGVSLESFA"
FT   gene            complement(586962..588311)
FT                   /locus_tag="Achl_0542"
FT   CDS_pept        complement(586962..588311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0542"
FT                   /product="protein of unknown function DUF445"
FT                   /note="PFAM: protein of unknown function DUF445; KEGG:
FT                   art:Arth_0319 protein of unknown function DUF445"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38541"
FT                   /db_xref="GOA:B8HB56"
FT                   /db_xref="InterPro:IPR007383"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB56"
FT                   /inference="protein motif:PFAM:PF04286"
FT                   /protein_id="ACL38541.1"
FT                   /translation="MQVNSEPTARESPRRAAPPVPEGAKPQAAVVGHQLSAGDAEKAAA
FT                   LRKMKMLALSLLIAMAVVFVFAFALQEEYPWLQYVRAAAEGGMVGALADWFAVTALFKY
FT                   PMGIKIPHTAIIPRRKDQIGASLGEFVETNFLSEQVVQDKLASVNIARRAGEWLAAPGG
FT                   ADRVAKEGAAVIRGAFKVLNDDDVQAVIEGMVRKHLLTPPWGPPVGRLAERIFHDGHHH
FT                   TLVDLLVDRAADWVDENHETVSRLVSDRSPTWVPQFVDGLVGDKVYVEILKFARAVQSD
FT                   PNHQVRQQIDKYLNDLAQDLQHDPKMIARAEDIKAQVLGDPEVRELASRTWGTVKNALL
FT                   GAVDDPDSELTVKFKAAVRDFGSRLVNDPELAGKVNAWIGDAAGYLVKTYRSDIAGVIT
FT                   DTVARWDAEETSQKIELQVGKDLQFIRINGTVVGSLAGLLIFTVAHLIFG"
FT   gene            588361..589347
FT                   /locus_tag="Achl_0543"
FT   CDS_pept        588361..589347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0543"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: glycerophosphoryl diester phosphodiesterase;
FT                   KEGG: art:Arth_0320 glycerophosphoryl diester
FT                   phosphodiesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38542"
FT                   /db_xref="GOA:B8HB57"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB57"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACL38542.1"
FT                   /translation="MTPDEPTRDRTTHDGAAPDRTSLDGTTPGGPAPGSLEQRPLVFAH
FT                   RGSSGAFAEHTRAAYLQALADGADGVECDVHLTRDQHVVLLHDANLDRTSDGTGPVAER
FT                   TLRELRQLDFSSWKGARIPEIYGARSEQLLTLPELLDVLRGAGRPVKLAIELKHPSPYQ
FT                   LKLEDRVLEVLRSEGWDPGSSTVDNVAVTFMSFSPDSVRHLLRSVPAQFICQLVDDLTV
FT                   HEIRGGLGLGLITGGAVANLMKATQLEGERILDAGLVGLAGPGIDYVRERPDTIRQWLD
FT                   AGRRFRVWTVDSADDVALCRELGIQELTTNVPARVLSQLQVAPSQGR"
FT   gene            589350..590696
FT                   /locus_tag="Achl_0544"
FT   CDS_pept        589350..590696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0544"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: aau:AAur_2076 CaiB/BaiF family acyl-CoA
FT                   thioesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38543"
FT                   /db_xref="GOA:B8HB58"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB58"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACL38543.1"
FT                   /translation="MAGTDAANLRTWWGGPLDVEGLALAAVGAAATALDRYTGAAGRYS
FT                   ASPELTAAAFDSSGHLRIAGRPLQGFAPLSGFRRTRDGWIRLHANYPHHRQRLLQALNA
FT                   TTAEEAEAALRIMDSLEAESVIQARGAVAAAVRTRAEWQASEMGRAAAAGPWMVLDPQA
FT                   PDGPAAGAAMEGSGRRGIPQPGGDPRRPLLGVRVLDLTRVIAGPVSTRLLAALGADVLR
FT                   IDPTALPELSDQFVDTSFGKRSAVADLGRPGTRAALERLVAGADIVITGYRTGSLDRFG
FT                   LDAASLLSARPDLAVVTLNSWGTDGPWSSLRGFDSIVQAASGIAHLYGTTDDAGWRPGA
FT                   LPVQALDHATGYGAAAAAVTLLARRQESGAGGSARLSLARTAEELFRLPPGPRGLPALP
FT                   PPEYRTMASSYGGLRYVRPPLLVEGQALDYPGPPPPYASSALDWVPRSD"
FT   gene            590806..591273
FT                   /locus_tag="Achl_0545"
FT   CDS_pept        590806..591273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0545"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38544"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB59"
FT                   /inference="similar to AA sequence:KEGG:Arth_0323"
FT                   /protein_id="ACL38544.1"
FT                   /translation="MPFPSSGRAARNLSAAAMSALLLASAGKHFRSPGFYRQVVPDYLC
FT                   REDPAPGTVPTGANGPFAVLSRDEWIAVSGLIEAAAAVGILIPATRKVTATAVAAMFTA
FT                   FLAGHADALRRAYSPEGTPLQRRIHTARLPLQAPLIAWAWSLRNTGPDGRR"
FT   sig_peptide     590806..590880
FT                   /locus_tag="Achl_0545"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.774) with cleavage site probability 0.577 at
FT                   residue 25"
FT   gene            591279..592019
FT                   /locus_tag="Achl_0546"
FT   CDS_pept        591279..592019
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0546"
FT                   /product="AzlC family protein"
FT                   /note="PFAM: AzlC family protein; KEGG: art:Arth_0324 AzlC
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38545"
FT                   /db_xref="GOA:B8HB60"
FT                   /db_xref="InterPro:IPR011606"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB60"
FT                   /inference="protein motif:PFAM:PF03591"
FT                   /protein_id="ACL38545.1"
FT                   /translation="MASPAVRVGISISIATGLYGVSFGALSVTSGLDFWQTMALSLLLF
FT                   SGGSQFAFIGVVGGGGSGIAAMSAATLLGMRNGIYGMQLNALLRPEGWRKYVGAQLTID
FT                   ESTATSTGQADPAEQRRGFWAAGIGIYVLWNLFTAVGALAGSGLGDPKQWGLDGAAVAA
FT                   FLALLWPRLKGREPVAIAVVCAVATVLAVPFVPAGVPILVAALVAALIGWFSHGRSDEG
FT                   LEPDVEPYGGHHRHGHGDAAEASQ"
FT   gene            592016..592327
FT                   /locus_tag="Achl_0547"
FT   CDS_pept        592016..592327
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0547"
FT                   /product="branched-chain amino acid transport"
FT                   /note="PFAM: branched-chain amino acid transport; KEGG:
FT                   art:Arth_0325 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38546"
FT                   /db_xref="GOA:B8HB61"
FT                   /db_xref="InterPro:IPR008407"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB61"
FT                   /inference="protein motif:PFAM:PF05437"
FT                   /protein_id="ACL38546.1"
FT                   /translation="MNLWFWILVSCVLAYAWKLVGYFVPARFLENPRMSRIAGTMTIGL
FT                   LVSLTVVNAAATGQALAADARLGALAAAAIALALRAPFLLVVIVGAGTAALLRMAGWV"
FT   gene            592418..592672
FT                   /locus_tag="Achl_0548"
FT   CDS_pept        592418..592672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0548"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38547"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB62"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38547.1"
