(data stored in ACNUC7421 zone)

EMBL: CP001348

ID   CP001348; SV 1; circular; genomic DNA; STD; PRO; 4068724 BP.
XX
AC   CP001348; AAVC01000000-AAVC01000121;
XX
PR   Project:PRJNA17419;
XX
DT   15-JAN-2009 (Rel. 99, Created)
DT   30-AUG-2017 (Rel. 134, Last updated, Version 4)
XX
DE   [Clostridium] cellulolyticum H10 chromosome, complete genome.
XX
KW   .
XX
OS   Ruminiclostridium cellulolyticum H10
OC   Bacteria; Firmicutes; Clostridia; Clostridiales; Hungateiclostridiaceae;
OC   Ruminiclostridium.
XX
RN   [1]
RP   1-4068724
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Saunders E., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ivanova N., Zhou J., Richardson P.;
RT   "Complete sequence of Clostridium cellulolyticum H10";
RL   Unpublished.
XX
RN   [2]
RP   1-4068724
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Chertkov O., Saunders E., Brettin T.,
RA   Detter J.C., Han C., Larimer F., Land M., Hauser L., Kyrpides N.,
RA   Ivanova N., Zhou J., Richardson P.;
RT   ;
RL   Submitted (06-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; 737c08bf7e99d9dd3c594c310482aa4d.
DR   BioSample; SAMN00623037.
DR   EnsemblGenomes-Gn; Ccel_R0001.
DR   EnsemblGenomes-Gn; Ccel_R0002.
DR   EnsemblGenomes-Gn; Ccel_R0003.
DR   EnsemblGenomes-Gn; Ccel_R0004.
DR   EnsemblGenomes-Gn; Ccel_R0005.
DR   EnsemblGenomes-Gn; Ccel_R0006.
DR   EnsemblGenomes-Gn; Ccel_R0007.
DR   EnsemblGenomes-Gn; Ccel_R0008.
DR   EnsemblGenomes-Gn; Ccel_R0009.
DR   EnsemblGenomes-Gn; Ccel_R0010.
DR   EnsemblGenomes-Gn; Ccel_R0011.
DR   EnsemblGenomes-Gn; Ccel_R0012.
DR   EnsemblGenomes-Gn; Ccel_R0013.
DR   EnsemblGenomes-Gn; Ccel_R0014.
DR   EnsemblGenomes-Gn; Ccel_R0015.
DR   EnsemblGenomes-Gn; Ccel_R0016.
DR   EnsemblGenomes-Gn; Ccel_R0017.
DR   EnsemblGenomes-Gn; Ccel_R0018.
DR   EnsemblGenomes-Gn; Ccel_R0019.
DR   EnsemblGenomes-Gn; Ccel_R0020.
DR   EnsemblGenomes-Gn; Ccel_R0021.
DR   EnsemblGenomes-Gn; Ccel_R0022.
DR   EnsemblGenomes-Gn; Ccel_R0023.
DR   EnsemblGenomes-Gn; Ccel_R0024.
DR   EnsemblGenomes-Gn; Ccel_R0025.
DR   EnsemblGenomes-Gn; Ccel_R0026.
DR   EnsemblGenomes-Gn; Ccel_R0027.
DR   EnsemblGenomes-Gn; Ccel_R0028.
DR   EnsemblGenomes-Gn; Ccel_R0029.
DR   EnsemblGenomes-Gn; Ccel_R0030.
DR   EnsemblGenomes-Gn; Ccel_R0031.
DR   EnsemblGenomes-Gn; Ccel_R0032.
DR   EnsemblGenomes-Gn; Ccel_R0033.
DR   EnsemblGenomes-Gn; Ccel_R0034.
DR   EnsemblGenomes-Gn; Ccel_R0035.
DR   EnsemblGenomes-Gn; Ccel_R0036.
DR   EnsemblGenomes-Gn; Ccel_R0037.
DR   EnsemblGenomes-Gn; Ccel_R0038.
DR   EnsemblGenomes-Gn; Ccel_R0039.
DR   EnsemblGenomes-Gn; Ccel_R0040.
DR   EnsemblGenomes-Gn; Ccel_R0041.
DR   EnsemblGenomes-Gn; Ccel_R0042.
DR   EnsemblGenomes-Gn; Ccel_R0043.
DR   EnsemblGenomes-Gn; Ccel_R0044.
DR   EnsemblGenomes-Gn; Ccel_R0045.
DR   EnsemblGenomes-Gn; Ccel_R0046.
DR   EnsemblGenomes-Gn; Ccel_R0047.
DR   EnsemblGenomes-Gn; Ccel_R0048.
DR   EnsemblGenomes-Gn; Ccel_R0049.
DR   EnsemblGenomes-Gn; Ccel_R0050.
DR   EnsemblGenomes-Gn; Ccel_R0051.
DR   EnsemblGenomes-Gn; Ccel_R0052.
DR   EnsemblGenomes-Gn; Ccel_R0053.
DR   EnsemblGenomes-Gn; Ccel_R0054.
DR   EnsemblGenomes-Gn; Ccel_R0055.
DR   EnsemblGenomes-Gn; Ccel_R0056.
DR   EnsemblGenomes-Gn; Ccel_R0057.
DR   EnsemblGenomes-Gn; Ccel_R0058.
DR   EnsemblGenomes-Gn; Ccel_R0059.
DR   EnsemblGenomes-Gn; Ccel_R0060.
DR   EnsemblGenomes-Gn; Ccel_R0061.
DR   EnsemblGenomes-Gn; Ccel_R0062.
DR   EnsemblGenomes-Gn; Ccel_R0063.
DR   EnsemblGenomes-Gn; Ccel_R0064.
DR   EnsemblGenomes-Gn; Ccel_R0065.
DR   EnsemblGenomes-Gn; Ccel_R0066.
DR   EnsemblGenomes-Gn; Ccel_R0067.
DR   EnsemblGenomes-Gn; Ccel_R0068.
DR   EnsemblGenomes-Gn; Ccel_R0069.
DR   EnsemblGenomes-Gn; Ccel_R0070.
DR   EnsemblGenomes-Gn; Ccel_R0071.
DR   EnsemblGenomes-Gn; Ccel_R0072.
DR   EnsemblGenomes-Gn; Ccel_R0073.
DR   EnsemblGenomes-Gn; Ccel_R0074.
DR   EnsemblGenomes-Gn; Ccel_R0075.
DR   EnsemblGenomes-Gn; Ccel_R0076.
DR   EnsemblGenomes-Gn; Ccel_R0077.
DR   EnsemblGenomes-Gn; Ccel_R0078.
DR   EnsemblGenomes-Gn; Ccel_R0079.
DR   EnsemblGenomes-Gn; Ccel_R0080.
DR   EnsemblGenomes-Gn; Ccel_R0081.
DR   EnsemblGenomes-Gn; Ccel_R0082.
DR   EnsemblGenomes-Gn; Ccel_R0083.
DR   EnsemblGenomes-Gn; Ccel_R0084.
DR   EnsemblGenomes-Gn; Ccel_R0085.
DR   EnsemblGenomes-Gn; Ccel_R0086.
DR   EnsemblGenomes-Gn; Ccel_R0087.
DR   EnsemblGenomes-Gn; Ccel_R0088.
DR   EnsemblGenomes-Gn; EBG00001138184.
DR   EnsemblGenomes-Gn; EBG00001138185.
DR   EnsemblGenomes-Gn; EBG00001138186.
DR   EnsemblGenomes-Gn; EBG00001138187.
DR   EnsemblGenomes-Gn; EBG00001138188.
DR   EnsemblGenomes-Gn; EBG00001138189.
DR   EnsemblGenomes-Gn; EBG00001138190.
DR   EnsemblGenomes-Gn; EBG00001138191.
DR   EnsemblGenomes-Gn; EBG00001138192.
DR   EnsemblGenomes-Gn; EBG00001138193.
DR   EnsemblGenomes-Gn; EBG00001138194.
DR   EnsemblGenomes-Gn; EBG00001138195.
DR   EnsemblGenomes-Gn; EBG00001138196.
DR   EnsemblGenomes-Gn; EBG00001138197.
DR   EnsemblGenomes-Gn; EBG00001138198.
DR   EnsemblGenomes-Gn; EBG00001138199.
DR   EnsemblGenomes-Gn; EBG00001138200.
DR   EnsemblGenomes-Gn; EBG00001138201.
DR   EnsemblGenomes-Gn; EBG00001138202.
DR   EnsemblGenomes-Gn; EBG00001138203.
DR   EnsemblGenomes-Gn; EBG00001138204.
DR   EnsemblGenomes-Gn; EBG00001138205.
DR   EnsemblGenomes-Gn; EBG00001138206.
DR   EnsemblGenomes-Gn; EBG00001138207.
DR   EnsemblGenomes-Gn; EBG00001138208.
DR   EnsemblGenomes-Gn; EBG00001138209.
DR   EnsemblGenomes-Gn; EBG00001138210.
DR   EnsemblGenomes-Gn; EBG00001138211.
DR   EnsemblGenomes-Gn; EBG00001138212.
DR   EnsemblGenomes-Gn; EBG00001138213.
DR   EnsemblGenomes-Gn; EBG00001138214.
DR   EnsemblGenomes-Gn; EBG00001138215.
DR   EnsemblGenomes-Gn; EBG00001138216.
DR   EnsemblGenomes-Gn; EBG00001138217.
DR   EnsemblGenomes-Gn; EBG00001138218.
DR   EnsemblGenomes-Gn; EBG00001138219.
DR   EnsemblGenomes-Gn; EBG00001138220.
DR   EnsemblGenomes-Gn; EBG00001138221.
DR   EnsemblGenomes-Gn; EBG00001138222.
DR   EnsemblGenomes-Gn; EBG00001138223.
DR   EnsemblGenomes-Gn; EBG00001138224.
DR   EnsemblGenomes-Gn; EBG00001138225.
DR   EnsemblGenomes-Gn; EBG00001138226.
DR   EnsemblGenomes-Gn; EBG00001138227.
DR   EnsemblGenomes-Gn; EBG00001138228.
DR   EnsemblGenomes-Gn; EBG00001138229.
DR   EnsemblGenomes-Gn; EBG00001138230.
DR   EnsemblGenomes-Gn; EBG00001138231.
DR   EnsemblGenomes-Gn; EBG00001138232.
DR   EnsemblGenomes-Gn; EBG00001138233.
DR   EnsemblGenomes-Gn; EBG00001138234.
DR   EnsemblGenomes-Gn; EBG00001138235.
DR   EnsemblGenomes-Gn; EBG00001138236.
DR   EnsemblGenomes-Gn; EBG00001138237.
DR   EnsemblGenomes-Gn; EBG00001138238.
DR   EnsemblGenomes-Gn; EBG00001138239.
DR   EnsemblGenomes-Gn; EBG00001138240.
DR   EnsemblGenomes-Gn; EBG00001138241.
DR   EnsemblGenomes-Gn; EBG00001138242.
DR   EnsemblGenomes-Gn; EBG00001138243.
DR   EnsemblGenomes-Gn; EBG00001138244.
DR   EnsemblGenomes-Gn; EBG00001138245.
DR   EnsemblGenomes-Gn; EBG00001138246.
DR   EnsemblGenomes-Gn; EBG00001138247.
DR   EnsemblGenomes-Gn; EBG00001138248.
DR   EnsemblGenomes-Gn; EBG00001138249.
DR   EnsemblGenomes-Gn; EBG00001138250.
DR   EnsemblGenomes-Gn; EBG00001138251.
DR   EnsemblGenomes-Gn; EBG00001138252.
DR   EnsemblGenomes-Gn; EBG00001138253.
DR   EnsemblGenomes-Gn; EBG00001138254.
DR   EnsemblGenomes-Gn; EBG00001138255.
DR   EnsemblGenomes-Gn; EBG00001138256.
DR   EnsemblGenomes-Gn; EBG00001138257.
DR   EnsemblGenomes-Gn; EBG00001138258.
DR   EnsemblGenomes-Gn; EBG00001138259.
DR   EnsemblGenomes-Gn; EBG00001138260.
DR   EnsemblGenomes-Gn; EBG00001138261.
DR   EnsemblGenomes-Gn; EBG00001138262.
DR   EnsemblGenomes-Gn; EBG00001138263.
DR   EnsemblGenomes-Gn; EBG00001138264.
DR   EnsemblGenomes-Gn; EBG00001138265.
DR   EnsemblGenomes-Gn; EBG00001138266.
DR   EnsemblGenomes-Gn; EBG00001138267.
DR   EnsemblGenomes-Gn; EBG00001138268.
DR   EnsemblGenomes-Gn; EBG00001138269.
DR   EnsemblGenomes-Gn; EBG00001138270.
DR   EnsemblGenomes-Gn; EBG00001138271.
DR   EnsemblGenomes-Gn; EBG00001138272.
DR   EnsemblGenomes-Gn; EBG00001138273.
DR   EnsemblGenomes-Gn; EBG00001138274.
DR   EnsemblGenomes-Gn; EBG00001138275.
DR   EnsemblGenomes-Gn; EBG00001138276.
DR   EnsemblGenomes-Gn; EBG00001138277.
DR   EnsemblGenomes-Gn; EBG00001138278.
DR   EnsemblGenomes-Gn; EBG00001138279.
DR   EnsemblGenomes-Gn; EBG00001138280.
DR   EnsemblGenomes-Gn; EBG00001138281.
DR   EnsemblGenomes-Gn; EBG00001138282.
DR   EnsemblGenomes-Gn; EBG00001138283.
DR   EnsemblGenomes-Gn; EBG00001138284.
DR   EnsemblGenomes-Gn; EBG00001138285.
DR   EnsemblGenomes-Gn; EBG00001138286.
DR   EnsemblGenomes-Gn; EBG00001138287.
DR   EnsemblGenomes-Gn; EBG00001138288.
DR   EnsemblGenomes-Gn; EBG00001138289.
DR   EnsemblGenomes-Gn; EBG00001138290.
DR   EnsemblGenomes-Gn; EBG00001138291.
DR   EnsemblGenomes-Gn; EBG00001138292.
DR   EnsemblGenomes-Gn; EBG00001138293.
DR   EnsemblGenomes-Tr; Ccel_R0001-1.
DR   EnsemblGenomes-Tr; Ccel_R0002-1.
DR   EnsemblGenomes-Tr; Ccel_R0003-1.
DR   EnsemblGenomes-Tr; Ccel_R0004-1.
DR   EnsemblGenomes-Tr; Ccel_R0005-1.
DR   EnsemblGenomes-Tr; Ccel_R0006-1.
DR   EnsemblGenomes-Tr; Ccel_R0007-1.
DR   EnsemblGenomes-Tr; Ccel_R0008-1.
DR   EnsemblGenomes-Tr; Ccel_R0009-1.
DR   EnsemblGenomes-Tr; Ccel_R0010-1.
DR   EnsemblGenomes-Tr; Ccel_R0011-1.
DR   EnsemblGenomes-Tr; Ccel_R0012-1.
DR   EnsemblGenomes-Tr; Ccel_R0013-1.
DR   EnsemblGenomes-Tr; Ccel_R0014-1.
DR   EnsemblGenomes-Tr; Ccel_R0015-1.
DR   EnsemblGenomes-Tr; Ccel_R0016-1.
DR   EnsemblGenomes-Tr; Ccel_R0017-1.
DR   EnsemblGenomes-Tr; Ccel_R0018-1.
DR   EnsemblGenomes-Tr; Ccel_R0019-1.
DR   EnsemblGenomes-Tr; Ccel_R0020-1.
DR   EnsemblGenomes-Tr; Ccel_R0021-1.
DR   EnsemblGenomes-Tr; Ccel_R0022-1.
DR   EnsemblGenomes-Tr; Ccel_R0023-1.
DR   EnsemblGenomes-Tr; Ccel_R0024-1.
DR   EnsemblGenomes-Tr; Ccel_R0025-1.
DR   EnsemblGenomes-Tr; Ccel_R0026-1.
DR   EnsemblGenomes-Tr; Ccel_R0027-1.
DR   EnsemblGenomes-Tr; Ccel_R0028-1.
DR   EnsemblGenomes-Tr; Ccel_R0029-1.
DR   EnsemblGenomes-Tr; Ccel_R0030-1.
DR   EnsemblGenomes-Tr; Ccel_R0031-1.
DR   EnsemblGenomes-Tr; Ccel_R0032-1.
DR   EnsemblGenomes-Tr; Ccel_R0033-1.
DR   EnsemblGenomes-Tr; Ccel_R0034-1.
DR   EnsemblGenomes-Tr; Ccel_R0035-1.
DR   EnsemblGenomes-Tr; Ccel_R0036-1.
DR   EnsemblGenomes-Tr; Ccel_R0037-1.
DR   EnsemblGenomes-Tr; Ccel_R0038-1.
DR   EnsemblGenomes-Tr; Ccel_R0039-1.
DR   EnsemblGenomes-Tr; Ccel_R0040-1.
DR   EnsemblGenomes-Tr; Ccel_R0041-1.
DR   EnsemblGenomes-Tr; Ccel_R0042-1.
DR   EnsemblGenomes-Tr; Ccel_R0043-1.
DR   EnsemblGenomes-Tr; Ccel_R0044-1.
DR   EnsemblGenomes-Tr; Ccel_R0045-1.
DR   EnsemblGenomes-Tr; Ccel_R0046-1.
DR   EnsemblGenomes-Tr; Ccel_R0047-1.
DR   EnsemblGenomes-Tr; Ccel_R0048-1.
DR   EnsemblGenomes-Tr; Ccel_R0049-1.
DR   EnsemblGenomes-Tr; Ccel_R0050-1.
DR   EnsemblGenomes-Tr; Ccel_R0051-1.
DR   EnsemblGenomes-Tr; Ccel_R0052-1.
DR   EnsemblGenomes-Tr; Ccel_R0053-1.
DR   EnsemblGenomes-Tr; Ccel_R0054-1.
DR   EnsemblGenomes-Tr; Ccel_R0055-1.
DR   EnsemblGenomes-Tr; Ccel_R0056-1.
DR   EnsemblGenomes-Tr; Ccel_R0057-1.
DR   EnsemblGenomes-Tr; Ccel_R0058-1.
DR   EnsemblGenomes-Tr; Ccel_R0059-1.
DR   EnsemblGenomes-Tr; Ccel_R0060-1.
DR   EnsemblGenomes-Tr; Ccel_R0061-1.
DR   EnsemblGenomes-Tr; Ccel_R0062-1.
DR   EnsemblGenomes-Tr; Ccel_R0063-1.
DR   EnsemblGenomes-Tr; Ccel_R0064-1.
DR   EnsemblGenomes-Tr; Ccel_R0065-1.
DR   EnsemblGenomes-Tr; Ccel_R0066-1.
DR   EnsemblGenomes-Tr; Ccel_R0067-1.
DR   EnsemblGenomes-Tr; Ccel_R0068-1.
DR   EnsemblGenomes-Tr; Ccel_R0069-1.
DR   EnsemblGenomes-Tr; Ccel_R0070-1.
DR   EnsemblGenomes-Tr; Ccel_R0071-1.
DR   EnsemblGenomes-Tr; Ccel_R0072-1.
DR   EnsemblGenomes-Tr; Ccel_R0073-1.
DR   EnsemblGenomes-Tr; Ccel_R0074-1.
DR   EnsemblGenomes-Tr; Ccel_R0075-1.
DR   EnsemblGenomes-Tr; Ccel_R0076-1.
DR   EnsemblGenomes-Tr; Ccel_R0077-1.
DR   EnsemblGenomes-Tr; Ccel_R0078-1.
DR   EnsemblGenomes-Tr; Ccel_R0079-1.
DR   EnsemblGenomes-Tr; Ccel_R0080-1.
DR   EnsemblGenomes-Tr; Ccel_R0081-1.
DR   EnsemblGenomes-Tr; Ccel_R0082-1.
DR   EnsemblGenomes-Tr; Ccel_R0083-1.
DR   EnsemblGenomes-Tr; Ccel_R0084-1.
DR   EnsemblGenomes-Tr; Ccel_R0085-1.
DR   EnsemblGenomes-Tr; Ccel_R0086-1.
DR   EnsemblGenomes-Tr; Ccel_R0087-1.
DR   EnsemblGenomes-Tr; Ccel_R0088-1.
DR   EnsemblGenomes-Tr; EBT00001729370.
DR   EnsemblGenomes-Tr; EBT00001729371.
DR   EnsemblGenomes-Tr; EBT00001729375.
DR   EnsemblGenomes-Tr; EBT00001729379.
DR   EnsemblGenomes-Tr; EBT00001729382.
DR   EnsemblGenomes-Tr; EBT00001729383.
DR   EnsemblGenomes-Tr; EBT00001729385.
DR   EnsemblGenomes-Tr; EBT00001729387.
DR   EnsemblGenomes-Tr; EBT00001729389.
DR   EnsemblGenomes-Tr; EBT00001729390.
DR   EnsemblGenomes-Tr; EBT00001729393.
DR   EnsemblGenomes-Tr; EBT00001729395.
DR   EnsemblGenomes-Tr; EBT00001729397.
DR   EnsemblGenomes-Tr; EBT00001729399.
DR   EnsemblGenomes-Tr; EBT00001729401.
DR   EnsemblGenomes-Tr; EBT00001729403.
DR   EnsemblGenomes-Tr; EBT00001729404.
DR   EnsemblGenomes-Tr; EBT00001729407.
DR   EnsemblGenomes-Tr; EBT00001729409.
DR   EnsemblGenomes-Tr; EBT00001729410.
DR   EnsemblGenomes-Tr; EBT00001729412.
DR   EnsemblGenomes-Tr; EBT00001729414.
DR   EnsemblGenomes-Tr; EBT00001729416.
DR   EnsemblGenomes-Tr; EBT00001729419.
DR   EnsemblGenomes-Tr; EBT00001729421.
DR   EnsemblGenomes-Tr; EBT00001729422.
DR   EnsemblGenomes-Tr; EBT00001729425.
DR   EnsemblGenomes-Tr; EBT00001729427.
DR   EnsemblGenomes-Tr; EBT00001729429.
DR   EnsemblGenomes-Tr; EBT00001729431.
DR   EnsemblGenomes-Tr; EBT00001729433.
DR   EnsemblGenomes-Tr; EBT00001729435.
DR   EnsemblGenomes-Tr; EBT00001729437.
DR   EnsemblGenomes-Tr; EBT00001729439.
DR   EnsemblGenomes-Tr; EBT00001729441.
DR   EnsemblGenomes-Tr; EBT00001729443.
DR   EnsemblGenomes-Tr; EBT00001729444.
DR   EnsemblGenomes-Tr; EBT00001729445.
DR   EnsemblGenomes-Tr; EBT00001729446.
DR   EnsemblGenomes-Tr; EBT00001729447.
DR   EnsemblGenomes-Tr; EBT00001729448.
DR   EnsemblGenomes-Tr; EBT00001729449.
DR   EnsemblGenomes-Tr; EBT00001729450.
DR   EnsemblGenomes-Tr; EBT00001729451.
DR   EnsemblGenomes-Tr; EBT00001729452.
DR   EnsemblGenomes-Tr; EBT00001729453.
DR   EnsemblGenomes-Tr; EBT00001729454.
DR   EnsemblGenomes-Tr; EBT00001729455.
DR   EnsemblGenomes-Tr; EBT00001729456.
DR   EnsemblGenomes-Tr; EBT00001729457.
DR   EnsemblGenomes-Tr; EBT00001729458.
DR   EnsemblGenomes-Tr; EBT00001729459.
DR   EnsemblGenomes-Tr; EBT00001729460.
DR   EnsemblGenomes-Tr; EBT00001729461.
DR   EnsemblGenomes-Tr; EBT00001729462.
DR   EnsemblGenomes-Tr; EBT00001729463.
DR   EnsemblGenomes-Tr; EBT00001729464.
DR   EnsemblGenomes-Tr; EBT00001729465.
DR   EnsemblGenomes-Tr; EBT00001729466.
DR   EnsemblGenomes-Tr; EBT00001729467.
DR   EnsemblGenomes-Tr; EBT00001729468.
DR   EnsemblGenomes-Tr; EBT00001729469.
DR   EnsemblGenomes-Tr; EBT00001729470.
DR   EnsemblGenomes-Tr; EBT00001729471.
DR   EnsemblGenomes-Tr; EBT00001729472.
DR   EnsemblGenomes-Tr; EBT00001729473.
DR   EnsemblGenomes-Tr; EBT00001729474.
DR   EnsemblGenomes-Tr; EBT00001729475.
DR   EnsemblGenomes-Tr; EBT00001729476.
DR   EnsemblGenomes-Tr; EBT00001729477.
DR   EnsemblGenomes-Tr; EBT00001729478.
DR   EnsemblGenomes-Tr; EBT00001729479.
DR   EnsemblGenomes-Tr; EBT00001729480.
DR   EnsemblGenomes-Tr; EBT00001729481.
DR   EnsemblGenomes-Tr; EBT00001729482.
DR   EnsemblGenomes-Tr; EBT00001729483.
DR   EnsemblGenomes-Tr; EBT00001729484.
DR   EnsemblGenomes-Tr; EBT00001729485.
DR   EnsemblGenomes-Tr; EBT00001729486.
DR   EnsemblGenomes-Tr; EBT00001729487.
DR   EnsemblGenomes-Tr; EBT00001729488.
DR   EnsemblGenomes-Tr; EBT00001729489.
DR   EnsemblGenomes-Tr; EBT00001729490.
DR   EnsemblGenomes-Tr; EBT00001729491.
DR   EnsemblGenomes-Tr; EBT00001729492.
DR   EnsemblGenomes-Tr; EBT00001729493.
DR   EnsemblGenomes-Tr; EBT00001729494.
DR   EnsemblGenomes-Tr; EBT00001729495.
DR   EnsemblGenomes-Tr; EBT00001729496.
DR   EnsemblGenomes-Tr; EBT00001729497.
DR   EnsemblGenomes-Tr; EBT00001729498.
DR   EnsemblGenomes-Tr; EBT00001729499.
DR   EnsemblGenomes-Tr; EBT00001729500.
DR   EnsemblGenomes-Tr; EBT00001729501.
DR   EnsemblGenomes-Tr; EBT00001729502.
DR   EnsemblGenomes-Tr; EBT00001729503.
DR   EnsemblGenomes-Tr; EBT00001729504.
DR   EnsemblGenomes-Tr; EBT00001729505.
DR   EnsemblGenomes-Tr; EBT00001729506.
DR   EnsemblGenomes-Tr; EBT00001729507.
DR   EnsemblGenomes-Tr; EBT00001729508.
DR   EnsemblGenomes-Tr; EBT00001729509.
DR   EnsemblGenomes-Tr; EBT00001729510.
DR   EnsemblGenomes-Tr; EBT00001729511.
DR   EnsemblGenomes-Tr; EBT00001729512.
DR   EnsemblGenomes-Tr; EBT00001729513.
DR   EnsemblGenomes-Tr; EBT00001729514.
DR   EnsemblGenomes-Tr; EBT00001729515.
DR   EnsemblGenomes-Tr; EBT00001729516.
DR   EnsemblGenomes-Tr; EBT00001729517.
DR   EuropePMC; PMC2812471; 19948806.
DR   EuropePMC; PMC3008519; 20889752.
DR   EuropePMC; PMC3147429; 21685171.
DR   EuropePMC; PMC3558957; 23408234.
DR   EuropePMC; PMC3584212; 23239474.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00023; tmRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00050; FMN.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00162; SAM.
DR   RFAM; RF00167; Purine.
DR   RFAM; RF00168; Lysine.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00230; T-box.
DR   RFAM; RF00379; ydaO-yuaA.
DR   RFAM; RF00380; ykoK.
DR   RFAM; RF00442; ykkC-yxkD.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00515; PyrR.
DR   RFAM; RF01071; OLE.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01470; rli38.
DR   RFAM; RF01750; pfl.
DR   RFAM; RF01831; THF.
DR   RFAM; RF01854; Bacteria_large_SRP.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   RFAM; RF02003; group-II-D1D4-4.
DR   RFAM; RF02004; group-II-D1D4-5.
DR   SILVA-LSU; CP001348.
DR   SILVA-SSU; CP001348.
DR   StrainInfo; 267495; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4002584
CC   Source DNA and bacteria available from Jizhong Zhou
CC   (jzhou@rccc.ou.edu)
CC   Contacts: Jizhong Zhou (jzhou@rccc.ou.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..4068724
FT                   /organism="Ruminiclostridium cellulolyticum H10"
FT                   /strain="H10; ATCC 35319"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:394503"
FT                   /culture_collection="ATCC:35319"
FT                   /type_material="type strain of [Clostridium]
FT                   cellulolyticum"
FT   gene            27..1349
FT                   /locus_tag="Ccel_0001"
FT   CDS_pept        27..1349
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: cth:Cthe_2371 chromosomal replication
FT                   initiation protein; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74389"
FT                   /db_xref="GOA:B8I3R2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I3R2"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACL74389.1"
FT                   /translation="MNVQLNEIWNRTLELLKGEMTEISFNTWILTIEPISIDSNTITLG
FT                   VPADFNKGILEARYSYLIKNALRQISHRDYNIYFAIPSQTPVKPVAQEYTEDSNMSFLN
FT                   PKYTFDTFVIGNGNRFAHAASLAVAEAPAKAYNPLFLYGGVGLGKTHLMHAIGHFVLSQ
FT                   NPALKVLYVSSEKFTNELINAIRDDKNEEFRYKYRNIDVLLIDDIQFIGGKERTEEEFF
FT                   HTFNALYEANKQIIISSDKPPKEIPTLEDRLRSRFEWGLIADIAPPDLETRIAILRKKA
FT                   QLENLDVPDDVMVFIADKVASNIRELEGALNRVIAYSTLTENIINVDMAVEALKDMLNN
FT                   SKAIIINSKTIQEAVARYFHLKTDDLKSKRRSRDVSFPRQIAMYLCRDMTDMSLPKIGD
FT                   EFGGRDHTTVIHACEKINNDLNNSTELKRTVEEIKKNITGG"
FT   gene            1598..2698
FT                   /locus_tag="Ccel_0002"
FT   CDS_pept        1598..2698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: cth:Cthe_2372 DNA
FT                   polymerase III subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74390"
FT                   /db_xref="GOA:B8I3R3"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3R3"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACL74390.1"
FT                   /translation="MKVICSKENLLNGINIVQKAVSTKTTLPILEGILLNADDKFKLTG
FT                   NDLEIGIECYVEADIRSTGCIVINSKIFGDIVRRLPDSEVLIEVTGNNLVIVECENSHF
FT                   EIKGINPSGYPSLPVVEKENILELTQSDLKDMIRQTVFAVGSDENRPVLTGSLIEVKDK
FT                   ELVIVSIDGFRLALRRKNLENDINDFSVIVPGKTLNEISKILQPTDEEVSVYSSNNQVV
FT                   FDAKSWRIVSRLIEGKFLNYNSLLNKDFETKVIINIKEFQSSLERASLISMNDKNSPVK
FT                   LFIGNDKIIITSNADLGNVREEVKAEIEGNALEIGYNPAFLIDALKAIDEERASIYFIT
FT                   TNAPCTMRPLIESNNAFAYLVQAVRI"
FT   gene            2726..2941
FT                   /locus_tag="Ccel_0003"
FT   CDS_pept        2726..2941
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0003"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: RNA-binding S4 domain protein; KEGG:
FT                   cpr:CPR_0003 S4 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74391"
FT                   /db_xref="GOA:B8I3R4"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3R4"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACL74391.1"
FT                   /translation="MEEVGINTEFIKLDQFLKWVGACDNGALAKGFIVDGFVKVNGNVE
FT                   LQRGKKLRNGDTVEFNQKQYKVIQNC"
FT   gene            2955..4073
FT                   /locus_tag="Ccel_0004"
FT   CDS_pept        2955..4073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0004"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: cth:Cthe_2374 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0004"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74392"
FT                   /db_xref="GOA:B8I3R5"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I3R5"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACL74392.1"
FT                   /translation="MIVKNLVLENYRNHTNTRILFSDRFNIFYGDNGQGKTNILEAIYL
FT                   CASGRSHRTSRDSELIKFGCENFSIAVHVSKTGGLDKDIEISYYENQKKQIKINDIPIK
FT                   KIGALMGNLYAVLFSPEDLFIVKQGPTERRRFVDITLSQIKPSYFYNLQQMSKILKQRN
FT                   TLLKNISSNPKLMDTVDIWNMRLAEVAAAIIKARRTFSIMLSGMAENQHNFLTGKSEKI
FT                   SFDYRCSFQISGQDDTEQIEKLYLVQLEKSMQRDIVLGYTTVGPHRDDYDIMINDKSLK
FT                   LYGSQGQQRSAVLSLKIAEIELVKKATNQYPVLLLDDVMSELDKNRQKYLMDSIKEVQT
FT                   FITCTNKEHFGNLLSANSNFFKIVGGNIHSCM"
FT   gene            4141..4410
FT                   /locus_tag="Ccel_0005"
FT   CDS_pept        4141..4410
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0005"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2375 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74393"
FT                   /db_xref="InterPro:IPR007169"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3R6"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2375"
FT                   /protein_id="ACL74393.1"
FT                   /translation="MFLHIGGDVVIPIKNVIAIMDIDTTTISKDTREFLKVAEEEGFVK
FT                   SISEDLPKSFIITETDKKSKIYLSPISSVTLQKRSKYITDISNI"
FT   gene            4442..6370
FT                   /locus_tag="Ccel_0006"
FT   CDS_pept        4442..6370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0006"
FT                   /product="DNA gyrase, B subunit"
FT                   /note="KEGG: cth:Cthe_2376 DNA gyrase subunit B; TIGRFAM:
FT                   DNA gyrase, B subunit; PFAM: DNA gyrase subunit B domain
FT                   protein; ATP-binding region ATPase domain protein; TOPRIM
FT                   domain protein; DNA topoisomerase type IIA subunit B region
FT                   2 domain protein; SMART: DNA topoisomerase II"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74394"
FT                   /db_xref="GOA:B8I3R7"
FT                   /db_xref="InterPro:IPR001241"
FT                   /db_xref="InterPro:IPR002288"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR011557"
FT                   /db_xref="InterPro:IPR013506"
FT                   /db_xref="InterPro:IPR013759"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR018522"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR034160"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3R7"
FT                   /inference="protein motif:TFAM:TIGR01059"
FT                   /protein_id="ACL74394.1"
FT                   /translation="MSDINNNSIYDESQIQVLEGLEAVRKRPGMYIGSTSSRGLHHLVY
FT                   EIVANSIDEALAGRCDIIKVIVHKDNSVTVTDNGSGIPVGIHPKMGIPTLEVVHTILHA
FT                   GGKFGSGAYSVSGGLHGVGASVVNALSESMEVEVKREGHIYRQKYSRGKPLTSVDIVGD
FT                   TDETGTITTFKPDPEIFEEIVYDFDAMISRYREMAFLNKGINIKLIDERPEESVEKNLH
FT                   YEGGIISFVEYLNKSKEPLHDEVIYLEGSRDANIVEVAMQYNDSYNESVFTYANNIATT
FT                   EGGTHLTGFRAAITKVLNDYARKFNILKENDKNLSGEDVREGLTAVLSVKLPEPQFEGQ
FT                   TKTKLGNSEIRTLVENVVSDKLFIFLEEHPAVAKIILDKSITAARAREAARKARELTRR
FT                   KSAMDSSTLPGKLADCSEKDPTKTEIFIVEGDSAGGSAKQGRDRKIQAILPLWGKMLNV
FT                   EKSRMDKVYDNEKLSPVIIALGAGIGDEFDTSKLRYDKIIIMADADVDGSHIRMLLLTF
FT                   FFRYMRPLVEQGHVYIAMPPLFKVYKGKEEYYAYDDIELDKIFKERGWRKDDPNVNIQR
FT                   FKGLGEMNPDQLWETTMNPETRTIIKVDLEDAISADEVFCKFMGDKVEPRREYIQMHAR
FT                   DVSNLDI"
FT   gene            6639..7412
FT                   /locus_tag="Ccel_0007"
FT   CDS_pept        6639..7412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0007"
FT                   /product="Cobyrinic acid ac-diamide synthase"
FT                   /note="PFAM: Cobyrinic acid ac-diamide synthase; KEGG:
FT                   cth:Cthe_2377 chromosome segregation ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74395"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3R8"
FT                   /inference="protein motif:PFAM:PF01656"
FT                   /protein_id="ACL74395.1"
FT                   /translation="MAKIIAIANQKGGVGKTTTAVNLSSCLAYKGKKVLVIDIDPQGNT
FT                   TSGLGIDKKNIKHSVYDVIINDEPIENTLLEACIDGLMICPSNIQLAGAEVELVSMISR
FT                   ENRLKSALYYIRKEFDFIIIDCPPSLGLLTLNSLTASDTILVPIQCEYYALEGLSQLMN
FT                   TVKLVQRHLNPQLEVEGVVLTMFDARTNLSIQVVEEVKKYFGNRVYRTIIPRNVRLSEA
FT                   PSFGLPIILYDAKSKGAECYIDLAEEVIEYTEEVV"
FT   gene            7418..8263
FT                   /locus_tag="Ccel_0008"
FT   CDS_pept        7418..8263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0008"
FT                   /product="parB-like partition protein"
FT                   /note="TIGRFAM: parB-like partition protein; PFAM: ParB
FT                   domain protein nuclease; KEGG: cth:Cthe_2378 chromosome
FT                   segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74396"
FT                   /db_xref="GOA:B8I3R9"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3R9"
FT                   /inference="protein motif:TFAM:TIGR00180"
FT                   /protein_id="ACL74396.1"
FT                   /translation="MIKKGLGRGLGALISNEALEEESGILQLRINELEPNIGQPRKNFD
FT                   DEKLVQLAESIKQHGIIQPIIVKKSDSIYTIIAGERRWRAAKLAGLTNVPVIVNNFSNK
FT                   QTMEVALIENLQREDLNPIEEAEAFLHLMDEYNLTQEQIAATIGKSRPAIANSLRLLGL
FT                   KDDVRKYIISGELTSGHARTLVIIQDEELQKKAADFIIENKLSVRETENYVKKLCKGNN
FT                   KVRKTTEVSNPELIDVENKLKNILGTKVKLQSKNNKGKITIEYYSNDELERLLDFFYKI
FT                   "
FT   gene            8426..8956
FT                   /locus_tag="Ccel_0009"
FT   CDS_pept        8426..8956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0009"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2379 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74397"
FT                   /db_xref="GOA:B8I3S0"
FT                   /db_xref="InterPro:IPR027981"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S0"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2379"
FT                   /protein_id="ACL74397.1"
FT                   /translation="MNDFFRNILNIDFEILVLFGICFIFIIINCFMLIANIKKTNKLKL
FT                   KYKKFMNGLSDRNIEELLETCLNTTNSVSTKNKEIELKINKIERRLFQCIQKVGVVRFN
FT                   AFDNVGSDLSFAIALLDNNDSGVVISGIYARESSSTYSKPVVSGSSKYTLSAEEIQAID
FT                   IAKKTNVERSYIE"
FT   gene            9000..9761
FT                   /locus_tag="Ccel_0010"
FT   CDS_pept        9000..9761
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0010"
FT                   /product="TPR repeat-containing protein"
FT                   /note="KEGG: cth:Cthe_2380 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74398"
FT                   /db_xref="GOA:B8I3S1"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S1"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2380"
FT                   /protein_id="ACL74398.1"
FT                   /translation="MNIHFHSNKENKNEKKQIWMYAVILFTGAFIILLLTAYSQVKFQN
FT                   NISDYQNKLSSQEKAKLTAVTDLKSALKENERLNKELESLRNKLIESEQEIATQSSKTT
FT                   DIESKYNSSVIATDALIAAMEYYNNKDYVNAAVTLKYDVKIEYLSPKVINTYNDLVEKS
FT                   YGKASLKSYRDGYRDYKNKNYAGAIINLNRAIDFSKKNEYYIDDAYYYLANSYYKSSNF
FT                   TDAKRIINAFQTDYPKSEFARSMRNLLEKIS"
FT   sig_peptide     9000..9119
FT                   /locus_tag="Ccel_0010"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.795) with cleavage site probability 0.519 at
FT                   residue 40"
FT   gene            9876..9966
FT                   /locus_tag="Ccel_R0001"
FT                   /note="tRNA-Ser1"
FT   tRNA            9876..9966
FT                   /locus_tag="Ccel_R0001"
FT                   /product="tRNA-Ser"
FT   gene            10007..10098
FT                   /locus_tag="Ccel_R0002"
FT                   /note="tRNA-Ser2"
FT   tRNA            10007..10098
FT                   /locus_tag="Ccel_R0002"
FT                   /product="tRNA-Ser"
FT   gene            complement(10403..10942)
FT                   /locus_tag="Ccel_0011"
FT   CDS_pept        complement(10403..10942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0011"
FT                   /product="CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase"
FT                   /note="TIGRFAM: CDP-diacylglycerol/serine
FT                   O-phosphatidyltransferase; PFAM: CDP-alcohol
FT                   phosphatidyltransferase; KEGG: ctc:CTC01356
FT                   CDP-diacylglycerol--serine O-phosphatidyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74399"
FT                   /db_xref="GOA:B8I3S2"
FT                   /db_xref="InterPro:IPR000462"
FT                   /db_xref="InterPro:IPR004533"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S2"
FT                   /inference="protein motif:TFAM:TIGR00473"
FT                   /protein_id="ACL74399.1"
FT                   /translation="MKNSIKHSLPNLLTFINLSLGIIALLFAIKNDLIQASLLVMVAAL
FT                   TDRFDGKVARMLDSTSELGKELDSLSDLISFGVAPIIIAWKISFFDLTIIGYLLAVMFP
FT                   IAGAYRLARYNVTTFNNVFSGVPITIAGAFLSIINLYNCFSIEHNNYSKVNTIVTAVII
FT                   VLLSYLMISKIQIKKR"
FT   gene            11177..11815
FT                   /locus_tag="Ccel_0012"
FT   CDS_pept        11177..11815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0012"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   1"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 1; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: tpd:Teth39_0448 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74400"
FT                   /db_xref="GOA:B8I3S3"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S3"
FT                   /inference="protein motif:TFAM:TIGR01549"
FT                   /protein_id="ACL74400.1"
FT                   /translation="MNNFKYIFFDLDGTLIDTVPLILDSFNYTFNYHFGETRPEEETIS
FT                   YIGMPLINHLRDIYPGHEEELAKTYRDYNDKRHDSCIGVFIGIFETIKILYEKGIVMGV
FT                   VTSKRRELAIRGLKIFNLDQFFIFVNGSEDSKKHKPDGDPLIVAMNRAGATNKDEVLYV
FT                   GDSPLDILCAKNAGVKSAAVAWTYSQRSDLEKVEPDIFLECPADIFKYV"
FT   gene            11880..12416
FT                   /locus_tag="Ccel_0013"
FT   CDS_pept        11880..12416
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0013"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2385 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74401"
FT                   /db_xref="GOA:B8I3S4"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S4"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2385"
FT                   /protein_id="ACL74401.1"
FT                   /translation="MAKTLVAIFEAYEMAEKAAYEIRDKGLRTDNISIITKTGDNINRF
FT                   RSTKDGDFEENRKNKNTFSRAGSISTRISDGIVTGGIIGGVIGILIGAGSMFINDIGLV
FT                   AAAAPIGGLFSGLLVGGIIGGLIDFGVPRIKKKEYEKLISNGKAIFSMMVDEDRSEDIL
FT                   EILKKNGALMVEKYQ"
FT   gene            12496..12750
FT                   /locus_tag="Ccel_0014"
FT   CDS_pept        12496..12750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0014"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2388 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74402"
FT                   /db_xref="InterPro:IPR019644"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74402.1"
FT                   /translation="MEISLNKAINNVVKTSEAKALANERVILLKEIEKVKGELQKAYKN
FT                   FDYVNDSLMVDYYTYQIKAYETMFEFLIKKAKAMGISEL"
FT   gene            12880..13071
FT                   /locus_tag="Ccel_0015"
FT   CDS_pept        12880..13071
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0015"
FT                   /product="sigmaK-factor processing regulatory BofA"
FT                   /note="PFAM: sigmaK-factor processing regulatory BofA;
FT                   KEGG: ckl:CKL_3823 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74403"
FT                   /db_xref="GOA:B8I3S6"
FT                   /db_xref="InterPro:IPR010001"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S6"
FT                   /inference="protein motif:PFAM:PF07441"
FT                   /protein_id="ACL74403.1"
FT                   /translation="MNIGKVVKKLFINIILGVILLIIINFVGLYFGFNIALNIYSALII
FT                   GMLGVPGLILLILLQFMV"
FT   gene            13334..16885
FT                   /locus_tag="Ccel_0016"
FT   CDS_pept        13334..16885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0016"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   pyruvate flavodoxin/ferredoxin oxidoreductase domain
FT                   protein; 4Fe-4S ferredoxin, iron-sulphur binding, conserved
FT                   site; KEGG: cpy:Cphy_3558 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74404"
FT                   /db_xref="GOA:B8I3S7"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR011895"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019456"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S7"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACL74404.1"
FT                   /translation="MSRHKQSMDGNTAAAHVAYAFTDVAAIYPITPSSPMADSVDQWSA
FT                   AGRENIFGNQVKVVELQSEAGAAGTVHGSLAAGALTTTFTASQGLLLMIPNMYKIAGEL
FT                   LPSVFHVSARTVATHALNIFGDHSDVYACRQTGFAMLAESNPQEVMDLSAVAHLATLEG
FT                   KVPFINFFDGFRTSHEVQKIDTWDYADLKEMCDMDSVRAFRDHALTPEKPSMRGSHENG
FT                   DIFFQHREACNTTYDKLPAIVEKYMAKVNAKLGTNYDLFNYYGAPDADRVIIAMGSFCD
FT                   VAEEVIDYLTAAGEKVGLIKVRLYRPWVSSSLLKVLPETVKKIAVLDRSKEPGALGDPL
FT                   YLDVATTLREAGLNDIVVTNGRYGLGSKDTPPSSVFAVFTELKKDAPKPRFTIGIVDDV
FT                   TYLSLPEVKPAPITAAAGTVECKFWGLGGDGTVGANKNSTKIIGDHTDKYIQAYFQYDS
FT                   KKTGGVTISHLRFGDKPIKSPYYVNQADFVACHNPSYIVKGFKIVQDVKPGGIFMINCQ
FT                   WSDEELNSKFNAATKKYIADNNIQLYTINAIDKAAEIGMGKRTNTILQSAFFKLANVMP
FT                   IDDAIKFMKEAAKKSYGKKGDAIVEMNYKAIDAGVSALHKVTVPASWSNPEADPAEPKL
FT                   DGRPELVDMVKNLLNPISLMDGDSLPVSAFANIADGQFEMGASAYEKRGTAVLVPEWDA
FT                   SLCLQCNSCAFVCSHATIRPFMLSEDEIKAAPSNIKLADTRPKASEYKFTMSVSPLDCM
FT                   GCGECITVCPVKEKAIKMVPQESQAQEQPVFDYLVANVGKKPGMPADTTVKGSQFNQPL
FT                   LEFSGSCAGCAETSYARLVTQLFGEQMYISNATGCSSIWGGPAATSPYTVNKDSQMGPA
FT                   WANSLFEDNAEHGYGMQLGQKVLREQAIAKIEKLAVSDKASDELKAAIAKFIETKDMTR
FT                   ENTPATKALVVELEKAAAAGCDLSKEILEKKQYLSKKSVWILGGDGWAYDIGFGGLDHV
FT                   LASGENVNVMVFDTEMYSNTGGQVSKASNIGGVCQFAASGKEIGKKSLAEIAMTYGYVY
FT                   VAQIALGANPNQTIKVIAEAEAYNGPSLIICYAPCELHGVKGGMNHCQDEMKKAVASGY
FT                   WNLFSFNPALKAEGKNPFTLTSKPGDGTYQDFLNNETRYTRLQRSFPERAERLFKESEK
FT                   AAKERYEHLVKLVELYK"
FT   gene            17239..18222
FT                   /locus_tag="Ccel_0017"
FT   CDS_pept        17239..18222
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0017"
FT                   /product="spore coat protein, CotS family"
FT                   /note="TIGRFAM: spore coat protein, CotS family; KEGG:
FT                   cth:Cthe_2398 putative spore coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74405"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR014255"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3S8"
FT                   /inference="protein motif:TFAM:TIGR02906"
FT                   /protein_id="ACL74405.1"
FT                   /translation="MNEFERELQLNYNLKIKSLTNFRDMFLADTDIGKKLIKIASVKRE
FT                   RINFIGEVKEHLFNNGFIHIDRNIPTVKGDYSIQFNEQTVYITDYIEGRECNLESKEET
FT                   IGCAGLLAKMHRASYGFVCSENSLGRSELGRLPGSYRKRLDEIKKLRKNAQKGRMKFDN
FT                   LVSKNIDYFYEVGEQALDLLLISDYYGLVEEAQKNRTISHHDFNHHNIYIQNNEMFLIN
FT                   FEHCCYDLKVYDLINLLRRKMRKCNWDINEAVIILNEYSRYEALSGSDMVLMKIMLMFP
FT                   QKFWRVINKYYNSRKSWSEQSYLLRIQEVIDEAQCHRVFLEKFSAL"
FT   gene            complement(18289..19959)
FT                   /locus_tag="Ccel_0018"
FT   CDS_pept        complement(18289..19959)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0018"
FT                   /product="formate-tetrahydrofolate ligase FTHFS"
FT                   /note="PFAM: formate-tetrahydrofolate ligase FTHFS; KEGG:
FT                   cth:Cthe_2399 formate-tetrahydrofolate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74406"
FT                   /db_xref="GOA:B8I3S9"
FT                   /db_xref="InterPro:IPR000559"
FT                   /db_xref="InterPro:IPR020628"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I3S9"
FT                   /inference="protein motif:PFAM:PF01268"
FT                   /protein_id="ACL74406.1"
FT                   /translation="MQTDIQIAQRCKMHHIADIAKNLGIDTEDIEFYGNYKAKLSDKLW
FT                   DKVKNKKDGKLVLVTAINPTPAGEGKTTTTVGLGQAMARIGKNAVIALREPSMGPVMGI
FT                   KGGAAGGGYAQVVPMEDINLHFTGDMHAITAANNLLSAAIDNHLQQGNMLNIDSRQIVW
FT                   KRCMDMNDRALRNVIVGLGGKINGVPREDGFNITVASEIMAILCLALDIKDLKKRLGRI
FT                   IIGYTYEGKPVTAHDLKVDGAMTLLLKDAIKPNLVQTLEGTPALMHGGPFANIAHGCNS
FT                   ISATKLALKLSDYVITEAGFGADLGAEKFFDIKCRFAGFKPDAVVLVATIRALKYNGGV
FT                   RKEDLKEENIDALSKGFANAEKHIENLKQFGVPVMVAINHFDTDTEAEIKLIQEKCSSL
FT                   GVEVAFSDVFLKGGEGGIELAEKLVALTDSTVSNFAPIYDEKLPIKEKVQQIVSKIYGG
FT                   RNVIYNAAAEKSIAKIEEMGLDRLPICMAKTQYSLSDNPALLGRPQDFDVTVKEVRISA
FT                   GAGFLVVLTGDIMTMPGLPKVPAAERIDINESGVITGLF"
FT   gene            20228..20431
FT                   /locus_tag="Ccel_0019"
FT   CDS_pept        20228..20431
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0019"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbt:CLH_0458 sporulation peptidase YabG"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74407"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74407.1"
FT                   /translation="MREIEIGSLVYRKSYEKDVLFRVCDIKNCDGRKIIILKGVDVRLI
FT                   ADAEEDDLDIIDVHEDEQHKVM"
FT   gene            20580..20846
FT                   /locus_tag="Ccel_0020"
FT   CDS_pept        20580..20846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0020"
FT                   /product="protein of unknown function DUF1021"
FT                   /note="PFAM: protein of unknown function DUF1021; KEGG:
FT                   cth:Cthe_2401 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74408"
FT                   /db_xref="GOA:B8I3T1"
FT                   /db_xref="InterPro:IPR009366"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T1"
FT                   /inference="protein motif:PFAM:PF06257"
FT                   /protein_id="ACL74408.1"
FT                   /translation="MIDKGELFQIKRDIEGCVGEKVQLTANKGRKKSFIREGVLENTYP
FT                   SIFVVKFENEYDNTRRVSYSYTDILTKAVELVVCKDDKKIQVC"
FT   gene            21120..22688
FT                   /locus_tag="Ccel_0021"
FT   CDS_pept        21120..22688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0021"
FT                   /product="Peptidoglycan-binding LysM"
FT                   /note="PFAM: Peptidoglycan-binding LysM; KEGG:
FT                   cth:Cthe_2402 peptidoglycan-binding LysM"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74409"
FT                   /db_xref="InterPro:IPR018392"
FT                   /db_xref="InterPro:IPR024300"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T2"
FT                   /inference="protein motif:PFAM:PF01476"
FT                   /protein_id="ACL74409.1"
FT                   /translation="MSLELLKQAFKVSNLLGEDTIDNVIENDIIVPDVKPDIAKILLLD
FT                   GDVFVTGCDTGTDRAVVSGCLLVKILYISEDENRSVKSITTNIPFSYTLDIPGVRSGVK
FT                   SRAKGTIEHIDYTLLNERKVNIKAIISINCKVTDEIEREISSGITGIDDIQVLKDDIDI
FT                   NTYLGSNKVNFILKEDMELPSTKPSVAEILRNDLKISGKDFKITDGNVVVKGDINIATL
FT                   YIADDETRSMQYMENELTFTQFIELEDVKEDTSVNVDFDLIDYKIEPFEDSDGENRNLR
FT                   AEATINIYVTGLCKRSYEVLSDAYSPIIRINLEKQQFSIDETVSENRSQLIVKDTLNFE
FT                   DFNPEVREIFNVISRCSVSETHLEDEKLNIEGSVLNNVIYLSNDEEQPVFCHSKEIPFK
FT                   HVVEIKGLKNDMKVDTNVEIEHCNYSMLSSDQVEIRCAIGINARVETNKVIPIINKATE
FT                   GIIDEKKLLSMPSVIIYIVQPGDSLWKIAKKYSTTVENLLMVNNLNDKDVLMPGQQLLI
FT                   LKRAM"
FT   gene            22884..23735
FT                   /locus_tag="Ccel_0022"
FT   CDS_pept        22884..23735
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0022"
FT                   /product="4-diphosphocytidyl-2C-methyl-D-erythritol kinase"
FT                   /note="TIGRFAM: 4-diphosphocytidyl-2C-methyl-D-erythritol
FT                   kinase; PFAM: GHMP kinase; GHMP kinase domain protein;
FT                   KEGG: cth:Cthe_2403
FT                   4-diphosphocytidyl-2-C-methyl-D-erythritol kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74410"
FT                   /db_xref="GOA:B8I3T3"
FT                   /db_xref="InterPro:IPR004424"
FT                   /db_xref="InterPro:IPR006204"
FT                   /db_xref="InterPro:IPR013750"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR036554"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T3"
FT                   /inference="protein motif:TFAM:TIGR00154"
FT                   /protein_id="ACL74410.1"
FT                   /translation="MITLNAHAKINLSLDVLSKRQDGYHNLKMIMQTLQLHDTITIQEI
FT                   KSGIEIECEAAYVPNNSSNIAYKAAEKMVVKYGLDAGVRISIDKKIPVAAGLAGGSTDA
FT                   AAVLKGVNSLFKLGLDQQELMEIGKTIGADIPYCIRGGTALAEGIGELITPLPRMEPIP
FT                   VLLVKPRFGVSTASVFKSLEIDKITDRPKTELLINALQRKDTHFIANNLCNVLESVTAA
FT                   RYPLIDKIKKDLITKGAIGSIMSGSGPTVFGLFDDTEVAKKAFGILKKSRNDCILTYIT
FT                   ND"
FT   gene            23752..24438
FT                   /locus_tag="Ccel_0023"
FT   CDS_pept        23752..24438
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0023"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: cth:Cthe_2404 GntR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74411"
FT                   /db_xref="GOA:B8I3T4"
FT                   /db_xref="InterPro:IPR000485"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T4"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL74411.1"
FT                   /translation="MAGKLSKINLNDYKPLREVIFNSLREAIIIGELRPGERLMEVQLA
FT                   EKMGVSRTPVREAIRKLELEGLVDMIPRKGAHVAELSIKDIMDVLEVRASLDGLATSLA
FT                   AERITDDELKELKHINSQFANYIEKENLNGSIKKDAEFHDIIYRASRNDKLISIINNLR
FT                   EQVQRFRVIYLKDYNNSKNLIKEHNDIYEAVSSRSMENARNIAKTHIINQESTILSSLK
FT                   MQKGNS"
FT   gene            24516..26117
FT                   /locus_tag="Ccel_0024"
FT   CDS_pept        24516..26117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0024"
FT                   /product="AAA ATPase central domain protein"
FT                   /note="PFAM: AAA ATPase central domain protein; SMART: AAA
FT                   ATPase; KEGG: cth:Cthe_2407 AAA ATPase, central region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74412"
FT                   /db_xref="GOA:B8I3T5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T5"
FT                   /inference="protein motif:PFAM:PF00004"
FT                   /protein_id="ACL74412.1"
FT                   /translation="MWFNEFLSKYKSGISHEFLFYFNVKDTMDNTRNFFRYIDDEFIKQ
FT                   RNFGIVAFYDISRGLTFLAPEMEREFKKIAGNEASKLFFSLPSRIFPFIDIALKSTKMA
FT                   LFIDHAEKIVPSGDIGSMTLEERMALIWMTEWSVNSKISSVGSTIFMLADNLADISREF
FT                   LNSSYRIEPILVELPGEDERKNYIEFLLQDKSTSSEISIDEFAKLSSGLSRKSIKDIKL
FT                   KAEAEGVPITFDFIKEKKHGVLQKEYGDVLDFIYPEISFEDIGGMEAAKSYLTKNIIEP
FT                   IRRGDSRRVPMGILLCGPSGTGKTLLVEALAKSSGFNCVKIDMSRILGQYVGESEKNFK
FT                   KCLLGAKSQEPVIVFVDEIDTAFRRGESGDSGVSRNIFSEFLQFTSNTNNRGKIIFIAA
FT                   TNRPDLLDAALKRAGRFDKKIPVLLPEKEERAEIFRIIIKKYGINTDIQDFVPYSEMAE
FT                   NYTGAEIDTVVRKAYELACNMKENHPVITDTILKEALKKCRPSTQEIEFMTELAIAECD
FT                   DIDLLPEKYWPRFDRT"
FT   gene            26265..26996
FT                   /locus_tag="Ccel_0025"
FT   CDS_pept        26265..26996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0025"
FT                   /product="phage shock protein A, PspA"
FT                   /note="PFAM: PspA/IM30 family protein; KEGG: cth:Cthe_2408
FT                   phage shock protein A, PspA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74413"
FT                   /db_xref="InterPro:IPR007157"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T6"
FT                   /inference="protein motif:PFAM:PF04012"
FT                   /protein_id="ACL74413.1"
FT                   /translation="MGLFSRLGQMFRGFFGLFVGNLEERNPEALFEDIKNQIDKARRQA
FT                   EQQIIEIQTSAEMIKIEMKTAEKNLIAIKARVESAQRVGDKELLVELLVQEEEYQTVYE
FT                   THKATYENAMVQVEKIREDYKIFESEMNGKLNELKTLKSQAKMANLRENINSVNAQYTS
FT                   KNSRVGNVNDSLDRARDIVNKKTARANAVESLNQDNLDMKLKKLDMNSARDRARARAEA
FT                   LLGGDNGGFEVKEKTDNKISN"
FT   gene            27021..27515
FT                   /locus_tag="Ccel_0026"
FT   CDS_pept        27021..27515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0026"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   ckl:CKL_2298 acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74414"
FT                   /db_xref="GOA:B8I3T7"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T7"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL74414.1"
FT                   /translation="MDTHIREAIEEDLPKITDIYNWAIKNTTASFDINPQTIEQRAVWF
FT                   SHYGGDRFPLIVYIEDGEVAGYASLSEFRTKEGYKNTCELSVYVQPDFQKQGIGKKLMD
FT                   YIIQLGRDVGYHNIISCITTDNIISIQMHEKKGFKLCGELKEVGYKFGRYLDCLFYQLL
FT                   L"
FT   gene            27546..28373
FT                   /locus_tag="Ccel_0027"
FT   CDS_pept        27546..28373
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0027"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74415"
FT                   /db_xref="GOA:B8I3T8"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T8"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2409"
FT                   /protein_id="ACL74415.1"
FT                   /translation="MNSNLFVSALLRFRNFSTLLIWTAIVNLVSGNGQVQNMIASQTAD
FT                   YSLVLAGAYGTGVLVYVAMVMQSMFSNNYKEEVKRKEKRKEINDLNRQCNRLSVQARNY
FT                   GNPIQKQKLRKIMQDKNDIFNSQKRGDEYSYLKEKIVEQSLKLVISYTKLMMNYSIRSK
FT                   ELSEININQLMNKINANRRKISFMKDDRMLDDINNVIEMDEKAIQRVKDERNELERIHA
FT                   RLDYIESMLNMFKHQIISSIESEEMVEKLETAVNEATALDSVLQERRRNQISL"
FT   gene            28447..30024
FT                   /locus_tag="Ccel_0028"
FT   CDS_pept        28447..30024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0028"
FT                   /product="protein of unknown function DUF342"
FT                   /note="PFAM: protein of unknown function DUF342; KEGG:
FT                   cth:Cthe_2410 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74416"
FT                   /db_xref="InterPro:IPR005646"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3T9"
FT                   /inference="protein motif:PFAM:PF03961"
FT                   /protein_id="ACL74416.1"
FT                   /translation="MSVNIAIYSSPYISITQRDDGYYIQSFKKGLSIDEFQKILNSHPE
FT                   IKVTNFTTIKNALVLAPQDPRRFASAKERISIEVSGDELRAFVTVNVGQPEVLGTEIVK
FT                   EVVLELNRRGVVYGIKKDVLLNLVAGKTVLIAEGEPPQNGVNSQNRLYQIKEAKPEIKE
FT                   DGTADHYDLNLINMVSAGEWLGEKIHATPGKEGKTVYGNPIKPLPGKDYPIFFDRKTVK
FT                   AVEEEGKTTLYATRNGAVYFAGDSISVSNHLEIDENVGVKTGNVDFDGYLTVKGTIEDN
FT                   YTVTTTKDIEVLSDYGVGSCKEISSREGSIYIRGGIAGKGKTVIKCKKNLYLKFVADAE
FT                   IICDGSVHVGFYCLNSNIIAKEVILESLKGQIIGGNITADIRVLAATYGTPSEKRTNIC
FT                   VKGFDRIALKDSLEQLVQEIDQLKTSMNQYKQQISIFNISDAVKSRKSEYEKLNENYNN
FT                   IRAELQVKEELRKNIAGYLKVKGEGEISILKKAFPNTFFEIKRIQKEIQTPILRTSFYY
FT                   SEGTIKEL"
FT   gene            30070..31995
FT                   /locus_tag="Ccel_0029"
FT   CDS_pept        30070..31995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0029"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hau:Haur_4114 multi-sensor signal transduction
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74417"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74417.1"
FT                   /translation="MKYQSILQRLEDEKRDEVLSAKLYRYTGLMQAIEYFSQKLVFKQI
FT                   IEAAFDFINELLLVNNSIVYVLEEGKYTAKKVKGFKDYPKEIEATSTLENLAALYGNVL
FT                   YEKDKIARFFDMEMVSNMGINAVVPLIIEEHLYGFIMINGKDFVDDEYIISESLMRLIN
FT                   TALENYSRYEKLAKVNKELDEKVFNLFAINQSSKVLLSELRINTLYNLSVELFSELTRS
FT                   MVTSFILYDERSGRYVLKGFKDVFYKIKDAFISLSLNQTYKIDPNKVIIDLGNPDDSHY
FT                   FYNLFEDSAIQVDKLEAKYIVIIIKESEILGFVTLSKTVTGDNYSSGVFELIESLASSM
FT                   YIAVSNANLFKQVNEQKQIIQRKLDKLICLNKLIKNISSSLRIDTLMEVAAKTLEISFN
FT                   LQKGLLCLYDKDSDEFSISESIGLDGNLNKNILPNNKWRRVFEGDCVYEIGKDKVAEYI
FT                   GYEVAERVGEAQGILIVPIYVDTLEVELSGVIIIFKYDGLLLDNEENLITLETIAGHIA
FT                   PVLKNLSVIQMQQRFMLPNFIELFKNELKGEIRDAMDYNINLSVIQVEDKRDFIFKGTS
FT                   IIDSIKENFKKVYPFSYNNVFIIENEDENIEERIKRCTGISDLKIRKMVLGKDFKDFAN
FT                   FFDLFR"
FT   gene            32022..32426
FT                   /locus_tag="Ccel_0030"
FT   CDS_pept        32022..32426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0030"
FT                   /product="holo-acyl-carrier-protein synthase"
FT                   /note="TIGRFAM: holo-acyl-carrier-protein synthase; PFAM:
FT                   4'-phosphopantetheinyl transferase; KEGG: cno:NT01CX_1261
FT                   4'-phosphopantetheinyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74418"
FT                   /db_xref="GOA:B8I3U1"
FT                   /db_xref="InterPro:IPR002582"
FT                   /db_xref="InterPro:IPR004568"
FT                   /db_xref="InterPro:IPR008278"
FT                   /db_xref="InterPro:IPR037143"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I3U1"
FT                   /inference="protein motif:TFAM:TIGR00516"
FT                   /protein_id="ACL74418.1"
FT                   /translation="MEMLLGTDIIEVDRIKRAIENGGRKFSEKVFTLNEIEYCESRKAG
FT                   KYQSYAARFAAKEAVSKAFGTGIGKNAAFSEIEILKDSLGKPYVRLSGKAKEFYDSLGT
FT                   AGISVSLSHCRAYAVAYAVISLGDSFKNKI"
FT   gene            32453..33592
FT                   /locus_tag="Ccel_0031"
FT   CDS_pept        32453..33592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0031"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: cth:Cthe_2411
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74419"
FT                   /db_xref="GOA:B8I3U2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U2"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACL74419.1"
FT                   /translation="MKQVSFIHTADIHLDAPFSSLGDKEKADIRRQELEDGLKNIIDRV
FT                   RIQNVDLLIISGDFFEDSHIRGSTIIGVKNLFSELYGTEVIIIPGNHDPLKENSFYHTI
FT                   GWGENVHILTDSNQVLFLKKCNTCIYNMGAIGNVAGDFSNIKEKDISADTFNILVFHGT
FT                   IDMPFEESNYNSIGSKDIFELGMDYVALGHMHNYIRFQNRTSLMINPGSPIPMGFDEEG
FT                   VHGFIQGKIMYTDDNKKLVEADFVPFSSRNYYNIELDVTGCNRNEEIIQKLSTDDNINF
FT                   SNKDLYSLTLRGFIPKDFTPDIKYLMELLKNKCFYVRIKNETSIQFDYEQYLEDPGIKG
FT                   EFVRMLMDMQENEDSQDRKEILYMAIQYGLQAMENNRVD"
FT   gene            33613..35607
FT                   /locus_tag="Ccel_0032"
FT   CDS_pept        33613..35607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0032"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2412 SMC protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74420"
FT                   /db_xref="GOA:B8I3U3"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U3"
FT                   /inference="protein motif:COG:COG4717"
FT                   /protein_id="ACL74420.1"
FT                   /translation="MKIKRLHVRGFGKLQDFNCDFSDGLNVIYGHNESGKSTLMAFIKA
FT                   ILYGVKGGRTGKNGVLPDSRRYMPWNSSQYGGYMNIELNDGCLYRIDRNFLTNEVNIFD
FT                   SSFNDISVNFIDGRDINSVGEKLVGLNESLFERTVFIKQMGTRIDTSTSKDLVDRISNI
FT                   QQSGFEDISYIKAQNALKEALKRQVGTDRSYTRPLDIINQRLAELQEKKINLLNEEKRL
FT                   EELREKQQDISMKINELKFKYRLLNRIIDYCKLKERLQFLNEKNEEIYFLEESARQVQE
FT                   NITKLEEDKKSVILHLNNNQVARGKKLRSIDVFLMICITATLTVGLAAVVFNILSPLFT
FT                   LIPFLPALASLVLRIGIVKREEEEFKTNKTKELNRQLLEFDERITQNKTQYQKLTDRIE
FT                   NINTVVGSEVPAVLESKIVGDYINIMRDKQNVEDQLTQNEKELIDELSKDSHGSLLVKA
FT                   FSINKTVILDLQRLEDEYSEVARMVENGNNISISDIDNEISRLSSQKKSLESKGEALKI
FT                   AIITLEAAAEQVRKKYVPLMNRVLNSTFSNLTSKKYNDVRTGDNLKIMLDNPETQTLVP
FT                   VSTLSDGTIDQIYLALRVAISETVLQNHECMPFIMDEPFAQYDDERTFNALKYIAHISN
FT                   KQQVIIFTCKKREVELISSEFPCKICSLT"
FT   gene            35660..36586
FT                   /locus_tag="Ccel_0033"
FT   CDS_pept        35660..36586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0033"
FT                   /product="NLP/P60 protein"
FT                   /note="PFAM: NLP/P60 protein; SH3 type 3 domain protein;
FT                   KEGG: cth:Cthe_2413 NLP/P60"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74421"
FT                   /db_xref="InterPro:IPR000064"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U4"
FT                   /inference="protein motif:PFAM:PF00877"
FT                   /protein_id="ACL74421.1"
FT                   /translation="MRKHLIIYIFAVTTAIILTLAGCGNRDIPVTKNEQYVSGITWDNA
FT                   AIINDAVVDVFSRNDILSTRITQALFNQIVKIVSQEGSWTRIMLLDGTTGWVKTKYISR
FT                   DTSCVTDGSINNKIVVTAKTVYVYIGTDNDIKYKQVVLGTELYSVSKTKTGYDVLLPNN
FT                   KKGWVEDGGVIAVPVSQNSIPKTSAQGFIQTVSKFEGTIYIIGGVSRWGIDSPGLCYIS
FT                   SRINGVEIPRNIKEMAKTGTGVTLDEMKPGDLLMFSTDNVKKDVSGVGVYKGNNEFIHS
FT                   SPSRGVVTDSLEDSYYKNRIVDIRRIF"
FT   gene            complement(36592..37704)
FT                   /locus_tag="Ccel_0034"
FT   CDS_pept        complement(36592..37704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0034"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /note="PFAM: Glycosyltransferase 28 domain;
FT                   Monogalactosyldiacylglycerol synthase; KEGG: cbl:CLK_3302
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74422"
FT                   /db_xref="GOA:B8I3U5"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U5"
FT                   /inference="protein motif:PFAM:PF06925"
FT                   /protein_id="ACL74422.1"
FT                   /translation="MRVLILYVSVGTGHMKAAEALKESIERQFPDWKVDVLDALKYINP
FT                   VIDKIVVSSYLGTLKRNPKLYSMIYTASGTGTGIYDTSKAVNKLLSYKLKSLINDYKPS
FT                   AVVCTHPFPMQMLSSLKRKNKLNIPTMAILTDYVVHSLWLDSGMDAFIVANDNMKSEMI
FT                   RRGIPDNIIFPYGIPVSPKFLASTNKKDLLLKYGMEDKFTVLVMGGGMGFGNIEKTMAS
FT                   LLDCNVDIQIIAVTGTNQKLKFQLEEYAAQSSKKVLILSYTDRVNELMDISDLLITKPG
FT                   GMTVSEALVKGLPIFIISPIPGQEEGNANFLIRSGVANKIDSFNNLVSILSQVTNDPYT
FT                   LKIMRENSKELGKPHSAHDIAALLGKLVTG"
FT   gene            37904..38599
FT                   /locus_tag="Ccel_0035"
FT   CDS_pept        37904..38599
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0035"
FT                   /product="spore cortex-lytic enzyme"
FT                   /note="TIGRFAM: spore cortex-lytic enzyme; PFAM:
FT                   Peptidoglycan-binding domain 1 protein; cell wall hydrolase
FT                   SleB; KEGG: cth:Cthe_2415 cell wall hydrolase, SleB"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74423"
FT                   /db_xref="GOA:B8I3U6"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011105"
FT                   /db_xref="InterPro:IPR014224"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR042047"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U6"
FT                   /inference="protein motif:TFAM:TIGR02869"
FT                   /protein_id="ACL74423.1"
FT                   /translation="MRKYKIIALFLLIVFSLTIVDEGRIFLTSSAPSLKIGDRGEEVKD
FT                   MQQELKNWGYFDGNVDGRFGYDTLRSVLSYQRQYGLKANGIADRTTLLTMGLAELIESG
FT                   TANAAATSNISNEQLLARAINGEARGEPFEGQVAVGAVILNRVNNSKFPKTVAGVIYQP
FT                   GAFTAVSDGQINVPIDPKSTVVKAARDALAGWDPTDGCLYYWNPATATSKWIWSRKVRY
FT                   KVGKHWFGV"
FT   sig_peptide     37904..37966
FT                   /locus_tag="Ccel_0035"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.771) with cleavage site probability 0.685 at
FT                   residue 21"
FT   gene            38615..40006
FT                   /locus_tag="Ccel_0036"
FT   CDS_pept        38615..40006
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0036"
FT                   /product="germination protein YpeB"
FT                   /note="TIGRFAM: germination protein YpeB; PFAM: Propeptide
FT                   PepSY amd peptidase M4; KEGG: cth:Cthe_2416 peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74424"
FT                   /db_xref="GOA:B8I3U7"
FT                   /db_xref="InterPro:IPR014239"
FT                   /db_xref="InterPro:IPR025711"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U7"
FT                   /inference="protein motif:TFAM:TIGR02889"
FT                   /protein_id="ACL74424.1"
FT                   /translation="MAENGFHLNDRRRSWAVPLAIVAILALVGVSLWGYYQNRQLKRLQ
FT                   VLMTNQYNRAFVDLSDYVDNVETLMAKSLVTSTPVSTSKMLEEVWRQANLAQTNMGQLP
FT                   IAPPILEKTSNFLTQAGDMAYSLNNKTMNGIPLNDKEYGALQKLHGYAVSLQKNLHGIE
FT                   DQITNGKMTWDKYTNKGKFMVASTSKDPKTGQFENIDKTFQEYPTLIYDGPYSDHMLKS
FT                   KPQGLGDKKVSVSDAKNIAINFIGKNKVSDVKQLENNDLGNIKTYRFKVMYKDRKESEY
FT                   AEVEVTQQGGQVYLMLSNRNIGKDTVNMGKAKKLAKDFLDSKGYKNMVDTYYQKVDGTA
FT                   VISYAYKQGGVIVYPDLIKVKIALDNGEIIGIESKGYLYNHRVRTIPKTNITLEQARAK
FT                   VNNKIKIDRQGEAIIPTNYKTEKYCYEFMGKVNGRNFIIYINALTGAEEDVLMLVTTPE
FT                   GTLTM"
FT   gene            40169..40603
FT                   /locus_tag="Ccel_0037"
FT   CDS_pept        40169..40603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0037"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; KEGG: cac:CAC0197
FT                   MarR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74425"
FT                   /db_xref="GOA:B8I3U8"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR023187"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U8"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACL74425.1"
FT                   /translation="MEPKELNLLLIKVGAIHRRKSANEFMKQELSSGQPRILNYLFQNN
FT                   GCIQREIAVDFNMEPASITSVLNSMEKAGLIVREPVKGDKRALEVRLTDKGYEKKKVVD
FT                   DIFIKVEDACFQNFNEEEKLQAKNFLKRIHNNLLKWEPDN"
FT   gene            40629..41084
FT                   /locus_tag="Ccel_0038"
FT   CDS_pept        40629..41084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0038"
FT                   /product="peptide deformylase"
FT                   /note="TIGRFAM: peptide deformylase; PFAM: formylmethionine
FT                   deformylase; KEGG: cbf:CLI_2343 peptide deformylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74426"
FT                   /db_xref="GOA:B8I3U9"
FT                   /db_xref="InterPro:IPR023635"
FT                   /db_xref="InterPro:IPR036821"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3U9"
FT                   /inference="protein motif:TFAM:TIGR00079"
FT                   /protein_id="ACL74426.1"
FT                   /translation="MALRNIRTLDDEVLRKKCRPVDEVNDKVRELLKDMADTMYNTGNG
FT                   AGLAAPQVGILKRIVVIDMGDGLINLVNPEIVEQKGSQEVIEGCLSILGKWGKVIRPTE
FT                   VKVKALNEKGEEVIITGKKDMAKCLCHEIDHLDGILFTDKVTEYIED"
FT   gene            41190..42203
FT                   /locus_tag="Ccel_0039"
FT   CDS_pept        41190..42203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0039"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: cth:Cthe_2877
FT                   S-layer-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74427"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR020481"
FT                   /db_xref="InterPro:IPR038144"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V0"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACL74427.1"
FT                   /translation="MKRTVSALILMGALALSSTFAFAQPTDNIENKFNDISGHWCNSAV
FT                   QMLIGKNVLPFTGDEFSPAKAITKGEFVSLLHDALGIRIEYFAAPQIKDYFEDVDQNAS
FT                   YTTDLIDLVTANIIEKGGNFNPGASFSREEMIHYVMNAYKYQMGDKYALINIKPPFFND
FT                   DKDVSPEFGGDVGRAAHYKLISGSKGMFHPKANTTRGEAAVVISKLVSLLEKQNPVVTV
FT                   SSEADIKDDSIVMKVTITNNSKGAVSLIHSSGQKYDFVLLDSDKKELYRWSSDKMFTMA
FT                   LMYSKIEAGKSVVYTETLSGEQYNTIKDKIVSMKAYVLGNSDEFTFDTKGYEIILK"
FT   sig_peptide     41190..41261
FT                   /locus_tag="Ccel_0039"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            42369..43385
FT                   /locus_tag="Ccel_0040"
FT   CDS_pept        42369..43385
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0040"
FT                   /product="Abortive infection protein"
FT                   /note="PFAM: Abortive infection protein; KEGG:
FT                   cth:Cthe_2417 abortive infection protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74428"
FT                   /db_xref="GOA:B8I3V1"
FT                   /db_xref="InterPro:IPR003675"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V1"
FT                   /inference="protein motif:PFAM:PF02517"
FT                   /protein_id="ACL74428.1"
FT                   /translation="MENNIDRQLSSIRTDENKKRLPGPVASGLLFSIVTILLTFGGPIL
FT                   KINNRYLKSGMGELLFILLPVVAFLIIGRYDIKRTLNLRRTRPLNYLLVVLVTLFGMPV
FT                   VGVLNAITFVVIRAIFGRNLPTPRIIVNDVPTLLIALLVIGVSAAVCEEIMFRGLIQKG
FT                   YRKYGIALSLGITSVLFGLLHRDIQKAVSTILLGALIGFIVYRTGSIFTGMVAHFTNNA
FT                   SAVILSFMASKMSGYLNGESIQQTQSFDFSNLPVASIGIVFLFYAIIYMGLVSGFVALL
FT                   YAFYRSTKKDVKAMEEEAVQYEFTNEKISLPAVLSMLPGLLIILFTFLYQIMKLKWG"
FT   gene            complement(43420..44433)
FT                   /locus_tag="Ccel_0041"
FT   CDS_pept        complement(43420..44433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0041"
FT                   /product="IstB domain protein ATP-binding protein"
FT                   /note="PFAM: IstB domain protein ATP-binding protein; KEGG:
FT                   cth:Cthe_2418 DNA replication protein DnaC"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74429"
FT                   /db_xref="GOA:B8I3V2"
FT                   /db_xref="InterPro:IPR002611"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V2"
FT                   /inference="protein motif:PFAM:PF01695"
FT                   /protein_id="ACL74429.1"
FT                   /translation="MNRDIHSIIAREYERRQKVATDIVDQRKEQVYTKIPELYKIEAMI
FT                   NQFGIKYNRLILSESGDKKFILEELTEKIRELSNARNKLLVKNNISTDFFKPPYQCEKC
FT                   KDTGYITDTSGSQRCSCYRQQIISHLFSQSNISVNGNECFDNFNEMLYPDEIDEAKYGI
FT                   TISPRENINSIKESCIKFIKNIDDPNQKNLFFNGRTGVGKTFLSFCIARELINQGRTVL
FT                   YLTAPALFDIITGHKMRTFKEDDFIDDRYQSIFSVELLIIDDLGTEPLSDARYAELLNI
FT                   LNSRQSQSSVRTCKTIISTNIGPKKLYELYTERITSRIVGYFDRLVLAGKDIRLLQ"
FT   gene            complement(44466..45452)
FT                   /locus_tag="Ccel_0042"
FT   CDS_pept        complement(44466..45452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0042"
FT                   /product="primosome, DnaD subunit"
FT                   /note="TIGRFAM: primosome, DnaD subunit; PFAM: DnaD and
FT                   phage-associated region; KEGG: cth:Cthe_2419 DNA
FT                   replication protein DnaD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74430"
FT                   /db_xref="InterPro:IPR006343"
FT                   /db_xref="InterPro:IPR017019"
FT                   /db_xref="InterPro:IPR034829"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V3"
FT                   /inference="protein motif:TFAM:TIGR01446"
FT                   /protein_id="ACL74430.1"
FT                   /translation="MYFEDFKSLLYSDTLVSDIFISQYMPSMDSTCVKVYIYMLFLCKH
FT                   NKKVTSDELAKTLNLSLDEVKSALTNLDNLEVITWVEDKIQLNDLKEAEINRMYKLKAI
FT                   STPEQANENFEKNKSRNNTLAAINSKFFQGLMAPNWYLTIDNWFTIYKFDEDVMYTLFK
FT                   YCHDNNTFHKSYIEAVATNWHRRGIQNFFDLEKYFEDMAQVRGIKGTIIKKLRLRRALT
FT                   EYESEYVERWVIDYKYGFDVIELALKKTVGKTNPDFKFLNSVLTRWHDLGLVTAEDIHG
FT                   YENSIKSQPRSGQSTQRAKTKPSQRDNFEQRDYGDEYFENFFTNTSK"
FT   gene            45662..46177
FT                   /locus_tag="Ccel_0043"
FT   CDS_pept        45662..46177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0043"
FT                   /product="Ferritin Dps family protein"
FT                   /note="PFAM: Ferritin Dps family protein; KEGG:
FT                   csc:Csac_2712 ferritin, Dps family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74431"
FT                   /db_xref="GOA:B8I3V4"
FT                   /db_xref="InterPro:IPR001519"
FT                   /db_xref="InterPro:IPR008331"
FT                   /db_xref="InterPro:IPR009040"
FT                   /db_xref="InterPro:IPR009078"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR041719"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V4"
FT                   /inference="protein motif:PFAM:PF00210"
FT                   /protein_id="ACL74431.1"
FT                   /translation="MISEKMNDLLNRQVQKEFYSAYLYLGFEAYFQHQNLDGFANFFRV
FT                   QVQEERDHAMKIFNYITQAGGKVKLYQVDEPEDNFNSAEEIFEQTLKHEQEVTKSIYNL
FT                   VDNALAEKDHGTNTFLQWFVTEQVEEEATVDKVLRKLQLIKNDPHALLMLDAELATRVY
FT                   TAPAAETV"
FT   gene            complement(46249..47865)
FT                   /locus_tag="Ccel_0044"
FT   CDS_pept        complement(46249..47865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0044"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: cth:Cthe_2961 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74432"
FT                   /db_xref="GOA:B8I3V5"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V5"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL74432.1"
FT                   /translation="MKRILALVLSLATIITVFAGCGSPSSNDTKGITASIASEPASIDP
FT                   SLNKSLDGGTYINYAFEGLTTYDKEGKIVPGTAEKWDVSADNKVYTFHIRKDAKWSDGK
FT                   AVTANDFVYSWKRAVDPKTASDYAYYLYFVKNGEAINTNGADINTLGIKAIDDNTLEVT
FT                   LENVCPFFTEIVAFPTLVPLREDVVSKNPDKWTLDPKTYIGNGPYVMTDWKHSSKLVFE
FT                   KNENYWGKDNVVAPKIEWLLMNDPNAILGAFKNKQLSFARNIPHDEIPAEKDAGNLQIF
FT                   PQLGTYYLDLLNTKAPFDNPKVRKAVSLAIDRNYITEKVRKAGETPASGFVPYGIADVS
FT                   QDPDFRTKGGDFYSVKPEDYEKNVAEAKKLLAEAGYPDGKGFPKITFGLNTGSGHEAVA
FT                   EAIQQQLKTNLGIEVEIQAQEWNVFQESRKNGLFDIARDGWIGDYMDPSTFMDLITSNN
FT                   PQNNSKYNNAAYDKAIADARKETDPAKRMQLYHDAENLLMEEAGVAPLFFYTDPLIIDK
FT                   NLQDYVVTKLGFIYLQWASFK"
FT   sig_peptide     complement(47785..47865)
FT                   /locus_tag="Ccel_0044"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.620 at
FT                   residue 27"
FT   gene            complement(48051..49049)
FT                   /locus_tag="Ccel_0045"
FT   CDS_pept        complement(48051..49049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0045"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: cth:Cthe_2962 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74433"
FT                   /db_xref="GOA:B8I3V6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V6"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL74433.1"
FT                   /translation="MENNSNGNKSPLVEIRNLKQYFTIKNTDGKKAYVKAVDDVSFDIF
FT                   KGETLGLVGESGSGKTTLGRSMLRIYNPTSGSVKIDGVDITKFQGKKLLPYRKKMQYIF
FT                   QDPYASLDPRMTVSDIVGEALDIHGLASSKSDRADKVRELLTLVGLNTEHASRYPHEFS
FT                   GGQRQRIGIARAIAVQPDFIVCDEPVSALDVSIRAQIINTLEEMQDRLDLTYLFISHDL
FT                   GVVRHTCDRVGVMYLGHIVELVESEELYKNPMHPYTRALLTAIPEPNPDTAKKRNRIIL
FT                   KGEIPSPVNPPSGCKFRTRCPYAKDVCSKKTPELADHGNGHFVSCHFAGEI"
FT   gene            complement(49039..50049)
FT                   /locus_tag="Ccel_0046"
FT   CDS_pept        complement(49039..50049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0046"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: cth:Cthe_2963 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74434"
FT                   /db_xref="GOA:B8I3V7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V7"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL74434.1"
FT                   /translation="MNNKLLEINDLKVSFFTPAGEVKAVNGISYSLEPGKVLGIVGESG
FT                   SGKSVSSYSVIGLIDKPGKIVGGSITFNGKDVSKMSKQERLAMAGNEIAMIFQDPMTCL
FT                   NPVFTIGNQIAESLYHKYGKISKDDVKKRSMDLLSLVGINEPEKRLSQYPHEFSGGMRQ
FT                   RAMIAMALAGEPKLLIADEPTTALDVTIQAQILELLKDIQKKTGMAIVLITHDLGIVAD
FT                   MADDIIVMYGGKIVEQGSVYSIFKNPHHPYTKGLLRSLPDLNAKGSKLIPIMGNPIDLL
FT                   HLPSGCAFAPRCEECLKVCISNMPEAYKDADGHTTSCWLMDERAKESVEEHKNGK"
FT   gene            complement(50186..51181)
FT                   /locus_tag="Ccel_0047"
FT   CDS_pept        complement(50186..51181)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0047"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cth:Cthe_2964
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74435"
FT                   /db_xref="GOA:B8I3V8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74435.1"
FT                   /translation="MNTMNDTKVLEKNLFLPATDEEKATTEIMRPSVSYWRDAWNRLRA
FT                   NKVATGALVVIILIILAAIIGPIISPYTYEQINKGQENLKPSMQHIFGTDSLGRDLFTR
FT                   TMIGARISLAVGVVAAIMISIIGIIYGAISGFFGGWVDNIMMRIVDIVYSIPTILIVIL
FT                   LQVVLKKPIDIYIQSGHAPAFLNSMGVGLISIFLVMALLYWVDMARIVRGQILALKEQE
FT                   FVLAAKVLGASNRSIIFKHLIPNCIGQIIVVTTLKIPEAIFTESFLSFIGLGVSSPMAS
FT                   LGSLSQTALKGIYSYPYMLIFPAAAISVIILSFNLFGDGLRDALDPRMKK"
FT   gene            complement(51198..52121)
FT                   /locus_tag="Ccel_0048"
FT   CDS_pept        complement(51198..52121)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0048"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cth:Cthe_2965
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74436"
FT                   /db_xref="GOA:B8I3V9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3V9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74436.1"
FT                   /translation="MGKYVFKRLLLSLLTLWIMFTITFFLMHLVPGNPFIGEKKMTAEM
FT                   LANLNAKYGLDKPLGVQYVNYAKNVLRGDFGQSIQLIGQDVKDIIAQKFPYSLRLGVFA
FT                   SALAIISGTVLGVLSALKKNTAVDRLIMVVVTIGIAVPSFVVATLSMIIFGVQLRILPT
FT                   ISDLSTISSYILPGFALSFFPLSFITRLMRSSMLDVINQDYIRTARAKGLSDKVVIFKH
FT                   ALRNGILPVVTYAGPMVASVLTGSFVIESIFSIPGLGSTFVTSITGRDYTTVMGVTIFF
FT                   GTILILMNFIVDVVYRFIDPRIDIIN"
FT   gene            complement(52670..54397)
FT                   /locus_tag="Ccel_0049"
FT   CDS_pept        complement(52670..54397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0049"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: dsy:DSY4790
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74437"
FT                   /db_xref="GOA:B8I3W0"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR024478"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W0"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL74437.1"
FT                   /translation="MFKLMDNAKIRVKLVLLIFAMIIGMVLVGSMGWFQTRKAQRALDT
FT                   MYNDNLNQVASLSNAGTALMTDFTNILRLIASDNTSYQMAVLSDIIEKEKNLDINIKKI
FT                   STTNLGSDEDKIYASIKENITAWKEIKNKIIELSTSGNTQEASAIYSDNGDTLFRKLEA
FT                   SVTSLINANIKEASDVYAKSLESARQASLFLIILMIAVSMVCIIIGIVIARSITGPIST
FT                   IVSIIRKTAGFDLVFDESYNSMINRKDEIGIIINSISDMRHSLNNTITELHNISGTMAA
FT                   NSEELTTSTAESTKSITQVTASLDEIAKGNANQSEVVSKTSEHITEIVEHISQANDATI
FT                   ENEKAVILSLEAVTEGYNAIVLTSEKVLESTSVSEEVNRSLEDLSKSVIKVGSITDVIN
FT                   SLASQTNLLSLNAAIEAARAGTAGKGFAVVADEVRKLAEESSNAAKEINSIVQAIIANN
FT                   AMTADKMERAKELEAEQSSAVDTTKQAFDKIKISVEVIADKTKKVSEMLNTIDKASKEI
FT                   SSHTHDLSTLAEESAASSEEISASCQQQLSAMEIIAKASSDLSVMAQQLDGEINKFRL"
FT   sig_peptide     complement(54311..54397)
FT                   /locus_tag="Ccel_0049"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.898) with cleavage site probability 0.300 at
FT                   residue 29"
FT   gene            complement(54709..54785)
FT                   /locus_tag="Ccel_R0003"
FT                   /note="tRNA-Arg4"
FT   tRNA            complement(54709..54785)
FT                   /locus_tag="Ccel_R0003"
FT                   /product="tRNA-Arg"
FT   gene            55000..55911
FT                   /locus_tag="Ccel_0050"
FT   CDS_pept        55000..55911
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0050"
FT                   /product="diacylglycerol kinase catalytic region"
FT                   /note="PFAM: diacylglycerol kinase catalytic region; KEGG:
FT                   aoe:Clos_2864 diacylglycerol kinase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74438"
FT                   /db_xref="GOA:B8I3W1"
FT                   /db_xref="InterPro:IPR001206"
FT                   /db_xref="InterPro:IPR005218"
FT                   /db_xref="InterPro:IPR016064"
FT                   /db_xref="InterPro:IPR017438"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W1"
FT                   /inference="protein motif:PFAM:PF00781"
FT                   /protein_id="ACL74438.1"
FT                   /translation="MKHVFIINPAAGKGRALKLIPIIQEYFKGKSDEYLIKVTEYPGHA
FT                   TKIAREYAQGEVCRIYSLGGDGTVNEVVNGIAGTNASLGVIPAGSGNDFIRSICGEYNV
FT                   REVVADTIGGEERRIDLAMANGKYFINISSIGFDADVVYNAQKFKRLPCVTGSMAYLFS
FT                   LIYTIFKNKINEVIVTIDDKKINLKILLAAVANGRFYGGGMLPAPDAVLDDGLLDICLV
FT                   QEVNRLKMLTLFPKYMKGEHGQIKYVSFLRGRKIKIESKKTISLNIDGEILTGKDIEFE
FT                   ILKGAINVIYPVGTIKECVANF"
FT   gene            55929..57095
FT                   /locus_tag="Ccel_0051"
FT   CDS_pept        55929..57095
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0051"
FT                   /product="nuclease SbcCD, D subunit"
FT                   /note="TIGRFAM: nuclease SbcCD, D subunit; PFAM:
FT                   metallophosphoesterase; KEGG: ctc:CTC00578 exonuclease
FT                   SbcD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74439"
FT                   /db_xref="GOA:B8I3W2"
FT                   /db_xref="InterPro:IPR004593"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR026843"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR041796"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W2"
FT                   /inference="protein motif:TFAM:TIGR00619"
FT                   /protein_id="ACL74439.1"
FT                   /translation="MKIIHTGDWHIGKIVNEFSMLEDQEYILNQLISVIENEKPDALII
FT                   AGDIFDRSIPPVDAVELVDKVFNIVLLDLRVPIFAIAGNHDSAERLSFASRILTNNGLH
FT                   IAGSFDGNIRKVILEDGFGPVNFYLIPYSDPRTIRNILQDNEISTHDDAMKKLVEKVGQ
FT                   AENENKRSVMITHGYITYMGGQADIISESERPLSIGGTDIVNSNYFNSFSYTALGHLHA
FT                   PQRAGADNIRYSGSLLKYSFSEVNQKKGINVVEIDGDGNSCVKLTELKPKRDMRIIKGP
FT                   LEELLKSEVYKDTNTDDYIYAILTDKGELIDPISKLRSVYPNVMGLTKEIGISRDDNKT
FT                   SASEGYKSKSKLELFQEFYSSIQGEPLSFEELKIIEKVIGEVETGGYK"
FT   gene            57092..60241
FT                   /locus_tag="Ccel_0052"
FT   CDS_pept        57092..60241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0052"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: ctc:CTC00579
FT                   exonuclease SbcC"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74440"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038729"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W3"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ACL74440.1"
FT                   /translation="MKPLKLTISAFGPYAGKQFIDFTTLTEQIFVISGPTGAGKTTIFD
FT                   AISFALFGEASGSSRDRDSLRSDFAEPDTETFVELEFELKGKIYKIRRMPQQQQRKLRG
FT                   EGYTLRNADAELLMPNGTLITKIVNVDERINQLLGIDKSQFKQIVMLPQGEFRKLLESD
FT                   SSDREVIFRKIFGTEDFAEIQKRIDDDRASLEKSVHDLKTQINTHISHFDVGEDQTLVD
FT                   MRNSKNINLEQFIYSVERLLQKDKSIIDEIKAELTETIKAQGMLKEEITKCTEVNRKLS
FT                   DREQTKQQYEALLSKGNEYSQKEKNLEYARKALPISEVDEQCRKVKQTLEVKAGELELA
FT                   RQELEKRTCEFKSIAESLNTYKDLEPENKKNETELALLEKMLPKVIEYEKGLKHLNAAR
FT                   AEYTQLTGEFERIQRELETNKIKESQQAETLKLIYTTEAECISLEKQISENRKLLIELD
FT                   GIRKLMGICQEEQNSLENKRAEFASFEKNFCDFRSRLEVMEDNYIRGQAGILAGTLKEN
FT                   TPCPVCGAYDHPKPAEMPSSIPSQEQIRDSKAEFSKLTELRTEKSKAISELNGSVESKY
FT                   KEIIIRLKALDDIIKIDNYAELVGSGRFETVLGQINATGTGLKEKTVELKAQYNSKKEF
FT                   TGKKDAYEKEQTQIRDKVKIQEESVQKMTAQKTGILESITKFQTEAQVIEKEISEDIRS
FT                   ASKLKARIEEQKTKIADFQKEYNQLKKLHESSREAVSNAEKEVAVRVSSVDESREEITR
FT                   QERLLKEKLASSKFGDYEQFLRMKKTQQEIDILQQEITMYYRSLNSLKDLYRHLEEETK
FT                   GLEKQDILLLNTRYAELEQRQQVLQEQHNLVFSRYNNNSRTIKQLTGTMEKLKQLECKY
FT                   GIIAKLAKVAKGDNPQRITFERYVLAAYFDEIIIAANYRLTRMTGSRYLLKRKEEKGKG
FT                   RAQQGLELEVFDNYTGKARHVKTLSGGEGFKASLALALGLADVVQSYSGGISLDTLFVD
FT                   EGFGSLDPESLDGAIECLTEIQKTGRLVGVISHVTEIKERINSVLEVISSKEGSFIKFN
FT                   I"
FT   gene            complement(60279..62507)
FT                   /locus_tag="Ccel_0053"
FT   CDS_pept        complement(60279..62507)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0053"
FT                   /product="1,4-alpha-glucan branching enzyme"
FT                   /note="KEGG: cth:Cthe_2191 1,4-alpha-glucan branching
FT                   enzyme; TIGRFAM: 1,4-alpha-glucan branching enzyme; PFAM:
FT                   glycoside hydrolase family 13 domain protein; alpha amylase
FT                   catalytic region; alpha amylase all-beta; SMART: alpha
FT                   amylase catalytic sub domain"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74441"
FT                   /db_xref="GOA:B8I3W4"
FT                   /db_xref="InterPro:IPR004193"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR006048"
FT                   /db_xref="InterPro:IPR006407"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR037439"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W4"
FT                   /inference="protein motif:TFAM:TIGR01515"
FT                   /protein_id="ACL74441.1"
FT                   /translation="MRKIYAETATSIINGECKDPHSYLGMHLLGVEGKNLQTVVRAFQP
FT                   TAKMVELVDVSAGTSFPMKMECGNGMFEIIFPDRCDIFEYQLKITDLSGNSFITHDPYS
FT                   FWPVISEFDTHLFNQGNHHRIYEKLGAHVMTHNNVNGTLFAVWAPCAKRVSVVGDFNQW
FT                   DGRRHQMRELGSSGIWELFIPLTSEGDLYKYEIMTPDGSLIFKADPYAYYAEKRPATAS
FT                   IVMNIDNYSWGDTQWMAQREENDVFNCPMSIYELHPGTWSTSGEPDENGDIYLNYRVIA
FT                   DRLVPYIKYMGYTHIELLPVAEHPYDGSWGYQVTGYYAVTSRYGKPEDFMYFVDKCHQN
FT                   DIGVLLDWVPAHFPKDAHGLARFDGTALYEHEDPRQGEHPEWGTLVFNHGRNEVRNFLI
FT                   SNAVFWFEKYHIDGLRVDAVASMIYLDYAKKPGQWIPNKYGGNLNLEAADFLKQLNTTV
FT                   FGYFKGIIMVAEESSSWPMITKPPYMGGLGFTFKWNMGWMNDFLKYINMDPIYRKYHHH
FT                   LITFSLMYAFTENYILVLSHDEVVHGKYSMLSKQPGDYWQKFAGLRATYGYTYGHPGKK
FT                   LLFMGGEYGQFIEWNDKKGLDWHLLDYEMHKKLQTYVKDLNTLYRESKALYEVDLSYDG
FT                   FEWIDCNDNDHSVVSFIRKGRDYHDMLIFVCNFTPAVNYNYCIGVPFDLEYELVMNSNY
FT                   EKYGGYDPDDSNKIYTAISDSLHGRPFKLCLTIPSFGVLIFKPIFKDS"
FT   gene            complement(62580..63638)
FT                   /locus_tag="Ccel_0054"
FT   CDS_pept        complement(62580..63638)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0054"
FT                   /product="periplasmic sugar-binding protein"
FT                   /note="KEGG: tte:TTE0289 periplasmic sugar-binding
FT                   proteins"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74442"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W5"
FT                   /inference="similar to AA sequence:KEGG:TTE0289"
FT                   /protein_id="ACL74442.1"
FT                   /translation="MWIKQLKIFLLLASLITMVLLAGCSYKNPIDKPDKITIGLSMATL
FT                   QEERWHRDIEALRAKAQAKGAEILFRNANNNINDQISQVKSLLSKDIDILVIVPQDAEK
FT                   SQQAVQLARNKGIRVICYDRLIKNSNTDFYVSFDNIRVGEYMASLMVSKVPKGNYILIN
FT                   GAKTDYNSFMYNKGFKNILGKYLYEGSIKIVDEVWANDWKPEDAFKCVDKALRDGKKID
FT                   AIIAANDSLAGAAIKALSQRRLAGKVPVAGHDADISGCQRVAEGTQLLTVYKPIDQLAE
FT                   KAIDVVLGLLNNDYYACNKFINDGESDIPYEMVEPVVVTKDTLVDTVISAGFHKLEDVY
FT                   RNVPESKWPRKK"
FT   sig_peptide     complement(63555..63638)
FT                   /locus_tag="Ccel_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.741 at
FT                   residue 28"
FT   gene            63997..64281
FT                   /locus_tag="Ccel_0055"
FT   CDS_pept        63997..64281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0055"
FT                   /product="ribosomal protein S6"
FT                   /note="PFAM: ribosomal protein S6; KEGG: cth:Cthe_2187 SSU
FT                   ribosomal protein S6P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74443"
FT                   /db_xref="GOA:B8I3W6"
FT                   /db_xref="InterPro:IPR000529"
FT                   /db_xref="InterPro:IPR014717"
FT                   /db_xref="InterPro:IPR020814"
FT                   /db_xref="InterPro:IPR035980"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W6"
FT                   /inference="protein motif:PFAM:PF01250"
FT                   /protein_id="ACL74443.1"
FT                   /translation="MLKNYETIFIINSEVGEENTKALVEKFKTMLETSAQLESMDEWGK
FT                   RKLAYEIDDKTEGYYVLANFSSSPDFPAELERMYKITEGILKYIIIKKD"
FT   gene            64293..64721
FT                   /locus_tag="Ccel_0056"
FT   CDS_pept        64293..64721
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0056"
FT                   /product="single-strand binding protein"
FT                   /note="TIGRFAM: single-strand binding protein; PFAM:
FT                   single-strand binding protein/Primosomal replication
FT                   protein n; KEGG: cth:Cthe_2186 single-strand binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74444"
FT                   /db_xref="GOA:B8I3W7"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W7"
FT                   /inference="protein motif:TFAM:TIGR00621"
FT                   /protein_id="ACL74444.1"
FT                   /translation="MNKVLLMGRLTKDPDLRYTSGNNTAVASFTLAVNRRFAREGQPQA
FT                   DFINIVAWDRSAEFCGKYFTKGMQVAVVGRIQTRTWDDNEGKRHYVTEVVAEETYFADS
FT                   KRNSEAGNSGSTQKTYSETPAASGDGFYPMDEDDELPF"
FT   gene            65010..65303
FT                   /locus_tag="Ccel_0057"
FT   CDS_pept        65010..65303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0057"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: cth:Cthe_2185 30S
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74445"
FT                   /db_xref="GOA:B8I3W8"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W8"
FT                   /inference="protein motif:PFAM:PF01084"
FT                   /protein_id="ACL74445.1"
FT                   /translation="MPGPKRDNRRNDRDSYDKGEGKGGMRMRRVKKKVCSFCVDKATDI
FT                   DYKDVAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKRARHIALLPYTAE"
FT   gene            complement(65420..65758)
FT                   /locus_tag="Ccel_0058"
FT   CDS_pept        complement(65420..65758)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0058"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   ckl:CKL_2928 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74446"
FT                   /db_xref="GOA:B8I3W9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3W9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL74446.1"
FT                   /translation="MSQKDKPTFLVLLGKKIRQSRLHKGLTQEDLSEITGLHPSYIGQI
FT                   ERGEKSPSVETLIDISKSLDTSISYILNVPDYKMKKELSDLVLLCSEANKEEIYKITEI
FT                   AKIILKRT"
FT   gene            66103..66315
FT                   /locus_tag="Ccel_0059"
FT   CDS_pept        66103..66315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0059"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74447"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3X0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74447.1"
FT                   /translation="MRRCSRCCLKNLWETKGADEIINKIEKQYSFSSDKLYTRACVYTL
FT                   TGKLKLALDYLRKHQRWGKKIQSNV"
FT   gene            66526..66897
FT                   /locus_tag="Ccel_0060"
FT   CDS_pept        66526..66897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0060"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0060"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74448"
FT                   /db_xref="UniProtKB/TrEMBL:B8I3X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74448.1"
FT                   /translation="MNYRTRWAYLRFTKKVGDNIKIPMIVLDACVGKGAGSKILTEIEG
FT                   EVLELLISAEQGAYSINIFDDLINYFCPDISYTDICYSDEIITKEILMEVIKSIQLKKF
FT                   VNFKDAFFDKEIKKVFLRK"
FT   gene            67215..67685
FT                   /locus_tag="Ccel_0061"
FT   CDS_pept        67215..67685
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0061"
FT                   /product="transposase IS200-family protein"
FT                   /note="PFAM: transposase IS200-family protein; KEGG:
FT                   cac:CAC3531 IS605/IS200-like transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74449"
FT                   /db_xref="GOA:B8I495"
FT                   /db_xref="InterPro:IPR002686"
FT                   /db_xref="InterPro:IPR036515"
FT                   /db_xref="UniProtKB/TrEMBL:B8I495"
FT                   /inference="protein motif:PFAM:PF01797"
FT                   /protein_id="ACL74449.1"
FT                   /translation="MDSESLAHSKYNCKYHIVFAPKYRRQVIYGKIKADIGQILRKLCD
FT                   QKGVEIIEANACPDHIHMLVSIPPKISVSSFMGYLKGKSSLMIFDRHANLKYKYGNRHF
FT                   WCKGFYVDTVGKNKNAIAKYIQNQLQNDIASDQMSLIEHIDPFTGEPVKKGK"
FT   gene            68141..69136
FT                   /locus_tag="Ccel_0062"
FT   CDS_pept        68141..69136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0062"
FT                   /product="hydrolase (metallo-beta-lactamase
FT                   superfamily)-like protein"
FT                   /note="KEGG: shl:Shal_0525 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74450"
FT                   /db_xref="GOA:B8I496"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8I496"
FT                   /inference="protein motif:COG:COG2333"
FT                   /protein_id="ACL74450.1"
FT                   /translation="MDITVIRAGRGDCIWIRWEDQCVHNIIIDSGPAATKAIFRRLIQQ
FT                   EITSKGEAIDLLVLTHIDDDHIRGFLYYLADYYSSTNANTFREVWFNTGICCLSCDHSP
FT                   NSAAKLSCKLNNLGIHYSDSVLRGDSISIGDVTLKVICPFAEAVGHVNKIILQQQPSLH
FT                   AASINKPLEDILANDCFQMDSSDTNKASIAMVLTYCGKYRIAFLGDAHEKEVREGLVEF
FT                   FPGQAMNLVKLSHHGSSHNLSNELIDILNTRQYILSSSRDMDIITLARLYQKVSSTKET
FT                   TVIYSNYSQLLAKQRLVEAGNKLLKIETLDAKPQLLWKEGDLVCRIRTIR"
FT   gene            69576..70424
FT                   /locus_tag="Ccel_0063"
FT   CDS_pept        69576..70424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0063"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74451"
FT                   /db_xref="UniProtKB/TrEMBL:B8I497"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74451.1"
FT                   /translation="MAFYNRDSRISESDPDAELKGFSGGGVFALLQNTIFLCGIYPGVP
FT                   SDAVHYRDFNVLSLQAFQETCASNFLPIPDFQPLIPDSLRKHLFVCQSEIDVGHILKDY
FT                   LQDVSRCNFSGLICSSCGHCNPCEYGEHFYLCDRFQQQLLKSSALLSHHNDGFDEHEAL
FT                   KVKKGEDYHEVHIICSDVRPTHVSGLIRAIKQDYLGRNILPENSLILWASKERCKQSLS
FT                   NCTRAEYQNIISDIARAYPNPSDFSDVNEAPEQLAIMNIPYILDEMETNSNAFADFVNR
FT                   M"
FT   gene            70435..70953
FT                   /locus_tag="Ccel_0064"
FT   CDS_pept        70435..70953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0064"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chu:CHU_0039 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74452"
FT                   /db_xref="UniProtKB/TrEMBL:B8I498"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74452.1"
FT                   /translation="MEQLVDLESQLNQMFDSAFRIRCYAYSTYGYPVRIICAFPLGNLE
FT                   DNWKSLNDAISFKLQAQIHNTVERYNIYLLIFELNISTELRRIIESDRYCCRKIVLPES
FT                   MPENDNTLENLVENRLFYFIEQTVSPDNVQSVQTLINSIDPSGQLLDLIANLRSRISDE
FT                   DVQGVINIL"
FT   gene            70967..73924
FT                   /locus_tag="Ccel_0065"
FT   CDS_pept        70967..73924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0065"
FT                   /product="SMC domain protein"
FT                   /note="PFAM: SMC domain protein; KEGG: sun:SUN_0732
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74453"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041685"
FT                   /db_xref="UniProtKB/TrEMBL:B8I499"
FT                   /inference="protein motif:PFAM:PF02463"
FT                   /protein_id="ACL74453.1"
FT                   /translation="MYKLSKIELDNFRVFKGHKTIEFLNRTGSPYNFICIYGSNGSGKT
FT                   ALVDAFEWLATGKLHRIDSDMQVQGKSYEGAILTHIEAYDNDQRANVVAHFIDSNRDTL
FT                   QYKRNIRIRRDSINDYLSGNCTGSGLSAKQILPYSRVAGFVSAEKPEQRFTSWAGFINP
FT                   EDQSFSLLTNTYRLRSKIKSALEKTERELGEVTTALVNCNLDAGLVSVLNSDILSYNEL
FT                   YTEILSEEKPIEPLHQNDLGIYQIPDLSSIKAIQLRVSGELERFRSREPIFRQLIDNYP
FT                   VYHKAEDDLVNIYKVEKIYQERIKKIHQKKEFDTLSRNVGSLYDALTHLLKECTDDINE
FT                   QIKVSMAQKDKLEKERKTWRQQLEQIEKDTVDLKKYDPNPIYLNAVEQQKVLQNGLASL
FT                   AQISLYIESHKFEDASTLTTTLSQEFRNEVLEKIHELTLQNDLIQSTIKQRTQISLQIR
FT                   ESESSCNEVIASIEKIRAQITSEQLNACPICKTEFSTTESLLARIEQEFCSKDLAEARA
FT                   EYNTKDLQLRNFRESYKSMVQSWNIIKQNTSKVLEVKLTDLNKEIEEISVKVEHFNRSI
FT                   FLLEEQRQLLIAQLNSIIDFTGELTLDVFDLLIKNTYQRLHESHVQKESMLSQICILSE
FT                   RLHAVMLCLPGETKDAQKQLEISLHLLPIQSERINTLKVSTQEYISKVDQLVSMHETLL
FT                   DFCEVNSDELQTCNTKVSDLVQQQSTLKLIINDYQNLVFKAHLDQQTAIEQVKQQFFNE
FT                   QNIKDILETKISVSLINILSHETELLNYQNQYKKLIKQKNELNKKVEVVKRAFEKTDNL
FT                   YNSMCSIQQGVVDQAFAGEMVNEIYRLLEPNKDFPRLSFKIDFNSTERPELYINAHERD
FT                   MSNSIVLPELIFSTAQLNTISLCIFLSNALSNSRLDSQTLILDDPISSFDDINTVAFSD
FT                   LLRILCVQNDWQIIFTTHDEKLFRLLQVKLSPEYHNSLFLQFKDKGQLVDIRHLI"
FT   gene            74147..77449
FT                   /locus_tag="Ccel_0066"
FT   CDS_pept        74147..77449
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0066"
FT                   /product="type III restriction protein res subunit"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: nwi:Nwi_2131 DEAD/DEAH
FT                   box helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74454"
FT                   /db_xref="GOA:B8I4A0"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A0"
FT                   /inference="protein motif:PFAM:PF04851"
FT                   /protein_id="ACL74454.1"
FT                   /translation="MMKLFPDWQGKITLPLSPLRREVVGGNAVCQQAFRGGDTIAEAEA
FT                   LDNEGYYLVKTRLLFPFNELLLRRKGTRHIETNYLVLLAPDLKRIYELGPDTRLEWDDL
FT                   GLLTRSFRNPEQILESWKGKFSFREEDNVTGAKGLRPPQIGALHAIAAHFAVGKNFEPA