FT                   /translation="MENQQHAGERTGRAHRKNPRRRAGVPAKHFITRFAGLSDVPAADL
FT                   ELLAGSLRRGLDLEPGSPIPALHAAVHREIRRRADAAAG"
FT   gene            592781..593038
FT                   /locus_tag="Achl_0549"
FT   CDS_pept        592781..593038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0326 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38548"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB63"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38548.1"
FT                   /translation="MNDKTPHGSESTRELRDTARRRRDAEEKLQQHLVEARDHVPNEYS
FT                   EPPTAREGGAGGAERDAGPDGAGTADAAGSGSGQRDKEGS"
FT   gene            complement(593061..593285)
FT                   /locus_tag="Achl_0550"
FT   CDS_pept        complement(593061..593285)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0327 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38549"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB64"
FT                   /inference="similar to AA sequence:KEGG:Arth_0327"
FT                   /protein_id="ACL38549.1"
FT                   /translation="MNTHQLFSFLSDPRDPEEVLAALPAEELAGLLDLLFQELDTVEPA
FT                   FGAQAWYDLAVEESNRRSVSPDGAAHGVA"
FT   gene            complement(593505..594146)
FT                   /locus_tag="Achl_0551"
FT   CDS_pept        complement(593505..594146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0551"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: art:Arth_0331
FT                   transcriptional regulator, TetR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38550"
FT                   /db_xref="GOA:B8HB65"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB65"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL38550.1"
FT                   /translation="MSLAVARKPLRADAARNVDKIISAARQCFREFGPEVPLQTIASTA
FT                   GVGPATLFRNFADKEELVLAALNRQLRISVDPVVDGALADIDAANGLFRVLESLMDAAS
FT                   ADANLLGAVAGRRELLTGITGSLMDSLSVLLVRGQGQGSLRQDISMTDMFRLLAMLISV
FT                   VDTMEPGSDAWRRPLALVEDAIRSTRPARPLPAHVPVPATATAQPSNLRD"
FT   gene            594268..594591
FT                   /locus_tag="Achl_0552"
FT   CDS_pept        594268..594591
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0552"
FT                   /product="protein of unknown function DUF77"
FT                   /note="PFAM: protein of unknown function DUF77; KEGG:
FT                   aau:AAur_0374 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38551"
FT                   /db_xref="InterPro:IPR002767"
FT                   /db_xref="InterPro:IPR029756"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB66"
FT                   /inference="protein motif:PFAM:PF01910"
FT                   /protein_id="ACL38551.1"
FT                   /translation="MLLAFSVAPSGTPAEGSSPGDASVHDAVAAAVKIVRDSGLPNKTD
FT                   SMFTTIEGEWDEVFDVVKRATEAVGRYGSRVSLVIKADIRPGYSGELTAKVDRLEEALT
FT                   DGS"
FT   gene            594688..595365
FT                   /locus_tag="Achl_0553"
FT   CDS_pept        594688..595365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0553"
FT                   /product="O-methyltransferase family 3"
FT                   /note="PFAM: O-methyltransferase family 3; KEGG:
FT                   art:Arth_0333 O-methyltransferase, family 3"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38552"
FT                   /db_xref="GOA:B8HB67"
FT                   /db_xref="InterPro:IPR002935"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB67"
FT                   /inference="protein motif:PFAM:PF01596"
FT                   /protein_id="ACL38552.1"
FT                   /translation="MFEHKPRPEWIATEEFLSRVVVHPDHALEQAIRSAAEAGMPAIEV
FT                   APNAGKLLMLLVQLSGARRILEIGTLAGFSTIWMGRGLPANGTLVTCEFLPKHAEVAWA
FT                   NIDFAGLGQKVEIRLGPALETLAALEEEGREPFDFIFIDADKENNSRYLDWAVRLGRRG
FT                   ATVVLDNTIWEGAVLEPDMDPVNAPGIIDALTLLGEHPRLDATVIQTVGSKGWDGFALA
FT                   RIT"
FT   gene            595462..595941
FT                   /locus_tag="Achl_0554"
FT   CDS_pept        595462..595941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0554"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   art:Arth_0334 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38553"
FT                   /db_xref="GOA:B8HB68"
FT                   /db_xref="InterPro:IPR002177"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR023188"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB68"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACL38553.1"
FT                   /translation="MKASPTLASNLQMVLTDLIELHLQGKQAHWNLVGTNFRDLHLQLD
FT                   EIVTAARLFADEVAERMRALHALPDGRSSTVTADNRLAEFPEGLTSTKDTVKLITARLE
FT                   RTVKTMRDVHDDVDDEDPTSADVLHAIIERLEQLAWMVNAETMAPSAAVTEPASK"
FT   gene            596023..597075
FT                   /locus_tag="Achl_0555"
FT   CDS_pept        596023..597075
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0555"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0335 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38554"
FT                   /db_xref="GOA:B8HB69"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB69"
FT                   /inference="similar to AA sequence:KEGG:Arth_0335"
FT                   /protein_id="ACL38554.1"
FT                   /translation="MLLGSTAEQVERFAPGLAAVGGAAGDVPALLQLAVAAGRSWPLPG
FT                   EGRTAQLWELLASVAAVDVAAARVFEPHLDAVAILKQASAIDGAGEGSWGVFAAEGPGL
FT                   RLRATADGTGYVLDGSKPWCSLAGQLDHAVITAHTDDGGRAAFAVDLRHAGVTAEEPEW
FT                   IARGLREIPSGTVHFDHVPAAAVGGSGWYHSRPGFAWGGMGVAACWLGGAVGVARDFRD
FT                   GLRKAAESGREPDQLALAALGETDRIIVAALQYLARAAERVDAAGYAAGNAAGSSSGWS
FT                   EAQRVRGTVAAAVERVLQLVTANRGPAPLAFDAAYAKRVADLALYVRQHHGHRDDAQLG
FT                   SLTLKGDCPW"
FT   gene            597069..598463
FT                   /locus_tag="Achl_0556"
FT   CDS_pept        597069..598463
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0556"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; NodS family protein;
FT                   Methyltransferase type 11; Methyltransferase type 12; KEGG:
FT                   aau:AAur_3424 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38555"
FT                   /db_xref="GOA:B8HB70"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR008715"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB70"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ACL38555.1"
FT                   /translation="MVTFSHADLGTAESAWVAAGLSAAPELPLDSGELAALGFVVLAAH
FT                   PDDETLGAGGLAASLRQLGASVEVLLCTAGEGSHPESATHTPERLAAARLEEFAAALTE