FT                   TVVLPTGTGKTETMLSMQVYKRLLRTLVIVPSDALRTQIYKKFLTLGVLPDLEVVPSET
FT                   IGPNVTRLVTGIRSKEEALAIIEKSNIIITLPKTLSASDPEALRILTEYCTDLIVDEAH
FT                   HIPASQWSLVCQMFSDKRITQFTATPFRRDNKRIDGKIIFNYKLGDAQAADYYRPINLK
FT                   TIEEFGDKEQRDLCIAEEALTALRRDRNELHLDHILMARCESKERAVNVFELYQKLAPE
FT                   MLPQLVYSGPGRIHKNREALEKLIQRKKNAAQIVVCVDMLGEGFDLPNLKVAALHDTHK
FT                   SLAITLQFIGRFTRKGNWEQIGEATVVVNIADSETETKLEALYAEGADWDSLIKRLSED
FT                   RIDQEIRLQKIVHNLRESGDLHTFLSLWNLRPSLSMQVFKTQCQNWSPENYFNVFSKDS
FT                   KSWHAISKDNDILIAVVHRKARVRWGNYQNLFDRQYHLLMARWDKENGALFIHASDYEE
FT                   LKSTTLAKEITNDKTVLLQGPVIFNILNNVELPLVKNLGSSRIGAISFTSYFGPNVTEG
FT                   LALIERAESTLNNIACVGYENGERVLWGGTQRRGKIWQQSSGTISQWIDWTAHTWEKVS
FT                   TQDNIDVANITNEFLRPHKLSQPYNQYPISVQWGEQVQASFSNNQSIVFDTTEVPLYLV
FT                   DLQISEVRDNGEIIIRLSSDTNSSEYSFQINDDSESGYYYKKISGPDVYFAKGTNIKTE
FT                   VCEYFVVDPVIVRYVDGTYSYNCYHIPIPLKAGEYPRERIEVWDWASIPLNKESIGKTG
FT                   NKNTIQYQSFLTISDKYDVVFNDDGKGEAGDLVCLKDIDESTIKLCLVHCKGALGGQIS
FT                   NDIGNFYTLCGQAQKSITVKHMGMTRLYNDLKRRHEIWARAGYSRFLKGDMKYLSYFKE
FT                   KSRRSKLQFEVIIVQPGGSKAALSTDILKLLGTTELFLKTTTQGNLRVVVSP"
FT   gene            77670..78827
FT                   /locus_tag="Ccel_0067"
FT   CDS_pept        77670..78827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0067"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: cbl:CLK_1309
FT                   site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74455"
FT                   /db_xref="GOA:B8I4A1"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A1"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL74455.1"
FT                   /translation="MHLEKAIYKNGKKKYLIVDENFVIHEEALFFSNFLYSEGYAINTI
FT                   EGYLRDLKIFLEYLESKDILLGEVRPIHVSQFMDYLRGHELEEIINLSESERRKATTVK
FT                   RILSSLSTFYKSLDAADAKSNSPFTYLDGIKPQDMYKTFLSYTRGSKIKKRNVGIRQKR
FT                   TDGETSQVVRKYSNRTGKRLFTDEVDIFYKGLTGTRNKLIFDILYETGMRIGELLSLKV
FT                   NDYSEVDPWNLFGYIYIIYDEENDDQNRQQKTGSRTLVTTMKLLGRIEEYITEIRPYIK
FT                   EQEYIFVAESGKTKGQPLSRSLIEKVFSECTEKTGIKCTPHMLRHTHLTELSEFGFDEI
FT                   FLKGRAGHRSIHTTEKYTHPSLEAQVRAYERYMKARTSKWGTSKE"
FT   gene            78824..80209
FT                   /locus_tag="Ccel_0068"
FT   CDS_pept        78824..80209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0068"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: amt:Amet_1594
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74456"
FT                   /db_xref="GOA:B8I4A2"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR025269"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A2"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL74456.1"
FT                   /translation="MIVNYDDDIWRIPATNNYSITDYNFEFGRFKSPTLKMQVKDYMYA
FT                   HLKRDVVEHSTLHRYCYSLQHFANFIESNEIWLSYFSELTPLMIDQFILYLKRELKSPK
FT                   TMVVAFSALKSVVRFGQFLQSEKYPPMQIFPDSPCRIFGIEDTLTTKCISNFVMIQINQ
FT                   ALKKEQDILLKTCLLIAKETGLRLSEILLLEEGCVMEDFLGSPILFTFSPKIDDERAVV
FT                   ISTELLKVVNELNRYTKEFRKKNNTLLLFVRKAKKKCRKEIVQYNQSIARSELRDFKIR
FT                   NKIVDESGQIADFTFHSFRHTLGTDMINNGMSPIDVRSQLGHVSMHSTGIYARVSNTSL
FT                   QNEYAKLGFIGISEKTLSDVYSISEKVIAEEKKIQGALPDGICTKVFEGETHCSKFNMC
FT                   LFCDKYRTFIKDLPTHKEHLERLRKDRIQYMSEMSIGNQEFLQRIEDALVTIIERLETL
FT                   ACT"
FT   gene            80200..81753
FT                   /locus_tag="Ccel_0069"
FT   CDS_pept        80200..81753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0069"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: amt:Amet_1595
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74457"
FT                   /db_xref="GOA:B8I4A3"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A3"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL74457.1"
FT                   /translation="MYLVDFIGYRPEYFEQGYTHFKIGNSFFEDDTWNFIGLTPEQAGK
FT                   PDCRFLIKFGEIKKPRLRFTTKQIVLSWCLTLEILSVQRKLVGIKKFIHFIEHEYPEID
FT                   AYSKVNKGIVCSYITWMLGVKKNGKLLSASDIKFGSLGLKDLFIEGMRKGWDVPQNCGW
FT                   IALLHEEMVLKSPRVRKFSREKTTKKAYAKETIETIIKCALQDDNIFVRAAVIIQTQVG
FT                   LRISELLSIKDGCINYVNGIPQLTYITTKTKKQPMSVEKPINSLVVQVITELEEYTRAI
FT                   RKKAGLESLFVHRIRYDTKTVIIAYHTFGKNFLRPFVKRWDIKEDGEPLELTSHYFRHF
FT                   FAQGAWKGGMPVQFISKMLNHDSLVMTETYTYSLQEQMNEKFIEIMSNPENLAGVGIGR
FT                   IKERLRSENPFQGKTEREIKIIMEAMRIRILANGICMHHPARRESCPISDGESCMHCPN
FT                   FVSPRVCIPVHKLRVERITDEIKRAEKQGNTIWLSKLMQEKEYIEQNFIRKFECREVVQ
FT                   "
FT   gene            81750..82196
FT                   /locus_tag="Ccel_0070"
FT   CDS_pept        81750..82196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0070"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cyt:cce_4564 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74458"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74458.1"
FT                   /translation="MSKDYANVDGLLKYHVERNKETINKVNKAISDFKKGKKKITVKAV
FT                   AKKANVSVATIYNNPALKERIDQLKDIQRGGKDIDAGSTIKSIKKVKMDEMRDTINRLR
FT                   TNLEAERQKNGLLLGELEKKTSENIELKARVAQYRNYIESAKKQ"
FT   gene            82681..84462
FT                   /locus_tag="Ccel_0071"
FT   CDS_pept        82681..84462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0071"
FT                   /product="SEC-C motif domain protein"
FT                   /note="PFAM: SEC-C motif domain protein; KEGG:
FT                   cth:Cthe_1113 SecC motif-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74459"
FT                   /db_xref="InterPro:IPR004027"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A5"
FT                   /inference="protein motif:PFAM:PF02810"
FT                   /protein_id="ACL74459.1"
FT                   /translation="MEEKIKLLKEKLQSFGTRDLLGMIGVQFLTFGNNAADVTEQSDIF
FT                   KKTDLTSPHKQYTYLAGLLMSTDDHSNGVTNDNFRKYKELEEDIESITLEYTKTFLDFG
FT                   DTPDNPDFDIVKRNLVSMQAFTSYFDMDILRYKEQTENLIKGLYIPFNKELEQLTSLNV
FT                   NDYLTFFHMIEDSFSNALDDGKAATQRLQTFLNSFDPTPGNIENEFQRLISGDNGRIGR
FT                   EIQNAMDVLNTISKDKLIHTFGEAKGKKLLEIFALERKERNFLFYNRPNPFAEKPLCWL
FT                   DNGQTLYIVHPTFVLSAIFNFITNTLENPKNSFAEKYKREKGNITENLFHQQLVKVFGD
FT                   SATYHTSVCEERGTKEHDILIEYKDYIFIAEVKASKVREPFFNPQKAFPRIKDHFNSDT
FT                   GIGGAYQQAIVLKKLIESSDVLTLYEEKTKPFALTHCSSKTILPLVLTLNQFGSIAVNT
FT                   TLLLDKEDDQPYPWVCNLHDLENIIEINTYLKKDTRDFIEYILWRIKNHKVTLSSDELD
FT                   VIEGYYFDKNARIAKDTNMFFLPTGPSLIDKIYFEKKCIPYHFPPLDSMPLKSQKVGRN
FT                   DPCSCGSGKKYKKCCGA"
FT   gene            84739..87255
FT                   /locus_tag="Ccel_0072"
FT   CDS_pept        84739..87255
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0072"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: abm:ABSDF3536 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74460"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR039444"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74460.1"
FT                   /translation="MIPIELLKEISENKAVLFLGAGASKQSGGPIGCELTEFIANELNI
FT                   QKIQNSDLAIFTQYLIKSNYASRKEIELAIKNRLQSLPPSNGYKAMTVIPWKEIYSVNF
FT                   DDLVEQSYKSYRGLYDCKIMTEDNLQDEIESNQIPLYKMHGSIGDVYSPQKPLVITYDD
FT                   LINPNSYKEQLIKRLTNRLLETVIFIGYSFSDGVIEEILKSFKRSGNFDGIKRKYAVLP
FT                   TPSDEDKLKYQSIYNIEIIDMKSDDFFLDVKNHFDQEYRAKLRAFSKSLSIFCGNSKVT
FT                   FDPQIKSLIDNYFEYYDENKNYPNDANCFYRCGAPHWGNIKMNLDINRNVLIDGENYTY
FT                   TLINTTNIPDIIFSKLQDNENKITIYKITGPIAVGKSTLCYRIAYELYNKGVLALFSNT
FT                   SESIRPGLLTEIHKALKRPFVVIVDDAVNYDRKISMMIKECEKSGLEVSFIIAVRENDW
FT                   ECLLDYQFKRRLNNKSITIRLEDKLDKQQSTELAEKLFINNILIETVEQTKQDLIKKFV
FT                   QSKNLVASLMTSIENTDFEKKLAHDYDRYSPETQNAYGIISLVNRLCLPFKWELLQRSL
FT                   YRSYCIEWDVFTEKVIKAEAKGNIIQYGYGANYYFSCRHNLIAQLISDIHYKGDRFKEI
FT                   KDLKNIILSVNKFSHEEIFIGKLVQYIVSRGELDLGYSYKQIIEILDCAILNISNPYFL
FT                   LHVKGQYIMESQKDFDGALKCFNKCIDDEKNLQYALHSAAMAHFNIASSLESDSGVRHI
FT                   EIRKTKDLLIKGSIHFPDNPFFYKTMLQLLDFDSCNSIHESNYLLAKSTMEKYKKYCSL
FT                   DKDPEVFDLFEKLKMKQQQSLNQPCG"
FT   gene            complement(87609..88196)
FT                   /locus_tag="Ccel_0073"
FT   CDS_pept        complement(87609..88196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0073"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74461"
FT                   /db_xref="GOA:B8I4A7"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74461.1"
FT                   /translation="MTFYSCIKEILNWLYTLSGIAVTLTIFIGIKQVRHMQKDSADNLY
FT                   RQSIDKAVEYITRFSEITLPALKDYQAKIANKNPKTWSKKSEYSFEVSDEERELLYKID
FT                   IIEIGKLGIFKIINELEILSIGVNTGMINDETVFGCIGKLFCEAVESTYDAICYFRVVE
FT                   NAGLFNNIEKLYKEWRPKFEDIISTITVDIGV"
FT   gene            88905..89834
FT                   /locus_tag="Ccel_0074"
FT   CDS_pept        88905..89834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hch:HCH_04427 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74462"
FT                   /db_xref="InterPro:IPR021352"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A8"
FT                   /inference="similar to AA sequence:KEGG:HCH_04427"
FT                   /protein_id="ACL74462.1"
FT                   /translation="MPNELIPEIESILRSKFYDIVGKYYEIPKILYHYTNITGLVGIIG
FT                   SQKLWATDRRFLNDSSEISYGLELVKEILSEKIENEKSEVVSEFMRRSLNIDIVINIYE
FT                   IYISCFCEEGNLLSQWRGYGDKGDGYSIGIEPEKIKNRNYQIGKVIYSREEQNFIINSI
FT                   LDYHCKLISELACERGVKANRDLITSFTLNFSTLVSQIICLFKHPTFAEEKEWRYVYLI
FT                   PKYTKPSESIFFSSLDTVKFRNNSEYLIPYIEIDLVNEENEFKIPIKRVISGPSKQPEL
FT                   KKVSLEQFMEKKECFKIEIIDSNIPFRN"
FT   gene            90250..90540
FT                   /locus_tag="Ccel_0075"
FT   CDS_pept        90250..90540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0075"
FT                   /product="ribosomal protein S18"
FT                   /note="PFAM: ribosomal protein S18; KEGG: cth:Cthe_2185 30S
FT                   ribosomal protein S18"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74463"
FT                   /db_xref="GOA:B8I4A9"
FT                   /db_xref="InterPro:IPR001648"
FT                   /db_xref="InterPro:IPR018275"
FT                   /db_xref="InterPro:IPR036870"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4A9"
FT                   /inference="protein motif:PFAM:PF01084"
FT                   /protein_id="ACL74463.1"
FT                   /translation="MPGPKRDNRRNDRDYDKGEGKGGMRMRRVKKKVCSFCVDKATDID
FT                   YKDIAKIRKYVSERGKILPRRISGNCAKHQRQLTVAVKRARHIALLPYTAE"
FT   gene            complement(90746..91423)
FT                   /locus_tag="Ccel_0076"
FT   CDS_pept        complement(90746..91423)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: gme:Gmet_2951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74464"
FT                   /db_xref="InterPro:IPR012808"
FT                   /db_xref="InterPro:IPR015996"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B0"
FT                   /inference="similar to AA sequence:KEGG:Gmet_2951"
FT                   /protein_id="ACL74464.1"
FT                   /translation="MSFNGFSGEALKFLFENRMNNSKEWYDSHKPDYKKYVYVPFVELI
FT                   KELTPAMLEIDQQIITIPSKLISRVRRDTRFTKDKTLYRDNAWIVFLRDKSIMSTSPSF
FT                   WFGITQKGSSYGVGFYGVETSSMANMREMIIKRHPLFMDALACYESQNKFVIGGDMYKR
FT                   SKFPDQPENLKLWLDRKNIYFESVQEGFNLAFSKELPDVLRQDFLRLKPIYDFLSMLAA
FT                   YGG"
FT   gene            91604..91918
FT                   /locus_tag="Ccel_0077"
FT   CDS_pept        91604..91918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0077"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fno:Fnod_0976 glycine cleavage system
FT                   aminomethyltransferase T"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74465"
FT                   /db_xref="InterPro:IPR018551"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74465.1"
FT                   /translation="MDREQDQIMWKYLTTADNEFEFNIIKGKLEENGIVCVGKGKDLGL
FT                   IDSTLLNVILGPCVPIEIKVPEDRYQEALEIINTEVSEEELEKQALDSGKNEQENEDNS
FT                   "
FT   gene            92021..92863
FT                   /locus_tag="Ccel_0078"
FT   CDS_pept        92021..92863
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0078"
FT                   /product="prephenate dehydratase"
FT                   /note="PFAM: prephenate dehydratase; amino acid-binding ACT
FT                   domain protein; KEGG: cth:Cthe_2260 prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74466"
FT                   /db_xref="GOA:B8I4B2"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B2"
FT                   /inference="protein motif:PFAM:PF00800"
FT                   /protein_id="ACL74466.1"
FT                   /translation="MVKSIGYLGPFGTFSHEAAGLYAKGQSCTLLEFGSIQDVLYAVKD
FT                   NKIIEAIVPIENSLEGAVNVTLDVLAKEEGLYIKGEIILPVSLNLVVRKGTLPEDITTI
FT                   MSHPQPLGQARDFLNKYYPKVVQVEENSTSQAAQRVSEGDGTYAAITSRTAAKINGLEV
FT                   LAGDIQDVVNNHTRFVVISKEFPKRTGCDKTSIVFSTDNKPGSLYRILDIFSLWDINMT
FT                   RIESRPSKNALGQYIFFIDIDGHIEDQDVFDALTMIKRKTSFYRFIGSYPVYNGKNGE"
FT   gene            92956..93300
FT                   /locus_tag="Ccel_0079"
FT   CDS_pept        92956..93300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0079"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2259 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74467"
FT                   /db_xref="GOA:B8I4B3"
FT                   /db_xref="InterPro:IPR025984"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B3"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2259"
FT                   /protein_id="ACL74467.1"
FT                   /translation="MAQFDNQIDITRNVKIIEWLKSELLTDVANLFKALVNGFREEVSE
FT                   TFADTLANIILICYLLGKRFGINYRTIEMKIDSKIRLGLVENHDVEKYYGDLSALAKHL
FT                   NGSRSGRQGA"
FT   gene            93316..95319
FT                   /locus_tag="Ccel_0080"
FT   CDS_pept        93316..95319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0080"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: cth:Cthe_2258 phosphoesterase,
FT                   RecJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74468"
FT                   /db_xref="GOA:B8I4B4"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B4"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ACL74468.1"
FT                   /translation="MDSRKLSRIFIPKAGFYLWVIFFLIAVITFLKPLVSIPGYILFVF
FT                   LVIYNYKSTHIRNREITKYIETLTFNIDCATKDTLLNFPMPLVLAELDGTTVWYNSSFK
FT                   GIFQNDTVQQETVAELVTDLKPQMTEGDSINISSEVTINDRHYSVLGNLVKLDDSNNEE
FT                   SIIVMFYLVDNTELINEKQRFEDNKNTVGLIVIDNYDDLMQSMEDSVRQQLLAEIDKKV
FT                   TNWISHTGGVLKKFERDKYLCIFAFKYLHELEEKRFEILETVKEINLGNKIPVTLSIGL
FT                   GINAPTIVENLQNSYACIDIALGRGGDHVVIKDGDNFRFFGGRTRELEKRTRVKARVIA
FT                   YALRGLIDQAPSVLIMGHENADIDCLGAALGIYRIVKNRDKRVNIVLNHSNANIDAILN
FT                   KMAKEPEYNNVFVGTNEALDLITKKTLLIVVDTHKPGFTEAPELLKMTDQVVIIDHHRR
FT                   GADFIQDAVLSYQETYASSTCELVTELLQYVEDRIRLTNIETEALYAGIVVDTKNFIFK
FT                   TGVRTFEAASYLRRQGADTVSVKQLFQNDLKTYITISNIVKDAEVVYDNIAISICPSNV
FT                   KGAQLIAAQAADQLLSLAGLVAAFVLSYHDGEVVISGRSLGDINVQMILEKLGGGGHLT
FT                   VAGAQIEGVSIQDAKKMLKDAIYEYIDSLAKE"
FT   gene            95349..95795
FT                   /locus_tag="Ccel_0081"
FT   CDS_pept        95349..95795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0081"
FT                   /product="ribosomal protein L9"
FT                   /note="PFAM: ribosomal protein L9; KEGG: cth:Cthe_2257 50S
FT                   ribosomal protein L9P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74469"
FT                   /db_xref="GOA:B8I4B5"
FT                   /db_xref="InterPro:IPR000244"
FT                   /db_xref="InterPro:IPR009027"
FT                   /db_xref="InterPro:IPR020069"
FT                   /db_xref="InterPro:IPR020070"
FT                   /db_xref="InterPro:IPR020594"
FT                   /db_xref="InterPro:IPR036791"
FT                   /db_xref="InterPro:IPR036935"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4B5"
FT                   /inference="protein motif:PFAM:PF01281"
FT                   /protein_id="ACL74469.1"
FT                   /translation="MKVILKQDVKGLGKKEQMVEASDGYARNFLLPKGLAVEATSANVN
FT                   IMKTKKEAEAQKKEREVAQAKELAKKIKDITVTLKVKAGENGKLFGSITSKDVAEALKT
FT                   QQKLDIDKKKLVMPDSVKSIGTFDVEVKLYPEINSKFTVKIENL"
FT   gene            95838..97178
FT                   /locus_tag="Ccel_0082"
FT   CDS_pept        95838..97178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0082"
FT                   /product="replicative DNA helicase"
FT                   /note="TIGRFAM: replicative DNA helicase; PFAM: DnaB domain
FT                   protein helicase domain protein; KEGG: cth:Cthe_2256
FT                   primary replicative DNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0082"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74470"
FT                   /db_xref="GOA:B8I4B6"
FT                   /db_xref="InterPro:IPR007692"
FT                   /db_xref="InterPro:IPR007693"
FT                   /db_xref="InterPro:IPR007694"
FT                   /db_xref="InterPro:IPR016136"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036185"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B6"
FT                   /inference="protein motif:TFAM:TIGR00665"
FT                   /protein_id="ACL74470.1"
FT                   /translation="MDIGTLGRIPPQSLEAEQSVLGSMLIDKEVVPVVMEVLKSEDFYR
FT                   PDHKEIYDVIIELFDRAQPIDLITVSERLKLHGKLELVGGLEYLTNIATEVPTTANVKH
FT                   YAKIVEEKALLRKLIKASSDIVDLGYNASEEVTYILDRAEQNIFDILQKRSSQGFVPIK
FT                   DVLVDTFNKLEELYNSSGNITGIPTGFTDLDFKTSGLHNSDLILIAARPAMGKTAFALN
FT                   LAQNAAVHSNVPVAVFSLEMSREQLVNRMLCSEAMVDSNRMKTGKLEDNDWQKVAKALG
FT                   PLSEAPIFIDDTPGVSITEIRAKCRRLKLEHNLGLVIIDYLQLMQGSRSKSENRQQEIS
FT                   EISRSLKILAKEINVPVITLSQLSRAPEARTDHRPILSDLRESGAIEQDADIVMFLYRD
FT                   DYYNPETEKKNIAEVILAKHRNGSTGTVELVWLGQYTKFANLEKFRQ"
FT   gene            97179..98624
FT                   /locus_tag="Ccel_0083"
FT   CDS_pept        97179..98624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0083"
FT                   /product="tRNA(Ile)-lysidine synthetase"
FT                   /note="TIGRFAM: tRNA(Ile)-lysidine synthetase; PFAM:
FT                   PP-loop domain protein; KEGG: cth:Cthe_2255
FT                   tRNA(Ile)-lysidine synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74471"
FT                   /db_xref="GOA:B8I4B7"
FT                   /db_xref="InterPro:IPR011063"
FT                   /db_xref="InterPro:IPR012094"
FT                   /db_xref="InterPro:IPR012795"
FT                   /db_xref="InterPro:IPR012796"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B7"
FT                   /inference="protein motif:TFAM:TIGR02432"
FT                   /protein_id="ACL74471.1"
FT                   /translation="MQIKEMVMLKQLVLETIKNKELINYGEGIVVGISGGYDSVCLLHI
FT                   LYSISNELGIKIYPVHVNHMLRGDEALRDENFVKSFCSSLGLEVYIKHIDIAKKAKTEK
FT                   ISLEEAGRNARYEVFSLVAGERGASKIAVAHSRNDQAETILMRICRGTGLEGLRGMEYK
FT                   RDNIIRPLLDADRSQIEEYVNGIGVEAVTDSSNLHTDYFRNRIRIDVIPAINIASGSDI
FT                   TENLLRLSKIVVAEDDYLRYNSELYYQKSVLSERKMYTELDLNVLDEIHQSVRLRVLRI
FT                   AIEKTCGTLNGWGYIHLDKLNNLIENGRTGAQIDLPHGVAAVKSYGSLILKEQGKEHQE
FT                   QFEKKLIIPGETEIQRFGLIVKTEIYKFETNKSCRQFINNNEKVNTKFIDLEKVTAMGE
FT                   NLQIRNRRDGDIFKPLKSNGTKKLKEYFIDNKIPRQVRSTIPLIALNKDIVWVIGNKIS
FT                   DNYKVTDNTKMVLKITFIQKKKN"
FT   gene            98660..99199
FT                   /locus_tag="Ccel_0084"
FT   CDS_pept        98660..99199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0084"
FT                   /product="hypoxanthine phosphoribosyltransferase"
FT                   /note="TIGRFAM: hypoxanthine phosphoribosyltransferase;
FT                   PFAM: phosphoribosyltransferase; KEGG: cth:Cthe_2254
FT                   hypoxanthine phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74472"
FT                   /db_xref="GOA:B8I4B8"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005904"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4B8"
FT                   /inference="protein motif:TFAM:TIGR01203"
FT                   /protein_id="ACL74472.1"
FT                   /translation="MDVVERILVSKEQLDKQVEELGARISRDYEGQELVIIGVLKGGFI
FT                   FLADLARKITIPVDLDFMSVSSYGNSSKSSGIVKIIKDVDTDITGKHVLIVEDIIDTGL
FT                   TLNHLVELLKTRGPLSVKVCAALDKPSRRKVDLKVDYKGIEIPDEFVIGYGLDYAGKYR
FT                   NIQEVCVLKREVYTKK"
FT   gene            99447..101306
FT                   /locus_tag="Ccel_0085"
FT   CDS_pept        99447..101306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0085"
FT                   /product="ATP-dependent metalloprotease FtsH"
FT                   /note="KEGG: cth:Cthe_2253 ATP-dependent metalloprotease
FT                   FtsH; TIGRFAM: ATP-dependent metalloprotease FtsH; PFAM:
FT                   peptidase M41; AAA ATPase central domain protein; peptidase
FT                   M41 FtsH extracellular; ATPase associated with various
FT                   cellular activities AAA_5; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74473"
FT                   /db_xref="GOA:B8I4B9"
FT                   /db_xref="InterPro:IPR000642"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR003960"
FT                   /db_xref="InterPro:IPR005936"
FT                   /db_xref="InterPro:IPR011546"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR037219"
FT                   /db_xref="InterPro:IPR041569"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4B9"
FT                   /inference="protein motif:TFAM:TIGR01241"
FT                   /protein_id="ACL74473.1"
FT                   /translation="MKYFKGISFYIIIFILILVIITFFTATDNPPKMSYSELLTEMKAG
FT                   NVKSIGLQTDTATIELKKPKENNRTKFVVIVPPDVTSASERFTAALDNKLIEDFHVTQP
FT                   PQPPWWVSMLPTVGLVIILILIWFFFIQQSQGGGGGNRVMSFGKSRAKMTVDDKKKITF
FT                   ENVAGADEEKEELAEIVEFLKAPKKFVELGARIPKGVLLVGPPGTGKTLLAKAVSGEAG
FT                   VPFFSISGSDFVEMFVGVGASRVRDLFEQAKKNAPCIVFIDEIDAVGRHRGAGLGGGHD
FT                   EREQTLNQLLVEMDGFGINEGVIILAATNRPDILDPALLRPGRFDRRVVVGLPDIKGRE
FT                   QILKVHSRGKPLADDVRLDDLARITPGFTGADIENLLNEAALLTARANKKKIGNEEIKE
FT                   AAFKVMMGPEKKSRVMSEHDKKVTAYHEAGHAIAIKLVSSSQKVDRVSIIPAGMAGGYT
FT                   ASRPQEDKSYHTRSQLIEEIIIALGGRAAEEITMDEVSTGASSDLKKVNQIARNMVTKY
FT                   GMSEKLGNMIFGNDNDEVFIGRDLAQARNYSDELAAIIDNEVKSIIDNAYQKTVSLLRE
FT                   NIVRLNKLAEVLLEKEKVEGAEFEEIFENAVLEGSSQTPQLEG"
FT   sig_peptide     99447..99530
FT                   /locus_tag="Ccel_0085"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.614) with cleavage site probability 0.614 at
FT                   residue 28"
FT   gene            101392..101784
FT                   /locus_tag="Ccel_0086"
FT   CDS_pept        101392..101784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0086"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: drm:Dred_0128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74474"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR025540"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C0"
FT                   /inference="similar to AA sequence:KEGG:Dred_0128"
FT                   /protein_id="ACL74474.1"
FT                   /translation="MELKVGLTGNAEVLVSESNTAKKMGSGNLDVFATPAMIALMEKAA
FT                   SMAVQPYIGESSSTVGTMIDVKHIAATPIGMNVAARAELIEIDGKKLIFSVEAFDGKDK
FT                   IGEGRHERFIINTQKFITKVDSKLEG"
FT   gene            102061..103251
FT                   /locus_tag="Ccel_0087"
FT   CDS_pept        102061..103251
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0087"
FT                   /product="S-adenosylmethionine synthetase"
FT                   /note="PFAM: S-adenosylmethionine synthetase; KEGG:
FT                   cth:Cthe_2251 methionine adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74475"
FT                   /db_xref="GOA:B8I4C1"
FT                   /db_xref="InterPro:IPR002133"
FT                   /db_xref="InterPro:IPR022628"
FT                   /db_xref="InterPro:IPR022629"
FT                   /db_xref="InterPro:IPR022630"
FT                   /db_xref="InterPro:IPR022631"
FT                   /db_xref="InterPro:IPR022636"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4C1"
FT                   /inference="protein motif:PFAM:PF00438"
FT                   /protein_id="ACL74475.1"
FT                   /translation="MTKRLFTSESVTEGHPDKICDQISDAVLDAIYEKDPQARVACETA
FT                   VTTGMVMVMGEITTNCYVDIPKVVRNTIREIGYDRAKYGFDCDTCAVMTSIDEQSSDIA
FT                   MGVDKALEAKVGEMSEEQVQAIGAGDQGMMFGFACDETPELMPMPIILAHKLTMKLSEV
FT                   RKNGKVKYLRPDGKSQVTVEYDGDKPVRVDTVVISTQHGADVSHDTIEKDIMEHVIIPV
FT                   IPRELLDEGTKYFINPTGRFVVGGPQGDSGLTGRKIIVDTYGGYARHGGGAFSGKDPTK
FT                   VDRSAAYAARYVAKNIVASGIARKCEVQLAYAIGVAKPVSVLVDTFGTAVIPEEKISEL
FT                   VNKHFDLRPAAIINKLNLRRPIYRKTAAYGHFGRDDAEFSWEKTDVADALRKEAGL"
FT   gene            103403..103741
FT                   /locus_tag="Ccel_0088"
FT   CDS_pept        103403..103741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74476"
FT                   /db_xref="GOA:B8I4C2"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C2"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2250"
FT                   /protein_id="ACL74476.1"
FT                   /translation="MTDFSYIILGLFAIYGIISLFKSIFRLLENKKYYVEKANLVLLVN
FT                   DQEENIEKIVREAMMSKFVRNIAINGSFIVIDMKSKDQTYKILKRLEKQYSLVEVCSFD
FT                   ERESIFYK"
FT   gene            103985..106426
FT                   /locus_tag="Ccel_0089"
FT   CDS_pept        103985..106426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0089"
FT                   /product="exonuclease V subunit alpha"
FT                   /note="KEGG: tte:TTE0489 exonuclease V subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74477"
FT                   /db_xref="GOA:B8I4C3"
FT                   /db_xref="InterPro:IPR006345"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR027785"
FT                   /db_xref="InterPro:IPR029493"
FT                   /db_xref="InterPro:IPR041451"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C3"
FT                   /inference="similar to AA sequence:KEGG:TTE0489"
FT                   /protein_id="ACL74477.1"
FT                   /translation="MAISQFQQQRWSFESYPVGTNLNIIGRFDFKIYENSENGYKIYTF
FT                   DIEKIIDDDGFEHEVADQISVTGYYEVNEHCAVLPSKIRGSVAAYKGEKQLKAETVEFI
FT                   EPATDEGIISFLSCGIIKGVGEKTARNIVSGYKSGSNYVEGFGSNTLEVIKNEPLLLTK
FT                   IRGISPDKARVIHDSYMENMEYQNVMIFFQRFGVSSAKAMKIYNNFKGTSIAIAEQNPY
FT                   MFADIRGFGFKSCDEIARKLGIDPHSVFRLEAALKSVLQTAEADGNCYLLKAKLLEMTA
FT                   KALSNPDVTVTTDELEDAYNRMLKSGSLVNITFSEDQQSFEAVYTKEMYKIEYETALAI
FT                   KEIARCQPDVPMFSVDKLIEEFEAMRGFNLESMQKEAVKAVFNTNMLILTGSAGSGKTT
FT                   TVECMIYVLQRYFEKQEEMSFMLAAPTGKAAKRLTEITGFEAMTLHRLLQFSYENKGFF
FT                   YRQGNELPYDLIVVDESSMLSIDLAHALFTAISPGTTVVLIGDTQQIPSVGAGNVLDDM
FT                   IKSGVIPTVKLNVIKRQEDGSGIIFNANRIINGEMPEIINANKDFFIVEEDDKNRVIKR
FT                   TLEALNRLMTGYNYTIDDVQVICPQKTSELGTYEMNKAIQEMVNPAAAGKAEVKRGNSV
FT                   FRQGDKVIHLNNNYEATHYHKDAKTGRYIADEGSGVFNGDIGRIIEISKIGEIDQESED
FT                   GEAAGDNNTEEKVAVQYDEFIIIYQINELEEIDLAYSLTVHKMQGSQCEAAIFLCHLRN
FT                   YIMLNRNLGYTAVTRAKRMACIIGQRKAISVMVQNVKVTQRNTMLADLLSLKMIDPNTT
FT                   S"
FT   gene            106584..107246
FT                   /locus_tag="Ccel_0090"
FT   CDS_pept        106584..107246
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0090"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG: cth:Cthe_2248
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74478"
FT                   /db_xref="GOA:B8I4C4"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C4"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACL74478.1"
FT                   /translation="MIEYFFPPRCALCNAILKAGVAIYICEKCAGEIGYYKNSVTPLNL
FT                   PVGIQNYCDGILCVGRYSDSLKEALRRFKFSNKPSYYRTFGRLLALKVENTEQKVRFDI
FT                   IVPVPLYKSKEKTRGYNQAELMAGQVSKILNVPCEKRLLNKTFETKSQSILKKNERLLN
FT                   LQDAFVAINQRMIVNKNILLIDDILTTGSTVNQCCKALKEAGAGKVIAGVVATTRNY"
FT   gene            107296..107709
FT                   /locus_tag="Ccel_0091"
FT   CDS_pept        107296..107709
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0091"
FT                   /product="regulatory protein, MerR"
FT                   /note="KEGG: cth:Cthe_2247 regulatory protein, MerR"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74479"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C5"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2247"
FT                   /protein_id="ACL74479.1"
FT                   /translation="MPDLRNCRRCGRMYNFIGGAPICQDCKNADEEVFKKVKDYLYDNP
FT                   GATLSQVAMELDVSVEKIKMFLKEGRLEITDESNIILECERCGKSIKTGRFCRECQNEV
FT                   SVDLEKTTKTIHLDNSDQNRSNGIGMRYLNKKL"
FT   gene            107897..108184
FT                   /locus_tag="Ccel_0092"
FT   CDS_pept        107897..108184
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0092"
FT                   /product="Anti-sigma-28 factor FlgM family protein"
FT                   /note="PFAM: Anti-sigma-28 factor FlgM family protein;
FT                   KEGG: cth:Cthe_2246 anti-sigma-28 factor, FlgM"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74480"
FT                   /db_xref="InterPro:IPR031316"
FT                   /db_xref="InterPro:IPR035890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C6"
FT                   /inference="protein motif:PFAM:PF04316"
FT                   /protein_id="ACL74480.1"
FT                   /translation="MKISGDVYNVSKVYNTQNHIGAVNQVNSVKSKKDVISISDNAKDH
FT                   QLVFKALKEVPDIRQNKIDEFKEVYRSGTYNVSGQEIVEKLGKAVIDKKV"
FT   gene            108231..108731
FT                   /locus_tag="Ccel_0093"
FT   CDS_pept        108231..108731
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0093"
FT                   /product="FlgN family protein"
FT                   /note="PFAM: FlgN family protein; KEGG: cth:Cthe_2245
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0093"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74481"
FT                   /db_xref="GOA:B8I4C7"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C7"
FT                   /inference="protein motif:PFAM:PF05130"
FT                   /protein_id="ACL74481.1"
FT                   /translation="MDTGLIKELTDILNKENDIYETFLKLSNSKTDLITNGNVSELESI
FT                   VKIEQSLIIKIAKLEDQREKIVESLSSVLGRKPEEVTISELSSCLGEKEAMELKACQEK
FT                   ILKSINGLKSNNELNSKLIKNSLEYIDFSINMMTTVGTVTNSYGSSGNADEGKKRNLFD
FT                   VKL"
FT   gene            108765..110891
FT                   /locus_tag="Ccel_0094"
FT   CDS_pept        108765..110891
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0094"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: von Willebrand factor type A; protein of unknown
FT                   function DUF1078 domain protein; KEGG: cth:Cthe_2244
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74482"
FT                   /db_xref="GOA:B8I4C8"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C8"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ACL74482.1"
FT                   /translation="MAVGFSSYEIARSGLKVSERGLFVTGHNLSNVHTPGFTRQQAIIE
FT                   TNPYITQYGKNGKLFQYGLGADIQETRQIRHTFLDIVYRQENTIQGYWDTRSKAFQDVE
FT                   AILNDPMGDGLQGVMNKFWDSWQELSKEPESLTTRAMVRQRGQELVYYYNHIGNQLDKL
FT                   QNDLNSEIQVRINEVNNLTSQIAKLNTQIAAQEINGDKANDYRDQRNLLLDRLSILCDA
FT                   EVNEMQDGQMDVTLGGYYIVTRGQSKNLYVQANAEDGEFFYPKLEGTNIKVNVKSGILK
FT                   GLMEARGEVPGIKGSTENGTPNYKADITFAIDVSDGNNFDNLRDSLSSYISELKQSGLD
FT                   YNIRIITMGATSSVHENIYDKSNIDSMLADITANNLLEADATVNDGSFKGLINELTALN
FT                   NAPNGFREDAKRYTYVFTNKSINGDSVAADAFIGDAANYVNSLKGMGMKVSVVTDPAYN
FT                   TNGKPDAASNPEAGWSIITLGTGGSLADINSDLAGYTSMLKDWNDSLVQTVKDALGNIP
FT                   PSLNIVSDIKIKLNAMLNRMVNEINSLQMSGMTLDGKPGVAFFEAMDNNYPIEMGNLKL
FT                   SNALLSDSGLNNITASKTAAKGDNTVAKQIANLRDVDILVNSTGRVSIDEYYRNLILEL
FT                   GNGGMEAERIATSQATVVNAVDAQRNAISGVSMDEEMSNMMKYKFAYDASSRVLNIMDS
FT                   MMETIITSLGKVGR"
FT   gene            110923..112536
FT                   /locus_tag="Ccel_0095"
FT   CDS_pept        110923..112536
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0095"
FT                   /product="flagellar hook-associated protein FlgK"
FT                   /note="TIGRFAM: flagellar hook-associated protein FlgK;
FT                   PFAM: flagellar basal body rod protein; protein of unknown
FT                   function DUF1078 domain protein; KEGG: cth:Cthe_2243
FT                   flagellar hook-associated protein FlgK"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74483"
FT                   /db_xref="GOA:B8I4C9"
FT                   /db_xref="InterPro:IPR001444"
FT                   /db_xref="InterPro:IPR002371"
FT                   /db_xref="InterPro:IPR010930"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4C9"
FT                   /inference="protein motif:TFAM:TIGR02492"
FT                   /protein_id="ACL74483.1"
FT                   /translation="MQQSFFGLNIALSGLYTAQRNLDTVGHNLSNASTPGYSRQQSIQS
FT                   ASNPLAVMDGTGMVGTGSQVTGVERIRDTYLDFKYWSENVANGEWSKKAELMGEIQVTF
FT                   NEPSKSGFVKIMDGFFDSLQELSKDPSSGAARALVVQKATTLAKYFNNTATHFEQFQND
FT                   INDQVKTDVDQINIIASQIQLLNKQIYNYELTGGTANDLRDSRTLLVDQLSKLANIQAK
FT                   EIPYGKLPNGEDDIHFQITLSGKTLVDHFSATKLIVVQRNIKLNEEDIGNLYDIKWEDG
FT                   NSVNITGGELRGLLDVRDGKDGIDGTPIYKGVPYYQRKLNEFVRTFAINFNEGYTRNDA
FT                   LPDGYEHNGVGHIEGYGYDSDLTDAPTGIRFFTMLCVGDTPISGSAFIGTATSVGDIAN
FT                   QYNQITAKNFSVSSDIIDDANRIATSDADGQNGNTNILKKLMGIRSNQSLFKEGAPEDF
FT                   MKSLVAGMGIDAQQAETFAKTQKALVRQVDNRRMSVSGVNLNEEMTNMVKFQQSYNAAA
FT                   RMIVTMGEIYDTLINRLGVG"
FT   gene            112539..113468
FT                   /locus_tag="Ccel_0096"
FT   CDS_pept        112539..113468
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0096"
FT                   /product="flagellar hook-associated protein 3"
FT                   /note="TIGRFAM: flagellar hook-associated protein 3; PFAM:
FT                   flagellin domain protein; KEGG: cth:Cthe_2242 flagellar
FT                   hook-associated protein FlgL"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74484"
FT                   /db_xref="GOA:B8I4D0"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR013384"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D0"
FT                   /inference="protein motif:TFAM:TIGR02550"
FT                   /protein_id="ACL74484.1"
FT                   /translation="MRITNNMLISNMLTALGNNESRLSKYQNQLHTGKKIQLPSDDPIV
FT                   AARALKLRTDVSKIEQYQKNLGDAQSWVDATDAALAQIGDILKRAKELATQAANGTNSI
FT                   TETSDIGQEMKQLKVQLVHIANTTYSGRYMFSGFKTDQKLIEDDETSANFGKFEIDVNT
FT                   VTEKIQFEIGAGDNININVAGGDIFNSGGNAVNGGEPAMIALFTNVIADLDSGDNAGVS
FT                   SQLSQFDQQIDNLLRVRADIGARQNRIDLSADRMSNDLVNMTSLMSKNEDVDPAETIMN
FT                   LKNEENVYQASLAGGARIIQQTLVDFLR"
FT   gene            113503..114084
FT                   /locus_tag="Ccel_0097"
FT   CDS_pept        113503..114084
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0097"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0097"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74485"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D1"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2241"
FT                   /protein_id="ACL74485.1"
FT                   /translation="MGLSIQTTPARISIETIDCKIERKSVNARLELKQKPPVVNIKTEL
FT                   PRVLIDQYECFAEEGLKNNIDLLKEQSENAYRHVMEYIARVSQDGDAMAKIGKKANIMI
FT                   DIARRNSVTIHEFGMVTMPMSRPKIDVVGGTVEFDPEPINDIGMRNGVTATYIPPKTDF
FT                   NYTPGKVNTRVESYGSIDIKYTGNNVDSYI"
FT   gene            114168..114614
FT                   /locus_tag="Ccel_0098"
FT   CDS_pept        114168..114614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0098"
FT                   /product="protein of unknown function DUF180"
FT                   /note="PFAM: protein of unknown function DUF180; KEGG:
FT                   cth:Cthe_2240 flagellar assembly protein FliW"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74486"
FT                   /db_xref="GOA:B8I4D2"
FT                   /db_xref="InterPro:IPR003775"
FT                   /db_xref="InterPro:IPR024046"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4D2"
FT                   /inference="protein motif:PFAM:PF02623"
FT                   /protein_id="ACL74486.1"
FT                   /translation="MLVKTTHFGEINIKDEDIIEFSEGIVGFEDIHRYGIIRNQNSDSP
FT                   FSWLQAVEKSELAFAVVDPFVIKKDYDFVLSDEYVKALDINDPSQVNVYAIVVVPDDLT
FT                   KISMNLKAPVIVNKDNRKAAQVILDTDEYTVRHYIMDELQKQEV"
FT   gene            114616..114834
FT                   /locus_tag="Ccel_0099"
FT   CDS_pept        114616..114834
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0099"
FT                   /product="carbon storage regulator, CsrA"
FT                   /note="PFAM: carbon storage regulator; KEGG: lbf:LBF_3098
FT                   carbon storage regulator protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74487"
FT                   /db_xref="GOA:B8I4D3"
FT                   /db_xref="InterPro:IPR003751"
FT                   /db_xref="InterPro:IPR036107"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4D3"
FT                   /inference="protein motif:PFAM:PF02599"
FT                   /protein_id="ACL74487.1"
FT                   /translation="MLVLSRKKDQSLMIGNDIELTIIDIQGDQVKIGLKAPKNVSIYRK
FT                   ELYLEIQEENKKAATADVVELDSIFKK"
FT   gene            115020..115841
FT                   /locus_tag="Ccel_0100"
FT   CDS_pept        115020..115841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0100"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: esi:Exig_2443
FT                   flagellin domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74488"
FT                   /db_xref="GOA:B8I4D4"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D4"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACL74488.1"
FT                   /translation="MRINHNIAAMNTYRQLTNNTTASSKSLEKLSSGLRINRAGDDAAG
FT                   LAISEKMRGQIRGLNQASRNSQDGISMIQTGEGALATVSNILVRVKELAVQAANGTYDA
FT                   TNDLTRIKEEITELSAQIADITTNTKFNGISLLNNAAGITLQVGQETSQTLKIDTTKTN
FT                   LKTVADAVDLYKGWADSAAASGAIDAVEGLINNVSAMRSYFGANQNRLEYNINNLDTYS
FT                   ENLSASESRIRDVDMANEMMEFTKQNILSQAAQSMLAQANQQPQGVLQLLR"
FT   gene            116068..116889
FT                   /locus_tag="Ccel_0101"
FT   CDS_pept        116068..116889
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0101"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gka:GK3131
FT                   flagellin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74489"
FT                   /db_xref="GOA:B8I4D5"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D5"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACL74489.1"
FT                   /translation="MRINHNIAAMNTYRQLTNNTTASSKSLEKLSSGLRINRAGDDAAG
FT                   LAISEKMRGQIRGLNQASRNSQDGISMIQTGEGALATVSNILVRVKELAVQAANGTYDA
FT                   ANDLARVTEEIEELGLQITDIQTNTKFNGISLLNNDTGITLQVGQETSQTLLIDTAKTN
FT                   LKDVTAAVVLYKDWAATTDANGAIDDIEGLINDVSAMRSYFGANQNRLEYNINNLDTYS
FT                   ENLSASESRIRDVDMANEMMEFTKQNILSQAAQSMLAQANQQPQGVLQLLR"
FT   gene            117174..118004
FT                   /locus_tag="Ccel_0102"
FT   CDS_pept        117174..118004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0102"
FT                   /product="flagellin domain protein"
FT                   /note="PFAM: flagellin domain protein; KEGG: gka:GK3131
FT                   flagellin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74490"
FT                   /db_xref="GOA:B8I4D6"
FT                   /db_xref="InterPro:IPR001029"
FT                   /db_xref="InterPro:IPR001492"
FT                   /db_xref="InterPro:IPR042187"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D6"
FT                   /inference="protein motif:PFAM:PF00700"
FT                   /protein_id="ACL74490.1"
FT                   /translation="MRINHNIAAMNTYRQLTNNTTASSKSLEKLSSGLRINRAGDDAAG
FT                   LAISEKMRGQIRGLNQASRNSQDGISMIQTGEGALATVSNILVRVKELAVQAANGTYDA
FT                   ANDLKRITEEITELGAQVTDIKDNTKFNGISLLNGNSGNNIVLQVGQETAQKLTILTAT
FT                   TDLTAVAKAVTDYAGAWTASSAASTSINDVETQINKVSAMRSYYGANQNRLEYNINNLD
FT                   TYSENLSASESRIRDVDMANEMMEFTKQNILSQAAQSMLAQANQQPQGVLQLLR"
FT   gene            118101..119345
FT                   /locus_tag="Ccel_0103"
FT   CDS_pept        118101..119345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0103"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: aoe:Clos_2508 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74491"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D7"
FT                   /inference="similar to AA sequence:KEGG:Clos_2508"
FT                   /protein_id="ACL74491.1"
FT                   /translation="MTEKKKVFLAPQYFRKFKCIGSECEDSCCKGWKVSIDKETYKKYR
FT                   CVQNVELRPLLDKYVTRERKNGGDLVNYAKIKMLDEEGICPFLSDKKLCRIQLEYGEGY
FT                   LSKVCTTYPRNAIRVDNTIEMVTSLSCPEAAKLALLDPEIMEFDEYEDIPNPSLMGSCA
FT                   FNTQDKQFVNRPQRYFWDLRIFTIDILQNRNYFMWERLIILGLFIEKLNKSVDENKIND
FT                   IPDIIQSYNKMIEEGTFKGALDSIPAECKVQLQLIKDIIDIRVNSGVLNKIYMECYEHF
FT                   LKGINYTEEATKEEIINNYQKAFEEYYKPYMDSHEYILENYLVNYVFSRLFPFSSESIF
FT                   DAYMLLVLHYAIIKVHLIGMAGYNKGLEDDMVIKLISTFTKIVDHNTVFLSTITKQLKE
FT                   KRFNTLAYMTIMIKN"
FT   gene            119442..119828
FT                   /locus_tag="Ccel_0104"
FT   CDS_pept        119442..119828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0104"
FT                   /product="flagellar protein FlaG protein"
FT                   /note="PFAM: flagellar protein FlaG protein; KEGG:
FT                   cth:Cthe_2219 flagellar protein FlaG protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74492"
FT                   /db_xref="InterPro:IPR005186"
FT                   /db_xref="InterPro:IPR035924"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D8"
FT                   /inference="protein motif:PFAM:PF03646"
FT                   /protein_id="ACL74492.1"
FT                   /translation="MKIDSNELVSKSISSKSSNADIQKISTVSKPDRMLTTTKSISQIN
FT                   NYDKDNMPVSERVVIEAIQKANKAISGGNRRFEFSIHEKTNEIVVKVFDSDTNELIREI
FT                   PNEKVLDMVAKICEMAGILVDERR"
FT   gene            119833..122169
FT                   /locus_tag="Ccel_0105"
FT   CDS_pept        119833..122169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0105"
FT                   /product="flagellar hook-associated 2 domain protein"
FT                   /note="PFAM: flagellar hook-associated protein 2 domain
FT                   protein; flagellar hook-associated 2 domain protein; KEGG:
FT                   cth:Cthe_2218 flagellar hook-associated 2-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74493"
FT                   /db_xref="GOA:B8I4D9"
FT                   /db_xref="InterPro:IPR003481"
FT                   /db_xref="InterPro:IPR010809"
FT                   /db_xref="InterPro:IPR040026"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4D9"
FT                   /inference="protein motif:PFAM:PF07195"
FT                   /protein_id="ACL74493.1"
FT                   /translation="MNINSSGTNGLQGTTNYSRLTGMVSGFDTDGLVKASLSGDQAKID
FT                   KIKQSKELNMWMIDAYRDVTSSLQSFYNQFFDSVTSTTNLKLASTFSSYNTVLAAGSPS
FT                   DVISVTAGVGVRAGVYSLSNIVAATNARISTGTDITKTVETGVISQADLDTIKSSNYNN
FT                   IFKITLNGKTADITLDNDAGQIASVDDLVSQLQGKLNAAFGVDSSGNGKVKVENNGGKL
FT                   KFTTVRNTDSFTIGTINNAGANKLFSTAPTETTPFDLNGGNNQFELTIGNNTKTVTVPP
FT                   LAGNSTFTTADDLKAAIQNGIDAAFGAGSGITAEVNNGKVVLKSESAVNYSIGNTANGA
FT                   TNAILQIDSSNISNKVDLNTKLSSMGAGFAIDPFKNSDGTSIKNEDGTFSKNIEFTITS
FT                   SKGTSTFSFDPATTSINDIMRKVNMDTTANATMSYDVTTNSFRIQAKDTGATSKLDIVD
FT                   TAGGFMSSLGISGTGAVGSDASVTVTGDDGTSMTIVRPDNSFTYAGLTFNISKDLPIGA
FT                   DPIKVTVSGDTSKTFNTIKSFVDQYNALIDKLNTKISEKKERSYLPLTEAQKASMTTDQ
FT                   IEKWEVKAKTGLLQGNTDIQNTLDRLRTALYDSVEGVGISLYSIGITTSTDYRQKGKLV
FT                   IDESKLKEALANNPDEVTNLFTAASDKSYYKASGDYAIKRERYRESGLADRFSDIIQDA
FT                   IRTTPDARSNPGTLIMKAGQVGDASEYTNSLIKEILGFDKIIDELNAKLTSKENALYAK
FT                   YANMEKMLSRMSAQSGWLASQFGGQ"
FT   gene            122208..122612
FT                   /locus_tag="Ccel_0106"
FT   CDS_pept        122208..122612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0106"
FT                   /product="flagellar protein FliS"
FT                   /note="PFAM: flagellar protein FliS; KEGG: cth:Cthe_2217
FT                   flagellar protein FliS"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74494"
FT                   /db_xref="GOA:B8I4E0"
FT                   /db_xref="InterPro:IPR003713"
FT                   /db_xref="InterPro:IPR036584"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E0"
FT                   /inference="protein motif:PFAM:PF02561"
FT                   /protein_id="ACL74494.1"
FT                   /translation="MTINNGYNQYKENSVYTATPEELTLMLYNGLVKFIMLAQSAIDDK