FT                   LGLEGRWRFLGLPDRGLGLHADVIADSVRQAAAKAAGTPAEHRDVVIVAPYRADGHADH
FT                   DALGAVAADVAAEGGHGLLEYPIWYWHWAGPDHSDWRDWMRFHLDPPARQAKDRAMAAH
FT                   ATQVLPLSPAPGDEALLSEGFLQHFARGYEMFAWTPPRKPAEPSHRSGEATEIFDRVHQ
FT                   RTEDPWNYGSSWYEQRKRALTLAALPEATYAAGLEIGCSIGTLTADLAPRCRSLLAVDA
FT                   SGVAVEQARHRLAAAHHVTVEQAVLPAAWPAGSFDLIVVSEVGYYLARDELAAMWDRVE
FT                   AAMQPGGTLVLCHWRHPVAGWELDGESVHALARERLGWRQAGMYRERDFLLEVLVAPGP
FT                   AGTAPA"
FT   gene            598460..599212
FT                   /locus_tag="Achl_0557"
FT   CDS_pept        598460..599212
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0557"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   art:Arth_0337 glycosyl transferase, family 2"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38556"
FT                   /db_xref="GOA:B8HB71"
FT                   /db_xref="InterPro:IPR001173"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB71"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACL38556.1"
FT                   /translation="MTASTGHLVSHLGVVVPAHNEERHLGAALEAVGTAAGVLQGQRPG
FT                   LGVRVLVVLDACTDLSASVAGRFAAADPRFNVLQADFRSVGRSRREGNRAVLAEAGALG
FT                   VPEKEIWIANTDADSRVPAHWLTRQLELAEAGADAVLGSVEPDSDGMDTGLLQRWHARH
FT                   RLQDNHHHVYGANLGVRASAYLAAGGFPATESGEDRSLVRKLRSGGAVIAATDSNRVIT
FT                   SGRLEARAPRGFAGYLLALALDPRGAES"
FT   gene            complement(599276..599533)
FT                   /locus_tag="Achl_0558"
FT   CDS_pept        complement(599276..599533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0558"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_4523 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38557"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB72"
FT                   /inference="similar to AA sequence:KEGG:Arth_4523"
FT                   /protein_id="ACL38557.1"
FT                   /translation="MPANHFEDFLAEAVVPAKEPGLGLGRDELYGLYTSWCLIHKAQLQ
FT                   PPEELWAALKLEGIDPDNNNLSMTGPAAADYIIASAPDLV"
FT   gene            complement(599856..601064)
FT                   /locus_tag="Achl_0559"
FT   CDS_pept        complement(599856..601064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0559"
FT                   /product="ribonuclease BN"
FT                   /note="PFAM: ribonuclease BN; KEGG: art:Arth_0345 putative
FT                   ribonuclease BN"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38558"
FT                   /db_xref="GOA:B8HB73"
FT                   /db_xref="InterPro:IPR017039"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB73"
FT                   /inference="protein motif:PFAM:PF03631"
FT                   /protein_id="ACL38558.1"
FT                   /translation="MATHDASETSTAKAGQAPDPNDSRKPDSPRELDKPNWKYIAKKTL
FT                   REFSKDQCPDLAASLTYYAVLSLFPAILALVSLVGLFGDPQKTTDALLQIVSGFVPGET
FT                   MDTIGGVVKDLANAPAAGFTLVIGLGTALWSASGYVGAFGRALNRVYEVDEGRPFVKLR
FT                   GTMLAVTLLAIVIIAILAGMLVLSGPVAEAVGGFIGLSGVFLAVWNIAKWPVMVVLIIV
FT                   IIAVLYYATPNVKQPKFKWMSMGSGIALVVFLLASLGFGFYVGNFGNYNKTYGALGGVI
FT                   VMLLWLWILNMSLLFGAEFDAETERGRQLQAGIKAEETIQLPPRDTKKSEKLQAQEEED
FT                   IRHGRELREKYAAENGGSGDSQATDAGENAPSEPHRERVRDKVRDRAAHGTPEDDDRGH
FT                   QRH"
FT   gene            complement(601182..601856)
FT                   /locus_tag="Achl_0560"
FT   CDS_pept        complement(601182..601856)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0560"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0346 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38559"
FT                   /db_xref="InterPro:IPR022062"
FT                   /db_xref="UniProtKB/TrEMBL:B8H879"
FT                   /inference="similar to AA sequence:KEGG:Arth_0346"
FT                   /protein_id="ACL38559.1"
FT                   /translation="MSENPDAIRADIEATRARLGTNVDAVADKVTPSNIVHRQTDKVKD
FT                   AVSGVKEKIMGAADHTTTRVQDTLHHGAQSSAGHTTNALHSTGESLHDAKDNVASTLSD
FT                   AGHTVAATPDRVKAKTQGNPLAAGLIAFGAGMLISSLIPASDKERQAADQLKTAAEPLT
FT                   TELTDAAKGMVQDLKEPAQHAMDNVKTTATDGIEHVKTDSQDAATDVKDRATTAKDTIQ
FT                   NT"
FT   gene            complement(601853..602281)
FT                   /locus_tag="Achl_0561"
FT   CDS_pept        complement(601853..602281)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0561"
FT                   /product="protein of unknown function DUF1469"
FT                   /note="PFAM: protein of unknown function DUF1469; KEGG:
FT                   art:Arth_0347 protein of unknown function DUF1469"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38560"
FT                   /db_xref="GOA:B8HB75"
FT                   /db_xref="InterPro:IPR009937"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB75"
FT                   /inference="protein motif:PFAM:PF07332"
FT                   /protein_id="ACL38560.1"
FT                   /translation="MSSQIPESPNVAHQKADNASLGDLLGDVTRDLSTLMRQEVELAKA
FT                   ELKQSATRAGKGGGMLAGAGVAGHFVLIFLSLALMFALGAFMPLGWAAVIVAVIWAITA
FT                   AILASIGRKNLKEIKGLPQTGETLAEIPPTLKPGEVNR"
FT   gene            complement(602281..603291)
FT                   /locus_tag="Achl_0562"
FT   CDS_pept        complement(602281..603291)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0562"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0348 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38561"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB76"
FT                   /inference="similar to AA sequence:KEGG:Arth_0348"
FT                   /protein_id="ACL38561.1"
FT                   /translation="MTENQWPEDPNAVPPANTGIPSERTATTFPTTTTPQTPAPGTGGY
FT                   QADGYQAGNPSGGSKTDAARSEASDVAGQATSAAKDVAHTAKEEAANVAAEAKTNAKDL
FT                   MNQAKTGLTSEAGAQQQKAAQGIRNISDQLHSMATAPEQQGVASDLIRQAAERSSSVAS
FT                   WLESREPGDLLGDVQRFARNKPGTFLLLAAGAGVLAGRLTRSLTAGAPEASSGTGTSGT
FT                   PGRHSGGLQYSGTGYGDQFSESYPPAGGTVPPPPVQLPGPATTTAGYDGGAPGSGYPEP
FT                   ARPASGLDSPQLVEEPWSGNRIAEDPVYDRELADDPLANDPRTRDRSADGESGRL"
FT   gene            603470..604255
FT                   /locus_tag="Achl_0563"
FT   CDS_pept        603470..604255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0660 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38562"
FT                   /db_xref="GOA:B8HB77"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB77"
FT                   /inference="similar to AA sequence:KEGG:Arth_0660"
FT                   /protein_id="ACL38562.1"
FT                   /translation="MGSVETAPWIWIIIAVVVVLLIVVLLMSGRRRKAVQEKREQEHRE