FT                   NIEKANNSIIRAQDIILEFQVTLDMKYEVSNNLYSIYDYMHRRLVQANIKKDKDILEEV
FT                   LGMAKELRDTWTQAMKIAKRRGPSTDQIAR"
FT   gene            122698..123180
FT                   /locus_tag="Ccel_0107"
FT   CDS_pept        122698..123180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0107"
FT                   /product="FlgN family protein"
FT                   /note="PFAM: FlgN family protein; KEGG: cth:Cthe_2216
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74495"
FT                   /db_xref="GOA:B8I4E1"
FT                   /db_xref="InterPro:IPR007809"
FT                   /db_xref="InterPro:IPR036679"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E1"
FT                   /inference="protein motif:PFAM:PF05130"
FT                   /protein_id="ACL74495.1"
FT                   /translation="MTPEQYIQKLTELSLKKLDNMKEILNLTKEQSEVITEDSINELQN
FT                   IIDLKQKLIEEINELDDAFEVYYSRLKSVLGVERIEEISISKYQGTERLQQTVKLIFDT
FT                   TKEIQAAENENSVKAKKVLDSLGGQIRQVKQGKIANNGYNIGGKLPQQSYYFDTKK"
FT   gene            123349..124686
FT                   /locus_tag="Ccel_0108"
FT   CDS_pept        123349..124686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0108"
FT                   /product="Kelch repeat protein"
FT                   /note="PFAM: Kelch repeat-containing protein; Kelch repeat
FT                   protein; KEGG: LOC100082187; similar to kelch-like 5
FT                   (Drosophila); K10442 kelch-like protein 1/4/5"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74496"
FT                   /db_xref="InterPro:IPR006652"
FT                   /db_xref="InterPro:IPR015915"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E2"
FT                   /inference="protein motif:PFAM:PF07646"
FT                   /protein_id="ACL74496.1"
FT                   /translation="MRLSNKLKIFSAMVLMLVIVVSSSMVFAADPNTWTTKAPMATARY
FT                   NHEAVVLNGQIYAIGGQTTGAATLKSVEQYDPATDKWITKAPMTYAKHAHQVVVINGKI
FT                   YTIGGLGDVSGCMYSLEEYNPETDTWKTKASMSTARGHFGATVVNGKIYAMGGSSVKSM
FT                   EEYDPANNIWVTKASMSVDRMLFKVAVVNGKIYAIGGYNSTGYLNSVEEYDPATDKWTP
FT                   KAPMNIGRSAFEIAVLSGKIYVMAGANTRSTEVSESVEVYDPTTDTWTTKASMPTPIAG
FT                   KAVTLNGKIYMVGAGTGRNIVEEYDPATDKWTYDAPLTTGRAYDQSVVANGKIYHIGGS
FT                   ITNSVEEYTPTNTGGSSEGGNENPPVITGNSAILELTMVNGVIKEYDLNAAELDSFLTW
FT                   YDNSSEGSAPSYYIFNKKNNIKPFLSRKEYIAYSKIASFEVKEYAE"
FT   sig_peptide     123349..123435
FT                   /locus_tag="Ccel_0108"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 29"
FT   gene            complement(124785..125762)
FT                   /locus_tag="Ccel_0109"
FT   CDS_pept        complement(124785..125762)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0109"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2214 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74497"
FT                   /db_xref="GOA:B8I4E3"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E3"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2214"
FT                   /protein_id="ACL74497.1"
FT                   /translation="MRLFPVAYAERKSVLPKNIFLAVIYIIVLLLAAVAVVSFLSAWSI
FT                   THPKKVTTPQISSNIAPDYNNIRFTVGESKEKINGWFFPCSGSRKTVLMAHSYGKNRLQ
FT                   FGEQTFPLIASLNREGFNVLTFDQRGSGNSSGSVATFGKNETADVLSAIKYLKQQSTDQ
FT                   IILMGFSTGASSCLSALTQTPYRDSIIGVIVDSPYSNIDDYIDYIVDSSLWLPNIPFKP
FT                   VVKFAVKKISKVDSSLDIISKVPSIIPTPVLLIDGAQNIPSTSDNTKLIYEVYKRKSPV
FT                   QAHYWNSGAPSYGESYLSVQDKYIDQIVDFSQECVKDAEKAVQK"
FT   sig_peptide     complement(125634..125762)
FT                   /locus_tag="Ccel_0109"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.825) with cleavage site probability 0.535 at
FT                   residue 43"
FT   gene            125938..126828
FT                   /locus_tag="Ccel_0110"
FT   CDS_pept        125938..126828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0110"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   tex:Teth514_1289 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74498"
FT                   /db_xref="GOA:B8I4E4"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR016431"
FT                   /db_xref="InterPro:IPR040085"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E4"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL74498.1"
FT                   /translation="MHEICSCCPRHCGIDRNSVTGFCGVPEQPKVAKVFLHMWEEPCIS
FT                   GTNGSGTVFFSGCNLKCVFCQNYEISQEGHGKVITIDRLQEIFLELNEKGAHNINLVNP
FT                   SHYTKVIKEAILPLKQRGKINIPIVYNTNGYDSPETLQDMTGIVDVYLPDFKYFSGKTA
FT                   SKYAAASDYPQVCRNAVLEMYRQVGSPVLDSAGIIKKGLIIRHLIMPGHVNESMSILDW
FT                   ISENLPGDVYVSLMSQYTPYYNAQNFPEINRPITRNEYYKAVNHLYRLGLEEGYVQERE
FT                   SSDTQYIPDFNLEGV"
FT   gene            126931..128511
FT                   /locus_tag="Ccel_0111"
FT   CDS_pept        126931..128511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0111"
FT                   /product="serine/threonine protein kinase"
FT                   /note="PFAM: tyrosine protein kinase; Serine/threonine
FT                   protein kinase-related; SMART: serine/threonine protein
FT                   kinase; KEGG: cac:CAC0404 TPR repeat-containing
FT                   serine/threonin protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74499"
FT                   /db_xref="GOA:B8I4E5"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E5"
FT                   /inference="protein motif:PFAM:PF00069"
FT                   /protein_id="ACL74499.1"
FT                   /translation="MLDNYFHSKYKYIRLLGRGGCGDVYLAENVKLGNLWAVKEIAKGR
FT                   ETTISGYLEPEILKRLNHPALPRICDVYEDECCIYIVEDYIEGISLKRIIKEKGSIEEK
FT                   KVAEWAVQLCSVLDYLHSQKPDPIIYGDMKPHNIILAKGETIKLIDFGISAVVNISGSK
FT                   PPGMTETAFIGTKGYAAPEQFMGGYLCPATDIYSLGITLIHIITGVDPIKQYSFYQDNN
FT                   FSSHLSPEMYQILKKCINLKPEFRYQTAEELMKALRHYLLAGSDSLFYKSLQGISSPYL
FT                   FSKIIAVTGASGTGVSTLTVAMSEQAAKSGNSVCIVDLSNSVDLAKIIVRDDKGYLENL
FT                   PVKVKPHMYYVRPSIKLFADSSENVILYKLLGQLQEKYKYIFIDGPPGILNPIERYLDN
FT                   IFIISDMNPYNISKPFSYLEQDSLMEKIVSRTSFILNKFYKGELGSDLLIYSVLNKSAY
FT                   VKLKKQISGVEVFEVPYSEKVYLKWMYGYFDKFTGFNCLLSDSFKKSISNIISHKVIPN
FT                   EKKSLLKRS"
FT   gene            128517..129173
FT                   /locus_tag="Ccel_0112"
FT   CDS_pept        128517..129173
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0112"
FT                   /product="SAF domain protein"
FT                   /note="PFAM: SAF domain protein; KEGG: cac:CAC1974
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74500"
FT                   /db_xref="InterPro:IPR013974"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E6"
FT                   /inference="protein motif:PFAM:PF08666"
FT                   /protein_id="ACL74500.1"
FT                   /translation="MSKRLIIKTVLICIGLFLIMDSALFAYIFTKYPLNMEKQVSVVVA
FT                   TADIKKGTVIEERFLRKKDVWESTVNSSIERDIGNIEGKKALTDIYKDDYIRSCDLLEK
FT                   KDWYKDDERIIVLPTNMEERLANLIRKGSYVDIRLQKDSGEATEDILYKIKVEDVLDET
FT                   GTALDSKSAVNSKTAYFKLVLGKKERQKIYSAAKNGRLIYELYCDNIQKSGEEFK"
FT   sig_peptide     128517..128597
FT                   /locus_tag="Ccel_0112"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.981) with cleavage site probability 0.979 at
FT                   residue 27"
FT   gene            129173..129985
FT                   /locus_tag="Ccel_0113"
FT   CDS_pept        129173..129985
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0113"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rde:RD1_3835 chain length determinant domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74501"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74501.1"
FT                   /translation="MGKTVAVFSGAKNSGKSVVTYILANQIREIISEDKKVLVCCLNSK
FT                   FSLLYKLLGIDESAPGIEELINLQESGYGQKSGSLHDIIPKSNGIHFLGSYKTTISYVN
FT                   RNMAGFSKLIDRLEKDFDLIIFDTVSSKENAPTNIALEKSSLMINLFVQDAESVNTINS
FT                   IMEGRTERETMYLISKYRDIYPRVGDIKRRFSLGKVYTMNYCRTLQEMKNRDSLHFYLQ
FT                   RDTECNSSARLISRYIAEAFSLELKPSEKEQKGVNYLKSIFSNMFMIQ"
FT   gene            130032..131576
FT                   /locus_tag="Ccel_0114"
FT   CDS_pept        130032..131576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0114"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   cbl:CLK_A0282 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74502"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E8"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACL74502.1"
FT                   /translation="MRTLQKLCLKGLINYVEEELRLNGFNGIKEFQVNSASILETAKQT
FT                   QKIMAMDGSPKAREFMLNSIYFLLIEKSEIITPENIDGLLGEYHINYYKNIYTGSDSGC
FT                   ISKPIDTELAEYLSRYSISTGDDFDIKLQKLTQIIYQEVYGYGILDELIFDTGLNEVAC
FT                   TRSDYIWIQYKGIKRHIPNKAFCFRSEDSYRKLIENRLTSTAREEMNAGAPLVYAVLKN
FT                   GARVTALRPPLSKYYVVNVRLFAPKTQLVNYRDNFVEQRIARIIELLAGKGRRNVAIIG
FT                   EQGSGKTTAADELIIKQLDPDISIGLAENIHELNVSSNYPGKNIVELQYTKEFKPSDIT
FT                   EVFFRLNRDIVIYGEVRNSYEAFEMIKAMLRQARGSLFTFHSSSSRRMIHDLRQLLMQT
FT                   GYYTDFREAQFDVADAVDLVIHIKLDRETGQRYVYKVSEVLAQEDSMTFQINDLFVFDR
FT                   EKGKYISNKNGLSKQQLLSCLEYEFTQSDAEELSRLFCQNYSDDSSVSFVPEGFIV"
FT   gene            131573..132532
FT                   /locus_tag="Ccel_0115"
FT   CDS_pept        131573..132532
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0115"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tfu:Tfu_2275 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74503"
FT                   /db_xref="GOA:B8I4E9"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4E9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74503.1"
FT                   /translation="MMDIGRLSAEIITLLNHYQPYIIMLLTGLLLFLAGIGTSVYKGIL
FT                   KESKSGIKKAKLSRLVEFLEVFTQKFPLKYLSNRLDKALGYLILDNITQRKLVSIFTVF
FT                   IPITGLLIYCTIEAIMKLWYTKLAAIALCFMVPYYTFTLTLDYLKYSIKQRIPAFIDSF
FT                   RSSFVSHNRIKPALQECCSNSNKHLGRIMLRVSDSSDLNDSLRAVRDRISDTWFNIFVT
FT                   LLVNYRENGGELINQLYKLNKTITRYNNIEKKKNRRLIWYEFFTLGASIFSLPVIMLIN
FT                   RMILGTNMRLYYNTAQASGKIAIYSISALIVVRILRRL"
FT   gene            132558..133673
FT                   /locus_tag="Ccel_0116"
FT   CDS_pept        132558..133673
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0116"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74504"
FT                   /db_xref="GOA:B8I4F0"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74504.1"
FT                   /translation="MLFILLITAGIIAIVCGLNFKVVRVSKKNYRKSISSVFESLEANR
FT                   LIKKLLDIFTRNRELWFNRLETRILELSEVGINLKRLYLLKIICLILCTVIFIAIRYTN
FT                   VGYEQKLLIQDTGKNNSVLFSQTEQDETQYRFYKMVLSKAGKENLEMADNAGLFRLVEE
FT                   KVAQVINSSDQREIDEKTSWFIDKWKNTQKIDFFKPKYMFLILISLFLPDIFLVIRWLV
FT                   KGVLYKKEIIKLEYIFELLARIEGIKTLDIIYELEKASKIYAVWLRQFAAIFRYDKMKG
FT                   IEYLQKKNVKSLSKFTDIMEIYSIHDKEVALQILDREAMERDESIIMVADETLDFIDLI
FT                   AFLSIVPLVYELALLMLNPMLDIVYKAFEFI"
FT   gene            133685..133843
FT                   /locus_tag="Ccel_0117"
FT   CDS_pept        133685..133843
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0117"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74505"
FT                   /db_xref="GOA:B8I4F1"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74505.1"
FT                   /translation="MKQVIITITMLAIALALIIGIVVPLMGHGARTGNIAVTRGHDVLT
FT                   RLENILN"
FT   sig_peptide     133685..133768
FT                   /locus_tag="Ccel_0117"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.720 at
FT                   residue 28"
FT   gene            133868..134035
FT                   /locus_tag="Ccel_0118"
FT   CDS_pept        133868..134035
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0118"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74506"
FT                   /db_xref="GOA:B8I4F2"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74506.1"
FT                   /translation="MKKIVISIAMFAIAMALLVAVIVPLANHGRENGIKVEGQLNKVDT
FT                   EINSLSGTIR"
FT   sig_peptide     133868..133930
FT                   /locus_tag="Ccel_0118"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.566 at
FT                   residue 21"
FT   gene            134069..134221
FT                   /locus_tag="Ccel_0119"
FT   CDS_pept        134069..134221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0119"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74507"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74507.1"
FT                   /translation="MKNIIIAIIMFALCVALVIGTVLPASELISDTGEKVYQSVKKLND
FT                   NIKDD"
FT   sig_peptide     134069..134152
FT                   /locus_tag="Ccel_0119"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.960) with cleavage site probability 0.537 at
FT                   residue 28"
FT   gene            134228..134674
FT                   /locus_tag="Ccel_0120"
FT   CDS_pept        134228..134674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0120"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74508"
FT                   /db_xref="GOA:B8I4F4"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74508.1"
FT                   /translation="MNKIYAFFIIIPLIAVLFLKTLSFYEFDTKQRYVKNEVDSIAHKV
FT                   MITGAMTVSDKEELLEKLGKLGTFRASNISIKCGSIQPDGTVAELGDYVLGSVLDRGSI
FT                   FTIYVDSESVSIFSETEGNSADEDNELHYRAKATCRVEKSSRED"
FT   gene            134694..135332
FT                   /locus_tag="Ccel_0121"
FT   CDS_pept        134694..135332
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0121"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74509"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74509.1"
FT                   /translation="MGVIFIGLTVTFLVVFAFVNIADYAVYTYKRNSISKAIDYAVTAA
FT                   VQDIDRGKSFEGLAEGFDENTGRRLSDGVEIDIDRAEKTFLSVFNSNCNKEQTDISRNL
FT                   LICATFARGQRVSYKIKKSSGEVVDGTVDSPTLIEDRINEAAKGYWPDSDDNSSRIAIN
FT                   GNPKTNMIERGTYLFAYIKCIRITGVFTERELTLSCFGGAKLDRANAQN"
FT   gene            135466..136335
FT                   /locus_tag="Ccel_0122"
FT   CDS_pept        135466..136335
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0122"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   cbk:CLL_A1020 radical SAM"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74510"
FT                   /db_xref="GOA:B8I4F6"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F6"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL74510.1"
FT                   /translation="MKKFKKVYIEITNVCNLKCSFCPEFGRPPEFMDIKRFKHIIREVK
FT                   PFCEYVYFHVMGEPLLNSNLQSLLKICYDNFIKVNITTNGTLLNKCSQILLDSPALRKV
FT                   SISLHSFEANEGNGSLGSYINNVVSFIKKAVHKGIICELRLWNMDNGQIKGTNEMNNDI
FT                   IKKLEESFQPGFNLELAVKNQQSVKLEDRLFIGRSEIFEWPDINKDIMDEKVFCYGLRD
FT                   QFGILVDGTVVPCCLDSEGNIPLGNIFSNLLRDILYSERARSIYDGFSGRKAVEELCKK
FT                   CGYAKRYK"
FT   gene            136430..138361
FT                   /locus_tag="Ccel_0123"
FT   CDS_pept        136430..138361
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0123"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: amt:Amet_3372 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74511"
FT                   /db_xref="GOA:B8I4F7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032524"
FT                   /db_xref="InterPro:IPR032781"
FT                   /db_xref="InterPro:IPR037118"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74511.1"
FT                   /translation="MNILSAEGISKSYSEKILFNDISLGIGEGDKIGLIGVNGTGKSTL
FT                   LKIIAGMESVDTGRILKSNKVRVGYLEQSPAFKPGTTVLQQVFRGHSSEMLLLREYEEI
FT                   LLKSSQNPSDEKLEKKLLDLMHQMDTMNAWTLESEAKTILTRLGIDSFDADVADLSGGQ
FT                   RKRIAMAGALINPTELLILDEPTNHIDNETVDWLEKYLNNKKGALLMVTHDRYFLDRVA
FT                   NRIIELDNGKLYSYQANYTRFLELKAQREELEQASERKRQNLYRNELEWIRRGALARST
FT                   KQKARIERFEKLKEADGPKQDENIEIQVGSARLGRKIIEVENVKKSYGDKTLISDFSYV
FT                   LLRDDRIGIIGPNGIGKSTLLKLLSGKIKPDSGKVEIGETVKTGFFTQENTDMDQNLRV
FT                   IDYIRSVAEHIETANGSVSASQMLERFLFPPSVQWTPISKLSGGEKRRLYLLSILMDAP
FT                   NILLLDEPTNDLDIQTLTILEAYLDEFPGAVITVSHDRYFLDRTVNRIFSFEGYGRITK
FT                   YAGNYSDYRGYMAGREKQDDTGKAADPDKKNNSSQNKTEWQKNKEKPLKFTFKEQKEFD
FT                   EIDDVIEALETDIEKVKKDIDQSVTDFAKLQELLEKQQKLEKELDFKLERWTYLNELAE
FT                   KIENSKKK"
FT   gene            138387..139700
FT                   /locus_tag="Ccel_0124"
FT   CDS_pept        138387..139700
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0124"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; type III restriction
FT                   protein res subunit; DEAD/DEAH box helicase domain protein;
FT                   SMART: DEAD-like helicases; KEGG: ctc:CTC01856
FT                   ATP-dependent RNA helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74512"
FT                   /db_xref="GOA:B8I4F8"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F8"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACL74512.1"
FT                   /translation="MEQLFESMELEKSLVEALKKESITVPTDIQQKAIPEALKNRDVIL
FT                   HSSTGTGKTLAYLLPLFMKLSAEKKEMQALILVPTHELAIQVVRQIELLSQNSEIKATS
FT                   TPIIGDVNIMRQIDKLKLKPHIIVGTPGRILELIQKRKISAHTIKTIIIDEADRLLDDY
FT                   NLDNIKAIIKTTLKERQIVMCSATISKKTVERAMPLMKEPLVIESKADMGVPDAIEHLY
FT                   FVSEQRDKIDVLRKLVRMINPKKAIAFFANSEDILVSEEKLRYHKLKAGGIHGSNIKSD
FT                   RKKTMDDFKNGRLQLLIASDIAARGLDIEDVTHIFNVNIPERSMDYLHRAGRTGRNGKP
FT                   GVAISIVTEKEIEFIRKFEKELKIKIIPKSMFNGKIVEYKKERSMRTTGRPKSGSPAGT
FT                   EKSKISSAKRSQPVDRKKAFGDKKKWGKGPKVYHGPKK"
FT   gene            139755..140657
FT                   /locus_tag="Ccel_0125"
FT   CDS_pept        139755..140657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0125"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   Cupin 2 conserved barrel domain protein; KEGG:
FT                   cth:Cthe_2212 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74513"
FT                   /db_xref="GOA:B8I4F9"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4F9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL74513.1"
FT                   /translation="METTTLPKAWEGVLGSASFIPVTSVKAIERYHDAEWSKGLSIHEA
FT                   FEMVYIKSGNGVFEIGEQNVSVGSNDIVIIKPNQSHKLSVESEDGCDFIVLYFKFIDQT
FT                   EHTLSEVSLGDFINFVSGKESGSFIKLKVSHKNDIIILLNRILKEQTNDQLGSDLLNYL
FT                   MLMELFVLISRALKAEWENSIKNKSPKIKELMQSAIQFVHNNFEREISITDIAKYVFLS
FT                   SSYFTRAFKENTGLSPMQYLLNIRIKRACELLRETDQKVGEIALSVGFSNQQRFNDIFK
FT                   KQTNMTPMQYRNSAKNIHN"
FT   gene            140802..142061
FT                   /locus_tag="Ccel_0126"
FT   CDS_pept        140802..142061
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0126"
FT                   /product="3-isopropylmalate dehydratase, large subunit"
FT                   /note="TIGRFAM: homoaconitate hydratase family protein;
FT                   3-isopropylmalate dehydratase, large subunit;
FT                   3-isopropylmalate dehydratase; PFAM: aconitate hydratase
FT                   domain protein; KEGG: cth:Cthe_2211 3-isopropylmalate
FT                   dehydratase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74514"
FT                   /db_xref="GOA:B8I4G0"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006251"
FT                   /db_xref="InterPro:IPR011823"
FT                   /db_xref="InterPro:IPR011826"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR033941"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G0"
FT                   /inference="protein motif:TFAM:TIGR02083"
FT                   /protein_id="ACL74514.1"
FT                   /translation="MGMTMTQKILASHAGVDKLVPGQLIMAKLDMVLGNDITSPVAIKE
FT                   FDKIGLDKVFDKNKIAIVPDHFTPNKDIKSAEQVKVCREFSKRMGIVNFFEVGQMGVEH
FT                   ALLPEKGLVVPGDVVIGADSHTCTYGALGAFSTGIGSTDMAAGMATGKAWFKVPEAIKF
FT                   VLRGKPQKWVGGKDIILHIIGMIGVDGALYKSMEFTGDGVNALSMDDRFSMANMAIEAG
FT                   AKNGIFEVDEKTVEYVKEHSIRHYTVYKADEDAEYSEVYEIDLAEVKPTVAFPHLPENA
FT                   RTIDNVGDIKIDQVVIGSCTNGRIEDMRIAAGVLKGRKVSDNVRCIIIPATQKIWKQAM
FT                   NEGLFDIFIDAGAAVSTPTCGPCLGGHMGILAKGERAVATTNRNFVGRMGHPESEVYLA
FT                   GPAVAAASAVAGRIAGPDEI"
FT   gene            142195..142686
FT                   /locus_tag="Ccel_0127"
FT   CDS_pept        142195..142686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0127"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   cth:Cthe_2210 3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74515"
FT                   /db_xref="GOA:B8I4G1"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR011824"
FT                   /db_xref="InterPro:IPR011827"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4G1"
FT                   /inference="protein motif:TFAM:TIGR02084"
FT                   /protein_id="ACL74515.1"
FT                   /translation="MNAKGKVIKYGNNVDTDVIIPARYLNTSDPAELASHCMEDLDEKF
FT                   TQRVQKGDVMVAGKNFGCGSSREHAPISIKASGISCVIAETFARIFYRNAVNIGLPIIE
FT                   CSEAAKDIKDNDQVEIDFDKGLIKNLTTGKTYQGQPFPEFMQEIISADGLIQYIKNSLS
FT                   "
FT   gene            142711..143781
FT                   /locus_tag="Ccel_0128"
FT   CDS_pept        142711..143781
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0128"
FT                   /product="3-isopropylmalate dehydrogenase"
FT                   /note="TIGRFAM: 3-isopropylmalate dehydrogenase; PFAM:
FT                   isocitrate/isopropylmalate dehydrogenase; KEGG:
FT                   cth:Cthe_2209 3-isopropylmalate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74516"
FT                   /db_xref="GOA:B8I4G2"
FT                   /db_xref="InterPro:IPR004429"
FT                   /db_xref="InterPro:IPR019818"
FT                   /db_xref="InterPro:IPR024084"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G2"
FT                   /inference="protein motif:TFAM:TIGR00169"
FT                   /protein_id="ACL74516.1"
FT                   /translation="MNYKITVLPGDGIGPDIVAEALKVLELTGKKCGHTFLFTEADLGG
FT                   IAIDRHGEPLPQSTVDICKGSDAVLLGAVGGPKWDTLPGNKRPEAGLLGIRSALGLYAN
FT                   LRPAVIYSALKDASPLKSEIISNGIDIMVIRELTGGMYFGKRGRLETDGGEAAFDTEMY
FT                   NVSEVKRIAKVGFETAMKRSKKLMSVDKANVLESSRLWRQVVVEVAKEYPEVTLSHMYV
FT                   DNAAMQLVRNPAQFDVILTSNIFGDILSDEASMITGSIGMLPSASLGATKLGLFEPIHG
FT                   SAPDIAGQDKANPIATILSVAMMLRYSLGLTEEADSIEKAVTDVLNKGYRTADIASSGT
FT                   KVVGTKEMGKLIREHM"
FT   gene            complement(144201..145052)
FT                   /locus_tag="Ccel_0129"
FT   CDS_pept        complement(144201..145052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0129"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; Protein of unknown function DUF250; KEGG:
FT                   hmo:HM1_1018 integral membrane protein duf6, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74517"
FT                   /db_xref="GOA:B8I4G3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL74517.1"
FT                   /translation="MLITVIFWGYSFVSTKILLNELPPISIAFFRQVIASVVLIGFVIA
FT                   KKLFVKMPLKDLLLLTASSFFGIVLYFIFENTGLKYTTASNASIIVAAVPIFTLISESL
FT                   FYKLKITGRLIICVIVSISGVFFVIFEQGSLDFTGNLLKGNMLIVGAMVSWVIYTIICK
FT                   SLTQKYEGIVVTTYQMIAASILFIPLVLNEVDTWHIISGSGIANLLYLALFCSALAYYL
FT                   YNVAVTNLGATFSSMFLNLIPVVSIIGGVLVLHERISAFQIAGMLLIMVSLFFVGRNRD
FT                   RK"
FT   gene            145290..145556
FT                   /locus_tag="Ccel_0130"
FT   CDS_pept        145290..145556
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0130"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2206 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0130"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74518"
FT                   /db_xref="GOA:B8I4G4"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G4"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2206"
FT                   /protein_id="ACL74518.1"
FT                   /translation="MSVNEISQHNVDLRKGFILLGGWISAVLSLFIYPFVFGMVGVISG
FT                   ILATKDEKSRVGVLLVISSIVLMGVGLAFSNRLLATILRYFGV"
FT   gene            145600..146424
FT                   /locus_tag="Ccel_0131"
FT   CDS_pept        145600..146424
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0131"
FT                   /product="cyanophycinase"
FT                   /note="TIGRFAM: cyanophycinase; PFAM: peptidase S51
FT                   dipeptidase E; KEGG: cth:Cthe_2205 cyanophycinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74519"
FT                   /db_xref="GOA:B8I4G5"
FT                   /db_xref="InterPro:IPR005320"
FT                   /db_xref="InterPro:IPR011811"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G5"
FT                   /inference="protein motif:TFAM:TIGR02069"
FT                   /protein_id="ACL74519.1"
FT                   /translation="MDDLVNGNLLIIGGAEDKWGQSKVLKHAIEMCGGPEAKIMVLTTA
FT                   TQKPEEVGKEYRNVFSRLGVKSIDILNVDSRTDANSDSVAQKVSGAAGVFFTGGDQLRI
FT                   TSILGGTKTAKVLMSIYKKGIPIIGTSAGASVMSSVMIVEGNGNSAARKCTLGMSPGLG
FT                   FIDQVIIDQHFEQRGRLGRLLIGVAQNPSVLGIGIDEDTSIKVYSNASFDVIGTNCVTV
FT                   IDGASIQESNVSELKSEEIIALSNVTIHILPSGYGYDISQRKVKRPNENKHN"
FT   gene            146462..149143
FT                   /locus_tag="Ccel_0132"
FT   CDS_pept        146462..149143
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0132"
FT                   /product="cyanophycin synthetase"
FT                   /note="TIGRFAM: cyanophycin synthetase; PFAM:
FT                   phosphoribosylglycinamide synthetase; cytoplasmic
FT                   peptidoglycan synthetase domain protein; Mur ligase middle
FT                   domain protein; RimK domain protein ATP-grasp; KEGG:
FT                   cth:Cthe_2204 cyanophycin synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74520"
FT                   /db_xref="GOA:B8I4G6"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011810"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G6"
FT                   /inference="protein motif:TFAM:TIGR02068"
FT                   /protein_id="ACL74520.1"
FT                   /translation="MQIQSIYCFKGRNIYSHQPVIRMVVDIGKYEEGPTKDIPGFNKKL
FT                   LEFFPEIAEHTCGVGYAGGFGERLIEGTYMGHVAEHLIIAIQNRFGYGVKYGKTRQIEN
FT                   TSKYYIIYEYCNEAFATECGRKAIEIVHSFAEGTPIDIEKIMRELKRVLLDTEMGPSTK
FT                   AIYLAAKRRGIPVTRVGDGSILRLGYGKYTRIIQASLTDGSSCIAVDIASDKQMTKKLL
FT                   MDNNVPVPCGIVVRTEQEAFEAVEMVGYPLVIKPIDSNQGKGVTVNISTEDKIRAAYSE
FT                   ARKYSRKVIVEKYVCGKDYRVLVVGDKVCAVAERRPPRVTGDGISTIAQLVEYENTNPL
FT                   RGEDHEKPLTYIKLDDISINYLKLQGYSPNSILKAGQYVNLRQNGNLSTGGTARNCTRD
FT                   IHPKNAEYAIIAAKAMGLDIAGVDFSAQDISIPIDNNRGAIIEVNAAPGLRMHLHPSEG
FT                   EPVNVADSILDMMYPANKPFSIPVVAVTGTNGKTTTTRLIRHTLSLLGYNVGMTSTSGI
FT                   YVGNECVQKGDNTGPVSAEVILANKEVDVAVLETARGGIVRRGLGYDLADVGVLINISE
FT                   DHLGIDGINTLEDLAKTKALIVEAVKHDGYAVLNADDGMTPYVLERTRSNVIMFSRGIS
FT                   NPVFKRHCKNSKNIAVYVRDGYIWIQRNGKKLPLISLDDIPITFGGIVDCNIENSLAAI
FT                   SALIGLNIPLDIIIKGMSTFQPDTQLNPGRFNIFDMGTFKVMIDYSHNIAGYSAVVKFM
FT                   QKVKAKRLVGIIGMPGDRQDSNFKEVGELCAKSFHRIYIKEDIDLRGRRRGEVANIFEQ
FT                   SMINAGAKRENIEIIYSETEALEKAMLDAQPGDLIAMFYEEFDPAIQVINRFKKEQEHA
FT                   NEILEGSFNTTIEKLGQFSTNA"
FT   gene            149283..149933
FT                   /locus_tag="Ccel_0133"
FT   CDS_pept        149283..149933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0133"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2584 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74521"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G7"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2584"
FT                   /protein_id="ACL74521.1"
FT                   /translation="MPEVYYYASSDKVSDIIDCGLKLSASYDKEVLIDGNVQQCFVGLI
FT                   NPRDDINSYNSQSLTCIKINVRSDKCYVADSFVYDTIKDKPENLELYNKSVIPLEKYIF
FT                   GTYRKPECLITSTILAGEASRLDRCMDLPVIYENSEALYINNILNNFKEQYNNFDDHLL
FT                   YSLFSRLAEMGKVDTIKSSDGGKAIFISSSGELYCIRKPELIKIFQTEVPCEK"
FT   gene            149923..150903
FT                   /locus_tag="Ccel_0134"
FT   CDS_pept        149923..150903
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0134"
FT                   /product="biotin/acetyl-CoA-carboxylase ligase"
FT                   /note="TIGRFAM: biotin/acetyl-CoA-carboxylase ligase; PFAM:
FT                   biotin protein ligase domain protein; biotin/lipoate A/B
FT                   protein ligase; Helix-turn-helix type 11 domain protein;
FT                   KEGG: cth:Cthe_2585 biotin--acetyl-CoA-carboxylase ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74522"
FT                   /db_xref="GOA:B8I4G8"
FT                   /db_xref="InterPro:IPR003142"
FT                   /db_xref="InterPro:IPR004143"
FT                   /db_xref="InterPro:IPR004408"
FT                   /db_xref="InterPro:IPR008988"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR013196"
FT                   /db_xref="InterPro:IPR030855"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G8"
FT                   /inference="protein motif:TFAM:TIGR00121"
FT                   /protein_id="ACL74522.1"
FT                   /translation="MKNKILKILKEEDKYISGEDISKALNVSRTAVWKHINELRNDGYV
FT                   IQSSSKKGYRFLKAPDILDKREINIPKGQFIGSNIRYFEEIDSTNSYAKKIANEGCAHG
FT                   TVVISEVQTMGRGRVGRQWQSDTAEGIWFSIVVRPDLEPENIQVITLAASVAVVEAIKE
FT                   TCGIICGIKWPNDIILNGRKLGGILTELSAEPGHVNYVVVGIGLNANQDLEHFDYEIRQ
FT                   KAISLKMYAGKSISRANLLGSILTRFEKIYKSILLGENRDIIDKWTAYSVTIGKEVKVA
FT                   YKDMEYFGKALSVASDGRLIVECKDGVTREISAGEIQVRGLLGYI"
FT   gene            150937..151401
FT                   /locus_tag="Ccel_0135"
FT   CDS_pept        150937..151401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0135"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74523"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4G9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74523.1"
FT                   /translation="MVKKNEYPRKNYVKADGQVGQQSTQSTTQQKVYQKDSVRSTRPPR
FT                   DQHKDGFQPRENNQQKREFNSRDNSQRENSGRESGSYNNQHRENNYQRNYHRENYQGRE
FT                   NRESNRQHYQRTAIRPRAEETVEDIENDIVRIQKEIDLELKEIRSMRLGV"
FT   gene            151422..152189
FT                   /locus_tag="Ccel_0136"
FT   CDS_pept        151422..152189
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0136"
FT                   /product="putative transcriptional acitvator, Baf family"
FT                   /note="TIGRFAM: transcriptional activator, Baf family;
FT                   PFAM: Bvg accessory factor; KEGG: cth:Cthe_2588
FT                   pantothenate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74524"
FT                   /db_xref="GOA:B8I4H0"
FT                   /db_xref="InterPro:IPR004619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4H0"
FT                   /inference="protein motif:TFAM:TIGR00671"
FT                   /protein_id="ACL74524.1"
FT                   /translation="MVLVVDVGNTHIVLGVFEGKKLLANWRLGTNKERTSDELGMLILG
FT                   LFNHEKLSIDKVKSVVVASVVPPIMYTLEHAIKKYINIQPMIIGPGTKTGINIRYQNPK
FT                   EVGADRIVNAVAGFELYGGPLIIVDMGTATTFCAISEKGEYLGGVICPGIKISAEALYQ
FT                   KAAKLPRIDLVKPESVIGKNTISSMQSGVFFGYVGQVDYIVNRIKNEMHEENVRVIATG
FT                   GISRMITEESITINEFNPTLTLEGLRLIYERNV"
FT   gene            152422..153354
FT                   /locus_tag="Ccel_0137"
FT   CDS_pept        152422..153354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0137"
FT                   /product="L-lactate dehydrogenase"
FT                   /note="TIGRFAM: L-lactate dehydrogenase; PFAM:
FT                   Lactate/malate dehydrogenase; KEGG: cth:Cthe_0345 malate
FT                   dehydrogenase (NAD)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74525"
FT                   /db_xref="GOA:B8I4H1"
FT                   /db_xref="InterPro:IPR001236"
FT                   /db_xref="InterPro:IPR001557"
FT                   /db_xref="InterPro:IPR011304"
FT                   /db_xref="InterPro:IPR015955"
FT                   /db_xref="InterPro:IPR018177"
FT                   /db_xref="InterPro:IPR022383"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H1"
FT                   /inference="protein motif:TFAM:TIGR01771"
FT                   /protein_id="ACL74525.1"
FT                   /translation="MGFKVAIIGAGFVGASAAYAMSINNLVSELVLIDVNKEKAYGEAL
FT                   DISHGLSFSGNMTVYSGDYSDVKDCDVIVVTAGAARKPGETRLDLAKKNTMIMKSIVTD
FT                   IMKYYNKGVIVSVSNPVDVLAYMTQKWSGLPANKVIGSGTVLDSARLRTHISQALDVDI
FT                   ANVHGYIVGEHGDSQLPLWSATHIAGVQFDDYVKATGLNVDKEALFNEVKVAGATIIKN
FT                   KGATYYGIALSINRIVESILKDFNTIMPVGTVLDGQYGLKDVLLNVPTIVGGNGAEKVL
FT                   EVNITDAELQLLKHSAEQVRAVINEVKDI"
FT   sig_peptide     152422..152484
FT                   /locus_tag="Ccel_0137"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.975 at
FT                   residue 21"
FT   gene            153543..154718
FT                   /locus_tag="Ccel_0138"
FT   CDS_pept        153543..154718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0138"
FT                   /product="malic protein NAD-binding"
FT                   /note="PFAM: malic protein domain protein; malic protein
FT                   NAD-binding; KEGG: cth:Cthe_0344 malate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74526"
FT                   /db_xref="GOA:B8I4H2"
FT                   /db_xref="InterPro:IPR001891"
FT                   /db_xref="InterPro:IPR012301"
FT                   /db_xref="InterPro:IPR012302"
FT                   /db_xref="InterPro:IPR015884"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR037062"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H2"
FT                   /inference="protein motif:PFAM:PF03949"
FT                   /protein_id="ACL74526.1"
FT                   /translation="MGNIYEDSLKAHEEWQGKIEVVCKAPLKDKRDLSLAYSPGVAQPC
FT                   LEIQKDVENSYKYTRRHNLVAVVTDGTAVLGLGDIGPEAGMPVMEGKCCLFKTFGDVDA
FT                   FPLCIKSKDVDTIVNTIKLLSGSFGGVNLEDIAAPRCFEIEERLKKETDIPIFHDDQHG
FT                   TAIVTAAGLINALKVVGKKMEDISIVVNGAGAAAIAITKLLFSMGLRKVVLCDTKGAIY
FT                   EGRDNLNPIKAEMAKITNLEGKKGLLKDVIVGADVFIGVSAANLVTKEMVKSMAKDPII
FT                   FAQANPTPEILPEDALEAGAAVVGTGRSDYPNQVNNVLAFPGIFRGTFDVGAREINDEM
FT                   KIAAAYAIAGLVSDEERNAEYVIPAPFDPRVAKAVAEGVAEAARKSGVARR"
FT   gene            155053..156666
FT                   /locus_tag="Ccel_0139"
FT   CDS_pept        155053..156666
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0139"
FT                   /product="Mannitol dehydrogenase domain protein"
FT                   /note="PFAM: Mannitol dehydrogenase domain; Mannitol
FT                   dehydrogenase rossman domain; KEGG: mta:Moth_0429 mannitol
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74527"
FT                   /db_xref="GOA:B8I4H3"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013118"
FT                   /db_xref="InterPro:IPR013131"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H3"
FT                   /inference="protein motif:PFAM:PF08125"
FT                   /protein_id="ACL74527.1"
FT                   /translation="MKLNRNGIKDYSAWAANQVEMPKFDYDKVLGKTKEEPKWLHFGGG
FT                   NIFRGFIAALQQNLLNSGKADSGIIVAETFDYEIIDKVYKPFDNLSLLVHLNPDGSLEK
FT                   KVIASVSESLTGDTARTKDWERLKYIFRKPSLQMVSFTVTEKGYSLTGMSNEFLPDVLH
FT                   DMENGFKEPKSLIAKTSSLLYVRYLAGAFPIAMVSMDNCSHNGDRLKKSIQTIIQKWVD
FT                   NEIVEKGFLEYINNSSKVSFPCSMIDKITPRPSETVNKALMEMGLEDTEIIRTSRNTYI
FT                   SQFVNAEKPQYLVIEDQFPNGRMPLEDAGVFFTDKRTVENVERMKVTTCLNPLHTALAI
FT                   FGCLLGYTLIADEMKNTQLRKLVEKIGYEEGMPVVINPGIIDPQAFIDEVINQRFPNPY
FT                   IPDTPQRIACDTSQKISVRFGETIKTYVSHPNYDVKSLTYIPLVIAGWCRYLMGIDDNG
FT                   NIMELSPDPMLEQLKTYISAIELGKAETVGQHLKPLLSNDKIFGVNLYEVGLGEKIEGY
FT                   FMEFIEGKNSVKNVLKKYLK"
FT   gene            156692..157774
FT                   /locus_tag="Ccel_0140"
FT   CDS_pept        156692..157774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0140"
FT                   /product="mannonate dehydratase"
FT                   /note="TIGRFAM: mannonate dehydratase; PFAM: Mannonate
FT                   dehydratase; KEGG: trq:TRQ2_0878 mannonate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74528"
FT                   /db_xref="GOA:B8I4H4"
FT                   /db_xref="InterPro:IPR004628"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H4"
FT                   /inference="protein motif:TFAM:TIGR00695"
FT                   /protein_id="ACL74528.1"
FT                   /translation="MNMTFRWFGEKDDSISLEQIRQIPGVTGVVGALYDVPVGDVWPMD
FT                   KIIALKDSVEKAGLKLEVIESVNVHEDIKLGLSSRDKYIENYRQSIINLGKAGVKVICY
FT                   NFMPVFDWLRNNLAYPLLDGSNALCYDHDIVKDIDPVKLVEDTAKSSNGFTLPGWEPER
FT                   LSELKDTFEKYKNVNEDKLFDNLEYFLENIISACEEADVKMAIHPDDPPWPLFGLPRIV
FT                   TDRKNLERLVNLVDSPYNGLTLCSGSLGANPDNNIPDLIRNFGKMGRIHFGHVRNLKFF
FT                   GERKFHESSHLSLDGSFDMFEIMKAYHDIGFKGYIRPDHGRMIWAEKARPGYGLYDRAL
FT                   GVTYLNGLWEAIGKMTSGGE"
FT   gene            157776..159869
FT                   /locus_tag="Ccel_0141"
FT   CDS_pept        157776..159869
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0141"
FT                   /product="Glycosyl hydrolase 67 middle domain protein"
FT                   /note="PFAM: glycoside hydrolase family 67; glycosyl
FT                   hydrolase 67 C-teriminal domain protein; Glycosyl hydrolase
FT                   67 middle domain protein; KEGG: gtn:GTNG_1770
FT                   alpha-glucuronidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74529"
FT                   /db_xref="GOA:B8I4H5"
FT                   /db_xref="InterPro:IPR005154"
FT                   /db_xref="InterPro:IPR011099"
FT                   /db_xref="InterPro:IPR011100"
FT                   /db_xref="InterPro:IPR011395"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR029018"
FT                   /db_xref="InterPro:IPR037054"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H5"
FT                   /inference="protein motif:PFAM:PF07488"
FT                   /protein_id="ACL74529.1"
FT                   /translation="MYKSNVNDELYGANGYNCWLGYHLLENGELRENYSQWASNIVISK
FT                   EPDEIKIALSELKSGINGILGVDAVVVTREPEQSSCIALGVLGRGQNIDSYVKYDEVVQ
FT                   IGNEGFIIKAFKTGNSEIVVVAGTTTKGLLYGVFSLLRLLQTEATISGILKIENPANQL
FT                   RIINHWDNIDGSIERGYAGKSIFFTDNKVTEDLGRIKDYARLLCSVGINSIVINNVNVH
FT                   KYESMLITDKYLNDVASLAQIFRDYGIKLYLSANFASTIEIGGLATADPLDPQVRKWWK
FT                   EKADEIYSLIPDFGGFLIKADSEFRPGPFTYGRTHADGANMLAEALEPYGGLVIWRCFV
FT                   YNCMQDWRDRITDRARAAYDNFMPLDGLFRENVLLQIKNGPMDFQVREPVSPLFGGLQK
FT                   TNQLLELQITQEYTGQQKHLCYLVPMWKEILDFDTMAKGRNTSVKKIITGSVFNNKLGG
FT                   MAAVTNIGNDLNWTGHQMAQSNTYGYARLCWNPDLSAEKITDEWVRMTYSNYEKVVNTV
FT                   KEMLLGSWRTYENYTSPLGIGWMVNPNHHYGPNVDGYEYDKWGTYHRADHKGIGVDRTV
FT                   KSGTGYAGQYHKDVAGIYEDMDKCPEELLLFFHHMPYDYILKSGETLIQYIYNTHFKGV
FT                   EEVEELRNKWFSLKGWISEEIFLHVLERLDGQLEHSKEWRDVINTYFYRKTGISDELGR
FT                   KIY"
FT   gene            complement(159948..162230)
FT                   /locus_tag="Ccel_0142"
FT   CDS_pept        complement(159948..162230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0142"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; histidine kinase HAMP region domain protein;
FT                   KEGG: cpy:Cphy_1915 AraC family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74530"
FT                   /db_xref="GOA:B8I4H6"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H6"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL74530.1"
FT                   /translation="MKNYSVIVKLMIVLSLFIIIPIITITFIFNYGIMKYSEDEIGRSG
FT                   LGKLDSAKSVTDLLSQTINNEILHLSLDETLNRLYGMDDINQAIKDSDNNLMLYQFVSK
FT                   LSDIVKTNNAYSSVYLYLDNSNYIATSNGVYPKETFPDETWLKYYIKSKELGEPLSWTD
FT                   PRPSDTNGNSSVISYIFPLTYTTNLKGSITINIYESRLSNLINSNNYDISDFISIINAN
FT                   GEVISSVDKTILNKNLTDVPYISKILNSEIERGHFIHSINEKRFLITYLKTGAENWTFV
FT                   GVFSLDTLTTKVNSLKMSIIYISIFLLVLFVLLSYVISRRLFNPVKKLVQEIKSRKGID
FT                   IIGNGNEFTLLSKTFDVMIKQEDQLFRTIERDQKNLRENYLLSLLRGKPSNSEDEMKLF
FT                   PLKNTLCCVIYIDKYNDFISNFSYEHQYYLKSVILNLSEEKVGESFICSGVVLDGDKVV
FT                   IIVNITDEDIIKVTHVLKSAFSIVQQEASKIIETTISVCLGGIYDDILKIRNSYNEAQN
FT                   LIKQRFIIGHEAFIYQKENTAATNKYFYPFNMEKQIFNNIDIGSKDALLSSISSFFDEI
FT                   KHNKNLSYDNIMLILNQLLGSTIKYLLDLNISVSKVFGNDFNIYSKLAEIDTLDEAGLF
FT                   LSNIYLQIIEYNEMFKVEGKSHIVKILDYIHKNYKKDIAINMLAEHVGLSYSHVRKIFN
FT                   DETGENIVNYINNMRIEEAQRLLRQTNMNINDIALSLGYNNKQSFNRFFKKYVGINPGE
FT                   YRNIKAN"
FT   gene            162607..163563
FT                   /locus_tag="Ccel_0143"
FT   CDS_pept        162607..163563
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0143"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_1916
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74531"
FT                   /db_xref="GOA:B8I4H7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74531.1"
FT                   /translation="MGKNSTAVSKALPNKLPKKGFGHYFKRDIYLYLLLVLPVAYFIIF
FT                   KYIPMYGIVIAFKEYNIFQGVLASPWIGWDAFREVFRSDDFFRALRNTFLLNGFDMIFG
FT                   FPAPIILAIIINEVKSVRYKRISQTMLYLPHFLSWVIIGGIVLQIFAPNFGMIDTIVKD
FT                   MGFKTIPFLTEKWHWLATYTGIGIWQSAGWSMIIYLAAISGIPAELYEAADVDGAGRLR
FT                   KIWSITLPAIKSTIIILFILNIGKISMIGFDRPYILGNQQVKDFSDVISTYVYRVGLQS
FT                   SRYNIATAVGLFQSIVGLVFLSVTNWIANKSGEQGIW"
FT   gene            163583..164455
FT                   /locus_tag="Ccel_0144"
FT   CDS_pept        163583..164455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0144"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bpu:BPUM_2666 ABC
FT                   transporter ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74532"
FT                   /db_xref="GOA:B8I4H8"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H8"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74532.1"
FT                   /translation="MIYKTSDKVFNIFINSITLISVILCLFPVLNVVAVSLSSNSAILA
FT                   SKVFVWPIDFNIESYKAILKDTTMIWSLVYTIIITFAYTAIGMFLTICAAYPLTKQRLR
FT                   GRNAIMLMIIFTMYFSGGLIPDYMLVKNLNMLDSSWSLILPGVLSAFNLIVLKTFFTSL
FT                   PESLEESAILDGCNDIGVLFKIVLPLSKPVLATLSLFYAVGKWNSFMDALFYISDSKLY
FT                   PLQLKLYQIIVNSQTVDASIGDGGVSQNLPPESLKAACVVFATLPIVLVYPKLQKYFVS
FT                   GIMIGAVKG"
FT   sig_peptide     163583..163687
FT                   /locus_tag="Ccel_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.975) with cleavage site probability 0.775 at
FT                   residue 35"
FT   gene            164518..166110
FT                   /locus_tag="Ccel_0145"
FT   CDS_pept        164518..166110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0145"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cpy:Cphy_1918 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74533"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4H9"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL74533.1"
FT                   /translation="MKKLSTRIVSLALLTSMSVTLFAGCGSNGGTDADSSKSASSSGAA
FT                   KSGPAVELTVEVFDRATPGYKADDNFQIKWIQENFGKPNNINVKFVPVLRQQEVEKLNV
FT                   LMASNQAPDISFTYNDGIIYNYVKSGGLTDLGDLLTKNASNLTKYLGQTLLDYGKFDGK
FT                   QLAVPAKRVIEGCFSAYIRKDWLDAVGMSVPTTTDEWYQVMKAFKEKDPGKLGDKNYPF
FT                   STFVDPNNINWTTSMLLESFKQPISEEQRMTLPNWVIPGFKDGMKFLNKLYNEGILNPQ
FT                   FALDKDGKQYEKDVSQGRIGFMIHNYDFPIRVTPGLLSELKKQVPGADMVPCDPFTNSD
FT                   GKHPKMKYNPNGLYIIVPKVSKHAEEAVKYLEWQSKPEVIKFLQNGIKGDQYTDEVDGI
FT                   PANFIQNDQLSDDKKANFTDLALIVNGKEFGDPAKNIQAASFGYPGFEDTFKKAYDISL
FT                   TDANYIPHFDTVIEAQAKYQKALSDKEAEIFVKSITCKPADFDKTYDKLVAEYMKSGGQ
FT                   EIVDEKLAALKKK"
FT   sig_peptide     164518..164589
FT                   /locus_tag="Ccel_0145"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.585 at
FT                   residue 24"
FT   gene            166531..167331
FT                   /locus_tag="Ccel_0146"
FT   CDS_pept        166531..167331
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0146"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   pmo:Pmob_0232 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74534"
FT                   /db_xref="GOA:B8I4I0"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I0"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACL74534.1"
FT                   /translation="MRYEFYYPQGKKKALTFSYDDGQIHDRRLVEIFNKYNMKATFHLN
FT                   SGTLGTDGFITKEEIESLYKGHEISCHSVTHPYLTKLSKEQIVEEIREDRRELENIVGY
FT                   PLRGMSYPFGEYDADVVKALDVLGIEYSRTVNSTGGFSMPGNFLEWHPTCHHNSGIKAK
FT                   LLDFKNPSPWLKLPLFYIWGHSFEFYRENNWEVIEDFCKEAADDPAIWYATNIEIKDYI
FT                   CALKGLIFSVDQTIVYNPSAVSVWLSRDDRSAVELKAGQTLTFR"
FT   gene            167379..168956
FT                   /locus_tag="Ccel_0147"
FT   CDS_pept        167379..168956
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0147"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: bha:BH2109
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74535"
FT                   /db_xref="GOA:B8I4I1"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I1"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL74535.1"
FT                   /translation="MLKVLLVDDEPYVLEGLKVMLDWEAHGFRICGEASNGEDALEIVR
FT                   VCNPDLIMTDISMPRIDGLELIRLSTENLKSTAKFVILSGYDDFSYAKRAMLYNASNYL
FT                   LKPLDDVELDSVVTKLAEQIKKERKETENINKQLSFIANQSIIRLINGDNKPSLIGRVG
FT                   MLLDIAEDEEFRCILFEIDSADSWVQGEERTELNINRTTPARVIEDALDPAFQFRIFED
FT                   GKGRIGIIASEKMPFFNTLEEFTKSLLLQLNQIFGDVVYASISDSEKGLSLISKTYKQA
FT                   LFAIGFKFYSPGKSLISYENVKGLNLNFEMCTEYYNALLDFIRANRVEDIEPVVCRLFK
FT                   NFSENHSAPQIIISYLMNFQMELVKLIMEIGGDLKEFLTLALGFQKTAEHLNMSNLQGE
FT                   FLKQCLSAASHINGFKQGNPQFIVCEVKNYIKQNYCKDIKLKEVARHFYMNSVYLGQLF
FT                   KKVSGVQFNDYLNNVRVEEAKKLLQRTDMKVSEISSAVGYNDPKYFLSKFKAITSLPPS
FT                   AFKTGKTT"
FT   gene            168975..170759
FT                   /locus_tag="Ccel_0148"
FT   CDS_pept        168975..170759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0148"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase internal region; KEGG: csc:Csac_2691 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74536"
FT                   /db_xref="GOA:B8I4I2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I2"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACL74536.1"
FT                   /translation="MKLRPRILIRVNDIPLNIKFLIIYVLCILTPIIIINAAFLDKFYT
FT                   VVTQREENNYQISMQRAKNDINALIEGGIAVSHSISTDAIIYDLMDARYEDAGEYYDIY
FT                   SSTLRNRLSIYTVAYNYITNIGLYVDNPSIRAGNTYYYIDRSVRNTIWYKDLSESNEQV
FT                   LIRTYMGSSNSVPIRRIQYLSILRSSKNNPSLGSREKILKVDISLEKVFTIFNRERDYL
FT                   SLYLIDPQNTIVCSTTGRYGLNNIDKLEKLNSESLGKENMILEAYLGNSSYFKGWKLIG
FT                   VTDRERISDSVGDTLRFVLIFAFISVLISSLLMYIIVRSYNYRLRKLSKHMLKFKDGKF
FT                   ELININEGEDEIGGVIRNFNLMAARINTLINDVYKLELQKKSLELERVRAEINFLQSQM
FT                   NPHFLFNTLNAILVVSVKNNYTEIVDVIKYLSKTLRRLLSWKDDLVTIEEELSFTEMYL
FT                   KIEKFRFCDKFHYNINVNETLLDYQIPKMSLQPLVENACKHGIQTIKEVGVININIDMC
FT                   ESGLRVSVKDNGSGIDQYTLSGIIDNVKSEVEQSTSIGIRNVYRRLRLYYGENISFNIE
FT                   SCINTGTTIYFTIPFEKL"
FT   gene            170830..172407
FT                   /locus_tag="Ccel_0149"
FT   CDS_pept        170830..172407
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0149"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: bha:BH2109
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74537"
FT                   /db_xref="GOA:B8I4I3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I3"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL74537.1"
FT                   /translation="MFKVLLVDDEPMALEALRIVADWEELGFTVCGECSNGDEALNKIE
FT                   DIKPDLVVTDLKMPGMDGLELIRKVMECVNSDIIFIIVSGYDEFDYAKEAMQYGVRYYV
FT                   LKPVFKDEFSEVLLEIGNKLKKKYQLGKMTINNISTDIGSLLGKYLIGSLGEDEIRARM
FT                   PEKISKSKAYWSYVCLGTPRVWETVNFKNDEISEDSLSTFKEMVNTVLEGIYIYPILTN
FT                   TVIEGIVICITSEIQTNKIIETLKSSVSTLFGEGFYLGVGNTVNELSELSESMSQAHKA
FT                   IDYRFFSAPGSIIYYQNIKDFSLNYSFKGIYKIEDMYKALDSLDEMRIKKAIEVVFSDF
FT                   RREYTAPEIIKMYVVNIIYKSISIVTSLNGSTDQIPLLDSITAILAKSLIIDEMENMAH
FT                   EYCFKFVIYAKSLKDKAKNSDMKLVDEYIRNNYTRNLTIREISKKLYIHPNYLGHQINK
FT                   WFGCSFNEYLHGLRMEEAKNLIENTNLKVHEIAERVGYSSYSNFLDQFVKRFSIKPSDY
FT                   KIMLNNKN"
FT   gene            172536..174239
FT                   /locus_tag="Ccel_0150"
FT   CDS_pept        172536..174239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0150"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: bha:BH2111 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74538"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I4"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL74538.1"
FT                   /translation="MMLRKRNWLVVLLTVLLAVSFTLTGCGGSDSSSSTSTSGTATATG
FT                   SAAGEKLDPIEISFFISDPGQAPTPDNKIYKKIKEELGVTCNFEFLVGDKNQKIGVMIA
FT                   GGEYPDVVTVGSDTVSKFTGAGALVPLEDIIEKSAPNLKKHFDPFKNKVKDVEDGHFYA
FT                   MPGYGVYYNDFSINVNEGPAFFIQKAVLKDAGYPKVKTLDQYFDLIEKYKAKNPTIDGQ
FT                   PTIGFEILSEGWRDFCLKNPPQHLIGHPNDGGVVVNSETNTAEFFWDKDYAKRYYKKIN
FT                   EINAKGLLDPETFTMNFDQYIAKLSSGRVLGMFDQHWNFNNAELTLKTQKKFERTYAPL
FT                   PLVFDEDTRDYYMDRPVLNVNTGYAITKSAKNPERIVKFFDALLTEEWQTILGWGIKDE
FT                   DYKVGDDGMFYMTPEQRVNYNDQTWRLANMAHTLWYYAPKMEGTFSDGNATGPGGQPKE
FT                   YYDALDQYDKDFFKAYGYDQQSDFFSPAPENRISYPAWQIDLVDGSPASMANTKVGDIA
FT                   TKYLPKAILAKPDKFDSVWDEYVNQLHKEDIQAYVDRINDQLKWRAENWK"
FT   sig_peptide     172536..172613
FT                   /locus_tag="Ccel_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.324 at
FT                   residue 26"
FT   gene            174325..175296
FT                   /locus_tag="Ccel_0151"
FT   CDS_pept        174325..175296
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0151"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_3209
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74539"
FT                   /db_xref="GOA:B8I4I5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74539.1"
FT                   /translation="MANNVTALADNKLQGKKRTGHKITWNTLVKQKQLIFMSVPMLIYV
FT                   LIFSYVPIWGWLMAFQNYKPAKGFFEQKWVGLQNFKYLLRDDNFIRDFRNTICMSFINL
FT                   VLSYVTAIVLALLLNEIKNVFFKRTVQTISYLPHFLSWVIVTGIVATCLSTEGGIVNIV
FT                   LVKLGIINSPINWLSEGKYFWGIVGATNVWKELGWNTIIYLGAITAIDPALYEAADLDG
FT                   AGRFKKMQHVTLPGIKATFVVLLIMSIGHVMEAGFEIQYLLGKGPVLDWSETIDIYVIK
FT                   YGINQFNYSLATAAGIFKSVIAIIMLFLANNVAKRLGEERLI"
FT   gene            175306..176220
FT                   /locus_tag="Ccel_0152"
FT   CDS_pept        175306..176220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0152"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cpy:Cphy_3208
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74540"
FT                   /db_xref="GOA:B8I4I6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74540.1"
FT                   /translation="MINRRKPVRIGDAVFNTFNFVFMVLLMIVTLYPFLNTLAISFNNG
FT                   VDTLRGGIYLWPREFSFQNYKAIFIGGNVFHAFLVSVERTVISTVLNLFLTTMLSFTLS
FT                   RKEYVFRKPITIVFVLTMYFNAGIIPNYFLIKNLHLLNSFWVYVLPSLIAAFNMIVIRT
FT                   FIIGIPESFVESARIDGAGDFRIFIQIIFPLCKPVLATIALFVAVGAWNTWFDTFLYCS
FT                   SKQNLSTLQYELMKLLSSTQNFNANPALAAGVGANSQTADTMVTSLSIRAAITIVAAVP
FT                   IIIVYPFLQRYFVVGLNVGGVKE"
FT   gene            176198..177484
FT                   /locus_tag="Ccel_0153"
FT   CDS_pept        176198..177484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0153"
FT                   /product="glycoside hydrolase family 10"
FT                   /note="PFAM: glycoside hydrolase family 10; KEGG:
FT                   csc:Csac_0204 glycoside hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74541"
FT                   /db_xref="GOA:B8I4I7"
FT                   /db_xref="InterPro:IPR001000"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I7"
FT                   /inference="protein motif:PFAM:PF00331"
FT                   /protein_id="ACL74541.1"
FT                   /translation="MLVELKNNPFSGRGIVMGIINDNKYSHRIVTKTAKLSGLDGSVLK
FT                   NTEVVVQQTRHKFLFGCAQFDAIPYVNNEFKGEEKERAEQRFDKFIDLFNYATLPFYWA
FT                   FYESVKGQPMIKETKKAAEWLVSNGLLLKGHTLCWHTITAPWLLDMTNEEILMAQMKRI
FT                   NRDVSEFEGLIDIWDAINEVVIMPVFDKYDNGITRICKELGRIKLVSKVFSEAKKANPS
FT                   ATLLINDFNTSESYAILLEGLIEAGVPIDAIGIQSHMHQGYWGVEKTLEVLERFSRFNL
FT                   PLHFTENTLVSGQLIPPEIEDLNDYQVKEWPSTVAGEDRQAREVISHYKTLLANPKVES
FT                   ITWWDFADGAWLGAPSGFITVDNRVKPAYDELHKLIKGEWWLKPTKYMTNENGEITISG
FT                   FFGDYEVSCQGKRIGFTFDSSNDTVKLKI"
FT   gene            177659..180751
FT                   /locus_tag="Ccel_0154"
FT   CDS_pept        177659..180751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0154"
FT                   /product="glycoside hydrolase family 2 TIM barrel"
FT                   /note="PFAM: glycoside hydrolase family 42 domain 5 loop
FT                   region; glycoside hydrolase family 2 immunoglobulin domain
FT                   protein beta-sandwich; glycoside hydrolase family 2 TIM
FT                   barrel; glycoside hydrolase family 2 sugar binding; KEGG:
FT                   cpr:CPR_0750 beta-galactosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74542"
FT                   /db_xref="GOA:B8I4I8"
FT                   /db_xref="InterPro:IPR004199"
FT                   /db_xref="InterPro:IPR006101"
FT                   /db_xref="InterPro:IPR006102"
FT                   /db_xref="InterPro:IPR006103"
FT                   /db_xref="InterPro:IPR006104"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR023232"
FT                   /db_xref="InterPro:IPR023933"
FT                   /db_xref="InterPro:IPR032312"
FT                   /db_xref="InterPro:IPR036156"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I8"
FT                   /inference="protein motif:PFAM:PF02836"
FT                   /protein_id="ACL74542.1"
FT                   /translation="MIIENYFENPKILHVGTMEKRAYYVPYPPEDVNKSSDRNKSERLH
FT                   LLNGEWDFLYLKSVYNITDEFYLPGYDRAGFDKIPVPSVWQNHGYDRHQYTNIKYPFPY
FT                   DPPHVPVDNPCGVYVREFYADTSWNGMRKYINFEGVDSCFYLWINGKFTGYSQVSHSTS
FT                   EFDITDYVHEGVNTIAVLVLKWCDGSYFEDQDKFRTSGIFRDVYILIRPENHIRDFFVR
FT                   TSLKEDYKKAEIKVDMDIFGSIPGIDYKLTDNSTGNIEAQGNANGKSISIEMDNPKLWS
FT                   AEIPYLYTLIIRSDYEAISVQVGIREIKAEDGIVYLNGQKIKFKGVNRHDSDPVKGPAV
FT                   DVKDMIKDLMLMKQHNINAIRTSHYPNSPLFTELCDKYGCYVIAEADIEAHGTTAVYGG
FT                   GQDGKSFPMLAHDSEFEDAVIDRVESCVIRDKNHPCVVIWSLGNESGYGKNFESALDWL
FT                   KGYDNSRLTHYESSLYPPEGYDADYSSLDLYSRMYASCEDIIEYFQGDNVSKPLILCEY
FT                   SHAMGNGPGDLEEYHEQIERYDGLCGGFVWEWCDHAVYMGRTVDGRKKYLYGGDFGEFP
FT                   HDGNFCVDGLVYPDRRVHTGLLEYKNVLRPLRLVNENSKDGKFTFKNMLDFINTKDFLF
FT                   ISYEVTKNGEVILDGVIDEPGLLDIQPHEKKDICLTLHGVEEGDCYIKFDYIQKYDTPF
FT                   VGSGHLLGFDQVKLAVDKVGLKEDKITCILGEPDSKEGEISVVESDRNAIIIGNNFRYT
FT                   FNKMTGVFDKLIYKNNVILDKPMNYNIWRAPTDNDRNVRHKWEEAGYDRTLSRSYNTQV
FT                   FEENGNVRIITELSLLAVHIQRIMSISTEWNIAENGLISVNIQAERNMEMPFLPRFGLR
FT                   LFLPEYIRNVEYFGYGPHESYADKRRSSYVGRFKSNVGRMHEDYLKPQENGSHWGCHYV
FT                   KLASNCGLGLLVTGDETFSFNASYYTQEELTRKSHNFELEKCGSTVLCVDYAQSGIGSN
FT                   SCGPELMEKYRFNAQRFHYTMFLRPFMEQPSTAIVKAAHNT"
FT   gene            180862..182319
FT                   /locus_tag="Ccel_0155"
FT   CDS_pept        180862..182319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0155"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   cth:Cthe_2108 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74543"
FT                   /db_xref="GOA:B8I4I9"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4I9"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACL74543.1"
FT                   /translation="MKTIKEYNLPIYNYLRKYAKEDINVFHMPGHKLSRGIPRELSDDV
FT                   LKLDVTEIDGTDNLHYPEGIIKEAQELAARAFGADRTFFLVNGSTCGIQAAIMSVCTRG
FT                   QKIIIGRDSHKSVVSGLILSGAKPIFVYPEYNSKFGIHEGITAQSIENALSMNPDAAAV
FT                   LITRPNYYGICSDIKNIADTVHSYGKPLIVDEAHGAHLSFSPLLPPSANQYNADVVIQS
FT                   AHKTLPAVTQGAYLHLNGPLIDIDKILFNLAMLQTSSPSYIVMTYLDIARELMQTEGIQ
FT                   RLKYLLDEINIFNGRVSEIGGYKVLSGKYLGINTIQDPTRLVLNVSRLGISGFQAEATL
FT                   RAELSTQVEMADYENIVLITTIADKRRSFERLYESLSKLAQIPFDKDCIQQMEKKREFG
FT                   EIQKPSDGFSVLSPYEAYAAQKEQKELKSCLGRICAGVITPYPPGIPILYPGEIIDGEK
FT                   ISYIEYIIDLGGTVNGVGNNNSVQVVK"
FT   gene            182372..182992
FT                   /locus_tag="Ccel_0156"
FT   CDS_pept        182372..182992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0156"
FT                   /product="thymidylate kinase"
FT                   /note="PFAM: thymidylate kinase; KEGG: aoe:Clos_0060 dTMP
FT                   kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74544"
FT                   /db_xref="GOA:B8I4J0"
FT                   /db_xref="InterPro:IPR018094"
FT                   /db_xref="InterPro:IPR018095"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J0"
FT                   /inference="protein motif:PFAM:PF02223"
FT                   /protein_id="ACL74544.1"
FT                   /translation="MRKGLFITVEGTDGSGKTTQIKLMEQYLKDMGNEVVLSREPGGTR
FT                   ISEMIRDLILDPENKDISPLTEMMLYAAARAQHVSQVIRPAIESGKSVICDRFVDSSYA
FT                   YQGCGRGVDLKTIADVNRAAIDGVVPDITFFLDLDPRVAMERRVKSTGADRIEQEKMDF
FT                   HIRVYEGYERMALLYPERIKTIDASKSIEEISSQINIYLKEIL"
FT   gene            183026..183355
FT                   /locus_tag="Ccel_0157"
FT   CDS_pept        183026..183355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0157"
FT                   /product="protein of unknown function DUF970"
FT                   /note="PFAM: protein of unknown function DUF970; KEGG:
FT                   tte:TTE0095 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74545"
FT                   /db_xref="InterPro:IPR010375"
FT                   /db_xref="InterPro:IPR011322"
FT                   /db_xref="InterPro:IPR015867"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J1"
FT                   /inference="protein motif:PFAM:PF06153"
FT                   /protein_id="ACL74545.1"
FT                   /translation="MKLVFAIVHDEDGNRVMEELNKHGVSVTKMCSTGGFLKAGNTTLL
FT                   VGVDEEKLDEVIAIIEKKSKSRRQVINTPATSGGINGMFMPYPVEVTVGGATIFVVDVE
FT                   KFHKV"
FT   gene            183373..183840
FT                   /locus_tag="Ccel_0158"
FT   CDS_pept        183373..183840
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0158"
FT                   /product="protein of unknown function DUF327"
FT                   /note="PFAM: protein of unknown function DUF327; KEGG:
FT                   cth:Cthe_2106 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74546"
FT                   /db_xref="InterPro:IPR005585"
FT                   /db_xref="InterPro:IPR024042"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J2"
FT                   /inference="protein motif:PFAM:PF03885"
FT                   /protein_id="ACL74546.1"
FT                   /translation="MIPIPIKIQDSSESRANISALPSRDERTIRNERDTSFSNQLRKLE
FT                   TKNYEERVKVLADKIESQGKKLGKKTDIRELKVYKQLISDFLDEAVSHSHSFMKKNFLD
FT                   RRGRHRIYAIIKKINEELVELTNEVLKSQKDNISILKKLDDIRGLILDLFL"
FT   gene            183856..184824
FT                   /locus_tag="Ccel_0159"
FT   CDS_pept        183856..184824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0159"
FT                   /product="DNA polymerase III, delta prime subunit"
FT                   /note="KEGG: cth:Cthe_2105 DNA polymerase III, delta prime
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74547"
FT                   /db_xref="GOA:B8I4J3"
FT                   /db_xref="InterPro:IPR004622"
FT                   /db_xref="InterPro:IPR015199"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J3"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2105"
FT                   /protein_id="ACL74547.1"
FT                   /translation="MLGHQRIISALRTAIQKDNVSHAYIFEGPDGVGKRATALKFASML
FT                   MCREDQFPCGECKSCQLYREASNPDFQEIIQKDKSISVEEIRNILKGLVIRPLYSDYKV
FT                   IIINDADTMTIQAQNALLKSLEEPPPYVVFILTVQSLAAVAQTIRSRCQRILFNRLSHE
FT                   DIMEIMESKYGPRQSDWEFIVSYADGVAGTALELAESPHSLELREEVLEFTSRLVSDRD
FT                   ADPFKFYETFEKNNDRVDYILHVILLYFRDLLIYKETGDTSLLINSDKKDMIIRNVELS
FT                   FSHIIKCIQAVWDARRGLGNNANFQLAIEVMLMKIQKADNA"
FT   gene            184857..185732
FT                   /locus_tag="Ccel_0160"
FT   CDS_pept        184857..185732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0160"
FT                   /product="PSP1 domain protein"
FT                   /note="PFAM: PSP1 domain protein; KEGG: cth:Cthe_2104 PSP1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74548"
FT                   /db_xref="InterPro:IPR007557"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J4"
FT                   /inference="protein motif:PFAM:PF04468"
FT                   /protein_id="ACL74548.1"
FT                   /translation="MVKVVGVRFKKAGKIYYFDPGELVIDLNQNVIVETARGIEFGLVV
FT                   VPNREVDESEIVAPLKKVIRVATEEDIAHAQENDRKEKDAFNICLQKISDHNLEMKLID
FT                   VEYTFDNNKILFYFTADGRVDFRELVKDLASVFKTRIELRQIGVRDESKMMGGIGICGR
FT                   VLCCNSFLGEFQPVSIKMAKEQSLSLNPTKISGTCGRLMCCLKYEQEAYEDLLSRVPKV
FT                   GAIVETPEGQGTIVDVMLLKEILTVRLDIGNESDLRVYNFKDGEIKVIKDAAASYDSDI
FT                   DLEALKQLED"
FT   gene            185841..186011
FT                   /locus_tag="Ccel_0161"
FT   CDS_pept        185841..186011
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0161"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: cth:Cthe_2103 4Fe-4S ferredoxin, iron-sulfur
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74549"
FT                   /db_xref="GOA:B8I4J5"
FT                   /db_xref="InterPro:IPR000813"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J5"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACL74549.1"
FT                   /translation="MAYSINDACISCGACESECPVSCITAGDSIYVIDEDTCIDCGACA
FT                   NVCPVDAPQQK"
FT   gene            186078..186860
FT                   /locus_tag="Ccel_0162"
FT   CDS_pept        186078..186860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0162"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: methyltransferase small; Methyltransferase
FT                   type 11; KEGG: cth:Cthe_2102 methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74550"
FT                   /db_xref="GOA:B8I4J6"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J6"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL74550.1"
FT                   /translation="MIRGVLLVTIRDKERIDDLQLHGLKLIQNTEKFCFGVDAVLLSDF
FT                   ADVKRNSKVLDIGTGSGIIPVLLAGKTKAAKIVGIEIQEEMAEMASRSVLMNRLSDRLE
FT                   IVQGDIKLYREYFRKSSFDVVVSNPPYTNKGCGLVNPMDSKAISRHEILCSLEDVVSAA
FT                   AALLVPGGQLAMVHRPERLADIICSMRNNGIEPKHLRLVHPKPGKKPNLLLIKGNRGGN
FT                   PELKVMEPLYVYNSNGTYSDEINKIYGRAEEEKIERKG"
FT   gene            186844..187692
FT                   /locus_tag="Ccel_0163"
FT   CDS_pept        186844..187692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0163"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: cth:Cthe_2101
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74551"
FT                   /db_xref="GOA:B8I4J7"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J7"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACL74551.1"
FT                   /translation="MSEKGKLYLVATPIGNLQDITFRAINTLKDVDFIAAEDTRQTIKL
FT                   LNHFEIKKPLVSYYEHNKLVKGNYLIEQLLSGKNIALVSDAGSPGISDPGEDLVRLAIE
FT                   NGIEVTMIPGPVAAVTGLVISGLPAGRFVFEGFLPMNKRSRQERLQQLKNETRTIIFYE
FT                   APHKLSYTLKDIYNAWGDRRIALARELTKRFEEVIRCSLFEAMERFQTEAPKGEFVVII
FT                   EGQDEALLVEQEREKYSEISIEDHVNRYVEEGLTKKEAIKKAAEDRGLNKRDIYNAVMK
FT                   K"
FT   gene            complement(187761..188000)
FT                   /locus_tag="Ccel_0164"
FT   CDS_pept        complement(187761..188000)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0164"
FT                   /product="transcriptional regulator, AbrB family"
FT                   /note="TIGRFAM: transcriptional regulator, AbrB family;
FT                   PFAM: SpoVT/AbrB domain protein; KEGG: cth:Cthe_2100 AbrB
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74552"
FT                   /db_xref="GOA:B8I4J8"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J8"
FT                   /inference="protein motif:TFAM:TIGR01439"
FT                   /protein_id="ACL74552.1"
FT                   /translation="MKSTGIVRKVDELGRVVLPIELRRTLDIAEKDALEIYVDEATIIL
FT                   KKYEPACIFCGNAKDVIVYKGKNICPECMKELKK"
FT   gene            188368..188955
FT                   /locus_tag="Ccel_0165"
FT   CDS_pept        188368..188955
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0165"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   cth:Cthe_2099 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74553"
FT                   /db_xref="GOA:B8I4J9"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4J9"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACL74553.1"
FT                   /translation="MLNYIWIGLLMIGFAFGIVNGRLDAVTKAAMDSAQTAVNVCIGLL
FT                   GVMCLWTGLMKIAEKSGLIRIIGRAVRPVLGFLFPEIPKDHPALGAIVMNLVANFLGLG
FT                   NAATPLGLKAMKELQSINRDKRTATNAMCMFLVLNTAAIQLVPASIIALRTSEGSKKPA
FT                   EIIVCIWIASVCATIMGIIASKLLSLVWKKDN"
FT   gene            188971..189501
FT                   /locus_tag="Ccel_0166"
FT   CDS_pept        188971..189501
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0166"
FT                   /product="nucleoside recognition domain protein"
FT                   /note="PFAM: nucleoside recognition domain protein; KEGG:
FT                   cth:Cthe_2098 nucleoside recognition"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74554"
FT                   /db_xref="GOA:B8I4K0"
FT                   /db_xref="InterPro:IPR011642"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K0"
FT                   /inference="protein motif:PFAM:PF07670"
FT                   /protein_id="ACL74554.1"
FT                   /translation="MIFIRHLSDFAVPAIFIVIIGVAVLKKVKAYDVFVEGAKDGIDTI
FT                   IKIIPSLVGLLVAVGVFKASGAMDSLILLLRPLTDLLGMPPQVAPLALLRPISGSASFA
FT                   FVTEIIKSFGPDSYAGRVAATMMGSTETIFYTLAVYYGSVGIKNIRYTLIAAIMADIIS
FT                   VIASLWACQFIFG"
FT   gene            complement(189498..190556)
FT                   /locus_tag="Ccel_0167"
FT   CDS_pept        complement(189498..190556)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0167"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: dsy:DSY2213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74555"
FT                   /db_xref="InterPro:IPR019712"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74555.1"
FT                   /translation="MKNIIDCIRFTNRYAKKIHPVVQKRSQEYYNYTGRIVKYKLKRNA
FT                   KEALKESQFDMAVSSVCTLWPGVNVKLASEVIFSFLAIVSYLNKMCENSAVVTEAFIRV
FT                   IFSSLKDAANIRNESFEKYFTFFPSKDDNGYLSILVEKCRQKIQLLPSFNIVRDNISAF
FT                   LALYIDLQVTKYSSNDNEKEVNLIRWSSAHGQKYPELSNWEFCMCIDSGLDIQLLLALA
FT                   TNPDLTEEDVDSIHTAFFPWVSCIHKILECYLKYNDDLSTGSLNYIFYYGSLKEYEDRI
FT                   EFFTNKSLSVKTKYRGNVKSVLKILLSLFTTDPKANEGMNSITSKSLYKTGGKGMWLYS
FT                   LSAKILRALNKF"
FT   gene            190808..191575
FT                   /locus_tag="Ccel_0168"
FT   CDS_pept        190808..191575
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0168"
FT                   /product="hydrolase, TatD family"
FT                   /note="TIGRFAM: hydrolase, TatD family; PFAM: TatD-related
FT                   deoxyribonuclease; KEGG: cth:Cthe_2095 TatD family
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74556"
FT                   /db_xref="GOA:B8I4K2"
FT                   /db_xref="InterPro:IPR001130"
FT                   /db_xref="InterPro:IPR015991"
FT                   /db_xref="InterPro:IPR018228"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K2"
FT                   /inference="protein motif:TFAM:TIGR00010"
FT                   /protein_id="ACL74556.1"
FT                   /translation="MIFDTHAHYDDEKFDEDRDGLLQELYSNGIGYIVNASADINSLDA
FT                   SIELSGKYDFVYAALGIHPHYADQINDEVIERIKKLCKNSKVVAIGEIGLDYYYDNSPR
FT                   DIQKHWFERQIELAKELELPIIIHDRDAHEDTLNIIKKTNAQQVGGIFHCFTGSREMAL
FT                   DVLKHNLYIAVGGAVTFKNSRRIKEVVEAVPLDRLVIETDCPYLTPEPYRGKRNNSGYL
FT                   IHIIEKIAEIKGVSSEEIEEATLINAKKVFKLV"
FT   gene            191627..192322
FT                   /locus_tag="Ccel_0169"
FT   CDS_pept        191627..192322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0169"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: viral A-type inclusion protein, putative;
FT                   K02331 DNA polymerase phi subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74557"
FT                   /db_xref="GOA:B8I4K3"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74557.1"
FT                   /translation="MKRFIIIIVFLFLIALLISFNYLLWDREKQLENFQDLRDAKNFTI
FT                   DTLGEKNNALDKKNRELTEKIDSLNLAISDLKDEFNRLSVENTDLKNQVSDYADLINQF
FT                   KKNMNTMPINGLIKNWFEAINTKNYKVASALISKNSHDEILNNPANFSKTYQEEIKSIN
FT                   LKSLHIFTDLSDQEHLGKIQFRIITEVEKPESQQTDKLYKSGDNEKYITVEFNTQSKEW
FT                   LILEVSDKP"
FT   sig_peptide     191627..191701
FT                   /locus_tag="Ccel_0169"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.812) with cleavage site probability 0.724 at
FT                   residue 25"
FT   gene            192562..193632
FT                   /locus_tag="Ccel_0170"
FT   CDS_pept        192562..193632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0170"
FT                   /product="3D domain protein"
FT                   /note="PFAM: protein of unknown function DUF348; 3D domain
FT                   protein; G5 domain protein; KEGG: cth:Cthe_2093
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74558"
FT                   /db_xref="GOA:B8I4K4"
FT                   /db_xref="InterPro:IPR007137"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K4"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ACL74558.1"
FT                   /translation="MTPIAKNIKRYFSELKIRSLDVAIVCIVVVISVTAGFLVFNGLNR
FT                   HVVINDNGHTIAVKTMRTTVKEVLEQTGIKVDKADYISMPFDAKLTKIHQNVINIKRAV
FT                   PVSIKVDGKELDVKTCKDTVSEVLKDNNISVDSDDKFVGSQLGDKIVSNMKISIVRVEE
FT                   KTITETLPIPFKTITKENKRLDKGVRNTVRQGKEGVREKLYKVVFEDGKQTTKQLIKDF
FT                   VATNPLNCIVEVGTVLNYNTARGETIRFSKVLDMRATSYTASFKDTGKRPGEPGFGITA
FT                   TGAKVRRGIIAVDPRVIPLGTRVYVEVPGKAADYGYAVASDTGGAIKGNKIDVYLESGS
FT                   QVDAWGVKKVKVYILK"
FT   gene            193822..194694
FT                   /locus_tag="Ccel_0171"
FT   CDS_pept        193822..194694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0171"
FT                   /product="dimethyladenosine transferase"
FT                   /note="TIGRFAM: dimethyladenosine transferase; PFAM:
FT                   ribosomal RNA adenine methylase transferase; KEGG:
FT                   cth:Cthe_2092 dimethyladenosine transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74559"
FT                   /db_xref="GOA:B8I4K5"
FT                   /db_xref="InterPro:IPR001737"
FT                   /db_xref="InterPro:IPR011530"
FT                   /db_xref="InterPro:IPR020596"
FT                   /db_xref="InterPro:IPR020598"
FT                   /db_xref="InterPro:IPR023165"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K5"
FT                   /inference="protein motif:TFAM:TIGR00755"
FT                   /protein_id="ACL74559.1"
FT                   /translation="MIKNNTSEIIKKHRLKLTKALGQNFLTDFSVVKRIVDASDIDKDT
FT                   LAIEIGPGVGSMTRELAARSAGVAAIEIDKRLIPALNDNLSDYSNVSIINEDIMKADID
FT                   TIINKYREVYNAKSVKVVANLPYYITTPIIMRFLEEVKGVDKMVFMVQREVAERMVSGP
FT                   GTKDYGALSVAVQFYSKPEIIFDVPPHCFIPQPEVHSTIIGLDILSEPPVEVIDRNLYF
FT                   KIVKASFGQRRKTLVNALSNSGFFNKTKEQIKQILKEMGKSENIRGEVLTVAQFAQLSN
FT                   LMINEHQKD"
FT   gene            194789..196132
FT                   /locus_tag="Ccel_0172"
FT   CDS_pept        194789..196132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0172"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2091 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74560"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74560.1"
FT                   /translation="MGNAYERQYHIFKTMDNNWENPSGFIKVEINDDNTRFQLSLNNLS
FT                   DNKDSTYSLYGIQKDNSTLEYTDICRILPVNGRVDIKTNFSSDEIGSNKLNVHDINIFA
FT                   VIYRSTDKSSGTVKCPLVAYAKGEQVWKGEFERVLEQPSLKIEASAAAIDADDTAEIPV
FT                   AIQNEKNDEPETEDINIQSWTVLDDEYSKNPIELLESEGTEREQENIETYVSEEVSGQE
FT                   NIESYVSEEVSGQETDISDLSSKFQGDLSSVYQDSFEGEMEENDESGDNSQETGEVQDV
FT                   WKKIQDDFNDISSIRIDESANMDKSETDIEHPLNIQLLKQELDNSFEEFNPFKTRNRSY
FT                   KWWKINSPGFLNNILFRNNIKTYLLFNPKVMLAHYKYRYIILGLRNNRQPQRERLICGI
FT                   PGVYNIDDNPFGSEGSWVQMEGYRPKYGAFGYWIVTLDPRTGKISKMK"
FT   gene            196207..196605
FT                   /locus_tag="Ccel_0173"
FT   CDS_pept        196207..196605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0173"
FT                   /product="hemerythrin-like metal-binding protein"
FT                   /note="TIGRFAM: hemerythrin-like metal-binding protein;
FT                   PFAM: Hemerythrin HHE cation binding domain protein; KEGG:
FT                   gsu:GSU2929 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74561"
FT                   /db_xref="GOA:B8I4K7"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR012827"
FT                   /db_xref="InterPro:IPR035938"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K7"
FT                   /inference="protein motif:TFAM:TIGR02481"
FT                   /protein_id="ACL74561.1"
FT                   /translation="MAIKWRDSLAIGITEIDDQHKKLFEAIDKLFTACVQGKGKEEVVN
FT                   TIKFLEDYTIVHFNDEQEMHKKYNYPERDAHRKIHDNFLNSFSKLKEQFEQEGAGPLFI
FT                   STINKQVVDWLIQHIGKADKAFAAYVKG"
FT   gene            196730..197167
FT                   /locus_tag="Ccel_0174"
FT   CDS_pept        196730..197167
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0174"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   cth:Cthe_2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74562"
FT                   /db_xref="GOA:B8I4K8"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K8"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ACL74562.1"
FT                   /translation="MTAKNKVVIRIAGKDYTLVGSEPDEYIHKVGLYIDKKMNEIMLRN
FT                   SRLSTSFAAVLTAINVADDYFKSKAEEISLGKEKDELVNETEKLKCEIEQLREQNEELV
FT                   AKNTSLQVELAKREAELGEVRNSISKDNRVIAQKSLAGYDI"
FT   gene            197310..198203
FT                   /locus_tag="Ccel_0175"
FT   CDS_pept        197310..198203
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0175"
FT                   /product="metalloenzyme domain protein"
FT                   /note="PFAM: metalloenzyme domain protein; KEGG:
FT                   cth:Cthe_2087 metalloenzyme"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74563"
FT                   /db_xref="GOA:B8I4K9"
FT                   /db_xref="InterPro:IPR006124"
FT                   /db_xref="InterPro:IPR010045"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4K9"
FT                   /inference="protein motif:PFAM:PF01676"
FT                   /protein_id="ACL74563.1"
FT                   /translation="MKVIFTFLDGVGIGEKDRMANPVYATEQQILAQLIDNAKFQADAS
FT                   MGVDGLPQSATGQTTIFTGVNAPKILNRHLSGQPTISLKKVIYKSNMFSELIKRGFNVT
FT                   SSNVYKDEYLKNMLNSKDRKNRPSVTSVMCMASGIDFRTLSEFINGDGVYHDITGDILK
FT                   ESGCRIETVTPQKAAQNLYKLSRNYDFTLYEHFLTDIQGHKADFYEAAKLIDRLDSFLD
FT                   ELIKQMDFEEDVLIITSDHGNIEDISIHTHTMNKVPVIVLGKKAEKVKTEIHSLIDIMP
FT                   FVLELFSGNRRGSEVT"
FT   gene            198225..200732
FT                   /locus_tag="Ccel_0176"
FT   CDS_pept        198225..200732
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0176"
FT                   /product="peptidase U32"
FT                   /note="PFAM: peptidase U32; KEGG: cth:Cthe_2086 peptidase
FT                   U32"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74564"
FT                   /db_xref="GOA:B8I4L0"
FT                   /db_xref="InterPro:IPR001539"
FT                   /db_xref="InterPro:IPR020988"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L0"
FT                   /inference="protein motif:PFAM:PF01136"
FT                   /protein_id="ACL74564.1"
FT                   /translation="MAKKIELLAPAGTYDAFLAAIENGADAVYLGGKLLNARQFAGNFD
FT                   DDQLERALDYAHTRDASVFLTMNTLVLDSEMQEAVEYVAKAYENGVDAFIVQDLGLAAN
FT                   LKKLIPGITLHASTQMTVYSTEGINALDSLGFGRTVLARELNLEEIKKICRQTPLEIEV
FT                   FVHGALCICVSGQCYMSSMIGGRSGNRGKCAQPCRLPYSIKRDSSEFDSGYLISPKDIC
FT                   YIDHLSDLIDAGVTSLKIEGRMKSPEYVATVVGTYRKYLDLIYEKRDLSPSISSRHKVE
FT                   QEDRHKLLQSFNRGGFSKGYLLGKTGPEMMAYEKPKNWGTPLGNVVSQDRNTNSVLIKL
FT                   ENTLGMGDGIEIWSGSKFQESPGGIITKIVKDKKLVRKAHKGDTVWVSVIKGKVQKGSR
FT                   VYKTSDKEMLEQAAATYSKAGRKSPIKASFTMKYGQVPALTLQDAYGNIVSAVGEQFPQ
FT                   KAINKPLTKDRILEQLKKMGSTPFNIAEITLDLDEGAVIPISELNNIRRSAGEQLEQKR
FT                   ILSLKKESVNFDKRTFKSISYFPGNVQKINIDTKIAAMFYDYPDGMDFGDLDVDRVYLP
FT                   FTEIMGNEGLLRAKHIHETGRELYAYIPAVIRGHYTDILKKNLKNVSQTVDGFLAGSPA
FT                   VFEIIREKLGNSVPVVGDYTINIINSYSLNKLKELGFTGGTLSCELNLSQITELKYPAD
FT                   FDTELVIYGKIPVMTSEYCPIGGSVGKCEPRKCGKLCKKGVYRLSDRKGVEFIVKSDCI
FT                   DCRSTIFNSNVLFAPELSEQISRTGVNYFRLSFVDEGKKDIHNICALYRSLLEHKKTEP
FT                   DMEKLIERVKASGFTKGHLQKGI"
FT   gene            200770..201273
FT                   /locus_tag="Ccel_0177"
FT   CDS_pept        200770..201273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0177"
FT                   /product="deoxyuridine 5'-triphosphate nucleotidohydrolase
FT                   Dut"
FT                   /note="TIGRFAM: deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase Dut; PFAM: deoxyUTP pyrophosphatase;
FT                   KEGG: cth:Cthe_2085 deoxyuridine 5'-triphosphate
FT                   nucleotidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74565"
FT                   /db_xref="GOA:B8I4L1"
FT                   /db_xref="InterPro:IPR008181"
FT                   /db_xref="InterPro:IPR029054"
FT                   /db_xref="InterPro:IPR033704"
FT                   /db_xref="InterPro:IPR036157"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L1"
FT                   /inference="protein motif:TFAM:TIGR00576"
FT                   /protein_id="ACL74565.1"
FT                   /translation="MSVEIFLEICRKDTVLPKYANPGDAGMDVYAAESVMIAPGETVVV
FT                   PTGLKVAIPEGYEIQVRPRSGISFKTPLRVPNSPGTIDSGYRDELGIIISNSSDIDVPD
FT                   NRETPYTLEEKENRKGTYIIRKGDRIAQIVLQVVPKMKFTVVDSVREIGSDRGGGFGST
FT                   GVAR"
FT   gene            201303..203093
FT                   /locus_tag="Ccel_0178"
FT   CDS_pept        201303..203093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0178"
FT                   /product="GTP-binding proten HflX"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   proten HflX; PFAM: GTP-binding protein HSR1-related; KEGG:
FT                   cth:Cthe_2081 small GTP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74566"
FT                   /db_xref="GOA:B8I4L2"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006073"
FT                   /db_xref="InterPro:IPR016496"
FT                   /db_xref="InterPro:IPR025121"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR030394"
FT                   /db_xref="InterPro:IPR032305"
FT                   /db_xref="InterPro:IPR042108"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L2"
FT                   /inference="protein motif:TFAM:TIGR03156"
FT                   /protein_id="ACL74566.1"
FT                   /translation="MKVNGNIQSIKDKVLQELEDLYDKKYGSRDLVPEELALTITRISA
FT                   EINREISVLLNRRGVVVDISIGDSGTVTLPQVDGRRGTARLSAIRCIHTHPNGSGMLSQ
FT                   VDASTLQKLRLDAMIAVGITDGQPSDIYAGCLNHEEGVDIYGPFEIRDTRLNYIYRIIE
FT                   ELDASAKNEIYENEEEAETAILVSLETSQSRLENITSRDAQESLEELEELAKTAGAVVV
FT                   DKVLQKKQTEDSAYYIGKGKIEELSLMCQARDVQLLIFDDELSGAQIRNIEEMTKVRVI
FT                   DRTTLILDIFAQRAVSKEGKLQVELAQLKYKLPRLVGMGTELSRLGGGIGTRGPGEKKL
FT                   EVDRRHIRRRITGLEQELKHLEKRRQFLRSNRTSNNTPVVAIVGYTNAGKSTLLNRFCG
FT                   SSVFVEDKLFATLDPSARQLTLSDGREAVLIDTVGFIRKLPHDLIEAFKSTLEEAVHAD
FT                   MLLHVVDASNENVSMQISVVEKLLEELGASTKRTILVLNKQDLVQEDRRISSVGYSAVC
FT                   EISAVTGYGIEQLLEKITEGFMHQLKEVQLLVPYNDGWVMPYIYKNGRIIDQEYEEGGI
FT                   KVKALVKVEKVSRLTDFMVV"
FT   gene            203169..203582
FT                   /locus_tag="Ccel_0179"
FT   CDS_pept        203169..203582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0179"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: aoe:Clos_1784 NUDIX
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74567"
FT                   /db_xref="GOA:B8I4L3"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L3"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACL74567.1"
FT                   /translation="MLVRNCAGGVVFSGDKVFLLKNEKDEWVLPKGVIRSGDYPDEVAK
FT                   RRVKEETGIDAEIVLAAGNTNYEFFSVTRQRPVCNKITWYVMKSLNDNFEINKGENFSE
FT                   GRYFSIDEALEKITYSQDRALINLSYAKYKQLA"
FT   gene            203708..204358
FT                   /locus_tag="Ccel_0180"
FT   CDS_pept        203708..204358
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0180"
FT                   /product="protein of unknown function UPF0029"
FT                   /note="PFAM: protein of unknown function UPF0029; Domain of
FT                   unknown function DUF1949; KEGG: cth:Cthe_2078 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74568"
FT                   /db_xref="InterPro:IPR001498"
FT                   /db_xref="InterPro:IPR015269"
FT                   /db_xref="InterPro:IPR015796"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR023582"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR036956"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L4"
FT                   /inference="protein motif:PFAM:PF01205"
FT                   /protein_id="ACL74568.1"
FT                   /translation="MLTEYKTILNTAEAEFEEKKSRFIANVRPITCEEEALEFIEEMRS
FT                   KYWNATHNVYAYSINNGTLVQRYSDDGEPSGTAGMPTLEVIKRMGLQDVVVVVTRYFGG
FT                   TLLGASGLIRAYSKGASLGLEAAEIVTRKLCYNLNIIIEYTIFGRLQNMLISNNNIIKD
FT                   IRYEQDVELCVLIEVGNEEELMKDIVEVSNGRAVIDLGEKTYITLGSDGRLII"
FT   gene            204453..205199
FT                   /locus_tag="Ccel_0181"
FT   CDS_pept        204453..205199
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0181"
FT                   /product="protein of unknown function DUF28"
FT                   /note="PFAM: protein of unknown function DUF28; KEGG:
FT                   cth:Cthe_2075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74569"
FT                   /db_xref="GOA:B8I4L5"
FT                   /db_xref="InterPro:IPR002876"
FT                   /db_xref="InterPro:IPR017856"
FT                   /db_xref="InterPro:IPR026564"
FT                   /db_xref="InterPro:IPR029072"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I4L5"
FT                   /inference="protein motif:PFAM:PF01709"
FT                   /protein_id="ACL74569.1"
FT                   /translation="MSGHSKWANIKRQKGAADAVRGKIFTKLGREIQIAVRMGGADPSS
FT                   NSKLKDVIAKCKANNMPNDNIQRSIKRASGETDGSNYEEITYEGYGPGGVAVICECTTD
FT                   NRNRTAGDLRHYFDKFGGNLGQSGCVSYMFNKKGVIVIEKNDKVNEETLMMEALDAGAE
FT                   DFDSDDNCYEIITDPADFSTVREALEAKGYEFIEAEVSMIPTTTTKLTDPEQIKFMDKL
FT                   IEALEDLDDVSNVYHSWEQDEENEEE"
FT   gene            complement(205368..205874)
FT                   /locus_tag="Ccel_0182"
FT   CDS_pept        complement(205368..205874)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0182"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74570"
FT                   /db_xref="GOA:B8I4L6"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74570.1"
FT                   /translation="MLNQVNKLIHKKYFVNSIIILLLLVSLYLVILNNNKSHLIEENYA
FT                   KQQLIDKNFINYLSQTQSDFGADFFKIQQIDVRKKLYSQCLIDLSSAFSLAEYTTYDNT
FT                   NSSIDVTLYSLLRAMQDDDTSVQIMKDSKKIFYMLKDILYAPSDSTKLKPLSDYLDMLN
FT                   KKYKY"
FT   gene            complement(205992..206996)
FT                   /locus_tag="Ccel_0183"
FT   CDS_pept        complement(205992..206996)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0183"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: chy:CHY_1887 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74571"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74571.1"
FT                   /translation="MKERANLLIRNLVLVVISIILTSTIVFAQTETNSLEQAKDNMRTL
FT                   GFSEKIINDLSDNEIMEYLNAKLVSKTEEYYTYEYSSTFNSVTKKNDVKLVKRQKVSKE
FT                   DAYKIAEKENGENLQSKVDILTKVNDPDAITTFGFNNSYNSNTISTLKLQVWATYISGT
FT                   TYKIATQFDWLTHPSQCYYDMLALSNDGKSTKQQNTSSFFVKSDIYKKDIYGNSTFYTT
FT                   ENVVSTTTSPFKEEVTGVGYKYEVPTETYGPPISSREWYERQDLRGYLTYKISVPTTKQ
FT                   SYGVLGSYGHETQSLTWSNSVGVSFPAGISFSSWPSASSKITTSTVYTNFDVN"
FT   sig_peptide     complement(206910..206996)
FT                   /locus_tag="Ccel_0183"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.998 at
FT                   residue 29"
FT   gene            complement(207447..208730)
FT                   /pseudo
FT                   /locus_tag="Ccel_0184"
FT   gene            complement(209184..210080)
FT                   /locus_tag="Ccel_0185"
FT   CDS_pept        complement(209184..210080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0185"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0632 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0185"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74572"
FT                   /db_xref="InterPro:IPR032315"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L8"
FT                   /inference="similar to AA sequence:KEGG:Csac_0632"
FT                   /protein_id="ACL74572.1"
FT                   /translation="MKKFPIIILLLLLTACANTEPAQTTKSMVSEPMQASAKTSDTIEK
FT                   RENLINVNGKTVSERIRVPTDFERIKVDKTSFCQYLRDLPVKPDGTKIKLYNGNVTEKD
FT                   VHVAVLDIDVGNRDLQQCADAVIRLRAEYLYSQGLYKRIHFNFTNGFNADYWKWMNGNR
FT                   IVVKGNKTYWVKNTKSSNEYSSFRKYLDIVFAYAGTLSLSKEMKKESIENMQIGDVFLK
FT                   GATPGHTVIILDMAENKVTGEKIFLTAQSYMPAQSIHILKNPENENLSPWYSTNFGNTL
FT                   KTPEWDFDKSQLMRFEN"
FT   sig_peptide     complement(210021..210080)
FT                   /locus_tag="Ccel_0185"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.735 at
FT                   residue 20"
FT   gene            210243..211601
FT                   /locus_tag="Ccel_0186"
FT   CDS_pept        210243..211601
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0186"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; transcription activator effector binding; KEGG:
FT                   bld:BLi00678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74573"
FT                   /db_xref="GOA:B8I4L9"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4L9"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL74573.1"
FT                   /translation="MNYYERIQKSIDYIESNVENKINIDFAAQTAFMSLSNFYRMFFAL
FT                   TGYSVKEYIRLRRISLAAIDIQGTDTCLIDIAIKFDFESGDSFSRAFKRITGFLPSDYR
FT                   KKKSLYKFERIDIMEKYFDIQDKELIENYPDIKVLKEMEPTRVAYFCYYGKQPEHHAFT
FT                   VMAQWLNKNGLNVNEQNLRIFGYNNPSPASPDEEEYGYEVCATVADNIVVNDDLVKEKV
FT                   LGGGLYAVTNVRRGQDGDIGGEIIKAWSRFNNWLSDSKYVYGGHQWLEEHLGFDDNANH
FT                   IGGIDLYMPIALKSKDYDITKIFDNVEPMLTATYTATGKDADVKARDFFFKWADSQGFF
FT                   NDTKPHRFFAYYDHERIGHNDFFYKIHVTVDREFSTDNPYIKLEEFKGGYYAITKAKYS
FT                   YNGWAWGEFLKWLSKNKEFDLGNYWFFEEYKLNKPELDMDTEVVLHMPIKQKE"
FT   gene            211614..212171
FT                   /locus_tag="Ccel_0187"
FT   CDS_pept        211614..212171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0187"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: lbl:LBL_1122 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74574"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4M0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74574.1"
FT                   /translation="MCIRITLIFENIYDEVSINSVAKSYDRRFKIVNNPIILSQLPDGE
FT                   RWFESAYSSCECSTGIGSFELFTRNVENVIEQLKDKSIAEEVRTEEVKRKSMYKKDVDN
FT                   WGEFIKSLIRKYNFKRVGLLMHFTDDDLARADFLILDKYVVKYSDINPEVLMKIKNELY
FT                   IILWIIKLVKAKQIKVRNIREG"
FT   gene            212178..212768
FT                   /locus_tag="Ccel_0188"
FT   CDS_pept        212178..212768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0188"
FT                   /product="methyltransferase small"
FT                   /note="PFAM: methyltransferase small; KEGG: cpy:Cphy_3378
FT                   methyltransferase small"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74575"
FT                   /db_xref="GOA:B8I4M1"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR007848"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4M1"
FT                   /inference="protein motif:PFAM:PF05175"
FT                   /protein_id="ACL74575.1"
FT                   /translation="MSAIRLIETEIKGIKMKFKTSGKVFSPQNIDRGTLAMLSLADFKE
FT                   GDKVLDLGCGYGVVGILASKIVGPENVIMTDVDENAIKLAIENALINSVDSIKILKSDG
FT                   FKELKESGFSIILSNPPYHTDFSVAKEFVEKGFNRLIVGGRMIMVTKRKDWYKNKLTSI
FT                   FGGCKACEIDGYFVFVTEKRETTYAKVKSKKVK"
FT   gene            212840..213262
FT                   /locus_tag="Ccel_0189"
FT   CDS_pept        212840..213262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0189"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74576"
FT                   /db_xref="GOA:B8I4M2"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4M2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74576.1"
FT                   /translation="MNKKIVVIVTITILIAIAGIKYFKLLDMPVHKNINKEDVLSIESW
FT                   SDTHGITEIKDPVLFDNIVTWFNNSSDIRENPEFAGTTPAVGINIKLKSGKGISILEGA
FT                   IDFEVQRNDVRDKNVSYFAKQKDIAKYLDNLFTGVK"
FT   gene            213263..213646
FT                   /locus_tag="Ccel_0190"
FT   CDS_pept        213263..213646
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0190"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbe:Cbei_3830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74577"
FT                   /db_xref="GOA:B8I4M3"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4M3"
FT                   /inference="similar to AA sequence:KEGG:Cbei_3830"