FT                   KAAEIRREAETKEIDAREREAKAARARADAEQAQVNAARLRQEADEKAREAGSLRNEVA
FT                   DHTRKADEIDPDVTTDAGRRGRRADDGAQRTHQSDVASGTAGHAHDERVQDGQAHTTHS
FT                   HDDRAFGGQAATGRDSARDDRIYGDPVYGDHAGSSREADSPGPVAGQGAPGADGGTLAD
FT                   ERRPGEPDPRLERDRQPGGAVDSGADQARRAERNPRDGI"
FT   gene            complement(604276..605319)
FT                   /locus_tag="Achl_0564"
FT   CDS_pept        complement(604276..605319)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0564"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility domain; KEGG:
FT                   art:Arth_0349 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38563"
FT                   /db_xref="GOA:B8HB78"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB78"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL38563.1"
FT                   /translation="MRIVITGASGNAGTALLRNLQGQLTRKPGSLQLAGISRRLPDTSQ
FT                   APYAGVDWHTLDVGLEQHRQKLAAALEGADAVVHLAWQIQPNRDLEQLYRTNVVGTRHV
FT                   LDAARAAGVKQVVCASSVGAYSRSSKDGRRDESWPVEGMQGSHYSRHKAEQEALLDRFA
FT                   ESEPGIAVARLRPGLIFQGDAGSEIGRYFLGPVIPRLLPGRLRIPLLPAPDNLVFQAVH
FT                   ADDVAEAYWRVVDQRASGAFNIAAEPVLDPQELGRILGARRILPVPMWLLHRAAGLAWR
FT                   LRLQPTDSGWVEMAAGAPVMDTRRAQRILGWEAKTSAADAVREVLDGMGTGKGVAPSPV
FT                   LEPRSDP"
FT   gene            605465..606397
FT                   /locus_tag="Achl_0565"
FT   CDS_pept        605465..606397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0565"
FT                   /product="RNA polymerase, sigma 28 subunit, FliA/WhiG
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   Sigma-70 region 4 type 2; KEGG: art:Arth_0350 RNA
FT                   polymerase, sigma 28 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38564"
FT                   /db_xref="GOA:B8HB79"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB79"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACL38564.1"
FT                   /translation="MPESFSPAAVDSPYIHEVQSTPIQKTASPHDSQARSGQLRETFEN
FT                   DLVLGYLDLAEALAARFEARGRERADLNQVAYLGLVKAARGFDRSKGESFPAYAAPTIT
FT                   GELKRYLRDRTWVVRPPRNIQDLRTRLFRAEPELTQALGRSPSVEELAGELETDPAAVQ
FT                   EAMSASSSMHPDSLDAVNPNSDAPSIGDMLACPDTPLERLEELACLRDAMHDLAPADRE
FT                   LLYRRYFCEETQVQLGKRLGMSQMQVSRRLARVLVELQHRLENSSRLDEPSGGCPGTPA
FT                   SLGRAQAQRARHSQPERARRRGFGRPSTP"
FT   gene            606553..607089
FT                   /locus_tag="Achl_0566"
FT   CDS_pept        606553..607089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0566"
FT                   /product="hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; HAD-superfamily hydrolase, subfamily IA, variant
FT                   1; histidinol-phosphate phosphatase family protein;
FT                   hydrolase, HAD-superfamily, subfamily IIIA; KEGG:
FT                   art:Arth_0352 hydrolase, HAD-superfamily, subfamily IIIA"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38565"
FT                   /db_xref="GOA:B8HB80"
FT                   /db_xref="InterPro:IPR004446"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR006543"
FT                   /db_xref="InterPro:IPR006549"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB80"
FT                   /inference="protein motif:TFAM:TIGR01662"
FT                   /protein_id="ACL38565.1"
FT                   /translation="MVSPATAKIRAVLFDRDGTLVVDVPYNGNPALVRPVPGAREVLDA
FT                   LRARGIATGVVSNQSGIARGLISEDDVASVNARVEELLGPFDVWEVCPHSDQDNCSCRK
FT                   PAPGMVHSACRKLGIDESEAVLIGDIGADVLAAEAAGATGVLVPTPVTRAEEVAAARLV
FT                   ARDLAGAVGLLREAP"
FT   gene            607089..608177
FT                   /locus_tag="Achl_0567"
FT   CDS_pept        607089..608177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0567"
FT                   /product="glycosyl transferase family 9"
FT                   /note="PFAM: glycosyl transferase family 9; KEGG:
FT                   art:Arth_0353 glycosyl transferase, family 9"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38566"
FT                   /db_xref="GOA:B8HB81"
FT                   /db_xref="InterPro:IPR002201"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB81"
FT                   /inference="protein motif:PFAM:PF01075"
FT                   /protein_id="ACL38566.1"
FT                   /translation="MGQVLVARLDSMGDVLLAGLAVRAVANGRVPDGSGANHVVMLCGR
FT                   QGEAAAGILPGAAEVYSWDSPWIMNPAPKMTGPHADRLIEYVRNSRITEAVILTSFHQS
FT                   PLPLALLLRLAGVERITGASTDFAGSLLDVRLKPGEDFPEDQPEAERALGIAEAAGFRL
FT                   PQGDDGKLRITPGPDVQDLVGEGPYVVVHPGAAVPARAWPPLHHAAAVELLQGAGHRVV
FT                   VTGGPGETSLTATVAGPSALDLGGRTDVHTLAGVMAGADAVVTGNTGPAHLAAAVGTPV
FT                   ACLFSPVVPAVRWAPYGVPLELLGDQNAACRLTRARICPVPGHPCLDSVSPEEVVAAVE
FT                   RLISGVSSLSTHVSTRRKARNR"
FT   gene            608174..609202
FT                   /locus_tag="Achl_0568"
FT   CDS_pept        608174..609202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0568"
FT                   /product="transferase"
FT                   /note="KEGG: art:Arth_0354 transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38567"
FT                   /db_xref="GOA:B8HB82"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB82"
FT                   /inference="similar to AA sequence:KEGG:Arth_0354"
FT                   /protein_id="ACL38567.1"
FT                   /translation="MRILLWHVHGSWTDAFVRGRHEYLLPVLPEGGPWGLGRAGRNWPD
FT                   TVREVDLATLDADAVDAVVLQRPEEISEVSQVLGRTPGVDLPAVFVEHNTPKGDFPFTR
FT                   HPLADQNTIPLVHVTHFNRLAWDNGSAVSTVIEHGIPDPGQLYTGELPDLGVVVNEPVR
FT                   RGRVTGTDLLPAFAEVAPLQVFGMKTEGLAAAAGIGTERLTPRGDLKTQELHRELARCR
FT                   VYLHPMRWTSLGLSLLEAMHLGMPVVVLAATEAPRAVPPEAGAVSADIEELLRCARKLV
FT                   ANPEEARRRGVAAREAALARYGLGKFQDSWDGLLADLGRRPSARRRPDGQIPVSAQERK
FT                   SA"
FT   gene            609199..610467
FT                   /locus_tag="Achl_0569"
FT   CDS_pept        609199..610467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0569"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   art:Arth_0355 glycosyl transferase, group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38568"
FT                   /db_xref="GOA:B8HB83"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB83"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL38568.1"
FT                   /translation="MKIAMISEHASPLAALGGVDAGGQNVHVAALSEALARRGHQVTVY
FT                   TRRDATELPARVSVGPGFDVVHVDAGPPRHVPKDELLPFMGELADGVARDWDHRPPDVV
FT                   HGHFWMSGLAALDAARRAGSGYRVPVIQTFHALGTVKRRHQGAEDTSPQERRWLEPGVG
FT                   RSADRIIATCSDEVFELKAMGINTGKISIAPCGVDLDVFGPDGPVDAKPRSHRILSVGR
FT                   LVPRKGVDLVIRALPHLRAAGFADVELLIVGGGGDSGTLHSDPEVRRLLGLAAELGVQD
FT                   QVVMEGQVPRGDMPGIFRSADAVVCAPWYEPFGIVPLEAMACGVPVVAAAVGGLRDTVV
FT                   DHGTGLHVPPRDPEAIASALAMLLGNPSLRAELGNAGQRRARARYSWDRVAAESEKAYK
FT                   LAVAGAAAGAAGPAAIPLEGAAL"
FT   gene            610464..611168
FT                   /locus_tag="Achl_0570"
FT   CDS_pept        610464..611168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0570"
FT                   /product="sugar isomerase (SIS)"
FT                   /note="PFAM: sugar isomerase (SIS); KEGG: art:Arth_0356
FT                   phosphoheptose isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38569"
FT                   /db_xref="GOA:B8HB84"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035461"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB84"
FT                   /inference="protein motif:PFAM:PF01380"
FT                   /protein_id="ACL38569.1"
FT                   /translation="MTAESSLRDIDLAHLAMAPALPAVLPGAAYVDSASADAVRLHLDN
FT                   VVPALESLRSQSGRLAAWGVELAQRMLRGQRLLAAGNGGSAAEAQHLTAELVGRFDGER
FT                   VPFSAISLHAETSAITAIANDYGYDDVFARQVRAHGRSGDLLILLSTSGKSPNLLRAAE
FT                   AASRLNITTWALTGAGPNPLAAACDEAVMIDALNANAQEGHLIALHAVCRAFDLEVARR
FT                   HPASTLQQDGRP"
FT   gene            611165..612625
FT                   /locus_tag="Achl_0571"
FT   CDS_pept        611165..612625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0571"
FT                   /product="rfaE bifunctional protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   rfaE bifunctional protein; PFAM: cytidylyltransferase; PfkB
FT                   domain protein; KEGG: art:Arth_0357
FT                   cytidyltransferase-related domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38570"
FT                   /db_xref="GOA:B8HB85"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB85"
FT                   /inference="protein motif:TFAM:TIGR02199"
FT                   /protein_id="ACL38570.1"
FT                   /translation="MRIVVVGDVMLDVDLSGEATRLSPDAPVPVVDVYGIRSRAGGAGL
FT                   VARMLAGEGWPVTLVTVFGDDDAGRQLRDHLEGVRVVSGPSGHPTPVKTRVRAGSQAVV
FT                   RVDQGCGKPPVPGISAGMLRAVEEAGAIIVADYGRGMAANPELRHLLARRTAEVPVIWD
FT                   PHPSGPDPVPGVAVVTPNLAEATKAAAAFASSAPGDGAPGGPAAVVGRILLERWQSAAV
FT                   LVTKGAEGAVLLQRDSVSPLDVPAPRVEAGDPCGAGDRLAAGLAVHLLAGSALPEAAEL
FT                   AVNDAADFLGAGGVAALPDRGSGHGLPREGGGYTPASPGAPAAQPEDGPTPLHRSAEPL
FT                   LLARAVRGNGGTVVATGGCFDLLHAGHVRSLAAARKLGDCLIVCLNSDSSVRRLKGPER
FT                   PIISQQDRAELLLAMECVDAVMVFDEDTPEAALDRLRPDLWVKGGDYKGSRLPEAELVE
FT                   SWGGRCVTVPYHPARSTTGLADALAKVG"
FT   gene            612704..613405
FT                   /locus_tag="Achl_0572"
FT   CDS_pept        612704..613405
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0572"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: art:Arth_0358 short-chain dehydrogenase/reductase
FT                   SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38571"
FT                   /db_xref="GOA:B8HB86"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB86"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL38571.1"
FT                   /translation="MTADANNPGRVLVTGGASGLGAAVVEAVLKAGGTPVVLDRDISSV
FT                   SGVKAFEVDVADRPAVEAAVREAADTVGGLDGVVTAAGIDRCGKLADVEATEWEKVIGV
FT                   NLMGTVSVVRAALPYLKDTHGRVITVASTLGKRAVADATAYCASKFGVVGFSHALAAET
FT                   GGEIGVTTIIPGGMKTRFFDDRTEQYKPQDDSRLNDPANTAQAILFALNQPRGCEIREM
FT                   LICHEEEGSWP"
FT   gene            613472..614899
FT                   /locus_tag="Achl_0573"
FT   CDS_pept        613472..614899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0573"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: art:Arth_0360
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38572"
FT                   /db_xref="GOA:B8HB87"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB87"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL38572.1"
FT                   /translation="MPTTAIDTAAGPDTAGSGGITITDPRTGEVLWTVPEAAPEAVNHA
FT                   VEVARRATPEWAATAPEDRGAALKAAARALDTAAQELAGLNASETGRPVEEALAGIGAA
FT                   VSTLEQYAELAPVHRGHSLRGNRLAADYTVAEPRGVAVLLTPWNDPVAVACGLIGAALA
FT                   TGNTVIHKPSERCPRLGEALGEVLAPAFPPGVFLTVSGGAGVGALLSQSEVDVLAHVGS
FT                   SASGARIARAGALTGAHVIRENGGNDPLLVDRDVDPAWAAEQAAIGSFSNSGQICTAVE
FT                   RIYVHRDIAEDFTAALRAEAARRNADGSVAPLVDTRMRDAVHAQVSEALAAGAAAVEGG
FT                   ELPAGPGSFYPATVLVGCTARMQVMTEETFGPVAPVQVVDTFDDGLRLACSGKYGLAAT
FT                   VLSSNIAHIQQAVAALPVGTVKVNAVFGGAPGGAAQPRGDSGAGFGYGPELLDEFSQVK
FT                   VVHIAAPPAPPAGQGRP"
FT   gene            614896..616446
FT                   /locus_tag="Achl_0574"
FT   CDS_pept        614896..616446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0574"
FT                   /product="cytidyltransferase-related domain protein"
FT                   /note="TIGRFAM: cytidyltransferase-related domain protein;
FT                   PFAM: cytidylyltransferase; PfkB domain protein; KEGG:
FT                   art:Arth_0361 D-beta-D-heptose 1-phosphate
FT                   adenylyltransferase / D-alpha,beta-D-heptose 7-phosphate
FT                   1-kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38573"
FT                   /db_xref="GOA:B8HB88"
FT                   /db_xref="InterPro:IPR002173"
FT                   /db_xref="InterPro:IPR004821"
FT                   /db_xref="InterPro:IPR011611"
FT                   /db_xref="InterPro:IPR011914"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR029056"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB88"
FT                   /inference="protein motif:TFAM:TIGR00125"
FT                   /protein_id="ACL38573.1"
FT                   /translation="MSLTPETADLSTQRALAEWLPGRLAKEQPSVLVIGDLMLDGWWSG
FT                   TIERLCREAPAPVVDIAIRDSFPGGAANTAMNLAALGARVSVAGIIGTDDAGVDLRRQL
FT                   EAAGIDVRHLHSHPDMVTTTKIRISSGGQVMLRIDDAARTVPTEALAGLASSVRAAVER
FT                   QDAVLVCDYGNGVLADPVQESLAAALATAGNAGKRRPLVVVDSHDPRPWAPLRPDLVTP
FT                   NAQEAARLLDVRLPDGPDRADTVTGQAPALLAATGAAAVVVTLDRDGTVLIRPDGATHR
FT                   TWARPAAEKQASGAGDTFVAALTLARSAGLPLTASLDLAQSAADVVVHQPGTSVCSTSQ
FT                   LSRYLAAFADTALGAEELKQQLDLHRSEGQRIVLTNGCFDVLHSGHTRYLNQAKQLGDV
FT                   LVVALNSDDSVSRLKGPGRPINAVADRAAVVAALSCVDYVTVFDTPTAEPLIRQLHPDV