FT                   /protein_id="ACL74577.1"
FT                   /translation="MTEKRPIIITIIGDLSILAAMLSIGVTIFPDYFSKLGFHHNTLPI
FT                   YSNSVMNILLSFVLITAAAGYLNLKKWGYWLMIIYNIFLMLVNVIWRLQNKQIPFTTGI
FT                   IVLSIVLMNTIRYRKYFILGAEA"
FT   gene            213695..214720
FT                   /locus_tag="Ccel_0191"
FT   CDS_pept        213695..214720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0191"
FT                   /product="Appr-1-p processing domain protein"
FT                   /note="PFAM: Appr-1-p processing domain protein; KEGG:
FT                   blo:BL0806 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74578"
FT                   /db_xref="GOA:B8I4Z8"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR002589"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4Z8"
FT                   /inference="protein motif:PFAM:PF01661"
FT                   /protein_id="ACL74578.1"
FT                   /translation="MPFIIVRQDITKLKVDAIVNAANTDLRMGGGVCGAIFKAAGAAQL
FT                   QAVCDKLAPIKTGEVVITPGFNLSAKFVIHAAGPVYRHWNREQGEQYLRAAYTNSLKCA
FT                   VENKCESIAFPLISSGIYGYPKDEALRVATSEIHNFITDHDIDVTLVVFDKSAFTVSRK
FT                   LLGAVESYIDEHYANTHQFKRRQLLDVEREALYEADESVGIYSEPVFQKTLSPSVGAPL
FT                   DNLVSNLDESFSKVLLRLIDAKGKTDVEVYKRANLDRKLFSKIRSNKGYMPSKRTAIAL
FT                   AVALELSLDEADDLLKCAGYALSHAVKFDVIVEYFIVNGKYDIFEINEVLFKYDQPLLG
FT                   G"
FT   gene            214731..215426
FT                   /locus_tag="Ccel_0192"
FT   CDS_pept        214731..215426
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0192"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   cbh:CLC_0982 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74579"
FT                   /db_xref="GOA:B8I4Z9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8I4Z9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACL74579.1"
FT                   /translation="MKVVVLHGSPRKGNTYLATSLFLDELRKCGGVDVVEFFLQRAMPE
FT                   FCTGCQLCLGNPNEKCPHARYVTPILDAILKADALIFTTPHFGACSMSGIMKNLLDHLD
FT                   FLTMNVSPRKEIFRKKAFVISTGAGSTAAIKPIKSYLKNWGINRVYTCGIRMFTNKWSA
FT                   MPVAKQRKFERMLCKAAQHFYAVPKRHPYLSTVFMYYMSKFILKKFVGVGNYPYEYWNK
FT                   NGYFTKCPF"
FT   gene            215517..216170
FT                   /locus_tag="Ccel_0193"
FT   CDS_pept        215517..216170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0193"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: fnu:FN0557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74580"
FT                   /db_xref="InterPro:IPR002035"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8I500"
FT                   /inference="similar to AA sequence:KEGG:FN0557"
FT                   /protein_id="ACL74580.1"
FT                   /translation="MRKGLTELVFILDKSGSMSGLETDTIGGYNSMLVKQQEVEGECHI
FT                   TTVLFDNNYELLHDRIDIRAVSPITEKEYQVGGSTALLDAIGRTIHKIGNAQRQTAEDY
FT                   RAENVMFVIITDGEENSSREYSAEKVKVQIERQKTKYGWEFIFLGANIDAVQTAGRFGI
FT                   APERAVDYLADSKGTELNFKVMSAAVATFREAGMVDEACFEEIRQDVKQRGLRK"
FT   gene            complement(216405..216496)
FT                   /locus_tag="Ccel_R0004"
FT                   /note="tRNA-Ser5"
FT   tRNA            complement(216405..216496)
FT                   /locus_tag="Ccel_R0004"
FT                   /product="tRNA-Ser"
FT   gene            complement(216647..217933)
FT                   /locus_tag="Ccel_0194"
FT   CDS_pept        complement(216647..217933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0194"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: cpo:COPRO5265_1350 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74581"
FT                   /db_xref="GOA:B8I501"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B8I501"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACL74581.1"
FT                   /translation="MDQYIPIIDIVIALSSAIDLINPNISNHHKRVAYISYSIAKEMGF
FT                   PENEIKDLVLAGLLHDCGAVNLFERSSIFEFEFGNSYSDRHSHGYKGWYILRDAAELSK
FT                   AAEIIKYHHVFWNEISHKRYVSSKVPKFSHILHLADRIDVLINPNQEILGQRKYISKKI
FT                   HNGKDKMFMPQAVDAFENLISKPYFWFDITSVYLENHIRKIMSPYKVFINSELLIQYAN
FT                   IAHRIIDFRSKFTATHSIGVAASASALASKLGFSSCDTRLMHSAGLMHDLGKLCIPESI
FT                   LEKRGPLDQYEFNLMKAHTYHTYRIIDSIPGLEKVRDWAAFHHEKLDGTGYPFGLDYRS
FT                   LDLGSRILSVSDMFTAMAEERPYRHAMSLKDTVKLINGIKTLDYDVKYCLNQNIEEINE
FT                   IRRTSQEIVFQSCNEIFPDFDEELNLHAL"
FT   gene            218139..218852
FT                   /locus_tag="Ccel_0195"
FT   CDS_pept        218139..218852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0195"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cpy:Cphy_3008 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74582"
FT                   /db_xref="GOA:B8I502"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I502"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74582.1"
FT                   /translation="MLTISNLSKTYKGGKRAVDNLTLEIQKGDIYGFIGHNGAGKTTTI
FT                   KCVAGILEFSEGDILIEGKSVKTNPLECKRMIAYIPDNPDLYENMTGIQYLNFIADVFS
FT                   ISANEREKSIKEYADMMELTESLGDLISSYSHGMKQKLAIISALVHNPSLYIMDEPFVG
FT                   LDPKAAHTLKEVMKEKCRQGSAIFFSTHVLEVAEKLCNKIAIIKDGKLITSGETDSVRG
FT                   NSSLEQLFLELIDNE"
FT   gene            218845..220443
FT                   /locus_tag="Ccel_0196"
FT   CDS_pept        218845..220443
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0196"
FT                   /product="putative ABC transporter, permease protein"
FT                   /note="KEGG: cdf:CD2104 putative ABC transporter, permease
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74583"
FT                   /db_xref="GOA:B8I503"
FT                   /db_xref="InterPro:IPR031599"
FT                   /db_xref="UniProtKB/TrEMBL:B8I503"
FT                   /inference="similar to AA sequence:KEGG:CD2104"
FT                   /protein_id="ACL74583.1"
FT                   /translation="MNSIFLLIKANIINSWGINKALKSKSMSEKIKTVLLGLLIVYAFC
FT                   MLAFSMFMLNYSLGNILEELNSLELLIASSILSTTLFSLFISIYKIPGHLFSFKDFDLL
FT                   MSLPVKPSAVLASKMIFVYLSNLAISVLVGGPSLVTYGIKTHSGFMYYIFAFLATLFVP
FT                   LIPITIGAVFAYILGRISSKFRSTNTLMLIGSFILIAVFMVLPNMLAGVNQDQVQNAIP
FT                   SISGVTKVLFWTNLYIKALSNTNILYLAAFLLVSAAVFGIFITIFSRGFKTINSKMSEK
FT                   YKASDYKITRLKASSVMKALYFKQLRFYLSSYIYVTNTAVGVIMMLIFSLAVAVFGKEE
FT                   VAKVLELPMADAYLAPLVALIFGFCISFTFVTAASISLEGKSLWIIKSLPLKIESILWS
FT                   KILLNLTLTIPALVINTVIVAVSFKLGAETVSVLFLVSLLFSIVCPIIGILVNLFFPKL
FT                   EWTSQVSVVKQSASVFVTMIINVILLGVPLVVFILIKPSNTNLFMELVSVVLAILVFIL
FT                   IKVLNTVGVKKFKEL"
FT   sig_peptide     218845..219024
FT                   /locus_tag="Ccel_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.985) with cleavage site probability 0.799 at
FT                   residue 60"
FT   gene            220495..221310
FT                   /locus_tag="Ccel_0197"
FT   CDS_pept        220495..221310
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0197"
FT                   /product="protein of unknown function DUF1113"
FT                   /note="PFAM: protein of unknown function DUF1113; KEGG:
FT                   cpf:CPF_1398 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74584"
FT                   /db_xref="GOA:B8I504"
FT                   /db_xref="InterPro:IPR010540"
FT                   /db_xref="UniProtKB/TrEMBL:B8I504"
FT                   /inference="protein motif:PFAM:PF06541"
FT                   /protein_id="ACL74584.1"
FT                   /translation="MDVFYEFIIFLTIYSFIGWVCEVIYCSILSRKIVNRGFLAGPVCP
FT                   VYGFGAMFVVFLLKPADSGIIVIFLTGLALTSILEYITGWLLEAFFSTKWWDYSNNRFN
FT                   LNGRVCLKNSVLFGIMCVVLVKVLHPAITHVVALIPEIWVRVSGIVLIAAFAIDILLTV
FT                   NTLLNLHDRLKKLHEFTEDLKKNGEILEWFNERELFKSFEKLRLLAEESKNELNLRLRE
FT                   KFETLSQKRGSGQRLIKAFPNMKSIKYQVQLDHLKYILKQLRERAGGKH"
FT   gene            complement(221322..222926)
FT                   /locus_tag="Ccel_0198"
FT   CDS_pept        complement(221322..222926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0198"
FT                   /product="two component transcriptional regulator, AraC
FT                   family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; response regulator receiver; KEGG: csc:Csac_0684
FT                   response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74585"
FT                   /db_xref="GOA:B8I505"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR041522"
FT                   /db_xref="UniProtKB/TrEMBL:B8I505"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL74585.1"
FT                   /translation="MTDNPLKVMIVDDESNTRDLLKLLIDWDGLGMEAAGDATSGLEAL
FT                   DMLDELNPDIVITDIQMPYMDGLTLSKNIKERHPDISIIILTAHDEFAYAQNAVSLGAS
FT                   DFILKPVNKDTIFETLSKVGNSIRSTRERLGRLELSHQYMQSNIMVFQNKVLNDLVLNR
FT                   NFTFQPHELKMMEIRFDTDYNLYQVSLINVGIEKNRYTNLERQMLLENCCNYIRDFYFK
FT                   KGLAYVFTDIQSNIVLLNNDSSISLSDISEHASLYFREQFSVSVSCGIGLEVHALDNVY
FT                   KSYHQALNALNMCYITGEEITYADSQASEAENDTAFDRSFLTDNMKLAIKSGATSQALE
FT                   ITRKVLYNYTRENINDLDAVKIFSINMCNYIKELLSEMKIPFTGTLSLSGDFLLDIFKL
FT                   EKYVDIEVTILGIVEKATDLITEALNNKSKSIVDEVKNYIDRNYSDNSLTLKVVADKFY
FT                   INSSYLSRIFKKGTGITFSEYLTKVRIDNAKSILKSQDYKAYQLAEMIGIPDPNYFVKC
FT                   FKKVAGISFAEYKLQKA"
FT   gene            complement(222919..224688)
FT                   /locus_tag="Ccel_0199"
FT   CDS_pept        complement(222919..224688)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0199"
FT                   /product="putative sensor with HAMP domain"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase internal region; KEGG: cbe:Cbei_4963 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74586"
FT                   /db_xref="GOA:B8I506"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR010559"
FT                   /db_xref="InterPro:IPR033479"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I506"
FT                   /inference="protein motif:PFAM:PF06580"
FT                   /protein_id="ACL74586.1"
FT                   /translation="MNFFKHFMETLKNIFLNIPIRSKMLIIFMAFMLFYVIISLVIYDN
FT                   VITNETLSQVRQRSYETTELIRTNINTMIDNTNNVSKMLTTNSLIRSYLKSDRPSRSLS
FT                   KTANDVMFNIHITFPNIDSIYLYDLHGSGLRTNKVLTISSVEDVKKAPWFDELIRLNGG
FT                   YKISINAENTLKTYSGKNLVSVMRVLNDLDSLRPIGVLILNISQDSIAEVINETSENGG
FT                   SSFILLDADNNPVIENDSSYELYKPYFTGIADHEEIITIDNKKLLVFESVLPGTGWKII
FT                   NCTSLSFKSPGIRTLNVIYILFIGITVFLFIVASLFTASLITSPIKNLINSMQGVSNGV
FT                   FKRVSYRTGNDEIGELKNNYNLMIMEIDQLIIKLLDEEKKKRKFELDVLNEQIKPHFLY
FT                   NTLDNISYLALSGNNQAVYEAVNALGSFCRISLSKGSEVISLENEICQIQNYLLLQKLR
FT                   YGEMISDEYDIAPATSQIKILKNILQPLVENSIYHGIRPSGEPGFIKTSAHINDDLLIL
FT                   SVEDNGIGMDEKEINSISDENLAGNQASFGLRGTIQRLKLYYGTNDIYTVESSKYSGTK
FT                   ITLKIPLKEDKDD"
FT   gene            224941..226266
FT                   /locus_tag="Ccel_0200"
FT   CDS_pept        224941..226266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0200"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: cbe:Cbei_4964 extracellular solute-binding protein,
FT                   family 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74587"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="UniProtKB/TrEMBL:B8I507"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL74587.1"
FT                   /translation="MNKVSVTKRGVALILAGALTVGMAACGKNTTNNNAAGTTNNAGGN
FT                   KAKNVEIKFSHIWGSAADPFTPAAKKVIEDYQTANPNVKIAVDTNENEAYKTKIKAMAA
FT                   ANELPDIFSTWGGGFSQPFIQSKSVVQLDQYLTDDIKNKLVNGALTNVTYDGKVYGLPF
FT                   FLSVGAMFVNTELFDKNGVKVPTTWEELLTAVKTFKAKGITPMAVSGKDKWTIAMYFDV
FT                   MALRAAGPEKVTKTLTKQGSFKDPEFLNAANRFKELVDAGAFSKGAAGVSNDEAEVPFF
FT                   EGKIPMMFKGSWTAGKAGSKDSKVAGKVKAISFPSIPGGLGNPKQFTGGAVDAVMVSEN
FT                   SKNKEEAIKFQIYFAENMAKESYLSGASMPAWKTDVDESKVNPSLVDVVNLTKDAESYT
FT                   IWWDTLLAGKDTETYLNALQELFMGTKTPQQFVNSLQTIYGK"
FT   sig_peptide     224941..225024
FT                   /locus_tag="Ccel_0200"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.952 at
FT                   residue 28"
FT   gene            226370..227254
FT                   /locus_tag="Ccel_0201"
FT   CDS_pept        226370..227254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0201"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: oih:OB0775 sugar ABC
FT                   transporter permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74588"
FT                   /db_xref="GOA:B8I508"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I508"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74588.1"
FT                   /translation="MVDKVLGNKKAIVFFLFPALVIFIGLIIVPIIMSTYYSLQEWSGF
FT                   GKGTFIGLQNYKGLLSDPIFIKAAVNSLILAFASVFIQLPISLLLALTLAKGVKFEKSF
FT                   VTIYFIPVIISTVVIGQLWMKIYNPDYGILNLFLKNIGLGSLASEWLGDPKRALTATFI
FT                   PIIWQYIGYHMLLMYAGIKSISTDVFEAAVIDGSSWWNTSMKITIPMLKPVLNVSVIFA
FT                   VTGALKVFDLVYVLTGGGPAHASEVIGTYMVSTIFKGNQYGYGSAMAIFVILECFVLSI
FT                   LVGLLFREKGEAK"
FT   gene            227251..228105
FT                   /locus_tag="Ccel_0202"
FT   CDS_pept        227251..228105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0202"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bha:BH3682 sugar ABC
FT                   transporter (permease)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74589"
FT                   /db_xref="GOA:B8I509"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I509"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74589.1"
FT                   /translation="MSDMVRGKITNFSISKILMYIALLIVAVIQLFPLYWMFSFSLKDN
FT                   SEIFGGNPIGLPGKWLWSNYSNALTQGNVGRYFTNSVIVTTVTILLTSIIAVMASYALT
FT                   RMVFRIRKPLNSFFILGLTVPLHSALLPIFIMLRSLKMVNSYWALIAPYTAFAIPMAIL
FT                   IFSGFMGSIPREMEEAACIDGCSIYKIFFTIILPLMRPAIATVTIFTFLQAWNELMFAV
FT                   VFISDAKYKTLTVGIQSLAGQYTTEWGPIGAGLMVATIPTLIIYAIMSKKVQDSLVVGA
FT                   VKG"
FT   gene            228204..230342
FT                   /locus_tag="Ccel_0203"
FT   CDS_pept        228204..230342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0203"
FT                   /product="glycoside hydrolase family 3 domain protein"
FT                   /note="PFAM: glycoside hydrolase family 3 domain protein;
FT                   KEGG: cbe:Cbei_4974 glycoside hydrolase, family 3 domain
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74590"
FT                   /db_xref="GOA:B8I510"
FT                   /db_xref="InterPro:IPR001764"
FT                   /db_xref="InterPro:IPR002772"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR026891"
FT                   /db_xref="InterPro:IPR036881"
FT                   /db_xref="InterPro:IPR036962"
FT                   /db_xref="UniProtKB/TrEMBL:B8I510"
FT                   /inference="protein motif:PFAM:PF00933"
FT                   /protein_id="ACL74590.1"
FT                   /translation="MNKPKYLDKSLSFKERAVDLVSRMTLEEKASQLRYDAQPVERLGI
FT                   PRYNWWNEALHGVARAGVATVFPQAIGLAAIFDDEFLEKIADVIATEGRAKYNESSKKG
FT                   DRDIYKGITFWSPNVNIFRDPRWGRGHETYGEDPYLTSRLGVAFVKGLQGDGKYLKSAA
FT                   CAKHFAVHSGPEDDRHHFNAVASQKDMYETYLPAFEALVKEAKVESVMGAYNRTNGEPC
FT                   NGSKTLLKDILRDDWGFDGHVVSDCWAIKDFHEGHGVTKTPTESVALALKNGCDLNCGN
FT                   MYLLILLALKEGKITEEDIDRAAIRLMTTRMKLGMFDDDCEFDKIPYEVNDSIEHNKLS
FT                   LEAARKSMVLLKNNGLLPLDSKKIKNIAVIGPNADSSLALRANYSGTPSHNITILDGVR
FT                   SRVSEDTRVWYSLGSHLFMNREEDLAQPDDRLKEAVSMAERSDVVVLCLGLDASVEGEQ
FT                   NDQGTVILDAGGDKADLNLPESQRNLLNAVLATGKPTIVALLSGSALSIGDAADKAAAI
FT                   VQCWYPGSKGGLAFAEMIFGDYSPAGRLPVTFYKSTEELPPFEDYSMENRTYKFMKGEA
FT                   LYPFGFGLSYTNFEYSNIVCPQAVNNGESLSVSVDVQNAGSVDSDEVVQVYIKDMEASV
FT                   RVPNHSLCGFKRIFLKSGEKKTVTFEIDSRAMTIVDEEGKRYIENGDFTLYVGGAQPDN
FT                   VSERLLGKKPLVASFNVK"
FT   gene            230494..231060
FT                   /locus_tag="Ccel_0204"
FT   CDS_pept        230494..231060
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0204"
FT                   /product="NusG antitermination factor"
FT                   /note="PFAM: NGN domain protein; KEGG: cth:Cthe_1362 NusG
FT                   antitermination factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74591"
FT                   /db_xref="GOA:B8I511"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B8I511"
FT                   /inference="protein motif:PFAM:PF02357"
FT                   /protein_id="ACL74591.1"
FT                   /translation="MKVTSDCVKKAVIGVHWYVLFVKSGREHRVEQYLKKIVGIDMINP
FT                   FIPLHEFLFKISGTVKRELKPLFPGYVFIESDMAGQEFIRKLYNKIYLLSDIVRILKYS
FT                   DTEIAVRDSEKQMLLDLCNNEHCIESSRGVIKGDRIYITNGPLRGRESIIKKVNRHKRQ
FT                   ALVEMEFMGDKRLVSVALEIVEKVV"
FT   gene            231266..233302
FT                   /locus_tag="Ccel_0205"
FT   CDS_pept        231266..233302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0205"
FT                   /product="tRNA synthetase class I (M)"
FT                   /note="PFAM: tRNA synthetase class I (M); KEGG:
FT                   aoe:Clos_1001 methionine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74592"
FT                   /db_xref="GOA:B8I512"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015413"
FT                   /db_xref="UniProtKB/TrEMBL:B8I512"
FT                   /inference="protein motif:PFAM:PF09334"
FT                   /protein_id="ACL74592.1"
FT                   /translation="MNNQKGKSNSPIEEFNVSDSRPKFPKRAVVTAGMPYGNKELHLGH
FT                   IGGVFIHADTYARFLKDRIGKENVIFVSGTDCYGSPILEYYRKLVSSGSFDGTIDEFVT
FT                   YNHKKQKEVLDSYQIDISIFAASALGRAAEIHEKVSSDFINKLYSNGHLKKITTSQFYD
FT                   TELDVFLNGRQVVGQCPIAGCSSERGYADECSLGHQYMPVDLINPKSTLSGKKPEMRDV
FT                   TNWYFELDEFHDLLAQWVSQLEQDPSSRKFVIKSIGEFLEPPAIYVKRDHIEVLDSIKD
FT                   KLPEYELSDEKNKSSVLMVFKNLEEREAACLVLAENGIRFRTGKTLVPFRLTGNVSWGV
FT                   PSPVLEDMKDLTIWVWPESLWAPISFTMTYLENQKVATDTWKDWWCSKESQVYQFIGED
FT                   NIYFYGPVEMAMFMGSQGKEVSANPPEGDLQLPKLICNNHVLFLSKKASSSSEIKPPKA
FT                   DELLNHYTFEQLRAHFLSLGLGIKSVGFQPKPFNPKANEKDSDPVLKEGNLLSNVFNRA
FT                   VRSCFYTTQKYYDGKVPFAEVSSEILEESKKTILEYERLMFKTEFHLVMSLMDSYIRNI
FT                   NKYWSKYIKQAEQDNDDELRTKVLVDSFHMVRTATVLMHPIAPSGTEMILEYLNLNEEF
FT                   WNWDRIFDTIYDFMENPEKHKLKFLEPRVDFFEKHPSQIQAKN"
FT   gene            233378..233488
FT                   /locus_tag="Ccel_0206"
FT   CDS_pept        233378..233488
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0206"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74593"
FT                   /db_xref="UniProtKB/TrEMBL:B8I513"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74593.1"
FT                   /translation="MSKKQQPDQRKARVKTSAGQVPNPGQKANTEVNYPK"
FT   gene            233567..234145
FT                   /locus_tag="Ccel_0207"
FT   CDS_pept        233567..234145
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0207"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   lwe:lwe2186 transposase, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74594"
FT                   /db_xref="GOA:B8I019"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B8I019"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACL74594.1"
FT                   /translation="MAKYSFEFKKQIVKAYLNGEGGYEYLAKQYDIPSFNNIKKWVLNY
FT                   NAFGDEGLVRSRKQKKYSFEYKLHVVELYLTSEVSYQELAIQEGIRNPALIVKWVNDFR
FT                   IAGPDALRPKKKGRKKPLSLKRKVTDTNATESIIVDTSAEYVKQLEDELLKLRIENAYL
FT                   KELRRLRLEEETLLKKQRESSTASEEISN"
FT   gene            234187..234987
FT                   /locus_tag="Ccel_0208"
FT   CDS_pept        234187..234987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0208"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: ckl:CKL_3445
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74595"
FT                   /db_xref="GOA:B8I020"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8I020"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL74595.1"
FT                   /translation="MYWQKRFDRENPDKELEDKILEIHENNKNYGYRRMYGELRNQEFI
FT                   VNKKKVQRIMQKLSLQVTSFTRKSRKYSSYKGKVGTVAPNRIRRRFNTHIPHQKITTDT
FT                   TEFKYYEVDSKGHMTMHKLYLDPFMDMYNSEIVSFGIDKHPSAVNIMSALNKAIEITSD
FT                   CPYRRTFHSDQGWAYQMKVYSHRLKEERIFQSMSRKGNCHDNSVMENFFGLLKQEIYYG
FT                   VVYYSYEDLKNAIERYIKYYNEQRIKEKLGWLSPAQYRLRLLAA"
FT   gene            235341..236771
FT                   /locus_tag="Ccel_0209"
FT   CDS_pept        235341..236771
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0209"
FT                   /product="Xanthine/uracil/vitamin C permease"
FT                   /note="PFAM: Xanthine/uracil/vitamin C permease; sulphate
FT                   transporter; KEGG: cth:Cthe_1251 xanthine/uracil/vitamin C
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74596"
FT                   /db_xref="GOA:B8I516"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR026033"
FT                   /db_xref="UniProtKB/TrEMBL:B8I516"
FT                   /inference="protein motif:PFAM:PF00860"
FT                   /protein_id="ACL74596.1"
FT                   /translation="MSFFERQFKLKESGTNVATEAIAGFTTFFTMAYVIFVNPAILGQT
FT                   GIPKGGVYVATILAAVVGTLIMGLFANVPYAQAPGMGLNAFFTFTVVFGLGYTWQQALA
FT                   MVFICGVINIIITVTKIRKMIIKAIPESLQLAIGGGIGLFIAYIGFKSAGFLKFTSEGK
FT                   AYAPLKILGDDPTSATVVAEGANVVPAFVNFTSPVAQVALIGLVITAVLMILKVKGAIL
FT                   VGILASTVIGIPLNVTDISMSSSYKIADVAQTAFKMDFVGLFSDPGKLALVLVTILAFS
FT                   LSDTFDTIGTFIGTGRKSGIFDDKDEAELFAGKGFKSKMDKALFADATATSIGALFGTS
FT                   NTTTYVESAAGIGAGGRTGLTSVFTALLFALCLLFAPIAGVIPAAATAPALIIVGVLMM
FT                   GSFAKIKWDDFEEALPAFFTAALMPFAYSITSGIASGFIMYIIVKVFRGKAKAVHPVMY
FT                   IVTGLFLLNFLLSALLKL"
FT   gene            236949..237908
FT                   /locus_tag="Ccel_0210"
FT   CDS_pept        236949..237908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0210"
FT                   /product="Acetyl xylan esterase"
FT                   /note="PFAM: Acetyl xylan esterase; KEGG: bha:BH3326
FT                   acetylxylan esterase (cephalosporin-C deacetylase)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74597"
FT                   /db_xref="GOA:B8I517"
FT                   /db_xref="InterPro:IPR008391"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="InterPro:IPR039069"
FT                   /db_xref="UniProtKB/TrEMBL:B8I517"
FT                   /inference="protein motif:PFAM:PF05448"
FT                   /protein_id="ACL74597.1"
FT                   /translation="MPLIDMPLAELKKYNGINPCPADFNEYWDKSKEEMESTESNVELI
FT                   PSDFQVPFAECFDLYFTGVRGARIHAKYLRPKGMNEPHPAVLQFHGYTSNSGDWNDKLN
FT                   FVAMGYSVAALDARGQGGYSQDLGSVKGDTVHGHIMRGLDDKPENMLFRHIFLDTAQLA
FT                   KIVMAMPEIDESRVGAMGFSQGGALTLACAALEPRIKKLAPVYPFLCDYKRVWEMDLAK
FT                   DAYNDIRDYFRLFDPLHEREDEVFEKLGYIDLQYLVKHIKGEVLMGVGLMDNICPPSTQ
FT                   FSAYNKIASKKQMLIYPDYGHENIPTIMDKIYQFMMGL"
FT   gene            complement(237978..239078)
FT                   /locus_tag="Ccel_0211"
FT   CDS_pept        complement(237978..239078)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0211"
FT                   /product="ATPase"
FT                   /note="KEGG: cbt:CLH_3263 ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74598"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I518"
FT                   /inference="similar to AA sequence:KEGG:CLH_3263"
FT                   /protein_id="ACL74598.1"
FT                   /translation="MCAKIINYYACANSAKGFVNYLDDNINFLDRLFILKGGPATGKST
FT                   LMKRLGKEWYNRGFDVEYIHSPCDNSSVDGIIFPSLGIGVVDGTFPHVVEPRAPGAIEE
FT                   YINLGTAWNSKKLIPQKDEILAISKQISSCYKNTYNLFSQALKIHDEWEKIYISNINFS
FT                   KINELTQETINTIIGNNVKNNQANVKNRFFGGATPKGSVDFVMDLTSDMSNRYFIKGRP
FT                   GSGKSTMLKKIAQSAQDKGFDVEIYHCGFDPDSLDMVIIRELSVAVFDSTAPHEYFPSK
FT                   DTDRIIDVYSYAIKPGTDEEFKTQLEDIISRYKGIIREGIQYLSKAKDFNDDLENIYID
FT                   AIDYDIVDKIHQDIRLKIDDYFFSMV"
FT   gene            239553..241346
FT                   /locus_tag="Ccel_0212"
FT   CDS_pept        239553..241346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0212"
FT                   /product="phosphoenolpyruvate carboxykinase (GTP)"
FT                   /note="PFAM: phosphoenolpyruvate carboxykinase (GTP); KEGG:
FT                   cth:Cthe_2874 phosphoenolpyruvate carboxykinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74599"
FT                   /db_xref="GOA:B8I519"
FT                   /db_xref="InterPro:IPR008209"
FT                   /db_xref="InterPro:IPR008210"
FT                   /db_xref="InterPro:IPR013035"
FT                   /db_xref="InterPro:IPR018091"
FT                   /db_xref="InterPro:IPR035077"
FT                   /db_xref="InterPro:IPR035078"
FT                   /db_xref="UniProtKB/TrEMBL:B8I519"
FT                   /inference="protein motif:PFAM:PF00821"
FT                   /protein_id="ACL74599.1"
FT                   /translation="MTTNKKLEAWVKEIADMCQPDQIYWCDGSQEENDRLLKEMVDSGM
FT                   AKPLNPEKRPGCYSFNSDPSDVARVENRTYIASKTKEEAGPTNNWVDPNELKDTMKNLY
FT                   KGCMKGRTMYVIPFSMGPIGSPISKIGVELTDSAYVVVNMRIMTRIGKKVLETLGDGEF
FT                   VPCLHSVGAPLAEGEKDAKWPCAPIEKKYISHFPEEKTIWSYGSGYGGNALLGKKCFAL
FT                   RIASVIAREEGWLAEHMLILKLTDPKGNVKYICGAFPSACGKTNLAMLVPTIPGWKVET
FT                   IGDDIAWMKFGKDGRLYAINPEAGFFGVAPGTSLDSNPNAMHSIEKNTIFTNVGVTDDG
FT                   DVWWEGMGVDAPAHLIDWHGKDWTPGSESPAAHPNARFTAPASQCPVIAPEWEDPAGVP
FT                   ISAILIGGRRPSTIPLVHQSFDWNHGVFLGSIMGSEITAAAISDKIGQVRRDPFAMLPF
FT                   IGYNVNDYLQHWLDVGAASTEDKLPKIFYVNWFRKDENGKWLWPGYGENSRVLKWICER
FT                   VSGEGKAVKTEIGYMPTEDAIDVEGLNISAEDMEELLKVKKDEWLKEVESIKAHYETYD
FT                   INKVPAELKKQLADLEARLKA"
FT   gene            241577..242248
FT                   /locus_tag="Ccel_0213"
FT   CDS_pept        241577..242248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0213"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_0293 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74600"
FT                   /db_xref="InterPro:IPR029010"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8I520"
FT                   /inference="similar to AA sequence:KEGG:Csac_0293"
FT                   /protein_id="ACL74600.1"
FT                   /translation="MITLNKKILGILGDYYHDHDMALGALKKAVDILNRSGSDTFELID
FT                   SNFEGLDSALSQKVDLVILGSENRINPTDEVVNNWMTYDIEKKIVDYVNNGGSWMAWHA
FT                   GLASYDETGEYTQMIGGYFLNHPSEHNIVRYIPRKNSSGISLKETFEVIDEHYFVKYNL
FT                   DSSLIFLQSESPYGKSKAGWAREWGNGRVCCLTPTHREEGLTNKVMLEVLADCIAWCCK
FT                   I"
FT   gene            242291..243682
FT                   /locus_tag="Ccel_0214"
FT   CDS_pept        242291..243682
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0214"
FT                   /product="Glucuronate isomerase"
FT                   /note="PFAM: Glucuronate isomerase; KEGG: bsu:BSU12300
FT                   glucuronate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74601"
FT                   /db_xref="GOA:B8I521"
FT                   /db_xref="InterPro:IPR003766"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8I521"
FT                   /inference="protein motif:PFAM:PF02614"
FT                   /protein_id="ACL74601.1"
FT                   /translation="MLSNNFILSGKTAVSLYERYAKDAPVYDYHCHLCAKEIYEDEAFN
FT                   DISSIWLGYDHYKWRTMRFAGVPEEYITGNGDGRTKFRVWAKTCERLIGSPLYHWANME
FT                   LKTYFGVDEILKESNADRIYDHCNAKIKEEKLSPVKMIKASNVRLVCTTDDPVDSLEYH
FT                   LLLGKNSEKGFDVFPTFRPDNVLKILNDNFIEYIRKLEATTKLKIITYQDMLNVLKNRI
FT                   EFFRQAGCLLSDHSLESLVYLPTDIVEAGSIFLKRLNGEVITTHEAEKYKLYTLSFLAR
FT                   AYKEAGWAMQLHIGAIRSTNDNMLKKAGVDSGFDIMNDFQIAEPLAKLLNDMDKMNCLP
FT                   KTILYTLNSKDNLVLSSLPHCFTEDGVPGKVQFGAAWWFNDHKEGITAHLKAIADQGML
FT                   AYFVGMLTDSRSFLSYVRHDYFRRILCSFVGDLVEKGEFADDDAILGEIVEGICFKNIV
FT                   RYLGL"
FT   gene            complement(243756..245777)
FT                   /locus_tag="Ccel_0215"
FT   CDS_pept        complement(243756..245777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0215"
FT                   /product="protein of unknown function DUF255"
FT                   /note="PFAM: protein of unknown function DUF255; KEGG:
FT                   cth:Cthe_0291 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74602"
FT                   /db_xref="GOA:B8I522"
FT                   /db_xref="InterPro:IPR004879"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR024705"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8I522"
FT                   /inference="protein motif:PFAM:PF03190"
FT                   /protein_id="ACL74602.1"
FT                   /translation="MTTNNRMPNKLINEKSPYLLQHAHNPVDWYPWGPEAFSRAVSEDK
FT                   PIFLSIGYSTCHWCHVMERESFEDEEVAHILNRDFICIKVDREERPDIDSIYMSVCQAL
FT                   TGHGGWPLTVFLTPDKQPFYAGTYFPKEDSKGLMGLISLLGSVKEAWDNKREHLLVSAE
FT                   NIINHVSKESISKDSKISSDIIQEAFAHFKYNFDSKYGGFGTSPKFPSPHTLLFLLRYW
FT                   YTKKEPYALEMVEKTLESMKNGGIFDHIGFGFSRYSTDKKWLVPHFEKMLYDNALLAIA
FT                   YGEAYSATGNKNYEETARQILDYVQRDMSSQLGAFYSAEDADSEGVEGKFYIWSKEEVI
FT                   NVLGSKDGEEYCRIFDISPSGNFEGLNIPNLIETGTLPEQQKSFAEDCRKKLFTHREKR
FT                   IHPYKDDKILTAWNGLMTAAMAYCGRVLGEDKYIESAKRCIDFISKKLVRTDGRLLARY
FT                   REGEAVFPAYLEDYAFLVWGLLELYEATFTTLYLKRALKLTDAMLNLFGENNSTGLFLY
FT                   GHDSEQLIARPRESYDGAIPSGNSVAAMNLLRLARITGRHEYENRAKAIMDFFGTQINA
FT                   APTGHSYMLCSYMYSVSDISSEVVIAGVDGKGLIDTFNNKYLPFAVAISNISPELTEIA
FT                   PFIGDYKAQNGKTMAYVCRNFSCMEPITEPKKLGEVLS"
FT   gene            246091..246420
FT                   /locus_tag="Ccel_0216"
FT   CDS_pept        246091..246420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0216"
FT                   /product="transcriptional regulator, PadR-like family"
FT                   /note="PFAM: transcriptional regulator PadR family protein;
FT                   KEGG: cbf:CLI_0152 PadR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74603"
FT                   /db_xref="InterPro:IPR005149"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I523"
FT                   /inference="protein motif:PFAM:PF03551"
FT                   /protein_id="ACL74603.1"
FT                   /translation="MADRSQFLRGTLEGCILKIIEHNETYGYEIAEKLQKYGFSEISEG
FT                   TIYPLLLRLEKNGMINSVKKVSAYGPKRKYYSLTETGKKEILEFYTIWCEIQNAINQIF
FT                   KEGVE"
FT   gene            246423..247100
FT                   /locus_tag="Ccel_0217"
FT   CDS_pept        246423..247100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0217"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cac:CA_P0154 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0217"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74604"
FT                   /db_xref="GOA:B8I524"
FT                   /db_xref="InterPro:IPR008316"
FT                   /db_xref="UniProtKB/TrEMBL:B8I524"
FT                   /inference="similar to AA sequence:KEGG:CA_P0154"
FT                   /protein_id="ACL74604.1"
FT                   /translation="MLSLESLRNENNRFSEKLNKENRDIYTDIVCYLRVSYLTDVQQEE
FT                   IISDILSMFFDWEKQGKKVKDMIGEDYKKFADDIINAVNPHKSILEKSKEYLFIILEAF
FT                   CYMFTIDFLFLLPKIIKGNLHLMYDYSLDMALRSLLILIVAVSVINYIGRNSFSLRKKA
FT                   ISKPTRFLIGCCVGGFFIISAFLPKALSHIIFLSINIRYVIAITVVFWIYKAIRRILLN
FT                   YCT"
FT   gene            247219..247857
FT                   /locus_tag="Ccel_0218"
FT   CDS_pept        247219..247857
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0218"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; Methyltransferase
FT                   type 12; KEGG: mba:Mbar_A2392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74605"
FT                   /db_xref="GOA:B8I525"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I525"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL74605.1"
FT                   /translation="MNIHEHIEKWQVEDGVHLFDKIKLPDNSVLIDFGCGYGEYTISLA
FT                   LSKKHSTVFSVDKDERMLKIVQDKIESHSITNVRLIKADGTLSIAFPDCYSDMILMYDF
FT                   IHGNTQEKLPIRFKFFEEARRVLKPNGILSIAPFECEYLRDSSGKRRRYSLGMLISEIE
FT                   SYGFRYSESIDGAVHFDYYHSPYHWKKLNGEMSFDYLEIGPVMNFYKQK"
FT   gene            248175..249629
FT                   /locus_tag="Ccel_0219"
FT   CDS_pept        248175..249629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0219"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   cth:Cthe_0266 methyl-accepting chemotaxis sensory
FT                   transducer"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74606"
FT                   /db_xref="GOA:B8I526"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="UniProtKB/TrEMBL:B8I526"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL74606.1"
FT                   /translation="MQQNLLLIHVKKVNKILNWVFFALGFVMLIAGIATRTIASSSIPL
FT                   AITIASAFLALFLRYKKKDMAASYVLVVSALAQVLPLLPMMGGNAFILAMLPITVTALY
FT                   LNKWIFIFVGSIINAVVIILQIVMPGSNIEAHIFSDVFQLLITLVLFLLVKDGGKLIQG
FT                   SSENAEQANKLLDELQNTMNVVKTSTSGLNVDISKATENLEVVHEISSSITTSTQEITT
FT                   GIVGQSSSVTEISQMIKEADNKISELTEFSNQLENVSANASNVVTEGSEKINTMDKQME
FT                   IINQAVAKSFETVQELNENMDEINNFLSGITHIAEQTNLLALNAAIEAARAGESGKGFA
FT                   VVAEEVRNLAEQSANTVGHIYQIINKIKEKTKNVIDEVSIGQTATQDGEKAVKIVNKNF
FT                   EMIQVSFKDIDRYISDEISRIENIADLFSRINTEVESIASISKEQAASTEELLSTLEEQ
FT                   NLNIENMYGLIQGIKTSSDNLQGLIK"
FT   sig_peptide     248175..248294
FT                   /locus_tag="Ccel_0219"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.910) with cleavage site probability 0.639 at
FT                   residue 40"
FT   gene            complement(249891..250937)
FT                   /locus_tag="Ccel_0220"
FT   CDS_pept        complement(249891..250937)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0220"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: lpf:lpl2033
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74607"
FT                   /db_xref="GOA:B8I0K1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8I0K1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL74607.1"
FT                   /translation="MTAQDRIVKNKMSLIELAEYLQNVSEACKIHGVSRQHFYDIKKAY
FT                   EENGLEGLKDKTRRKPCMKNRVAPETEEAVLRIAYEKPAYGQLRASNELRKQGVLVSAG
FT                   GVRSIWQRYNIETFDKRLKKLEEKAAKEGILYTEDQLAALEKAQQEKNISIDEIDTQHP
FT                   GYLLAQDTFYVGYIKGVGRIYQQTAIDTYSAVGFAKLYTAKVPVTAADILNDRVLPFFE
FT                   NHMIPIMRVLTDRGTEYCGAPEKHLYELFLQMNDIEHTMTKAKSPQTNGICERFNQTIL
FT                   NEFYKPAFRRTMYKSVEQMQEDLDFYMLEYNEERTHQGKRCKGKTPMQTFLDSLPLARE
FT                   KLLNDPAS"
FT   gene            complement(251067..252752)
FT                   /locus_tag="Ccel_0221"
FT   CDS_pept        complement(251067..252752)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0221"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; CHASE3 domain protein; KEGG:
FT                   lsp:Bsph_4425 methyl-accepting chemotaxis protein McpA
FT                   (H1)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74608"
FT                   /db_xref="GOA:B8I528"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR007891"
FT                   /db_xref="UniProtKB/TrEMBL:B8I528"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL74608.1"
FT                   /translation="MSVAKKLITGYLLVLVIMAGIVGISIYATQSLKTQAENLITDAIP
FT                   IGYAADGLLTALVNEETGVRGYLVSGDETFLEPYNSGKSDVRTRLKEIESRLDKHPIMA
FT                   QLITEAKPKIDAIENYFDSQISLVKQGDLEEARSKAGDGKQLFDDFRKSHDKIKDDVYK
FT                   LTNDAWNEVLDVHNRSNILIIVISIIAVLITIILSFILTRIISTPVKKVTDTLHKISGG
FT                   DLTVDSLNIKSKDEIGVLVTSLNKMVSSMKEILSKVSDVSAQVAASSEELTASAEQCTK
FT                   ANEQIAEATLKSASGAEEQLGSVEHSTDTIKEMSSNIYQIAINSKEMYTLSDKAFSASE
FT                   DGIITVNDVVEQMNDITTTISDSENVIRKLGEHSKEIGNMVAIITSITEQTNLLALNAA
FT                   IEAARAGEQGNGFAVVADEIRKLAEQSKASASQIDEFVKEIQSETENAVTSINKGNEKV
FT                   KDGFAKTQQVAETFKAIKDDVTNVNRKVKDVMASIEIVSSQSQAIVSTSETIKKAAEEG
FT                   AILSQENSAANEEQVATMEEITSSAQALAELANELQSSVSIFKI"
FT   sig_peptide     complement(252642..252752)
FT                   /locus_tag="Ccel_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.759) with cleavage site probability 0.342 at
FT                   residue 37"
FT   gene            253238..253621
FT                   /locus_tag="Ccel_0222"
FT   CDS_pept        253238..253621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0222"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   cbe:Cbei_4343 regulatory protein GntR, HTH"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74609"
FT                   /db_xref="GOA:B8I529"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I529"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACL74609.1"
FT                   /translation="MKIIISNTSGVPIYEQIKEQIKSAILSGEVEENQLLPSLRQLARE
FT                   LKISVLTTTRAYTELEQEGYVTNVQGKGCYVLGRGSELIREQLLRDIEENLSAAIKSAR
FT                   RADVSKDDLVKMLRILMEDEGYE"
FT   gene            253614..254474
FT                   /locus_tag="Ccel_0223"
FT   CDS_pept        253614..254474
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0223"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: blj:BLD_0790 ABC-type multidrug transport system
FT                   ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74610"
FT                   /db_xref="GOA:B8I530"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I530"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74610.1"
FT                   /translation="MNNDIEIRNLCKNFDSFKLNDISFSLPQGYIMGLVGPNGAGKTTT
FT                   IKLMLNMIQKTSGDIKILGLDSVTDQNRIKESIGAVFDTNYFVQDWTVNEVERYIGMFY
FT                   DTWDSAKYKSLTNKFGLNSDKKVKDLSRGMQMKLMVSCALSHDARLLILDEPTSGLDPV
FT                   AREELLDIMTEFIGDGKSSVLFSTHITSDLDKIADYITFINQGSLFYTGTKDDFIDGFR
FT                   IVKGGKNDITREQEGKMIGIRKYSTGFEGLIKTEDLRYFVTLACEPVSIDDIIVFTNRG
FT                   GKCND"
FT   gene            254467..255120
FT                   /locus_tag="Ccel_0224"
FT   CDS_pept        254467..255120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0224"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: pth:PTH_0277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74611"
FT                   /db_xref="GOA:B8I531"
FT                   /db_xref="InterPro:IPR025699"
FT                   /db_xref="UniProtKB/TrEMBL:B8I531"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74611.1"
FT                   /translation="MTNILKLVKLDFALIKPYIKIIFIALLSPLIVMYTMRDIISGTIF
FT                   CMCIMAITSGYTFSVVEKNDLNRLYGLLPVGRKDIVSARYLFIALEGLILNFIGVSANA
FT                   IILTILKVNFTFSDILIGFSVGHVVYYFFTAIQLPLFFKFGGIKGRFFSFLPFLGIFSI
FT                   SEVAKRMSTDKLAELSSIAIINNPYGILILSILFGILSYSISVGISQKIFSRLE"
FT   gene            255425..255513
FT                   /locus_tag="Ccel_R0005"
FT                   /note="tRNA-Ser3"
FT   tRNA            255425..255513
FT                   /locus_tag="Ccel_R0005"
FT                   /product="tRNA-Ser"
FT   gene            complement(255709..256338)
FT                   /locus_tag="Ccel_0225"
FT   CDS_pept        complement(255709..256338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0225"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC01036 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74612"
FT                   /db_xref="UniProtKB/TrEMBL:B8I532"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74612.1"
FT                   /translation="MKIRFCVISLLVICIFLLTSCSSNETVDASNITSPVTHSNNSSSE
FT                   NISDTNKQTEMESTITKNEKPSTKDVKCRLYFLATTELKYYYIDKMIPVEDNALITALT
FT                   KELQSTSYNKDFLSLTDKIKIKSAKLDETTGVLKVVFSDSYVDHMNLGTNTEAGLLTCL
FT                   LATYGYNLGVDKVAIYFNDELYTSLKGDLPEGYFDVNYPSAQVYNP"
FT   sig_peptide     complement(256267..256338)
FT                   /locus_tag="Ccel_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.381 at
FT                   residue 24"
FT   gene            complement(257112..257546)
FT                   /locus_tag="Ccel_0226"
FT   CDS_pept        complement(257112..257546)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0226"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: aoe:Clos_0732 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74613"
FT                   /db_xref="UniProtKB/TrEMBL:B8I533"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74613.1"
FT                   /translation="MKSVFHKYIIVLFCAFCLVIPWSSYPVDAADNQKIGVQPFNLYIS
FT                   STSESVSISNGIATCSSSIRSTTNVTEVIIVAKLQKYQNGSWITQETFTETSYTYYGAL
FT                   SKTCAVEHGYSYRLVTTYQAVVNGLSVETITKTYNYGLYL"
FT   sig_peptide     complement(257457..257546)
FT                   /locus_tag="Ccel_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.988 at
FT                   residue 30"
FT   gene            complement(257627..258307)
FT                   /locus_tag="Ccel_0227"
FT   CDS_pept        complement(257627..258307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0227"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74614"
FT                   /db_xref="GOA:B8I534"
FT                   /db_xref="InterPro:IPR025377"
FT                   /db_xref="UniProtKB/TrEMBL:B8I534"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74614.1"
FT                   /translation="MISTKTLQDVLISVAKDTQINLSAELERYMSPSHKFSRSYTKRKK
FT                   LILRSQDEFLTISCFRKRILIPLVIIITIITCAMSVPAIREPVITFIVNVYNDMTDYII
FT                   RSDNEESVVIINDFTLEYIPENFTRQNTQVTSNLKTEVYKDNAGNGFSFTLEYYKEGIN
FT                   FSMDTENADITKTKIRGLSTIISEKNTGINIAVFDNKRHQIWNLTGNIDCDIALKIVEN
FT                   VKIK"
FT   gene            complement(258304..258846)
FT                   /locus_tag="Ccel_0228"
FT   CDS_pept        complement(258304..258846)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0228"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: csc:Csac_0467 ECF subfamily RNA
FT                   polymerase sigma-24 factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74615"
FT                   /db_xref="GOA:B8I535"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B8I535"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACL74615.1"
FT                   /translation="MEFFLSVLETEEDRGKFTNLYTYYESAMYNVAFSILRDRYLAEDA
FT                   VHEALLKIINYIPDISDIQCHKTRALIVIIIKSAAIDIYRKRDKQYTNEKPELPVEADT
FT                   GKLPLDHIIDDESFNELKMKLCKLNKEYMEIIMLKHLYDLSNNEIADVLCISCDAVRQR
FT                   LSRAKKAIKKVIEEENK"
FT   gene            259038..259604
FT                   /locus_tag="Ccel_0229"
FT   CDS_pept        259038..259604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0229"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nth:Nther_0814 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74616"
FT                   /db_xref="InterPro:IPR029050"
FT                   /db_xref="InterPro:IPR029051"
FT                   /db_xref="UniProtKB/TrEMBL:B8I536"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74616.1"
FT                   /translation="MKRGLLLFFAATIISTLCACQSLSNSKENSLVSSSVTTTHDSSVT
FT                   NEKITSEEREDWIIVDKSVTVKELEYTINAYKRSAKSELFEADKGKTFLLIDITVKNKS
FT                   NIAATVNSNLMFDLTDRFGTSYNDTSLGALSCLDDENLEQLDGHIAAASEFRGGIAFEI
FT                   PKVTKGLRLIIQGPAGDGRSPVVLY"
FT   sig_peptide     259038..259097
FT                   /locus_tag="Ccel_0229"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.441 at
FT                   residue 20"
FT   gene            259824..260300
FT                   /locus_tag="Ccel_0230"
FT   CDS_pept        259824..260300
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0230"
FT                   /product="NUDIX hydrolase"
FT                   /note="PFAM: NUDIX hydrolase; KEGG: tte:TTE1781 ADP-ribose
FT                   pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74617"
FT                   /db_xref="GOA:B8I537"
FT                   /db_xref="InterPro:IPR000086"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR020084"
FT                   /db_xref="UniProtKB/TrEMBL:B8I537"
FT                   /inference="protein motif:PFAM:PF00293"
FT                   /protein_id="ACL74617.1"
FT                   /translation="MDKIKDENTNWCQSVGGIVLKGNEVLLVRHTYGAGKGKLIIPGGY
FT                   VRVNETPQDALSREVFEETTVVAKPTGLVGVRFNLKDWYAVFMMDYVEGTPNSDNKENS
FT                   EALFMDINEAVKSPDVPDLTKVILKGVIENKDNAFENKPFVSREKHGEYSFYGI"
FT   gene            260554..262701
FT                   /locus_tag="Ccel_0231"
FT   CDS_pept        260554..262701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0231"
FT                   /product="glycoside hydrolase family 9"
FT                   /note="PFAM: glycoside hydrolase family 9; type 3a
FT                   cellulose-binding domain protein; cellulosome protein
FT                   dockerin type I; KEGG: cth:Cthe_0043 glycoside hydrolase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74618"
FT                   /db_xref="GOA:Q0PRN4"
FT                   /db_xref="InterPro:IPR001701"
FT                   /db_xref="InterPro:IPR001956"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR008965"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR033126"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR036966"
FT                   /db_xref="UniProtKB/TrEMBL:Q0PRN4"
FT                   /inference="protein motif:PFAM:PF00759"
FT                   /protein_id="ACL74618.1"
FT                   /translation="MRKKFLKTTSFMLIMSLLVSLFVYAPTTVRAETSPRVGGSFYNYG
FT                   EAMQKSILFYKANRLGDLPDNYVLPYRGDAAMTDGKDVGLDLTGGWADAGDGIKFTHPM
FT                   SYAAGQLGWAVYEYRDAFEKSGQLDDILDEIKWATDFFIKAHPSPDVLYYMCGYEESDH
FT                   SVWIPHELLDYKTDRKSFKVDSTTPGSDVAGQTAAALAIASIIFEPTDPEYAETCLTHA
FT                   KQLFKFGDTYRGKNPLKTLYPSGGYLDDLAWGAIWLYIKTQDATYLEKAKSILPVTVLG
FT                   GQHTHCWDDVSYGAALKIAQAGRDESYAAMVEKNLDYWMPGTGIKYTPGGLAWLSQWGS
FT                   LRYATTAAFLAFVWSDDKTIGTASKKQTYHDFAERQINYALGDNPRGGSYEVGFGVDAP
FT                   EHPHHRTAHGSWTSMLNVPTFHRHILYGALVGGPSSDDSWKDDIKDYTLNEVATDYNAG
FT                   FVGCLAKMYSMYGGNPLENWPKAEDFRSPQDNLTEYFTRGWIIYEGYGKLKVMFQINNR
FT                   SAWPATMKDKMSTRYYMDLSEIFEAGGTVDDVQLTLEDSQGAKLIGLKQYKDNIYYFTV
FT                   DFTGTQIMPAEWEMCEKDATVQIEYKNGVGSNENDWSYQNISGPPDFDAVSFAGMSKYI
FT                   PVYDNGKLLWGEEPAGKEPEVMYGDINNDGNIDAIDFALLKKILMGDTSGNVNLTAADF
FT                   NKDGDINAIDYAALKSYLQRG"
FT   sig_peptide     260554..260649
FT                   /locus_tag="Ccel_0231"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 32"
FT   gene            complement(263027..263401)
FT                   /locus_tag="Ccel_0232"
FT   CDS_pept        complement(263027..263401)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0232"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bat:BAS1604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74619"
FT                   /db_xref="UniProtKB/TrEMBL:B8I539"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74619.1"
FT                   /translation="MLSIYNNSEDLIILIHEIYGINPFILDTANRFALYGVIFCYGSRI
FT                   RDYTDISPSCPALLLFPSHEKSFNVRGFVSSFKKPGVEVHTLEGNHGFADSYSSEYNKS
FT                   SAQKTFALIDDFLKENSSGS"
FT   gene            263516..263986
FT                   /locus_tag="Ccel_0233"
FT   CDS_pept        263516..263986
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0233"
FT                   /product="C_GCAxxG_C_C family protein"
FT                   /note="TIGRFAM: C_GCAxxG_C_C family protein; KEGG:
FT                   cth:Cthe_1399 C_GCAxxG_C_C family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74620"
FT                   /db_xref="InterPro:IPR010181"
FT                   /db_xref="UniProtKB/TrEMBL:B8I540"
FT                   /inference="protein motif:TFAM:TIGR01909"
FT                   /protein_id="ACL74620.1"
FT                   /translation="MGASSEKALELFKEGYNCSQAVFGAFSNDIGMELKSALRIASSFG
FT                   GGMGRLREVCGAVSGMFMVAGILYGYDNPEEMEAKKEHYKLIQELAQRFKDINGTIVCR
FT                   ELLGLGKGPDNPTPESRTESYYTRRPCAEYVKCAADIMEQYICQKKAEAVSD"
FT   gene            complement(264063..265919)
FT                   /locus_tag="Ccel_0234"
FT   CDS_pept        complement(264063..265919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0234"
FT                   /product="cadmium-translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; KEGG: aoe:Clos_1087 heavy
FT                   metal translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74621"
FT                   /db_xref="GOA:B8I541"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I541"
FT                   /inference="protein motif:TFAM:TIGR01512"
FT                   /protein_id="ACL74621.1"
FT                   /translation="MNKAKKVIIRIGAGTLLLIIAVVASFPSYLNLAFFVSAYLIIGGD
FT                   VLWRALRNISHGQVFDENFLMSIATVGAFFVGEYPEAVSVMLFYQVGEMFQDFAVNRSR
FT                   KSISALMDIRPDYANVKRNGELVTVDPEEVVINEVIVVKAGEKIPLDGKVLEGYSLVDT
FT                   SALTGESVPREINTGSEVLSGCINLIGLLTIQVTKEFGESTVSKILDLVENASSKKAKR
FT                   ENFITRFARYYTPIVVIVAVTLAVVPPLLVPGATFSDWIYRALIFLVVSCPCALVISIP
FT                   LGFFGGIGGASRLGILIKGGNYLEALAAAEVVVFDKTGTLTKGTFKVTEIHPVGISDSD
FT                   LFELTAHAESYSNHPISQSLKNAFKSEIDNSRIKGVEEIPGYGVKAVVDEKTIYAGNSK
FT                   LMDKIGAVYSQNKTVGTVVHVTISGIYSGYIVISDEIKEDSASAITRLKAFGINKTVLL
FT                   TGDAKDVGESVGETLGLDEVYTELLPADKVNKVEKLIAEKSPKGNLIFAGDGINDAPVL
FT                   SRADVGIAMGGLGSDAAIEAADVVIMNDEPSKIATAIAISKKTLRIVNQNIVLALGVKA
FT                   IVLAMGAFGLSNLWEAVFADVGVSVIAILNSARALRVDKAFK"
FT   sig_peptide     complement(265827..265919)
FT                   /locus_tag="Ccel_0234"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.984) with cleavage site probability 0.535 at
FT                   residue 31"
FT   gene            complement(265953..266171)
FT                   /locus_tag="Ccel_0235"
FT   CDS_pept        complement(265953..266171)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0235"
FT                   /product="Heavy metal transport/detoxification protein"
FT                   /note="PFAM: Heavy metal transport/detoxification protein;
FT                   KEGG: fma:FMG_0054 putative cation-transporting P-type
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74622"
FT                   /db_xref="GOA:B8I542"
FT                   /db_xref="InterPro:IPR006121"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036163"
FT                   /db_xref="UniProtKB/TrEMBL:B8I542"
FT                   /inference="protein motif:PFAM:PF00403"
FT                   /protein_id="ACL74622.1"
FT                   /translation="MKKIYRLNDLGCANCASKMEREINKLEGVNSATVNFISQKLIIDV
FT                   VDESFEDIMTSVQKIIKKIEPDCTVKL"
FT   gene            complement(266193..266555)
FT                   /locus_tag="Ccel_0236"
FT   CDS_pept        complement(266193..266555)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0236"
FT                   /product="transcriptional regulator, ArsR family"
FT                   /note="PFAM: regulatory protein ArsR; KEGG:
FT                   tex:Teth514_1161 regulatory protein, ArsR"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74623"
FT                   /db_xref="GOA:B8I543"
FT                   /db_xref="InterPro:IPR001845"
FT                   /db_xref="InterPro:IPR011991"
FT                   /db_xref="InterPro:IPR018334"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I543"
FT                   /inference="protein motif:PFAM:PF01022"
FT                   /protein_id="ACL74623.1"
FT                   /translation="MAKEKELEKCDYICLHKDLIDQVLSHLPEETQLYDLAELFKVFGD
FT                   TTRIKILYVLFQAEMCVCDIAQLLNMSQSAISHQLRILKQAKLAKSRRDGKTIFYSLSD
FT                   SHVRSIIDQGFEHIVE"
FT   gene            266778..267587
FT                   /locus_tag="Ccel_0237"
FT   CDS_pept        266778..267587
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0237"
FT                   /product="peptidase U57 YabG"
FT                   /note="PFAM: peptidase U57 YabG; KEGG: cth:Cthe_2507
FT                   peptidase U57, YabG"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74624"
FT                   /db_xref="InterPro:IPR008764"
FT                   /db_xref="UniProtKB/TrEMBL:B8I544"
FT                   /inference="protein motif:PFAM:PF05582"
FT                   /protein_id="ACL74624.1"
FT                   /translation="MTKFHIGDVVTRRSYGGDILFKVVNIKTNFNGSESYVLRGLSYRI
FT                   EADSQADDLVKQDARTAYTRAINELDRVKKSIDCSVPVFKTFLSRIKHKPGRILHIDSA
FT                   EDFMNECLDFYKKSKINCYGKWVSENRQPSVVKQYLKSYRPDILVLTGHDGLKKGASNF
FT                   QSLDSYANSAYFIEAVRIARSYESDPDKLCIFAGACQSYFEAIMQAGANFASSPRRILI
FT                   NALDPAIVAQKVSVTDSSVILSPNSVIELTITGSAGIGGKDTRGQMR"
FT   gene            267707..267862
FT                   /locus_tag="Ccel_0238"
FT   CDS_pept        267707..267862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0238"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74625"
FT                   /db_xref="GOA:B8I545"
FT                   /db_xref="UniProtKB/TrEMBL:B8I545"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74625.1"
FT                   /translation="MYFVGSVIVIAFFTFSYTFFFKIKKYIYSKKCSWYNTKNNTNFTC
FT                   KYILKM"
FT   gene            267873..268883
FT                   /locus_tag="Ccel_0239"
FT   CDS_pept        267873..268883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0239"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: LOC100083241; similar to vitellogenin"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74626"
FT                   /db_xref="GOA:B8I546"
FT                   /db_xref="UniProtKB/TrEMBL:B8I546"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74626.1"
FT                   /translation="MKKRILAILLIFAFVSVSFIEADAKGLRSFSRSSKSFSKSYSGYK
FT                   SSSRNSSIFGSSRSKSSTSKSKSKSSGLFSSSKSKSSGSTKNSNSRSIPGSKSYTESSS
FT                   KKTNTSGFTAKASSKKKSYMQDTYKSQISNKNYKTYKQKLNNQQQKVYNDSMKRSYGSN
FT                   SRKMNFEDAMRTRTSRMNVFNNRPIFINVNRSIFGSPFSYGYAYVGPWDLWFLMRASDM
FT                   FWYHHWNEISPYRNYFDQNQYRQLENRVEKLEKQGVQRDPNYMEEGVDPDLQLSQQYQE
FT                   QNPENVYYTDKYPTNSSRNTGAVVVVIIITSVGLIIVIRKLSKPKPKKPRHSRVY"
FT   sig_peptide     267873..267941
FT                   /locus_tag="Ccel_0239"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.854 at
FT                   residue 23"
FT   gene            268920..269513
FT                   /locus_tag="Ccel_0240"
FT   CDS_pept        268920..269513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0240"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74627"
FT                   /db_xref="UniProtKB/TrEMBL:B8I547"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74627.1"
FT                   /translation="MFGFKKKGGQDILNPLNINSNSMVEFKLKELEEQGFFTFGKIIHM
FT                   GMGQRPFTRYLVYSRAEETEYIFEVYKGEEEGQLETYLYFLDDTVPFSEEFLEVVGQRC
FT                   ITTPDGTEYERCTMPQHDYRIDGVQGSIKVYDLNSEKVEYESEIEVWDYQRDAEGITEY
FT                   LNIEMLKTNGMFRVFIGQRLEGSLYKVYQGLDEK"
FT   gene            269533..270435
FT                   /locus_tag="Ccel_0241"
FT   CDS_pept        269533..270435
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0241"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: shl:Shal_3574 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74628"
FT                   /db_xref="GOA:B8I548"
FT                   /db_xref="UniProtKB/TrEMBL:B8I548"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74628.1"
FT                   /translation="MLDYFIFFLKDLSFSFVILMVGFILGWVIYNNLVLRDVSLKDALF
FT                   TKDNFATWIEFIGAFVFPVLYLSSHAIKGAASDNVFVDLAVCTGYTVFYVVILTVLRLM
FT                   SKTIVSLINAEDGHGKVCLNKEICEQKNIGAALFSVTLSVIFVSLIKYIDFIAIIVDGV
FT                   GAAILIKLLLFLVFVLIAIVCYSVVLRRKTTLFKELFIDNNAAAGIGLLGFVFAVQTII
FT                   TGIIDAYASDFNLITVALVIAVCLVIYGILSVLFKKIFTAIVKVDVWNEIYEQNNVGAA
FT                   VGQAALYVGIAMIIVNFIM"
FT   gene            270950..271042
FT                   /gene="ffs"
FT                   /locus_tag="Ccel_R0006"
FT   ncRNA           270950..271042
FT                   /gene="ffs"
FT                   /locus_tag="Ccel_R0006"
FT                   /product="SRP RNA; RNA component of signal recognitionparti
FT                   cle"
FT                   /ncRNA_class="SRP_RNA"
FT   gene            271206..272894
FT                   /locus_tag="Ccel_0242"
FT   CDS_pept        271206..272894
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0242"
FT                   /product="DNA polymerase III, subunits gamma and tau"
FT                   /note="KEGG: cth:Cthe_2144 DNA polymerase III subunits
FT                   gamma and tau; TIGRFAM: DNA polymerase III, subunits gamma
FT                   and tau; PFAM: AAA ATPase central domain protein; DNA
FT                   polymerase III delta; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74629"
FT                   /db_xref="GOA:B8I549"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR012763"
FT                   /db_xref="InterPro:IPR022754"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I549"
FT                   /inference="protein motif:TFAM:TIGR02397"
FT                   /protein_id="ACL74629.1"
FT                   /translation="MSYTALYRKWRPLVFEDVVEQEHVVRTIKNTVKSGRIAHAYLFCG
FT                   TRGTGKTTMAKIFARAINCINPKDGNPCNECEVCRGILDESILDVVEIDAASNNSVDNV
FT                   REIRDEVVYAPSQARYKVYIIDEVHMLSSGAFNALLKTLEEPPGHVVFILATTDPHKLP
FT                   ATILSRCQRFDFKKITPAGIAERVKLIAQASGINIDDDGALLIARLADGALRDALSILD
FT                   QCIAEGSTTITYQNVLDAIGIVSDDFISEIVDNIESKNVEGLVASVEMLSAEGRDILRF
FT                   ASDLVLYFRNLLICKLSKNPENILDVGKQYLDKMIAQSEAFTKERLIGIIKELSSFETQ
FT                   LKYALNQRVFLEVMLISISVGSYGQSGSDNNLLDRITNLESAVRTGATALGPSVKDRSS
FT                   VSVQVNVANTSPVPSGKKLDNLPPIPGSSVPKSSAKGNSFNELEEWANILSDLKANRRM
FT                   MLLSYLTSTKAVAADESTVLVVFPPDVVSLKNIVSKAEHIDVLENALERRLGRHVRVKV
FT                   VDEESLESMVQKEPSPLKNSEESQLVKLTREISDRLNVPLDIIDE"
FT   gene            272957..273304
FT                   /locus_tag="Ccel_0243"
FT   CDS_pept        272957..273304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   cth:Cthe_2143 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74630"
FT                   /db_xref="GOA:B8I550"
FT                   /db_xref="InterPro:IPR004401"
FT                   /db_xref="InterPro:IPR036894"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I550"
FT                   /inference="protein motif:PFAM:PF02575"
FT                   /protein_id="ACL74630.1"
FT                   /translation="MARGGFPGGGFGGNMNNLMKQAQKMQKDMEKAQQDLENKTIEVSV
FT                   GGGAINIVATGKKEIKEITIKPEVVDPDDVEMLQDLILSAVNEALRKADELANSEMSKI
FT                   TGGLGGLPGMF"
FT   gene            273343..273942
FT                   /locus_tag="Ccel_0244"
FT   CDS_pept        273343..273942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0244"
FT                   /product="recombination protein RecR"
FT                   /note="KEGG: cth:Cthe_2142 recombination protein RecR;
FT                   TIGRFAM: recombination protein RecR; PFAM: TOPRIM domain
FT                   protein; Zinc finger C4-type, RecR; SMART: Toprim sub
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74631"
FT                   /db_xref="GOA:B8I551"
FT                   /db_xref="InterPro:IPR000093"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR015967"
FT                   /db_xref="InterPro:IPR023627"
FT                   /db_xref="InterPro:IPR023628"
FT                   /db_xref="InterPro:IPR034137"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I551"
FT                   /inference="protein motif:TFAM:TIGR00615"
FT                   /protein_id="ACL74631.1"
FT                   /translation="MEYYAVPIAKLVEEFQKLPGIGHKSAQRLAFHVINLPMEKVQKLS
FT                   ESILEAKQKTRYCSVCSNLTDIDPCPLCSGTSRDKTVICVVQDPRDVVAMERTREFKGL
FT                   YHVLHGAISPMQGIGPEEIRIKELITRLGSGDVKEVILATNPNVEGEATAMYISKLIKP
FT                   LGVKATRIAHGIPVGGDLEYADEVTLAKALEGRREI"
FT   gene            273951..274076
FT                   /locus_tag="Ccel_0245"
FT   CDS_pept        273951..274076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0245"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74632"
FT                   /db_xref="UniProtKB/TrEMBL:B8I552"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74632.1"
FT                   /translation="MEVCIIKHGQRDKKFLLAIIFLENKNIRYHSKPLDIISLIE"
FT   gene            274123..274800
FT                   /locus_tag="Ccel_0246"
FT   CDS_pept        274123..274800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0246"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cpy:Cphy_0704 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74633"
FT                   /db_xref="GOA:B8I553"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8I553"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL74633.1"
FT                   /translation="MYKILIVDDEAGIRNIIKKYAVFEGHEVEEAADGMEAIQVCREKE
FT                   FDIIVMDVMMPELDGFSACKEIKKFSKAPVLMLSARGEEYDKIHGFELGIDDYVVKPFS
FT                   PKELMMRINVIVKRSRGTSDTENKKEIFTFKGLTVDFTGRLVYIDNEKIDMSPKEYDLF
FT                   FYLVKNRGIALTRERLITDVWGYDFFGDDRTLDTHIKLLRKSLGDYSKNIVTLRGVGYR
FT                   FET"
FT   gene            274790..276256
FT                   /locus_tag="Ccel_0247"
FT   CDS_pept        274790..276256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0247"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: cpy:Cphy_0705 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74634"
FT                   /db_xref="GOA:B8I554"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I554"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL74634.1"
FT                   /translation="MKHDKISIRYNMFFYLTAFVAVLLILLWLFQIVFLDDFYKQIKIH
FT                   SIKSMAETIENNVDAENFQEFLTSLSQEEDACIKILDDSGKTKYSVESRPDCIIHKVPP
FT                   SELFRLYNRAEQNGGTYLEMFPMDKGKERRDPAAYPFANNFAPPGNIPGNIIFVKIVDI
FT                   GDGSHAIVMLNSTITPVNATVNTLRIQLIWVTGITLLMALLMGLFISRKVSDPIIKINS
FT                   SAKELAKGNYDTIFHGRGYLEIAELNSTLNYAAKELSKVEGLRKELIANISHDLRTPLT
FT                   MITGYGEVMRDLPGENTPENVQIIIDEAKRLTTLVNDILDISQLESGTLKLNLDTFNIT
FT                   ESIRNILQRYNKLTEQDGYRLEFKSDKDIWVNADTVKMSQVIYNLINNAITYTGPDRTV
FT                   TIIQSSSSDSVKVEITDTGEGISEEMLPLIWDRYYKIDKAHKRAAIGTGLGLSIVKTIL
FT                   DMHGARYGVGSKPGKGSTFWFELNFEQKLN"
FT   sig_peptide     274790..274897
FT                   /locus_tag="Ccel_0247"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.734) with cleavage site probability 0.730 at
FT                   residue 36"
FT   gene            276341..277987
FT                   /locus_tag="Ccel_0248"
FT   CDS_pept        276341..277987
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0248"
FT                   /product="DHHA2 domain protein"
FT                   /note="PFAM: CBS domain containing protein; DHHA2 domain
FT                   protein; DRTGG domain protein; KEGG: ctc:CTC01649 putative
FT                   manganese-dependent inorganic pyrophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74635"
FT                   /db_xref="GOA:B8I555"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR004097"
FT                   /db_xref="InterPro:IPR010766"
FT                   /db_xref="InterPro:IPR028979"
FT                   /db_xref="InterPro:IPR038222"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B8I555"
FT                   /inference="protein motif:PFAM:PF02833"
FT                   /protein_id="ACL74635.1"
FT                   /translation="MKDIIYITGHKNPDTDSICSAIAYAELKKRHAALAVPIRIGDINK
FT                   ETEFVLKYFGVEVPEYRETVRTQISDLDIDIISPVSEDISIKAAWSIMLKNNVKVLPVA
FT                   DVKGKLIGIITLSDITGSYLDALENNIICASGTPCRNIMDTLAAKLVCGDEENFKSAGK
FT                   VVIAAMAPEDMEPFIDRGDIVLVGSRKDSQLKAIEIGASSMIITCGAKADEEVIKFAEE
FT                   KGCIVMDTYYDTFTTARLINQSIPVSHIMTKEQLISFNINDYIDNIKDKMLKTRYRSYP
FT                   VVDDEGIIKGFISRYHLITQRRKKVILLDHNERAQTIDGIDQADILEIIDHHRIGDIQT
FT                   GYPIFFKNDAVGSTSTLIANMYFENGMNPSKSVAGLLCAAIISDTMKFKSPTSTYADEL
FT                   AASRLAKIADINIDEFATSLFKANASLQGMTPQTILDYDFKDFVFNKYKIGIGQINSSD
FT                   TEGLNKIKDNLLKHMRTVLENREYSLILLLVTDIIKEGSELLFVGDDHAALMEKAFNIK
FT                   TGENGAFLKGLVSRKKQVVPQLSSTIQRESI"
FT   gene            278212..278898
FT                   /locus_tag="Ccel_0249"
FT   CDS_pept        278212..278898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0249"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mla:Mlab_1595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74636"
FT                   /db_xref="InterPro:IPR018966"
FT                   /db_xref="UniProtKB/TrEMBL:B8I556"
FT                   /inference="similar to AA sequence:KEGG:Mlab_1595"
FT                   /protein_id="ACL74636.1"
FT                   /translation="MERLKLRHEIKHEISTSDYIAVQHRLKYIAGKDPNADQSGRYKIR
FT                   SLYFDNVDNKALKEKIIGLNNREKFRIRYYNGDTRHIKLEKKGKINGLCYKKSTRLTVE
FT                   QCEQIISGDIKWMRFSDDLLLLELYTKMNFQQLRPRILVDYVREPYIYKPGNVRITFDS
FT                   GIKTGLNSKELFNQQTVSMNTHAVNKIIMEVKFDEFLPEIISDIIQLGQRQSSAFSKYA
FT                   ASRIFG"
FT   gene            278924..279595
FT                   /locus_tag="Ccel_0250"
FT   CDS_pept        278924..279595
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0250"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: swo:Swol_2179 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74637"
FT                   /db_xref="GOA:B8I557"
FT                   /db_xref="InterPro:IPR032531"
FT                   /db_xref="UniProtKB/TrEMBL:B8I557"
FT                   /inference="similar to AA sequence:KEGG:Swol_2179"
FT                   /protein_id="ACL74637.1"
FT                   /translation="MNFNDIFKSNFVEKVSSFSPLDMVIALAVSFALGLFIFYVYKKTF
FT                   NGVMYSASFGVSLLAMTLITTLIILAVTSNVILSLGMVGALSIVRFRSAIKEPMDIAFL
FT                   FWSISAGIVTGAGLIPLGVFGSLFIGVVMVIFVNKKTNDNPYILVVNCMDDKAEKLVNS
FT                   AIIDNVKKHVVKSKAVTTSGVELTVEVRLKGSSTEFVNQISEIRGVTNTVLVSYNGEYM
FT                   S"
FT   gene            279611..281650
FT                   /locus_tag="Ccel_0251"
FT   CDS_pept        279611..281650
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0251"
FT                   /product="Spore coat protein CotH"
FT                   /note="PFAM: Spore coat protein CotH; KEGG: cpy:Cphy_0703
FT                   spore coat protein CotH"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74638"
FT                   /db_xref="GOA:B8I558"
FT                   /db_xref="InterPro:IPR014867"
FT                   /db_xref="UniProtKB/TrEMBL:B8I558"
FT                   /inference="protein motif:PFAM:PF08757"
FT                   /protein_id="ACL74638.1"
FT                   /translation="MITSKYINIIIAVVLIVVVVFTGIFMTVPGSIGIATENSQPEYVT
FT                   KLFDKNKIISIDIKADKKEWEEMLKNATSEEYIQCDATINGTTYKSVGIRPKGNSSLSM
FT                   VANSDSDRYSFKLEFDHYIKGQTCMGVDKMVINNIQADSTYMKEYLSFDMMSYMGVTTP
FT                   LYAYTDVTVNGEKWGFYLAVEAMEESFAKRNYGVDFGKLYKPETMGGQRDENMKDIPRN
FT                   QEDEQKKNRVQQQQPGIVSGTTAEANGINGNSKTTDAQNTNQAGPGGFPGGPGFGGFGN
FT                   NQGGGADLKYIDDKISSYSNIFEGEIFKGTDADYKRVIKAIKNLNNGTELEKYISVDEC
FT                   LRYFAVNTVVVNLDSYFSNMKHNYYLYEENGKLSMLPWDYNLAFAGFQSGTASSAVNFP
FT                   IDTPVSGIEMSERPILNKLLEVDEYKEKYHKYLKDILNGYIDNEKFGSTVDKLNSLIAG
FT                   YVKNDATAFFTYDKYTAGVAMLKEFGKLRAKSIEGQLNGSIPSTKEGQSKASDKLIDAS
FT                   AINLSVMGTQGGGGGGGRVGGDRASQLEKSQQQGDDQKPQENQQGNSRMLPGDMPDRDI
FT                   MMQAMRIVQSADEEDLTEEQLKQLKELGMTEEQIAFVKNMPFGKGGMGGDGISSQKGDN
FT                   SIKSNNRQETTRMSDQDILVTGIYLVFMAAGLLFVIKFKRRKSS"
FT   gene            281804..283108
FT                   /locus_tag="Ccel_0252"
FT   CDS_pept        281804..283108
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0252"
FT                   /product="protein of unknown function DUF21"
FT                   /note="PFAM: CBS domain containing protein; protein of
FT                   unknown function DUF21; transporter-associated region;
FT                   KEGG: cth:Cthe_2870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74639"
FT                   /db_xref="GOA:B8I559"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR002550"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I559"
FT                   /inference="protein motif:PFAM:PF01595"
FT                   /protein_id="ACL74639.1"
FT                   /translation="MLTKVLLLVVLVLLNAFFSGSEIALISLNDKLIKKQAEEGDKKAK
FT                   QLYSFLSEPSRFLATIQIGITLAGFLASAFATESFVDDLTGLLVKTGFPVAESVIRSVS
FT                   LVVITIILSYFTLVFGELIPKRLAMQKSEFLANIAVGPLMFLSRITNPFVRFLTFSTNF
FT                   FIKVFGGNPAGGDDEKVTEEEIRMMMEVGEERGVIQDTEKEMIDNIFEFDNKSVSEIMT
FT                   HRTNIVGIPVDSDINYVLYIMNRDKYTRVPIYNDNIDNIVGILHVKDLLEYTQSHNKDF
FT                   SLKKIIRSAYFVPESKRTDELFKEMQKNKVHLAVVIDEYGGTAGIVTIEDLLEEIVGNI
FT                   FDEYDIEQKDIEYLENNTYIFDGAIDLDKVEEVLDEDLPVDDFDTLGGFILKLLGRIPK
FT                   VDEKPTVPYENIVFKVVKMEGKRIVKVQASKQENN"
FT   sig_peptide     281804..281878
FT                   /locus_tag="Ccel_0252"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.990) with cleavage site probability 0.663 at
FT                   residue 25"
FT   gene            283389..283757
FT                   /locus_tag="Ccel_0253"
FT   CDS_pept        283389..283757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74640"
FT                   /db_xref="InterPro:IPR018658"
FT                   /db_xref="UniProtKB/TrEMBL:B8I560"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2131"
FT                   /protein_id="ACL74640.1"
FT                   /translation="MAREAIGKCPVCGNETEVTRITCNSCDTVIEGHFKLCKFCKLTND
FT                   QRAFLDVFIKCRGNIKEVEKELGVSYPTVKNKLEDVAAALGHKGEPQPEVPGRKKEILD
FT                   KLNSGEISVEEAVELMKE"
FT   gene            283793..284995
FT                   /locus_tag="Ccel_0254"
FT   CDS_pept        283793..284995
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0254"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74641"
FT                   /db_xref="InterPro:IPR025164"
FT                   /db_xref="UniProtKB/TrEMBL:B8I561"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2130"
FT                   /protein_id="ACL74641.1"
FT                   /translation="MSISEEKLLILKMLEEKKISSEEAAKLLAALDEKKEEEPADRYKT
FT                   NQKTNGFTEEAAKVREKVNEWRKGFKNNYNQADFDNMIDDFANKAEKIGKNVATTTFGI
FT                   VDKVIDYVGSFVDTNSFNVFGNCKTVQKNFEVYPAENAIFEIAGVNGSISIKKHLDPKV
FT                   IIISRIKSSVPDGEGVVVFSDDPNNISVKVNSTALNVSVSHEIFIPDIKFKQITIENSN
FT                   GKIYIEDSNSQEITAVTKNAHIELMGVNSDKISLNTKNGRIQLNYIIGDKIDINTSNAV
FT                   IDIKHIKAKYINAITKNGRVNIENAQNVDTENDMDMYLKTSNGGIKVNMNDMDSRVYKV
FT                   KAHATNGTINLLIPEILYHNVNRKATGGSFIEAESKNYESGLSKVNITAETMNGHVEIV
FT                   K"
FT   gene            285258..286337
FT                   /locus_tag="Ccel_0255"
FT   CDS_pept        285258..286337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0255"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   cth:Cthe_2593 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74642"
FT                   /db_xref="GOA:B8I562"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I562"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACL74642.1"
FT                   /translation="MFDKLQAAEDRYEEISHKLSDPDVINNQDEYKKYMKECSDLEEIV
FT                   QKYREYTKVTKEIEEARELLEQTLDKDFREMVQQEFQEAQEKLEVIKRQLKILIVPKDP
FT                   NDDKNVIVEIRGGAGGEEAALFAGVLFRAMAKYAEKKRWKYEILDSNPTELGGFKEVVF
FT                   TIEGKGAYSRLKFESGVHRVQRVPSTESSGRIHTSTITVAVLPEVEEVDVDINPSDLRI
FT                   DTYRASGAGGQHINKTDSAIRITHMPTGIVVSCQDERSQHKNKDKAMKILRSKLYEIAQ
FT                   EQQINEVAQDRKNQVGTGDRSERIRTYNYPQGRVTDHRINLTLYKLEQVLDGDLDELID
FT                   ALITTDQSEKLGSGSDDEG"
FT   gene            286434..287177
FT                   /locus_tag="Ccel_0256"
FT   CDS_pept        286434..287177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0256"
FT                   /product="zinc/iron permease"
FT                   /note="PFAM: zinc/iron permease; KEGG: cth:Cthe_2594
FT                   zinc/iron permease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74643"
FT                   /db_xref="GOA:B8I563"
FT                   /db_xref="InterPro:IPR003689"
FT                   /db_xref="UniProtKB/TrEMBL:B8I563"
FT                   /inference="protein motif:PFAM:PF02535"
FT                   /protein_id="ACL74643.1"
FT                   /translation="MEHILKITIVGLISGITGTGIGGLIAFFVDRKISNRLLSSILEFS
FT                   AGLMTSVVCFELVPEAVKISGLNLTVIGIGLGILVVILLDDMVKRLDSVKNTKGNSGLL
FT                   RTGILVSIGLALHNLPEGFAVGSGFEASVKLGITLTIIIVIHDVPEGIAMALPMKIGGF
FT                   SAKKAFLLTVLSGVPMGLGAFVGAVLGHVSQQFIALCLGFAGGAMLYVVFGELIPESKR
FT                   IYVGRMSSVGNILGIVCGIIITMLN"
FT   gene            287206..288285
FT                   /locus_tag="Ccel_0257"
FT   CDS_pept        287206..288285
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0257"
FT                   /product="Sua5/YciO/YrdC/YwlC family protein"
FT                   /note="TIGRFAM: Sua5/YciO/YrdC/YwlC family protein; PFAM:
FT                   SUA5 domain protein; SUA5/yciO/yrdC domain; KEGG:
FT                   cth:Cthe_2595 translation factor SUA5"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74644"
FT                   /db_xref="GOA:B8I564"
FT                   /db_xref="InterPro:IPR005145"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR010923"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR038385"
FT                   /db_xref="UniProtKB/TrEMBL:B8I564"
FT                   /inference="protein motif:TFAM:TIGR00057"
FT                   /protein_id="ACL74644.1"
FT                   /translation="MKTQVIKIDAENINENALKPAAEALKQGMTVAFPTETVYGLGANA
FT                   LDGIAVSKIFKAKGRPSDNPLIVHIADREKVSELTSFIPDKAVALMDKLWPGPLTLVMK
FT                   KSSVIPKEITAGLDTVGIRMPEHPVALELIKLAGIPVAAPSANVSGKPSPTAAQHVLDD
FT                   LDGKIEMIVDAGSSRVGLESTVLDVSSDPPVLLRPGGVTPCQIEEIIGHIEIDKTIMNK
FT                   VTADNVPKSPGMKYKHYSPKAHVIIVESSDINKQAEVMCYLAEKYKKEGKKVGVCATDQ
FT                   TFDKYCLYDTISMGDRNHPETIASSLFSIFREFDGRRADIILAEAVDQNGVGLAIMNRM
FT                   VKAAGYDIVKADLVNSIGG"
FT   gene            288287..288793
FT                   /locus_tag="Ccel_0258"
FT   CDS_pept        288287..288793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0258"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: Protein-tyrosine phosphatase, low molecular
FT                   weight; KEGG: cth:Cthe_2596 protein tyrosine phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74645"
FT                   /db_xref="GOA:B8I565"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B8I565"
FT                   /inference="protein motif:PFAM:PF01451"
FT                   /protein_id="ACL74645.1"
FT                   /translation="MKENNPFSDSIKILFVCTGNTCRSCMAEGLMKEALKNSQHSKRII
FT                   AASRGISAFDGDSASGHSVKALKTLWDIDISSHKAKILTNTETEQADLILTMTRQHRDI
FT                   IKNVYPQKKTQIFTLKEYVYPDLNPDSVGADIRDPYGMPYDVYEACARELQKCIKLLLN
FT                   KLSFF"
FT   gene            288872..289321
FT                   /locus_tag="Ccel_0259"
FT   CDS_pept        288872..289321
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0259"
FT                   /product="sugar-phosphate isomerase, RpiB/LacA/LacB family"
FT                   /note="TIGRFAM: sugar-phosphate isomerase, RpiB/LacA/LacB
FT                   family; ribose 5-phosphate isomerase B; PFAM:
FT                   Ribose/galactose isomerase; KEGG: cth:Cthe_2597
FT                   ribose-5-phosphate isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74646"
FT                   /db_xref="GOA:B8I566"
FT                   /db_xref="InterPro:IPR003500"
FT                   /db_xref="InterPro:IPR004785"
FT                   /db_xref="InterPro:IPR036569"
FT                   /db_xref="UniProtKB/TrEMBL:B8I566"
FT                   /inference="protein motif:TFAM:TIGR00689"
FT                   /protein_id="ACL74646.1"
FT                   /translation="MIAIGSDHAGYLLKADIIKFLESKGLEVKDFGTNCPDSVDYPDYG
FT                   RAVAEAVASKECEKGILICGTGIGISIAANKVPGVRAALCTDSYMAKMCRQHNDANIIA
FT                   IGERVVGPGLAFDIIETWLETEFLGGRHQNRLDKISDIEKKYLTK"
FT   gene            289334..289963
FT                   /locus_tag="Ccel_0260"
FT   CDS_pept        289334..289963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0260"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: cth:Cthe_2598 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74647"
FT                   /db_xref="GOA:B8I567"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I567"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ACL74647.1"
FT                   /translation="MENVFVFDHPLIQHKISLLRDKNTNTKEFRELVSEIAMLMGYEVT
FT                   RNMPLKEVEIETPIGMAKTKVISGKKLGIVPILRAGLGMVDGMLRLIPMAKVGHIGLYR
FT                   DPESLQPVEYYCKLPVDVEEREIVVLDPMLATGGSASAAIQFIKNRGVKNIKLMCLIAA
FT                   KAGIERMQKDHPDVGIYCASVDEILNDHAYIVPGLGDAGDRLFGTK"
FT   gene            290014..290451
FT                   /locus_tag="Ccel_0261"
FT   CDS_pept        290014..290451
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0261"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   cth:Cthe_2599 CMP/dCMP deaminase, zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74648"
FT                   /db_xref="GOA:B8I568"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="InterPro:IPR016473"
FT                   /db_xref="InterPro:IPR035105"
FT                   /db_xref="UniProtKB/TrEMBL:B8I568"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACL74648.1"
FT                   /translation="MRPSWDEYFMQIVELIKTRSTCLRRQIGAVIVKEKRILASGYNGA
FT                   PVGCKHCSEVGCLREKLNIPSGQRHELCRAIHAEQNAIVQAAYSGTSVSGATLYVTNQP
FT                   CVLCAKLAINAGIVRIVFNGDYPDELSMTLLSEAGIEVVRL"
FT   gene            290586..292874
FT                   /locus_tag="Ccel_0262"
FT   CDS_pept        290586..292874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0262"
FT                   /product="UDP-N-acetylglucosamine 2-epimerase"
FT                   /note="PFAM: glycosyl transferase family 4;
FT                   UDP-N-acetylglucosamine 2-epimerase; KEGG: cth:Cthe_2601
FT                   UDP-N-acetylglucosamine 2-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74649"
FT                   /db_xref="GOA:B8I569"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003331"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="InterPro:IPR029767"
FT                   /db_xref="UniProtKB/TrEMBL:B8I569"
FT                   /inference="protein motif:PFAM:PF02350"
FT                   /protein_id="ACL74649.1"
FT                   /translation="MSSVYEYFISFTLAFIVAFSATPAVKSLAFKLGVVDVPKDSRRMH
FT                   KNPIALLGGLAIIAGFFVSILFSVVSSKLLNVETALVFDTRFLGLIAGSLIIAVLGFID
FT                   DKVALSAKLKFPIQIVAALIVALTGTRIEFVTNPFSVIGISTFGPWISYPLTVIWIVGI
FT                   TNAINFIDGLDGLAAGVSSIASMSLFFVSVMRGNPDIRTAVLAAILAGSILGFLPYNFN
FT                   PAKIFMGDTGATFLGFVLGTISIQGTYKSYTAIAIAVPLLVLALPLFDTLFAILRRVAS
FT                   GKSPMTADRGHLHHRLVDMGLTQKQSVSVIYVASAALGLCAVVLDYKGPVSAIILVIAV
FT                   AIFIVGGSMYMSEVNSASKAKEVHYLYNPSRMSIIGGRKLDRLKVMTIFGTRPDAVKMA
FT                   PLVKELERCDKIDSVVCVTAQHREMLDQVLKMFEITPQHDLNIMQSRQTLTGITTRALE
FT                   GLEKVMEQEKPDIVLVHGDTTTCFVGSLAAFYKQIAVGHVEAGLRTFDKFSPYPEEMNR
FT                   KLTGSMADIHLAPTQTNKENLLREGVSRDSIYITGNTVNDALKTTVKEDYTFQCEELKG
FT                   IDFKNKRIIAVTAHRRENLGEPLHNICRALAAIVDKYDDVELVYTVHLNPVVQDTAKEI
FT                   LGGKERVHLIPPLDVQDMHNLMARSYMIMTDSGGIQEEAPTLGKPVLVLRKETERPEAV
FT                   KAGTVRLAGTVESEIIEHASKLLDDKEDYDKMAKAVNPYGDGHASERIVNVLLYHFGLT
FT                   DEIPEEFSV"
FT   gene            complement(292994..293773)
FT                   /locus_tag="Ccel_0263"
FT   CDS_pept        complement(292994..293773)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0263"
FT                   /product="OmpA/MotB domain protein"
FT                   /note="PFAM: OmpA/MotB domain protein; KEGG: ckl:CKL_3788
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74650"
FT                   /db_xref="GOA:B8I570"
FT                   /db_xref="InterPro:IPR006665"
FT                   /db_xref="InterPro:IPR025713"
FT                   /db_xref="InterPro:IPR036737"
FT                   /db_xref="UniProtKB/TrEMBL:B8I570"
FT                   /inference="protein motif:PFAM:PF00691"
FT                   /protein_id="ACL74650.1"
FT                   /translation="MAKEKVVKDTSERYLLTYADLMNLLLILFIVLYSMSQVNTEKFQQ
FT                   LSQSLSSAFGNGETAYVIQGGSSGNSLIDFPATMPSPVIPSKIEDQQMEALEKEINSLV
FT                   DSEGLKGNVAVTMQERGIVVTINEKILFKSGSAIIEPKDQDTVIKIGKDILSKIPNKHI
FT                   RVEGHTDNVPMKSTLYASNWELSAGRAINVLKLLVEKGGINPKMIHPVPYGEYSPLVPN
FT                   TTDANRAKNRRVDIVILRDSSSKGEANTDNNESSIAK"
FT   gene            complement(293776..294576)
FT                   /locus_tag="Ccel_0264"
FT   CDS_pept        complement(293776..294576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0264"
FT                   /product="MotA/TolQ/ExbB proton channel"
FT                   /note="PFAM: MotA/TolQ/ExbB proton channel; KEGG:
FT                   csc:Csac_1524 MotA/TolQ/ExbB proton channel"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74651"
FT                   /db_xref="GOA:B8I571"
FT                   /db_xref="InterPro:IPR002898"
FT                   /db_xref="UniProtKB/TrEMBL:B8I571"
FT                   /inference="protein motif:PFAM:PF01618"
FT                   /protein_id="ACL74651.1"
FT                   /translation="MDITTIIGLILGIGGVLGGYIEEGGNLGALLKIGPFLIVFGGGFG
FT                   ATLVAFPLSEIKKMLSTINMLFIQKKYNEIDIINELADLSEKARKDGLLSLEQDAQTNK
FT                   NELIRKGLALVVDGIETEVIKDILARETELQEEIYESGVKIFEAMGGTWPAMGVCGTVM
FT                   GMISILKDLSDSDALGPKISGAFIATMLGVGTANLIWLPFGTKIKSKAARETMINEIII
FT                   EGLLSIQAGENPRIIKEKLNLNLMEKLSGAKNKSAVAAEEGAEA"
FT   gene            294828..295226
FT                   /locus_tag="Ccel_0265"
FT   CDS_pept        294828..295226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0265"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74652"
FT                   /db_xref="GOA:B8I572"
FT                   /db_xref="UniProtKB/TrEMBL:B8I572"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74652.1"
FT                   /translation="MSNIIKFFCKRVLALYLVALIVCFFGKNQKLPMIIMLTISVTFSL
FT                   LKFAIHEYLLKHLSGSTNKKVGVIHTLLLYLFNLGIITITFILALSFGVNTLLAALAGT
FT                   LSVMIVIVINTITETLGITKNRFGEKVI"
FT   gene            295226..295933
FT                   /locus_tag="Ccel_0266"
FT   CDS_pept        295226..295933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0266"
FT                   /product="ATP synthase F0, A subunit"
FT                   /note="TIGRFAM: ATP synthase F0, A subunit; PFAM:
FT                   H+transporting two-sector ATPase A subunit; KEGG:
FT                   cth:Cthe_2602 F0F1 ATP synthase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74653"
FT                   /db_xref="GOA:B8I573"
FT                   /db_xref="InterPro:IPR000568"
FT                   /db_xref="InterPro:IPR023011"
FT                   /db_xref="InterPro:IPR035908"
FT                   /db_xref="UniProtKB/TrEMBL:B8I573"
FT                   /inference="protein motif:TFAM:TIGR01131"
FT                   /protein_id="ACL74653.1"
FT                   /translation="MGEKLTHAMESHTAFYLKLFGLKIPVSDLVVTMWIIMAIMIVLAI
FT                   VLTRKLSLIPNKRQNVAEIIVEFINNLVKDAIPHHWKAFAPYLGTVMLFLILANTVSIF
FT                   NIIPGGEEGFKLRPPTRNINVTVCLAVMSICVVIYAGIRYNGVGGWIKSFAKPTPVMLP
FT                   FNILDYLIKPTSLALRLFGNILGAFIVMELIYMAFPIFAPAVLSCYFDLFDGILQAYVF
FT                   MFLTSIYISEALE"
FT   gene            295946..296176
FT                   /locus_tag="Ccel_0267"
FT   CDS_pept        295946..296176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0267"
FT                   /product="ATP synthase F0, C subunit"
FT                   /note="TIGRFAM: ATP synthase F0, C subunit; PFAM:
FT                   H+transporting two-sector ATPase C subunit; KEGG:
FT                   tte:TTE0631 F0F1 ATP synthase subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74654"
FT                   /db_xref="GOA:B8I574"
FT                   /db_xref="InterPro:IPR000454"
FT                   /db_xref="InterPro:IPR002379"
FT                   /db_xref="InterPro:IPR005953"
FT                   /db_xref="InterPro:IPR020537"
FT                   /db_xref="InterPro:IPR035921"
FT                   /db_xref="InterPro:IPR038662"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I574"
FT                   /inference="protein motif:TFAM:TIGR01260"
FT                   /protein_id="ACL74654.1"
FT                   /translation="MAGTGIIAIAAAIAAFTGIGAGIGISLATGKAVEGIARQPEAAGS
FT                   IRTSLLLGAALAEATAIYGLVVALVLVFLKM"
FT   sig_peptide     295946..296032
FT                   /locus_tag="Ccel_0267"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.899) with cleavage site probability 0.655 at
FT                   residue 29"
FT   gene            296368..296853
FT                   /locus_tag="Ccel_0268"
FT   CDS_pept        296368..296853
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0268"
FT                   /product="ATP synthase F0, B subunit"
FT                   /note="TIGRFAM: ATP synthase F0, B subunit; PFAM:
FT                   H+transporting two-sector ATPase B/B' subunit; KEGG:
FT                   cth:Cthe_2604 ATP synthase F0, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74655"
FT                   /db_xref="GOA:B8I575"
FT                   /db_xref="InterPro:IPR002146"
FT                   /db_xref="InterPro:IPR005864"
FT                   /db_xref="InterPro:IPR028987"
FT                   /db_xref="UniProtKB/TrEMBL:B8I575"
FT                   /inference="protein motif:TFAM:TIGR01144"
FT                   /protein_id="ACL74655.1"
FT                   /translation="MLKPDGYTFIFVALNLIILFLFMRKFLFKPVTNLMEERKSSIEQG
FT                   LKDADNAKLEATEARKKYDEQIKNIKLDGDKLLNEARARAAREYDEILASAKRDALAIV
FT                   EKGREEVERERAEMLKQVKQQIAVLAISAATKVVQQNMDSETNKSLVDKFIDEAGVA"
FT   gene            296853..297380
FT                   /locus_tag="Ccel_0269"
FT   CDS_pept        296853..297380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0269"
FT                   /product="ATP synthase F1, delta subunit"
FT                   /note="TIGRFAM: ATP synthase F1, delta subunit; PFAM:
FT                   H+transporting two-sector ATPase delta (OSCP) subunit;
FT                   KEGG: cth:Cthe_2605 ATP synthase F1, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74656"
FT                   /db_xref="GOA:B8I576"
FT                   /db_xref="InterPro:IPR000711"
FT                   /db_xref="InterPro:IPR026015"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I576"
FT                   /inference="protein motif:TFAM:TIGR01145"
FT                   /protein_id="ACL74656.1"
FT                   /translation="MPLVEKRYAQALLELSGSDINSIKEEFGDFTNLYNSDKDFRDFLN
FT                   NPVVKTDKKQALIRSVFTDRLSKNMLNMILLLVSKHRTAEIPGIFNQFIQMANETANVL
FT                   DMKIIMAAPMDEVQLETLREKFKKKYNAVAVNSTEIVDESLIGGLKVIIGDKVYDGSVK
FT                   GRIESLTEIVSV"
FT   gene            297404..298921
FT                   /locus_tag="Ccel_0270"
FT   CDS_pept        297404..298921
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0270"
FT                   /product="ATP synthase F1, alpha subunit"
FT                   /note="TIGRFAM: ATP synthase F1, alpha subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; ATP synthase F1 alpha subunit; KEGG:
FT                   cth:Cthe_2606 ATP synthase F1, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74657"
FT                   /db_xref="GOA:B8I577"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR000793"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005294"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR023366"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033732"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="InterPro:IPR038376"
FT                   /db_xref="UniProtKB/TrEMBL:B8I577"
FT                   /inference="protein motif:TFAM:TIGR00962"
FT                   /protein_id="ACL74657.1"
FT                   /translation="MRNMSLRPEEISSIIKQQIENYDTAVKTDDVGYVLQSGDNIARIY
FT                   GLKSCMSGELLQFENNVFGMALNLEEDNVGCVVLGDDRGIKEGSTVKRTGKTVQVPVGQ
FT                   SLVGRVVSPLGKPLDGKGDIAVEEYRPVDFTAPGVVDRKSVNKPLQTGIMALDALIPIG
FT                   RGQRELIIGDRQTGKTAIAVDTIINQKGKDVICVYVAIGQKASTITGIVNTLEKFGAME
FT                   YSIVVSSTASDPSSVQYLAPYAGCAMAEDFMYRYHKDVLIIYDDLSKHAVAYRAMSLLL
FT                   KRPPGREAYPGDVFYLHSRLLERAAKLSDELGGGSITALPIIETLAGDVSAYIPTNVIS
FT                   ITDGQIYLESELFHSGQRPAVNVGLSVSRVGGSAQIKAMRKIAGPLRINLAQYRELEAF
FT                   AQFGSDLDKSTRDKLTQGERLVETLKQPLNATLPVEEQVLILYGATNNYLMDLPVNKVG
FT                   KFNRELVAYVKQRYPKILTSIAETGDISDEVSKLMKTAADEFKTQFV"
FT   gene            299020..299904
FT                   /locus_tag="Ccel_0271"
FT   CDS_pept        299020..299904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0271"
FT                   /product="ATP synthase F1, gamma subunit"
FT                   /note="TIGRFAM: ATP synthase F1, gamma subunit; PFAM:
FT                   H+transporting two-sector ATPase gamma subunit; KEGG:
FT                   cth:Cthe_2607 F0F1 ATP synthase subunit gamma"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74658"
FT                   /db_xref="GOA:B8I578"
FT                   /db_xref="InterPro:IPR000131"
FT                   /db_xref="InterPro:IPR023632"
FT                   /db_xref="InterPro:IPR035968"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I578"
FT                   /inference="protein motif:TFAM:TIGR01146"
FT                   /protein_id="ACL74658.1"
FT                   /translation="MANNMREIKSRIKSINQMRQITKAMKLISASKLKKARAQLEETLP
FT                   YYNKVKETIADILAHSAEVESRFFDIREEKEGKKKAYIVMAGDKGLAGGYNSNIFKLTE
FT                   HEIGDNKENALLLVAGTTGRSYFSRKEYHVHTEFDYAVQNPTVFRAREITEIILDLYNK
FT                   QEVDEVYIVYTQMISAISLEPRILKLLPIEISALREDVKADEIVLDQRLKYEPSVTEVL
FT                   NVLIPKYIKGIMYGTFVEAFTSEQNARMTAMDNATKNADEMLQKLNLYYNRARQATITQ
FT                   EISEIVGGASALE"
FT   gene            299963..301360
FT                   /locus_tag="Ccel_0272"
FT   CDS_pept        299963..301360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0272"
FT                   /product="ATP synthase F1, beta subunit"
FT                   /note="KEGG: cth:Cthe_2608 F0F1 ATP synthase subunit beta;
FT                   TIGRFAM: ATP synthase F1, beta subunit; PFAM:
FT                   H+transporting two-sector ATPase alpha/beta subunit central
FT                   region; H+transporting two-sector ATPase alpha/beta subunit
FT                   domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74659"
FT                   /db_xref="GOA:B8I579"
FT                   /db_xref="InterPro:IPR000194"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004100"
FT                   /db_xref="InterPro:IPR005722"
FT                   /db_xref="InterPro:IPR020003"
FT                   /db_xref="InterPro:IPR024034"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036121"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I579"