FT                   YAKGGDYTPEMLAETSAVEESGGRVATLDYVAERSTTAVVNRIRGGQGTATALQGSGE"
FT   gene            616500..617450
FT                   /locus_tag="Achl_0575"
FT   CDS_pept        616500..617450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0575"
FT                   /product="putative spermidine synthase"
FT                   /note="KEGG: art:Arth_0362 putative spermidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38574"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB89"
FT                   /inference="similar to AA sequence:KEGG:Arth_0362"
FT                   /protein_id="ACL38574.1"
FT                   /translation="MAKRGRAGGRGRAVAGVVDSQASGSKGPVEGVYYVDTGDCELIAD
FT                   QDNSTGWLLKINGVMSSHIDLADPLFLDFEYMRWIAALIESRWPPQEASSVRAGGADGP
FT                   GKLRGLHLGGGACSLARYFSAAYPDARQVVVELDGKLAGYVRDWFDLPKAPLLRIRVGE
FT                   AREVTETLTADTRDFIIRDVFAGSFTPRPLTTAEFSQHVRRVLAPGGMYVVNSGDAPDL
FT                   KNAREDAATIAASFEHTLIIADPAMLKGRRYGNMVMAGSDVPFGDDPKLARRLLGGAVP
FT                   AHVWDDAQVRAFATGTPVRHDPPAPVVEPVETAGD"
FT   gene            complement(617482..618423)
FT                   /locus_tag="Achl_0576"
FT   CDS_pept        complement(617482..618423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0576"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: art:Arth_0364 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38575"
FT                   /db_xref="GOA:B8HB90"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB90"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL38575.1"
FT                   /translation="MTKAAPTVCTIADMNANPDDLLVLLEVSRSAKFTTAAQALGLNHT
FT                   TVSRRIAALEKSLGGRVLARAAGGWELTELGERAVRVAEQVEEVLATLGPGGRAPDPIT
FT                   GVVRMTATDGFSAYIAAPAVARLRRKHPGLSVEVVTMTRRALQQRSGLDIEVVVGEPQV
FT                   HRAEAVRLGEYMLGMYASRAYLAEHGTPGTVAELNDHPLVYFVDSMLQVDDLDAPRRLV
FT                   PAMRDGLTSTNVFVHVEATRAGAGIGFLPCFMGDLHDDLVRLLPDRIAELLPYWMVLRP
FT                   DSMRRPAVAAVVQALRDQVTMHRDALLGRSAR"
FT   gene            618516..619898
FT                   /locus_tag="Achl_0577"
FT   CDS_pept        618516..619898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0577"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: art:Arth_0365 general
FT                   substrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38576"
FT                   /db_xref="GOA:B8HB91"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB91"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /protein_id="ACL38576.1"
FT                   /translation="MSVGERPANQAAGTPTKGGGLKKIVAASMVGTVVEWYEFFLYATA
FT                   ATLVFGKYFFPSTGNELDGIIQAFITYAVGFVARPLGGIVFGQIGDKLGRKPTLQLTIV
FT                   IIGVSTFLMGCLPGFADIGYLAPALLVFLRFIQGFALGGEWGGAVLLVAEHSPNKSRAF
FT                   WSSWPQAAVPVGNLLATLVLYIMSSTLSSEAFLGWGWRVAFWLSAVIVFVGYYIRRHVS
FT                   EAPIFLEAKELVEKEQAVSYGVGEVIRKYPKGILQAMGLRFAENIMYYLVVSFAIVYLK
FT                   SVHKYDTSSLLLALLIAHVIHFLVIPQVGRLVDRWGRKPVYLVGAITGATWPFFAFPMF
FT                   DTRNAVVIVLAVTIGLCLHAFMYAGQPAIMAELFPTRMRYAGVSLGSQVTSIFAGSLAP
FT                   LLATQWLKDTGSWLPTAIYLVVACAITAFAVLSLRETKGIALQDVDKADAAREGLLNAS
FT                   AR"
FT   gene            619945..620694
FT                   /locus_tag="Achl_0578"
FT   CDS_pept        619945..620694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0578"
FT                   /product="3-hydroxybutyrate dehydrogenase"
FT                   /note="TIGRFAM: 3-hydroxybutyrate dehydrogenase; PFAM:
FT                   short-chain dehydrogenase/reductase SDR; KEGG:
FT                   art:Arth_0366 3-hydroxybutyrate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38577"
FT                   /db_xref="GOA:B8HB92"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB92"
FT                   /inference="protein motif:TFAM:TIGR01963"
FT                   /protein_id="ACL38577.1"
FT                   /translation="MEHELNGRKALVTGGAGGIGAACVRELAARGAKVVVADVDAAAAA
FT                   ALADEVGGTSWAVDLLDVDSLGTLSLDCDILVNNAGIQRISPIEEFDPVQFRRILALML
FT                   EAPFLLVRAALPHMYANKFGRIINLSSVHGLRASPFKSAYVSAKHGLEGLSKVTALEGG
FT                   EHGVTSNCVNPGYVRTPLVEKQIADQAAVHGIPESEVLAKVMLTEAAVKRLVEPEEVAS
FT                   LVAWLASDHAGMVTGASYTMDGGWSAK"
FT   gene            complement(620762..621025)
FT                   /locus_tag="Achl_0579"
FT   CDS_pept        complement(620762..621025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0579"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: art:Arth_0368 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38578"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB93"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38578.1"
FT                   /translation="MDSSDVQDLSGMGRPISLGSAVALGWGRAVEALRPRSPYRIGDAV
FT                   LGDDPFNGRHEGTVVTQDGTTVGVKTTRGLFFYDHRQLRRLD"
FT   gene            complement(621287..621664)
FT                   /locus_tag="Achl_0580"
FT   CDS_pept        complement(621287..621664)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0580"
FT                   /product="transcriptional regulator, HxlR family"
FT                   /note="PFAM: helix-turn-helix HxlR type; KEGG: cms:CMS_2972
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38579"
FT                   /db_xref="InterPro:IPR002577"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB94"
FT                   /inference="protein motif:PFAM:PF01638"
FT                   /protein_id="ACL38579.1"
FT                   /translation="MDATLQPVPLPPSFSDGVFPAGCPSRTLLDHVTSKWGVLILTALS
FT                   EGSQRWSELRRRAEGISEKMLAQTLKTLERDGLVSRDAQPVIPPRVDYSLTERGYELSA
FT                   LLVPLVAWTFDNAEEIINGRA"
FT   gene            621800..622666
FT                   /locus_tag="Achl_0581"
FT   CDS_pept        621800..622666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0581"
FT                   /product="NmrA family protein"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein;
FT                   KEGG: krh:KRH_16940 putative NAD(P)H--quinone
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38580"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB95"
FT                   /inference="protein motif:PFAM:PF05368"
FT                   /protein_id="ACL38580.1"
FT                   /translation="MSIVVTGATGQLGRHVLEALLERNVPAGDIVAAGRSVDKLADFAA
FT                   KGVRVVSVDYSDADSVAAALKGATRILLISGSEVGQRVEQHRTVIEAAKAEGGVELLAY
FT                   TSIANADTTGMKLADEHKATEELLRESGVPFALLRNGWYLENYTEQLPGTLAQGAIAGS
FT                   AGDGKVSGASRQDYAQAAAAVLVADGQAGKVYELGGDHAFSMADLAAEITAATGTDISY
FT                   NNMPSGNYAGLLAQVGVPQAFAEILADSDLGIARGDLLVTTGDLQKLIGRPTTSLAEAV
FT                   RSAAASA"
FT   gene            complement(622732..623367)
FT                   /locus_tag="Achl_0582"
FT   CDS_pept        complement(622732..623367)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0582"
FT                   /product="Lysine exporter protein (LYSE/YGGA)"
FT                   /note="PFAM: Lysine exporter protein (LYSE/YGGA); KEGG:
FT                   art:Arth_0367 lysine exporter protein (LysE/YggA)"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38581"
FT                   /db_xref="GOA:B8HB96"
FT                   /db_xref="InterPro:IPR001123"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB96"
FT                   /inference="protein motif:PFAM:PF01810"
FT                   /protein_id="ACL38581.1"
FT                   /translation="MVPASSLLAFALASVVLIAVPGPSVLFVIGRSLALGWRGGVLTVL
FT                   GNACGQLLQVAAVALGVGVLVAESVLLFSAVKFAGAAYLIYLGVQAIRHRTDPAGPESR
FT                   ATSARPRRLVAEGAVVGATNPKSVVFFVAVLPQFVDYPAGSIPLQLGVLGAVFLIIAVV
FT                   SDSLWAMAAGTAREWFARSPRRVSSVKATGGALMIGLGGTLALTGSKS"
FT   sig_peptide     complement(623308..623367)
FT                   /locus_tag="Achl_0582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.960 at
FT                   residue 20"
FT   gene            complement(623474..624961)
FT                   /locus_tag="Achl_0583"
FT   CDS_pept        complement(623474..624961)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0583"
FT                   /product="amino acid permease-associated region"
FT                   /note="PFAM: amino acid permease-associated region; KEGG:
FT                   art:Arth_0369 amino acid permease-associated region"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38582"
FT                   /db_xref="GOA:B8HB97"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB97"
FT                   /inference="protein motif:PFAM:PF00324"
FT                   /protein_id="ACL38582.1"
FT                   /translation="MQQAPSPTRNESRAGQQTPAAAVGSVLNRGLNVRHIRFMALGSAI
FT                   GTGLFYGSASAIQKAGPAVLLAYIIGGAAVFMVMRALGEMAVRHPVSGSFGQYASRYLG
FT                   PLAGFVTGWTYVFEMAIVAIADVTAFSIYMGFWFPQVDRWIWILAIICFLAALNLLSVK
FT                   VFGELEFWFSLIKVAAIIAMIAGGAAIIAFGFQAGGSTVAPGLGNLVEHGGLFPNGFGG
FT                   LLASFAVVMFAFGGIETLGITAGEAADPKKVIPKAVNTVPVRVLLFYVLTLGVLMSLFP
FT                   WNEVGTSGSPFVQIFSGLGIPAAPHILNAVVITAALSAINSDIFGAGRILFGLSRQGHA
FT                   PAAFGKVSRHGVPWMTVVMMTAILLVGVVLNAVIPEDVFLVIASIATFATVWVWVMILA
FT                   SHVAMKREIKHSGLPASEFPSPWWPAASVLTIAFMVLVIGVLGAFEDTRIALYVGAAWL
FT                   GLLVLGYRLWVKGDGRRRAHLEDETSPLPVVQPAART"
FT   gene            625188..626711
FT                   /locus_tag="Achl_0584"
FT   CDS_pept        625188..626711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0584"
FT                   /product="HNH nuclease"
FT                   /note="SMART: HNH nuclease; KEGG: art:Arth_0370 HNH
FT                   nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38583"
FT                   /db_xref="InterPro:IPR003615"
FT                   /db_xref="InterPro:IPR003870"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB98"
FT                   /inference="protein motif:SMART:SM00507"
FT                   /protein_id="ACL38583.1"
FT                   /translation="MGKSAVVRALEEIDAALAVLNAEVDGAGCEPFSAADPLAGLAGGC
FT                   LDILAGARAVEAGVAGLKAKAAVAYAESASAVAGPVVPAHSQEMSAAAEVGCVLALGPR
FT                   AASSFLATSHALVATLPLTLAGLQAGALSWDHAVVMADEAAGLDTVGAAALEAHFLNPG
FT                   APDAARGCPVGELPAHRFRVKARTWRERHHAESIEARHAKGVAERRAEYRPDRDGMAWL
FT                   SAYLPASQASAVWDRLTSEARALQGPHERRTLAQLRADNYATALLATYPAPGATNRTRP
FT                   DSDGSGAMAGAAAGAVAGGVSAPIRAQVLVTVPVFSLLGLTDEPAVLDGYGPIPPSMAR
FT                   NLVAGGAGSFYRVLVDPRDGAPLEIGRTSYRLTKAMRAWLRLRDGKCPFPGCSNHSLDN
FT                   DADHILSWANGGTTGISNLGQPCPKHHRLRHTTAWKPTPAGLNKPPGWVSPAGRHYPCE
FT                   PQDWEPPHRPQQLETISTPGGQDGGHPQHSCTGLSPAEEVFERVLRPPA"
FT   gene            complement(626856..627464)
FT                   /locus_tag="Achl_0585"
FT   CDS_pept        complement(626856..627464)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0585"
FT                   /product="protein of unknown function DUF664"
FT                   /note="PFAM: protein of unknown function DUF664; KEGG:
FT                   art:Arth_3852 protein of unknown function DUF664"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38584"
FT                   /db_xref="InterPro:IPR007061"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:B8HB99"
FT                   /inference="protein motif:PFAM:PF04978"
FT                   /protein_id="ACL38584.1"
FT                   /translation="MGRVRFMDEKETLHHYLRVRRDNLLGKLDGLGEYDCRRPLTPTGT
FT                   NLLGLVKHVASVELDYFGVVFDRPSGRSLPWLDDDALPDADMWVAADESLHDIVELHRF
FT                   AGEHSDATIEALTLDARGSVPWWPEERRQVTLHQILVHMVAERAHHLGHADILRELIDG
FT                   TAGQRPGDPNLTSRSPEEWAAHRTEIEAAARTAAGTAPE"
FT   gene            complement(627511..628230)
FT                   /locus_tag="Achl_0586"
FT   CDS_pept        complement(627511..628230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0586"
FT                   /product="Methyltransferase type 12"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: bph:Bphy_2128 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38585"
FT                   /db_xref="GOA:B8HBA0"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR041698"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA0"
FT                   /inference="protein motif:PFAM:PF08242"
FT                   /protein_id="ACL38585.1"
FT                   /translation="MNDYDPRLVDMYDQDNPDGPDHDFYRGLADEVAARNVLDLGCGTG
FT                   ILTVTLASAARTVVGVDPSASMIGFARNRPGAAQADWVVGDSRSIPGTGYDFAVMTGNV
FT                   VQAIPGAAWSRTLRDLRLAMAHGGTLAFESRNPAVRASNNWAFEDKRRESLHGPLIERR
FT                   TVSTPAPGIVKLQTSTTFAATGESIHETQLLEFRHSTTITRDLEEAGFAVEATYGDWTR
FT                   TPFADDAPIMVFVCRAV"
FT   gene            628389..629222
FT                   /locus_tag="Achl_0587"
FT   CDS_pept        628389..629222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0587"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein ArsR; regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: art:Arth_0373
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38586"
FT                   /db_xref="GOA:B8HBA1"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA1"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL38586.1"
FT                   /translation="MVAMDTVPGAAEQSAREARPASKVPAAENTLRILKLLASRRRPMA
FT                   ASQIASSLGLPRSSVYHLLGVMEANGFVLHLHEEQRYGLGISAFELSSAYSRQEPLSRL
FT                   GRPLLASLVDALGESAHLAVLHGRDVLYIVEERAKNRPSLVTDVGVRLPSHLTASGRAI
FT                   LAALPKSQVRALYPNAAAFTARHETESPIMKYSALSSHLDQVRQRGYATEHGEVTPGFG
FT                   SIAAAVTDHLGWPTAAVAVTFLEEKLAADSWPVLAARVQKVANELSVRIHGRPAT"
FT   gene            629434..631176
FT                   /locus_tag="Achl_0588"
FT   CDS_pept        629434..631176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0588"
FT                   /product="urocanate hydratase"
FT                   /EC_number="4.2.1.49"
FT                   /note="KEGG: art:Arth_0374 urocanate hydratase; TIGRFAM:
FT                   urocanate hydratase; PFAM: Urocanase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38587"
FT                   /db_xref="GOA:B8HBA2"
FT                   /db_xref="InterPro:IPR023636"
FT                   /db_xref="InterPro:IPR023637"
FT                   /db_xref="InterPro:IPR035085"
FT                   /db_xref="InterPro:IPR035400"
FT                   /db_xref="InterPro:IPR035401"
FT                   /db_xref="InterPro:IPR036190"
FT                   /db_xref="InterPro:IPR038364"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA2"
FT                   /inference="protein motif:TFAM:TIGR01228"
FT                   /protein_id="ACL38587.1"
FT                   /translation="MAPADFTTGARPVKAARGTELTAKSWQTEAPLRMLMNNLDPEVAE
FT                   RPDDLVVYGGTGRAVRSWTAFDAITRTLETMEKDETLLVQSGKPVGVFRTHEWAPRVLL
FT                   ANSNLVGDWATWPEFRRLEAEGLLMYGQMTAGSWIYIGTQGILQGTYETFAAVGRKLAD
FT                   AGQNTARHPAPAAEGSTEGPLAGTLTLTGGCGGMGGAQPLAVTLNDGACLIIDVDETRL
FT                   RRRAGKRYLDEVETDLDAAIAKVLKAKEERRGWSVGYVGNAAEIFPELLRRHKAGELTV
FT                   DVVTDQTSAHDPLSYLPEGISVEEWHREAEADPEGFTKKAQASMARHVQAMVEFQDAGA
FT                   EVFDYGNSIRDEARKGGYTRAFEFPGFVPAYIRPLFCEGLGPFRWVALSGDPEDIRVTD
FT                   EAIKELFPENKHLHKWIDAAQERVEFEGLPARICWLGYGERAKAGLLFNRLVKEGKVKA
FT                   PIVIGRDHLDSGSVASPYRETEAMADGSDAIADWPLLNALLNTSSGATWVSIHHGGGVG
FT                   IGRSIHAGQVSVADGTDLAAEKLERLLTNDPGMGVIRHVDAGYDRAAEVAKERGVRIPM
FT                   QENL"
FT   gene            631282..632874
FT                   /locus_tag="Achl_0589"
FT   CDS_pept        631282..632874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0589"
FT                   /product="histidine ammonia-lyase"
FT                   /EC_number="4.3.1.3"
FT                   /note="KEGG: art:Arth_0375 histidine ammonia-lyase;
FT                   TIGRFAM: histidine ammonia-lyase; PFAM:
FT                   phenylalanine/histidine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38588"
FT                   /db_xref="GOA:B8HBA3"
FT                   /db_xref="InterPro:IPR001106"
FT                   /db_xref="InterPro:IPR005921"
FT                   /db_xref="InterPro:IPR008948"
FT                   /db_xref="InterPro:IPR022313"
FT                   /db_xref="InterPro:IPR024083"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA3"
FT                   /inference="protein motif:TFAM:TIGR01225"
FT                   /protein_id="ACL38588.1"
FT                   /translation="MTAITHEPLIVTLGSAGVTPGDVLAVARHNAKVTISQDALDTVAR
FT                   VRAHIDGLAASDIPAYGISTGFGALANRHIPNDLRTQLQKSLIRSHAAGMGPAVEREVV
FT                   RGIMFLRAKTLASGRTGVRPVVLQTMVDVLNAGITPVVREFGSLGCSGDLAPLSHCALV
FT                   LMGEGEAEGPDGVRYGGRGEEPVAGLLAKHGIEPVILAEKEGLALVNGTEGMLGMLLMA
FT                   IADLRQLLTTADITAALSVEALLGTDQVFLPELHAALRPHPGQAASADNMLRVLSNSPI
FT                   VASHRVGDSKVQDAYSLRCAPQVAGAVRDTVDHAELVASRELAAAIDNPVVLPDGRVSS
FT                   NGNFHGAPVAYVLDYLAIAVADLSSIAERRTDRMLDPARSHGLPAFLAADPGVDSGLMI
FT                   AQYTQAGLVSDNKRLAVPASVDSIPSSAMQEDHVSMGWHAARKLRKAVENLRRVLSIEL
FT                   VTSARALDMRTQLSGGALTPGPAGTAVVAALRTVVDGPGTDRFLSPELEAADRLVSSGD
FT                   VLRAAESAVGSLA"
FT   gene            complement(633104..633277)
FT                   /locus_tag="Achl_0590"
FT   CDS_pept        complement(633104..633277)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0590"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38589"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL38589.1"
FT                   /translation="MLGAADLHTVGFEEKLLLRRAGRYKPQDVPALGDFFHLTGGYHMR
FT                   MLHDLDVVANLE"
FT   gene            complement(633386..633646)
FT                   /locus_tag="Achl_0591"
FT   CDS_pept        complement(633386..633646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: art:Arth_0377 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38590"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA5"
FT                   /inference="similar to AA sequence:KEGG:Arth_0377"
FT                   /protein_id="ACL38590.1"
FT                   /translation="MSTATLERRPAATGLADASAHRSIDLEFSSASEVHAGLENAVAEL
FT                   IGVAAQDASCGILVTRLYPGRYTVALDESVPFGQTFEAIAA"
FT   gene            633832..634701
FT                   /locus_tag="Achl_0592"
FT   CDS_pept        633832..634701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0592"
FT                   /product="5-oxopent-3-ene-1,2,5-tricarboxylate
FT                   decarboxylase"
FT                   /EC_number="4.1.1.68"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   aau:AAur_3802 putative 2-hydroxyhepta-2,4-diene-1,7-dioate
FT                   isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38591"
FT                   /db_xref="GOA:B8HBA6"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA6"
FT                   /inference="protein motif:PRIAM:4.1.1.68"
FT                   /protein_id="ACL38591.1"
FT                   /translation="MKIMRLGNAGEEQPAVLVPAADGTDRYFSLLPLTTDVDGSFLAAG
FT                   GLDRVREALAAGELPVLENAGDLRIGAPLARPGSVVGIGMNYAAHAAESGSAPPEIPVV
FT                   FLKPANTVTGPCDPAPIPPHSLKYDWEVELGIVIGKEASYLGSEEEARECIAGYVTAND
FT                   LSEREYQIPGAAGQWTKGKSLPGSTPLGPWLVPAGDVDAGNLALGSWVNGDVRQDSSTG
FT                   GLIFSPATLVHHCSQYMRLEPGDVIITGTPEGVALSGRFPYLQPGDVVEVEVEGLGRQR
FT                   QELYRAGA"
FT   gene            complement(634729..635121)
FT                   /locus_tag="Achl_0593"
FT   CDS_pept        complement(634729..635121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Achl_0593"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: art:Arth_1392 UspA
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Achl_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACL38592"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B8HBA7"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="