FT                   /inference="protein motif:TFAM:TIGR01039"
FT                   /protein_id="ACL74659.1"
FT                   /translation="MAGSSGVIVQVIGPVLDIRFENGILPDIYNAIKIPADSGTVTAEV
FT                   MQHLGNDTVRCVAMSSTDGLVRGMKAEDTGDAITVPVGKEVLGRIFNVLGEPVDKAGPV
FT                   EPTAYLPIHREAPSLEEQRPSTEILETGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIM
FT                   ELIRNIATEHGGYSIFTGVGERTREGNDLWHDMNDSGVIEKTAMVFGQMNEPPGARMRV
FT                   GLTGLTMAEYFRDQMGQDVLLFIDNIFRFVQAGSEVSALLGRIPSAVGYQPTLATDVGA
FT                   LQERIASTNKGSITSVQAVYVPADDLTDPAPATTFAHLDATTVLSRDIVAMGIYPAVDP
FT                   LESTSRILDPKVVGEEHYTIARKVQEILQRNKELQDIIAILGMDELPEEDKLTVFRARK
FT                   IQRYLSQPFFVGEQFTGYKGKYVPIKETIRGFKEIIDGKMDNISEAAFYMKGTIEEVYE
FT                   AAKEMEG"
FT   gene            301416..301820
FT                   /locus_tag="Ccel_0273"
FT   CDS_pept        301416..301820
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0273"
FT                   /product="ATP synthase F1, epsilon subunit"
FT                   /note="TIGRFAM: ATP synthase F1, epsilon subunit; PFAM:
FT                   H+transporting two-sector ATPase delta/epsilon subunit;
FT                   KEGG: cth:Cthe_2609 ATP synthase F1, epsilon subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74660"
FT                   /db_xref="GOA:B8I580"
FT                   /db_xref="InterPro:IPR001469"
FT                   /db_xref="InterPro:IPR020546"
FT                   /db_xref="InterPro:IPR020547"
FT                   /db_xref="InterPro:IPR036771"
FT                   /db_xref="InterPro:IPR036794"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I580"
FT                   /inference="protein motif:TFAM:TIGR01216"
FT                   /protein_id="ACL74660.1"
FT                   /translation="MATFFLEVLTPDRKFFSGEAECVIFKSSDGEMGVLAKHAPTVSAV
FT                   SVGPLRINAQGKWIEAVVTEGFAKIMPDKVVILTDTAEYPEEIDINRAKAAKQRAEERL
FT                   QKKLSQLEYMRSKTALARAMARLSATNRRR"
FT   gene            301963..304302
FT                   /locus_tag="Ccel_0274"
FT   CDS_pept        301963..304302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0274"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; Fibronectin type III
FT                   domain protein; KEGG: cth:Cthe_2454 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74661"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B8I581"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACL74661.1"
FT                   /translation="MISKKGKKIKHISKLAIMLVIAILTQSLVTFSTAAGTVKSNITAL
FT                   IHNTYLVTLNWNDYLTNEINYYLERSVDGGIFSMVSFSAANLTTFTDSSVQPGHIYTYR
FT                   VKVLDSSYTTYVYTDEISIRTDELIKLDSLTATAVSSNQIDLKWTYPEGKIGNTIIERK
FT                   MEGSTSWSEVARITAGQNTYSDKSIVSGTKYYYKVRSYSSENIKSAAYPDEYVGSSAVS
FT                   LLLKPSNLSGFALSGYKIQLKWQDVAFETAYIIERRASNEGAFTEVAVVPQNTTRYIDN
FT                   VAHENSVYSYRIKALTGVTDSEYSDILNVASTYLKPPSWLTAVSVDGEKINLSWQDLTT
FT                   NETGFEIWRKTVSETDYTLYDTMGRNANSYTDLNVSPQTNYYYKVRAKINDNEVYSDFS
FT                   NETSALTTSLSAPANLSFNVINKTEVELTWDDTSSMEAGFIVEKKIGLLSQWYQISQLE
FT                   PNTTKFNDKWISSTETTFYRIKAFDRSTAVSYSNEVQLSLDAPEAPSNLQVSVMSTNDA
FT                   KLTWKDNASTEEGFIIEAKQLYFYREIGRVDSNVTTFIYHDAIPGKTMRYRVRAVKGLV
FT                   QSNPSNEVAAATFTNTSYTDLSSVSWAVEAINNLASRNVFNSNSGKFGPKQTISKGEYC
FT                   AILVKSLGLEKTVAGRFNDVTAKHKYYKEIMASEYFGIISKDKNNKIYPDKLITREQAA
FT                   VMLALALKIKGTPLPEKDSSSLKQFSDFKSISDSSLRNISAVCGAGIISGRKINDKVYL
FT                   QPSNNVTRAEAVLMAYKGLIYNQGNQ"
FT   sig_peptide     301963..302067
FT                   /locus_tag="Ccel_0274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.643 at
FT                   residue 35"
FT   gene            304322..306814
FT                   /locus_tag="Ccel_0275"
FT   CDS_pept        304322..306814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0275"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: drm:Dred_2357
FT                   S-layer domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74662"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003343"
FT                   /db_xref="InterPro:IPR008964"
FT                   /db_xref="InterPro:IPR034650"
FT                   /db_xref="InterPro:IPR038480"
FT                   /db_xref="InterPro:IPR040751"
FT                   /db_xref="UniProtKB/TrEMBL:B8I582"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACL74662.1"
FT                   /translation="MKRYAKKISLMLAVVCFLVIPLSAFAATGTSYSNYTASLLSKWKG
FT                   YGVVDKSYSSLDLNKPIEKIDFIKMLNAILKTSKKADINFTDVHKNSWYGQEIAKAAAC
FT                   GYISNKENTKFYPFSNITRVEAAEMVSYVFGLELKNEKILSKIADGKALEKKQLNELAA
FT                   VIEKGGLTEVASGRYAPTGVLKLKDALIMLDKCVGQIALKSGTIKTNAAGNMFISVGAV
FT                   TLRGISISGDLIIGEGVGDGVVTLESVKLAGRLIIRGGGPNGVIIKNSQIGGNLIVEKS
FT                   AGNVYIRVVGSTTIKQAYLKSGCTIEEGYLTSGDGFVNITALNAAFDGQNAILKGDFKS
FT                   LTADNSNINLKLSGNAENVSLNKDSQGIFSLLSGTVKTVSAGVTKQQLEFLGGKVTTMN
FT                   ISKDAKGNKITINGPVEINTVNIESTTEISFKKGTVNSLILDTNSQGSYISMQSGSFIR
FT                   SFVIMADAEITGYGKIESAYSYANNVKMGITPSFYSYKYVPGWGNDDYLPSIGIGVPGA
FT                   TNDEITIQEGKSIDLYRDLNLSVSPDKSTVGFVSLNGNVATVSDKGLITAIEAGYTKIY
FT                   ITGQYSGYSNCIKRIDVNVTPGNVTLPGRLEISPVTGEAATVKDFEITYTSKDDFSNGT
FT                   VTFWLPDGFPAFETDTVKIGNGTEVTLNPSQRLNVRTLSFTNLNLSKGQKIIVKLRNKT
FT                   VPQGGEYVFSAVTDADGTGPKVPTSGQDERTVFTSDKLKTLLEVTNYTLSAYDAQNGAV
FT                   SFTKLSFAGFTGATKWLIAVQDGEFTHPGYDDLVSGTEYTVGSAITIAPNQHLMLAAVD
FT                   GDSMAGYKVKAFVDITVH"
FT   sig_peptide     304322..304402
FT                   /locus_tag="Ccel_0275"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 27"
FT   gene            307041..311933
FT                   /locus_tag="Ccel_0276"
FT   CDS_pept        307041..311933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0276"
FT                   /product="fibronectin, type III"
FT                   /note="KEGG: cth:Cthe_2611 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74663"
FT                   /db_xref="UniProtKB/TrEMBL:B8I583"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2611"
FT                   /protein_id="ACL74663.1"
FT                   /translation="MKTKLRFVSVMLVLSLILSNFSGIIQPVFAAPDVLNFSINQSTFD
FT                   ENAGTVRASWNGQLNVTGTITYEAPTALGNKTVSINVTAGIGTVLLTDIKKDYIYDIKV
FT                   SLTNPSSSYVAQKFYLAGISVYAEQIRQQYVDHPGGGRETGVYPAMKLSWKLPLIHDGV
FT                   NAFVPAKGSILSKIAPAIDRINYKFHMETSKTKPNLADVIVNMKDDGSGYTAMVSGDTT
FT                   RVSEVKWDNAQSEYSLYLFGVKDDETSIPTIQQLKDGTATIPTGIPAADVAYVLPHQEI
FT                   RPGCIYVVTMDALVCDQNGQYVSKALSGATTSPLTGIVNYTYTPVRFQLTKDSMDNILI
FT                   RINTVNLGDVSMPELSYFVQTSNVDSDDDSDWKNIKEITNISGEYTITNLQGINPKNTV
FT                   YYRIVVKSASVDDTIMSLSMPYRMLDDTSKTPVPKNVSVIGVNLSDTIPSETERTSDIK
FT                   IVWDKPANWDDTKDDDVYYHFMLSTGQKDLDPAVKYPLTANGKDYGNGNYAVKYRLVQY
FT                   VSTKSGLIKENANDNTKLEYTIKGLDLFKGFEGDGTVTPINNPDAYPEYLLPNKTYYLQ
FT                   VYTTLPADKGNTDDSSRMSEKSLTTSFTTLSLTSRDVPTPNNFQLVNTKVNTATAATPA
FT                   NAVITLRFEDLKIDWSKYTSNHSIADDAVIYDLYMSKQPDLNTFKLIGSSNQPDSDVEF
FT                   RPVISGDTTWINTIINEFSDISNINSFGYYLSPNTIYYFMVKVRLNLENEVPKIRESTQ
FT                   TNLLSVTTPRGEPTKPNDNAKKPVAPSDFAIALDKNGNPMVSGHSVTFEWTVKENEASY
FT                   NLISTAKKVALDTPDTDPSILEDSTYISYIAAFGDKDRNIDGNSKKLTLDPKASPLPPN
FT                   LVYDSKTKKCRYTINTWLYPNRVYYFSLRSEVVEANKSKSSVWISIPVTTSLIESPTRL
FT                   QTISDCELSFYWFDTNPQTTSDSYSIKIKAAGDKYYTQLTKAQYNIVKDGSVYYGRLYK
FT                   LKSNTQYNIQVVRTIDNAVLSNTTQSTRNDHYQIEVKWQGIAVDDYSGYEIAIKTEDDT
FT                   DYTVLSNSDLEQYIDVTRHTYPYYIEKTFSNIGTEYYTYTARIKYAEVTLPSGAKEHKP
FT                   LKPNTKYYIKVRAYKKDPSNLEAITRSKYIGPVNTRTEFNQGDYDDDDNNTSITSKFLD
FT                   MLNKLEQELFWNVNKGSSSTMEKFYVKDDKVVNLLEGPGYYSCTIDISQTPAYINTNEV
FT                   YMAKNILSAMKTYNKSVVIKTKDVEYTIRPDTFDINNMEEFKKAKAAAGAKDVYLKLDN
FT                   IKTGEVQPKAPANTTTVSKVDIITAQAVVSRETSENIQKMIKDKLYNEDTGIIKKKIDV
FT                   IKNPNNPNTKGNGTNIDKYLNQLLEEIKSELSYFINDTLNGANYSYGLFTEKYDIAEYN
FT                   SPMSVKMSYKGNTIANPYVLYGNAGNWHKLTQNLKYDTGYVTFFVASPGKYTVFAGKDV
FT                   TSTIGDESPAKPYITKLAGKYDLTFVFSGAGESYNPNLSVSVKEAIMLYELVSDLQVDS
FT                   TTDIKIKAKNYGLDKIINVSNVNRNITRQETAALIVMLYCQRTGADYSRLKASYNKIIR
FT                   DDAAIGTKYAVPVYACLNMNIMTLDTGAKFNPGMSINRKDIAVAFEKMLEA"
FT   sig_peptide     307041..307133
FT                   /locus_tag="Ccel_0276"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 31"
FT   gene            311987..315943
FT                   /locus_tag="Ccel_0277"
FT   CDS_pept        311987..315943
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0277"
FT                   /product="Fibronectin type III domain protein"
FT                   /note="PFAM: Fibronectin type III domain protein; KEGG:
FT                   cth:Cthe_2612 fibronectin, type III"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74664"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR003961"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR036116"
FT                   /db_xref="UniProtKB/TrEMBL:B8I584"
FT                   /inference="protein motif:PFAM:PF00041"
FT                   /protein_id="ACL74664.1"
FT                   /translation="MKTKRIFAALILLIFFITTYGTVYAAPIDVPIPAAPTQLVIPKII
FT                   PSTEPSIGYDSADGGKSGYYADIQWQVPNPMGKFVNIYLQESPKEYRTARPTYLKEKDL
FT                   PAGTTPIRMRDLTSGTVYTASSKAYATDVDPVTGQVYKSGESDSSNLVKFMTDINIQCI
FT                   TSGTNKIKIIWDDVWNDGKRINYQLYVSENRDFANTLPITVTQEQISKSGPVYVNQSDG
FT                   TLEYEHTVKDPGRVYYVKIVPVISDQSIIKTSQTKTILVSTYILVKTSRVSTTDDGTIW
FT                   RLDWSPVITGLSSSNITVQYQINRFEADNMPKIIMVETGTTTFITVPEGQENSYMIRAI
FT                   VKKDGLPYYPSNIDIVSDKVTLKESDVPATPSAPELVSQFKDSTDSVIIAYEDVKDING
FT                   VVIKKGELGKDTATILWRLPKKADGTIDSDVMYDLWLLEDSNLIDDPPVETKIQTNLKP
FT                   GTPNFVKDESNNGKVIGYKYKIENLQPNHTYYFRIAAKKTFAEEKEGIIQNVEHISTPA
FT                   LKVIVTLPGGFIDTPLIPSNPPLQIRKQEDGIKDMITDTSVTIQLKNRWFERFDPNTGI
FT                   WSYIQADKTSMSDTPPYNPQTTPPDNQNYRKVEYDPGVTLYVGCTEYTSGIDISAINTY
FT                   KLEKVSTTPNDDLEDMYLNVPENVPVPASGTPVYAKHNVVVPVKNLKPNTTYILWVRAS
FT                   RDGNPPLFSDISNPIIFTTLPTPSDTIEKPVVPDLRSTNVSDTFADLAWNYKEQNTYYI
FT                   KYGTVDDITKAQGSLTVTGAQIKNSGLDYVRITGLTADTQYYFWIQAEAFNSSLSASEK
FT                   SEWSDSLPLRTLKLMPPSTPRGFGVKNTADAVTKNSITFEWIQEPGLTYILEIAGKIDY
FT                   SDAKVYECGSVTEFKVEGLTSNFRYYARLYAYDPNKKLRSLPTQSISVRTLRSSDDYDS
FT                   DQDVDHPITGDVIEKAPTIVNGTWVVKITGVNADRLVQIMMTDNILDYTVDISKPPAPA
FT                   TNISLMISKKVFDKLDQLKENIAFKTAVVTYNLKAGILSNVNTADTKKEQIYTFNIALA
FT                   PQKPSARANELILRQPLAQMGVTLDTGASIMTISGFDRPLIISYPYTNSKDYVEGQTLG
FT                   YRYNGVTSSWEQKATSNRFDVDNRKGTISFQSAVPGLFALADRTNNLFDDIYGHIYEDA
FT                   ILNVAMAHKLKSITSRMFNPDKAATAGEAVKLAFDSLEYSYGSNYMDLAAKTGLAKVGK
FT                   TASAVLTRQDAACLAAVLYEMKTNTRVNGNKDVISTYKDYSKIDKTLLNKVAFAAENGF
FT                   LPYQSSTLFNPTQSVTRGELMYMLEKALVLAGDI"
FT   sig_peptide     311987..312064
FT                   /locus_tag="Ccel_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.999 at
FT                   residue 26"
FT   gene            316018..316866
FT                   /locus_tag="Ccel_0278"
FT   CDS_pept        316018..316866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0278"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: cth:Cthe_2613
FT                   S-layer-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74665"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B8I585"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACL74665.1"
FT                   /translation="MKKSITRHISILLATIVLLTIGVQDVQAHGVTVTTQKIEGKYRIT
FT                   LASQESGLGVNILAFSISNGKTINVAYTLKKGAAASASTEIDESIVLAPFRVITTNSDN
FT                   INKRPFSDIANTEFDEYIRHLHDVGITSGFSDGTFRPGNTLSRAEAAAMLSVALNLKPD
FT                   DSPNTKLKDVNGHWGKKYINAILNKGIMTGYSDKTFRPNNKITVAEVCTIISKSFSFKT
FT                   KSQGIFGKLKKNQWYSAYVQNVFNLKILTIEDSIYKNFTENGNISRGNFAMMLSRALST
FT                   F"
FT   sig_peptide     316018..316104
FT                   /locus_tag="Ccel_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.969 at
FT                   residue 29"
FT   gene            317002..317754
FT                   /locus_tag="Ccel_0279"
FT   CDS_pept        317002..317754
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0279"
FT                   /product="Protein of unknown function DUF1779"
FT                   /note="PFAM: Protein of unknown function DUF1779; KEGG:
FT                   cth:Cthe_2614 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74666"
FT                   /db_xref="InterPro:IPR014794"
FT                   /db_xref="InterPro:IPR036209"
FT                   /db_xref="UniProtKB/TrEMBL:B8I586"
FT                   /inference="protein motif:PFAM:PF08680"
FT                   /protein_id="ACL74666.1"
FT                   /translation="MRKFSFVLLSILLIIAILGTAFYILGKDNPDGRQISIKDAFNYSG
FT                   AKMIVNDLYFFARASDDYNTVSELSKVCEDVFKTLEISQYSKNTNSSDNLAKKEMHGTT
FT                   ADGVKVSAMASIVGNKSGNRDKYITIDATEAGDGKALLLREKIEGVFTKYRLKAEINSC
FT                   ITGTYEGDLSDNQLESICRKILNESSAKKIDSFRQQNEISVSAFSPLISDKLRVGGKNV
FT                   NLGIAFRYNKLENRTYLWVATPVVNAEY"
FT   sig_peptide     317002..317082
FT                   /locus_tag="Ccel_0279"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            317817..319079
FT                   /locus_tag="Ccel_0280"
FT   CDS_pept        317817..319079
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0280"
FT                   /product="UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /note="TIGRFAM: UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase; PFAM: EPSP synthase
FT                   (3-phosphoshikimate 1-carboxyvinyltransferase); KEGG:
FT                   cth:Cthe_2615 UDP-N-acetylglucosamine
FT                   1-carboxyvinyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74667"
FT                   /db_xref="GOA:B8I587"
FT                   /db_xref="InterPro:IPR001986"
FT                   /db_xref="InterPro:IPR005750"
FT                   /db_xref="InterPro:IPR013792"
FT                   /db_xref="InterPro:IPR036968"
FT                   /db_xref="UniProtKB/TrEMBL:B8I587"
FT                   /inference="protein motif:TFAM:TIGR01072"
FT                   /protein_id="ACL74667.1"
FT                   /translation="MAKYVISEGVPLRGSVRVDGAKNAVLPIIAASLLSESKSIIEEVP
FT                   DLNDVRIMCDLLRCLGTDVQKQSDPTTISFETKEITNSTAPYELVNKLRASFLVMGPML
FT                   ARTGYVRVALPGGCPIGSRPVDLHLKGFSALGAEITQGHGYIEARKNKKLVGNKIYLDF
FT                   PSVGATENIMMAAVMAEGQTIIENAANEPEIVDLASYLNEMGAIVVGAGTDTIRIEGVT
FT                   SMKGCTHTVIPDRIEAGTFMIAAAITNGEVRIENVVPDHLKPVVAKLKETGLEISEELS
FT                   AITVKSIGGLKPIDVKTLPYPGFPTDMQAQVTSMLSCIPGTSMVIETIFENRFMHISEL
FT                   KRMGANIKIDGRTAVIEGKPCLTGACVKATDLRAGAALVLAGLAAEGATEISEIQHIDR
FT                   GYSGFAEKLKSLGAKITRVED"
FT   gene            319266..320291
FT                   /locus_tag="Ccel_0281"
FT   CDS_pept        319266..320291
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0281"
FT                   /product="stage II sporulation protein D"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; stage II
FT                   sporulation protein D; PFAM: Stage II sporulation D domain
FT                   protein; KEGG: cth:Cthe_2616 SpoIID/LytB domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74668"
FT                   /db_xref="GOA:B8I588"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="InterPro:IPR014225"
FT                   /db_xref="UniProtKB/TrEMBL:B8I588"
FT                   /inference="protein motif:TFAM:TIGR02870"
FT                   /protein_id="ACL74668.1"
FT                   /translation="MKKVITYILLMAFIVVLVPFMVVQFNGKEVGPVQIQDKEKSNVTP
FT                   KQETAITINVYMHTQKKTVKMYLEDYIKGVLAAEMPAEFEIEALKAQAVAARTYALGRA
FT                   VKLYGSVGVHDDADVCTDSRHCQAWKSKEQAMENWGLLSSFKYWNKITRAVNETQGQVI
FT                   EYNKVLINPLFHSNSGGYTENVEDVWDGTSEPYLRGVKSVGEDEFREYKSVIELLESDM
FT                   IKILKKNNPKIQIKGNNLFANIKINGYSSGNRVLSMDIGNVKVKGTDFRKMFNLKSTNF
FT                   KLKKLAGGKISITTYGYGHGVGMSQCGANYLAQQGSHYKEILKYYYKGVEITRLDSSQK
FT                   K"
FT   sig_peptide     319266..319340
FT                   /locus_tag="Ccel_0281"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.729) with cleavage site probability 0.620 at
FT                   residue 25"
FT   gene            320377..321168
FT                   /locus_tag="Ccel_0282"
FT   CDS_pept        320377..321168
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0282"
FT                   /product="Peptidase M23"
FT                   /note="PFAM: Peptidase M23; KEGG: cth:Cthe_2617 peptidase
FT                   M23B"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74669"
FT                   /db_xref="GOA:B8I589"
FT                   /db_xref="InterPro:IPR011055"
FT                   /db_xref="InterPro:IPR016047"
FT                   /db_xref="UniProtKB/TrEMBL:B8I589"
FT                   /inference="protein motif:PFAM:PF01551"
FT                   /protein_id="ACL74669.1"
FT                   /translation="MKKLIPDENNWKNKLSKFFSSKGFYVVLAVCIIVVAATAILLTTQ
FT                   NMKDTGKIIPGEAANASQDEATKAVSGKLDKTKAANNNTQSAASETAKSTPTPPKSGES
FT                   KSSKSASANAVIKFSCRPVDGPIMKDFTRDINTFSESKTLGDIRAHDGIDFKVEKLTKV
FT                   RAVASGTISKVEDNTNGITVEITHSNNLKTRYAGLSKQNLEDISCGLKVKANDIIGLVG
FT                   DPIQIECEDGPHLHFQVLKNGKSVDPSPYLSVPSTADKQGK"
FT   sig_peptide     320377..320496
FT                   /locus_tag="Ccel_0282"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.959) with cleavage site probability 0.437 at
FT                   residue 40"
FT   gene            321360..322490
FT                   /locus_tag="Ccel_0283"
FT   CDS_pept        321360..322490
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0283"
FT                   /product="D-alanine/D-alanine ligase"
FT                   /note="TIGRFAM: D-alanine/D-alanine ligase; PFAM:
FT                   ATP-dependent carboxylate-amine ligase domain protein
FT                   ATP-grasp; protein of unknown function DUF201;
FT                   D-alanine--D-alanine ligase domain protein; KEGG:
FT                   cth:Cthe_1938 D-alanine--D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74670"
FT                   /db_xref="GOA:B8I590"
FT                   /db_xref="InterPro:IPR000291"
FT                   /db_xref="InterPro:IPR005905"
FT                   /db_xref="InterPro:IPR011095"
FT                   /db_xref="InterPro:IPR011127"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I590"
FT                   /inference="protein motif:TFAM:TIGR01205"
FT                   /protein_id="ACL74670.1"
FT                   /translation="MSKKRVAIIFGGQSSEHEVSRVSAQSVIENIDKQKYDVEIIGITK
FT                   SGQWLKYDGPVEKIGNGDWEAIAQKKPVESLSQAGISSSGITTVNSVRQIMPGNVKAPI
FT                   DVIFPVLHGCNGEDGTIQGLFELAGIPYVGCGVLGSAVGMDKAYTKIIFEKEGLPQGDY
FT                   LVFNRKQVYNRIEDVVAQIEGRLTYPCFVKPSNAGSSVGVNKASDRESLVKALNIAAKN
FT                   DRRILVEEFINGREIECAVLGNDNPVASTVGEVVPCNDFYDYEAKYQVGDSSKVVIPAP
FT                   NLSKETVEKIREYAVRAFKCLDCAGLSRVDFFVHKETGEIYINEINTLPGFTQISMYPK
FT                   LWAASGIPYSELINKLIELAFERYEDTRREYTNTLD"
FT   gene            322562..323029
FT                   /locus_tag="Ccel_0284"
FT   CDS_pept        322562..323029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0284"
FT                   /product="Domain of unknown function DUF1934"
FT                   /note="PFAM: Domain of unknown function DUF1934; KEGG:
FT                   cth:Cthe_1936 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74671"
FT                   /db_xref="InterPro:IPR012674"
FT                   /db_xref="InterPro:IPR015231"
FT                   /db_xref="UniProtKB/TrEMBL:B8I591"
FT                   /inference="protein motif:PFAM:PF09148"
FT                   /protein_id="ACL74671.1"
FT                   /translation="MNKDVIINVKGVQTGDENDPNTTELITEGKYYQKGGNYYITYKES
FT                   EVTGMEGTTTTLKVGEGIVTLIRFGKVNSQFVFQKGQKHVSSYNTEYGSFTVGVYANNV
FT                   DININETGGEIRIGYQIEIDNQGSGRNDFYMLIREAGTANEKYKLGNTSAN"
FT   gene            322992..324686
FT                   /locus_tag="Ccel_0285"
FT   CDS_pept        322992..324686
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0285"
FT                   /product="arginyl-tRNA synthetase"
FT                   /note="TIGRFAM: arginyl-tRNA synthetase; KEGG:
FT                   cth:Cthe_1935 arginyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74672"
FT                   /db_xref="GOA:B8I592"
FT                   /db_xref="InterPro:IPR001278"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR005148"
FT                   /db_xref="InterPro:IPR008909"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR035684"
FT                   /db_xref="InterPro:IPR036695"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I592"
FT                   /inference="protein motif:TFAM:TIGR00456"
FT                   /protein_id="ACL74672.1"
FT                   /translation="MKNINSEIRQQIRNAVINSINKSVETGELPSLEVTDITIEIPREK
FT                   GHGDFSTNVAMQITKAAKKAPRQIADIIIKNIVTDGTYIDKVTCAGPGFINFTLDNSYL
FT                   YETVNIIQQEKENYGRINIGNGKKVMVEFVSANPTGPLHMGNARGGALGDCIASVLDAA
FT                   GYNVTREFLINDAGNQIEKFGTSLEARYIQLIKGEDAIEFPEDGYQGEDITEHMKDFIA
FT                   IHGDKYINTDSEERKKVFVDFALPRNIARIKEGLESYGIHFDIWFSEQSLHKSGEVAET
FT                   IQLLKDRGCTVEKEGALWLKGSVIGSEKDEVLVRNNGIPTYFAADIAYHRNKFEKRGFE
FT                   WVINLWGADHHGHVARMKAAMAALGINPDKLDVVLFQLVRLYRNGEIARMSKRTGKSIS
FT                   LMDLVEEVGRDGVRYFFNTKASGSHLDFDLDLAVKQSNENPVFYVQYAHARICSMFKLL
FT                   ESEGIKVPSANAIKAELLDKPEELELIRKLSEYPDEVRISAETLEPSRLTRYVHDVAST
FT                   FHSFYNACRVRGEEEELMQARLVLVDCTRIVVKNVLDLLSITAPERM"
FT   gene            complement(324732..325658)
FT                   /locus_tag="Ccel_0286"
FT   CDS_pept        complement(324732..325658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0286"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: cellulosome protein dockerin type I;
FT                   polysaccharide deacetylase; KEGG: cth:Cthe_2972 glycoside
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74673"
FT                   /db_xref="GOA:B8I593"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:B8I593"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACL74673.1"
FT                   /translation="MFNLRKALKGLLAVSLIAASVLVMSPVSKAADTVKYGDVNNDGVV
FT                   DSIDYATVKSYLLGKGTIANLTAADTNFDKAVDAIDFANLKKFLLGTITLPVGTPPITG
FT                   KVVALTFDDGPDVTLTPKVLDKLDKYRVPATFMMIGQKINDSTAPVIKRIISSGSEIGN
FT                   HSWAYDSMSGMSYSAIKKSVDDTTAAIVKYSGTTPKFFRAPNLATGGSMFDAIDLTFAG
FT                   GVTCNDWVQSTTAQQRADAIIAGTRDGAILLMHDVQPLPHPTPEALDIIIPKLQSQGYT
FT                   FVTLSDLFKIKGVTLSPTDSKIYTYVP"
FT   sig_peptide     complement(325566..325658)
FT                   /locus_tag="Ccel_0286"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.984 at
FT                   residue 31"
FT   gene            complement(325968..327662)
FT                   /locus_tag="Ccel_0287"
FT   CDS_pept        complement(325968..327662)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0287"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cbh:CLC_2681
FT                   methyl-accepting chemotaxis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74674"
FT                   /db_xref="GOA:B8I594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="InterPro:IPR004090"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR033463"
FT                   /db_xref="UniProtKB/TrEMBL:B8I594"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL74674.1"
FT                   /translation="MKIKTKLVLSFTSVLLLFTLSISLLIYFMVSSMVKNQYQYNIKSS
FT                   ASLSLAFLDERYPGEWKVVGGSLLKGDHVVNEDTQFVDNIKKSTGNLATIFMNDTRVST
FT                   NVLQENGQRAVGSKASKEVIDTVLKKGNDYQGVTLVAGKNSFTYYTPLRDGNNKIVGMW
FT                   FTGIDKSVVDNQIKDNLTKIGVVVLIILLIGATISYYIGNKMSKAIKKINDCLIKFSEG
FT                   DFSVSLPDSVLKISSEIGHMARCANTLQDSVKGIIRTIYNESNNIDESLGMSVVSISDL
FT                   NSSIEEISATTEELSAGMEQTAAAMQEMSATSSDIETAVENIARKAQETSFAAQDISKR
FT                   ADMLKISSKESKDYAYSIYESANSELTTAIEHAKSIEKIGVLSDSIMQITTQTNLLSLN
FT                   AAIEASRAGEAGKGFAVVADEIRKLAEDSKNAVSEIQGVTKEVFTAVENLVTSSKNILS
FT                   FIESTVISDYTNQTASSEQYSDDASRIDNLVMDFSSTSQELMVSIGNMLKAINEVTVSV
FT                   NESATGTTNIASRSSDIHIKGSQVVELSEASKKSSENLRKYVAGFKV"
FT   sig_peptide     complement(327558..327662)
FT                   /locus_tag="Ccel_0287"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.848 at
FT                   residue 35"
FT   gene            327909..330629
FT                   /locus_tag="Ccel_0288"
FT   CDS_pept        327909..330629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0288"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1932 S-layer-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74675"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B8I595"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74675.1"
FT                   /translation="MNLIKLKNVKGKKLISRAAAAILSMTLISQTLAVGAANEKIINSF
FT                   NAVPTGQAIINNLKYTDIAGLDNNSKNSIFQNGSLGIYISPGSKKFNPKGYITKEMALY
FT                   LIYTAANRVSEVDEQGQALNTDRPVKKTNPQDVLFDGSLQLAANDGLISETDLADAMQA
FT                   NQKTLGASDFKRNSPVQRQEFATWIAKALMIPPEPQQQELLNNFSDWKSCKPENVPYLE
FT                   AVLRAKVMNGNGSGKFLPQGMVTRQQAAAILKNAENIILPLRDLEQRNATVEGIQSGRD
FT                   SSNGSTTDYNTITIRNSDGLLDEITVTKSSRKPVSNTNELTGSATASYSSELPVFKNGK
FT                   ITGSSDLKAGDRIQYISGTEDKIVRYVRVLAKNEVAPEEVEKGLYAGIVEENNPQLGYI
FT                   TLYNEDGTGKTPLALSKIRTYNYADPNDIKAYKNHVEARLDDIEAGDTVFIRVDSNNLV
FT                   TSVSGVDNYTVRYGKIISKKLSSIIVEADKKQQTYNIDRANVIKDGKLVKYSQLKDGDS
FT                   VKLLINEAPNMTVLKEITVEGGDKLVSNVYKGTFDYYNSISNTIFMNDPWTLRNGQWVK
FT                   ETNGSKVIELGNGFTAYFDGQKRALKDLTLLKDNTVYIASEKDYGNDELAVVASFTDST
FT                   DKEVPYDDKVYITATNRFVLEKNFVNITYNPGTIVIKDGRLVQGSSVSTDDYAYVMANR
FT                   DNSGSNSTIVAGVVSIEQRPGTEAVQLYRGRISSIDEYKTVTLESYSRLNGTNWVYANT
FT                   PMTFNLSSNTRITDTDGIVGQGDFTDEKTQGTFSGRTVYILGDGTDAVEISTAPFGNFN
FT                   IQGIVSNTVGGTVAEDGTVIQEPQSIILKNCRYYNTSAHLWVSKGDSNFNILTNSLILK
FT                   NNKKINPSDLKKGDSIRVLKKDNAVIGDAYIVIVE"
FT   sig_peptide     327909..328019
FT                   /locus_tag="Ccel_0288"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.477 at
FT                   residue 37"
FT   gene            330655..332259
FT                   /locus_tag="Ccel_0289"
FT   CDS_pept        330655..332259
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0289"
FT                   /product="S-layer domain protein"
FT                   /note="PFAM: S-layer domain protein; KEGG: cth:Cthe_1931
FT                   S-layer-like domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74676"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="UniProtKB/TrEMBL:B8I596"
FT                   /inference="protein motif:PFAM:PF00395"
FT                   /protein_id="ACL74676.1"
FT                   /translation="MRNTFYQRNKKYSILTKTAGFVVSAALIIGMATPGTAYALRGDSG
FT                   YEGGISSGENPNVTVTLTTSKISYQYQEPFFLTGVPIVLTGTMTVNKKLNTDSKTGVQT
FT                   LTTTYDYNVPNSNNNSLVRKIVMTTTITPRDNGQKTETTKLTSASETLKLNGVSYYISK
FT                   SNPNDYMISKAITNDYQPAVSYFAGTLIGKKTYHVGSSTSPNTIVVDSTCNTVGYDEYW
FT                   STAETQIIKQTITSRKGGQAAIVLGNANIDISTTTTKQLKYYENQPEQISFEGGYYKTQ
FT                   YNENVLKYTANLKELDKNGVPTSKTVTYTRSLKLESFPFNDPLVAPNLKKIKGHPAEES
FT                   MAIMFGLEAYKNIDSFNPQEYMSRGEFIDAFSKVAPAVPLDPVFKPKTTKSSSRKKAPV
FT                   VLLFKDVPEKNKYFSSINDAANRGIVSTGGNFRPDAKITLAEAVTMMINSLGLKGLAPN
FT                   PSPVTRFKDNDKIPGYARAPMYVAEKIGLIQEDSRGYIYPTAKITKANAARIMKVYIEY
FT                   MNSGIRKEYMERIISYK"
FT   sig_peptide     330655..330774
FT                   /locus_tag="Ccel_0289"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.752 at
FT                   residue 40"
FT   gene            332286..333752
FT                   /locus_tag="Ccel_0290"
FT   CDS_pept        332286..333752
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0290"
FT                   /product="carboxyl-terminal protease"
FT                   /note="TIGRFAM: carboxyl-terminal protease; PFAM:
FT                   PDZ/DHR/GLGF domain protein; Peptidoglycan-binding domain 1
FT                   protein; peptidase S41; KEGG: cth:Cthe_1930
FT                   carboxyl-terminal protease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74677"
FT                   /db_xref="GOA:B8I597"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR004447"
FT                   /db_xref="InterPro:IPR005151"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B8I597"
FT                   /inference="protein motif:TFAM:TIGR00225"
FT                   /protein_id="ACL74677.1"
FT                   /translation="MNKFRRITVLFLVISISLMVFTSTAFSADSKTTDGEYLQSIIDLI
FT                   KQKYNGNITDDELLQGALKGMFNTLDQYSQYYTPEEFEEFYGSLEGAVEGVGISIEKID
FT                   NNLIVNKVFANSPAKKAGVLSGDRIVQVNGESVQGKELNEVVSKIKGMSGTKVKLGIMR
FT                   QGTKNLITLEMYRAQVDLPSVHYELRGNIGYIHIDSFSQNSSKGVSEALKYFDGKKVTR
FT                   IVLDLRNNPGGYLDQAIAIARYFVPKGIITTLDYKDTLLEDKIYYSDLEKVKYSLAVLV
FT                   NENTASAAEILTGAIKDTKAGVVIGSKTFGKAKVQESIPILTDEAFSKFNEGSEKKSAN
FT                   AYDFKSYMTDLSGWAKMTIGLYYTPNGNCIDLKGIEPEIKIKEPTPFGIHVNLLEPMSV
FT                   TVKPSLGTQYYDVLSAECVLKLLNYNIGTPDYILDANSVEAIKKFQKSNKLSSSGILDF
FT                   TTQKLLNKKIADIKLKQDKVYSRAISELMK"
FT   sig_peptide     332286..332369
FT                   /locus_tag="Ccel_0290"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.962 at
FT                   residue 28"
FT   gene            333929..335533
FT                   /locus_tag="Ccel_0291"
FT   CDS_pept        333929..335533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0291"
FT                   /product="CTP synthase"
FT                   /note="TIGRFAM: CTP synthase; PFAM: glutamine
FT                   amidotransferase class-I; CTP synthase-like; KEGG:
FT                   cth:Cthe_1923 CTP synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74678"
FT                   /db_xref="GOA:B8I598"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I598"
FT                   /inference="protein motif:TFAM:TIGR00337"
FT                   /protein_id="ACL74678.1"
FT                   /translation="MSVKYIFVTGGVVSGLGKGITAASLGRLLKARGVHVTIQKFDPYI
FT                   NVDPGTMSPYQHGEVFVTEDGAETDLDLGHYERFIDENLSKNSNITTGKIYWSVISKER
FT                   KGDYLGGTVQVIPHITNEIKDRIYRVGKSERTDVVITEIGGTVGDIESLPFLESIRQVS
FT                   NEVGRENVMYIHVTLVPYLGISGELKTKPTQHSVKELRSIGIQPDVIVCRTEKYLSQDM
FT                   KEKLSLFCNVPEGAVVQNLDAEVLYEVPLMLEKEGLAKIVCKRLGLECKEPDLDEWEEM
FT                   VRRQKNPKSSVTIGLVGKYVELHDAYLSVAESLRHGGIGNDVEVDIRWVNSEEIENGEV
FT                   NSFLQGVDGILVPGGFGDRGIEGKINAITFARENKIPFFGICLGMQMAVVEFARNVAGL
FT                   HDANSSEFGETPYPVIDLMPEQREVDEMGGTMRLGVYPCKINENTLIKGIFEDELIYER
FT                   HRHRYEFNNEFRDTFIKNGMTLSGLSPSGKLVETIELKDHPWFVGVQFHPEFKSRPNKP
FT                   HPLFKDFVRAAYEYKTK"
FT   gene            335773..336459
FT                   /locus_tag="Ccel_0292"
FT   CDS_pept        335773..336459
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0292"
FT                   /product="stage II sporulation protein R"
FT                   /note="TIGRFAM: stage II sporulation protein R; PFAM:
FT                   Sporulation stage II protein R; KEGG: cth:Cthe_1920 stage
FT                   II sporulation protein R"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74679"
FT                   /db_xref="GOA:B8I599"
FT                   /db_xref="InterPro:IPR014202"
FT                   /db_xref="UniProtKB/TrEMBL:B8I599"
FT                   /inference="protein motif:TFAM:TIGR02837"
FT                   /protein_id="ACL74679.1"
FT                   /translation="MNKSLSLKPTKILSVCITIAILIVFSLWMLSYTYAEDVNAGLSQN
FT                   LVRLHVIANSDSASDQALKLKVRDEIIEYMKEKLSDSRNIDQTKEIINQNLLNIENISK
FT                   EVIKKNSSNYSVKASLGNYSFPTKTYGDIALPAGKYQALRIVIGQGSGANWWCVLFPPL
FT                   CFIDATHGTIPDSVKQNLKTSLSDEEYKLITTSDEEIPVKIKFKLVEFLEGSKVKLSGV
FT                   INKMFN"
FT   sig_peptide     335773..335880
FT                   /locus_tag="Ccel_0292"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.997 at
FT                   residue 36"
FT   gene            336602..337297
FT                   /locus_tag="Ccel_0293"
FT   CDS_pept        336602..337297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0293"
FT                   /product="MgtC/SapB transporter"
FT                   /note="PFAM: MgtC/SapB transporter; KEGG: cth:Cthe_1919
FT                   MgtC/SapB transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74680"
FT                   /db_xref="GOA:B8I5A0"
FT                   /db_xref="InterPro:IPR003416"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A0"
FT                   /inference="protein motif:PFAM:PF02308"
FT                   /protein_id="ACL74680.1"
FT                   /translation="MLIINWFSSNSEFYLSMIIRLALACLLGGFIGFEREHVHRPAGFR
FT                   THILVCVGSALVMITSEYIYYHFSSHVNTDPARLGAQVISGIGFLGAGTIIKEGISVKG
FT                   LTTAASLWAVSCVGIAIGIGFYSGAFIATAFIFLTLVVAKKTQSRRTVKKSLRLYVHTQ
FT                   IKKGEVNKLSMIIQEMGAVIKKTDFISSERDGEMVIRFTLDSSMEVSIAEIIEAILCND
FT                   AVRRVYEEI"
FT   gene            337422..340148
FT                   /locus_tag="Ccel_0294"
FT   CDS_pept        337422..340148
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0294"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   cth:Cthe_1917 ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74681"
FT                   /db_xref="GOA:B8I5A1"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A1"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ACL74681.1"
FT                   /translation="MSVTESMLDFTNPDNLLSKGLTDKEARRKLEKHGPNLLSERKRIS
FT                   PIKILFEQFTDLMVIILMISTVISGFMGEMTEAITIIAIIVVNAIMGFVQEYRTERTME
FT                   ALKSLAAPYAKVIRNEQQASIPAEDIVPGDVIVLETGDRIAADAAILECNSLHIDESLL
FT                   TGESLPVEKHQLKNKNVLMDPFDKKSSVYMGTVVTGGRAKAVVYATGMKTEMGSIADMI
FT                   QNIEDDETPLQKRLGHLGKFIAVGCLIICAIVSFTGIIRGEKLFNMLLSGISLAVAAVP
FT                   EGLPAIVTISLALGVQRMLKRNALIRKLPAVETLGCASVICSDKTGTLTENKMTVRKMY
FT                   ASGYRLDITGNGYNLEGNFLVDNKPTDPVRVDGIRLALEIGALCNNSVISHPVPEHTTV
FT                   GKIKSIFSKQESFKISGDPTEIALTIAAAKAGINETYLKRSYKRIDEIPFDSERKCMSI
FT                   ICKNNCGELLVFTKGAPDVIIDKCSRILSSRGVIKLDELTRRSIIKLNDTMANDALRVI
FT                   GVAYRKLETGKYNPGKTNIENELIFVGLMGMIDPPRKEAVEAVRKCRLAGIKPVMITGD
FT                   HKLTATAIAKELNIYSMGDQVLTGRELDVMNEAQLEKIADSVSVYARVSPKHKLMIVRA
FT                   LKKTGHIVAMTGDGVNDAPAVKEADIGVSMGITGTDVTKEASSMILLDDNFATIIAAVE
FT                   EGRVIYNNIRKFIRYMLACNLGEVLTMFLGMLLWLPIPLMPIQILWVNLVTDGLPAIAL
FT                   GLDPPENDIMFRRPRGAHDSIFSHGLLKLIIARGIFIGLSTLGIFVTVMYFVNNVELAR
FT                   TAAFMTLVLTQLVHVFECKSETRNIFEIDIFNNMPLVLAIICSLAMILAVVYIPSLQGI
FT                   FETVPLGLNEWMLIAGFSLMGPVLSSLIGINRKNKYC"
FT   gene            340452..341399
FT                   /locus_tag="Ccel_0295"
FT   CDS_pept        340452..341399
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0295"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cth:Cthe_2706 ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74682"
FT                   /db_xref="GOA:B8I5A2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74682.1"
FT                   /translation="MIEIQNLTKSYGQIKAVDDISFTVEKGEVLGFLGPNGAGKSTTMN
FT                   IITGFIPSTEGTVKVNGFDIMESPAEVKRRIGYLPELPPLYMDMTVSEYLGFAADLKNV
FT                   SKKQKKSQMADIMELVKLTDVRGRLVKNLSKGYKQRVGLAQALMGNPEVLILDEPTVGL
FT                   DPKQIIEIRKLIKALGKQHTIILSSHILPEVSAVCERVVIINKGKIAAVDTPENLSKGM
FT                   GTVSKLSATIVGPKSSIIGFIQGIYGIKYVEPHVEKDTDVVEYIIESDKEIDVRRPLFF
FT                   AMAKAGYPIIELKSLDLTLEDIFLQITTQEKEVI"
FT   gene            341402..342106
FT                   /locus_tag="Ccel_0296"
FT   CDS_pept        341402..342106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0296"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: cth:Cthe_2707
FT                   ABC-type transport system involved in multi-copper enzyme
FT                   maturation, permease component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74683"
FT                   /db_xref="GOA:B8I5A3"
FT                   /db_xref="InterPro:IPR032688"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A3"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACL74683.1"
FT                   /translation="MFSIFKKEFKSYFTSATAYVIMGMFVLVSSILFYINLVSQTADFN
FT                   FNLSYMSIILIIIIPILTMKILADERKSGTEVMLITSPTSLTNIVVGKYLAAFCVFLIM
FT                   TAITFIYPIILAVLGEPAMSEIIGGYIGFILLGASFLAFGLFASSLTESQIIAAIVSVV
FT                   GLVLMWLLQGIAPALGGVTAKVLNWFSLFSRTEDFYAGILSLSPIVYYLSFSAIFVFIT
FT                   IRVIEKRRWSKG"
FT   sig_peptide     341402..341527
FT                   /locus_tag="Ccel_0296"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.749) with cleavage site probability 0.562 at
FT                   residue 42"
FT   gene            342103..343530
FT                   /locus_tag="Ccel_0297"
FT   CDS_pept        342103..343530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0297"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2708 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74684"
FT                   /db_xref="GOA:B8I5A4"
FT                   /db_xref="InterPro:IPR019196"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A4"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2708"
FT                   /protein_id="ACL74684.1"
FT                   /translation="MIKVGKFKFLNKRSLKYGTNSIVLIVVVVAIAIVINLLVGMGNFR
FT                   FDLTADKLYSLSDQSKDIVKKIKKDVTIYGLFDNATIPGGSEYREITNLINEYKGLGVK
FT                   VKYVDPDKDPGTITSLDPQKTMGLTKGDFVVKSGNKVRKLEAQELYGQANQQYGRMYSA
FT                   EPLITGAIKFVTSDVTPVAYFVEGHNEIPLTEDLNQVSKILQSNNLEVKSLSLLTEKKV
FT                   PDDCQLLVFVSPQKDLTDEEKIKLDAYIKKGGKAVFLFDSLESSEKLANFEDSLSYFNI
FT                   GINYDKVKENDSSKHLPNDNYALIASLENNDINKVFSGANYAVFMPDSRSINILKNQKD
FT                   WLTNTPLITTTDKAESNDIVGGKINKGPFNLAVAAEVSGGSKVLVFGNSKFLSDRALSS
FT                   QYGTYFQYGTNYFLTTVVNWMQDKTNEETISGKLVTAKALTVTESQTKVLSIVLIGVIP
FT                   LAILGCGLFVWSRRRHL"
FT   gene            343534..344952
FT                   /locus_tag="Ccel_0298"
FT   CDS_pept        343534..344952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0298"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2709 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74685"
FT                   /db_xref="GOA:B8I5A5"
FT                   /db_xref="InterPro:IPR025641"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A5"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2709"
FT                   /protein_id="ACL74685.1"
FT                   /translation="MKLYRNAIILVVVLGLLVGAYFFINNKKSGTTDPASQTTETAKSI
FT                   KVNEMDSEKISSIEYSSSQGQFTLKKKGETWVMDPAFELPLDKNTIDNTVSSLADMEAN
FT                   KVVAENADRLADFGLDKPSMVKVVLSDGSSKEIEVGSKSPTGEDVYVKLKGQPKVYTVG
FT                   GYYEDMLKPNRAHYASKQILPVEATTIKKFEYKKDGKIQYSVDIESESEMKLVAPIKEE
FT                   ADTTKFSQLIQTVVQLSIADIVEENPTDLTKYGLDKPAFEVTYGDGKTTKTILFGDKAD
FT                   KGESSSSKGGNIFYAKYPDTKVVFTVDVSQLTFLDVKLQDVISPFVYIPNINEVNKVEL
FT                   SIDGKTIISDIKTVEGKKEEDKFKVDGKDANMKDSSDRSLFKAFYQAMIGITFNKYQPD
FT                   LKPQGTPEITIKYYMKPDNKVVTVDYIPKDNNYYYAVKDGVYTNRIVLKDKFNEEEGVR
FT                   DTYKKLKDAIDKAK"
FT   gene            345019..346089
FT                   /locus_tag="Ccel_0299"
FT   CDS_pept        345019..346089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0299"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74686"
FT                   /db_xref="GOA:B8I5A6"
FT                   /db_xref="InterPro:IPR038728"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A6"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2710"
FT                   /protein_id="ACL74686.1"
FT                   /translation="MIKGEFSNILKVAFLYMATIIGAGFASGQEIIQFFSIYYKGGFLG
FT                   IILAGGLFSIVGYIVLSKVYTERIKSYDEFLFPMMGYFFGKIMEFVVMLFMACVMSVMT
FT                   AGLGNILMGLTGLQYRYCVIIGITVCLLAILTNIKGIVVLSSFISPVLIAGIIFVGCYI
FT                   LVSKDTSVFNISNKLGVITNNWAFSSILYVSYNTILSTVLLTGMLPYLKSKKVSAWGGL
FT                   LGGGMLGATALILNSALYFFYPHSITSEIPVLGIIQNNSQMLSKIYSGVLILAMFISTV
FT                   TSGYCLAERISKKMKVNYKLVAIIICAIAVPLTSLGFSNLISTLYPVFGYLGLFLLFVI
FT                   IFQYIRGIISSRYSRG"
FT   sig_peptide     345019..345105
FT                   /locus_tag="Ccel_0299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.953) with cleavage site probability 0.880 at
FT                   residue 29"
FT   gene            346181..347377
FT                   /locus_tag="Ccel_0300"
FT   CDS_pept        346181..347377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0300"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2711 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74687"
FT                   /db_xref="GOA:B8I5A7"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011044"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74687.1"
FT                   /translation="MNTNPKPESNVIKFKKSGIVSVISFLLLFIAIFATAFIVYLRSSG
FT                   YDFSTMSVKDAVAFLKDKENKKSTSSTEITFSQDGSIDCKLYANFIVILSQDSIKWYEP
FT                   NGKLLQENALTLARPALRISEKYMVVADISGRDIFFYKGKKQLWTKKLDSQIINVDIND
FT                   DGYCTVVTQSKEFKSAVQVIDVNGLEKFTKLCAEDIVVTAKTINNGDDVFINKLTTGGV
FT                   KTGTMLEFNNIYDEKPFASIDVADTIIPLVLTQGDNVVAVGQNLILYMDKQGKEVWRKN
FT                   ADSIFCVVPDIGKYMVVAGKFAGTGEAAGQKVLVLDKKGNEVYSFDQPENIIGMDIYGN
FT                   RLLLRTQRSVYLYSLKGKKLGQYSARNELKDAYLVGDNDAILVSGGSIETVKIDDSTT"
FT   sig_peptide     346181..346291
FT                   /locus_tag="Ccel_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.884 at
FT                   residue 37"
FT   gene            347399..348097
FT                   /locus_tag="Ccel_0301"
FT   CDS_pept        347399..348097
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0301"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_2712 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74688"
FT                   /db_xref="GOA:B8I5A8"
FT                   /db_xref="InterPro:IPR003825"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5A8"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2712"
FT                   /protein_id="ACL74688.1"
FT                   /translation="MNWADFTVLIIIAVFTFIGLKNGFLYSVFRLLSYILSVVFAVKFY
FT                   PVLSGILQKTALFDSVKMSVVKGLMKQQENTISNPGETAAQSVVEGLKLPDFLKDSILE
FT                   HIQNSNILDLTGIINAVGAEIASLVINILSLIIIYTLIRFGLIFAKVVIKTIARVPVFR
FT                   QLDKTGGIVLGAVEGIFAVYIICAVLVLFSAFPKFSSSIEDIEKSLFAGRFYENNFIVS
FT                   WISPDTFSQN"
FT   gene            348359..350017
FT                   /locus_tag="Ccel_0302"
FT   CDS_pept        348359..350017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0302"
FT                   /product="dihydroxy-acid dehydratase"
FT                   /note="TIGRFAM: dihydroxy-acid dehydratase; PFAM:
FT                   dihydroxy-acid and 6-phosphogluconate dehydratase; KEGG:
FT                   cth:Cthe_2713 dihydroxy-acid dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74689"
FT                   /db_xref="GOA:B8I5A9"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR004404"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5A9"
FT                   /inference="protein motif:TFAM:TIGR00110"
FT                   /protein_id="ACL74689.1"
FT                   /translation="MRSDIVKKGIEKAPHRSLFKAMGYTDEELERPLIGVANSKSEIIP
FT                   GHIHLDKLTEAVKAGIRMAGGTPIEFGAIGVCDGIAMGHTGMKYSLATRELIADSCEAM
FT                   SKAHSFDGMVFIPNCDKIVPGMLMAAARINIPSIVISGGPMLSLNRDGKQLDLNSLFEA
FT                   VGSYKAGTMTKEEVDDIEDHACPGCGSCSGMFTANSMNCLTEVLGMGLTGNGTIPAVYA
FT                   ERIRLAKYAGMKIMELVEKDIKPSDILTNEAFENALTVDMALGCSTNSVLHLPAIANEL
FT                   GIEINLDIINEISSRTPNLCKLAPAGKYHIQDLYSAGGVQAVMSELAKKDLLHLDLVTA
FT                   TGKTIRENIQNAKVKDYEIVKSIDTPYSATGGIAVLRGNIAPDGAVVKKSAVAEKMLIH
FT                   TGPARVFDSEDEAITAIYSGQINKGDVVIIRYEGPKGGPGMREMLSPTSAIAGMGLDSD
FT                   VALITDGRFSGASRGASIGHVSPEAMEGGPIALVQEGDIVDIDIPAGRINIQVTNEEMV
FT                   KRKESWKAPKPKITTGYLGRYARLVTSASTGAVLK"
FT   gene            350068..351747
FT                   /locus_tag="Ccel_0303"
FT   CDS_pept        350068..351747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0303"
FT                   /product="acetolactate synthase, large subunit,
FT                   biosynthetic type"
FT                   /note="TIGRFAM: acetolactate synthase, large subunit,
FT                   biosynthetic type; PFAM: thiamine pyrophosphate protein
FT                   domain protein TPP-binding; thiamine pyrophosphate protein
FT                   central region; thiamine pyrophosphate protein TPP binding
FT                   domain protein; KEGG: cth:Cthe_2714 acetolactate synthase,
FT                   large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74690"
FT                   /db_xref="GOA:B8I5B0"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR012846"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR039368"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5B0"
FT                   /inference="protein motif:TFAM:TIGR00118"
FT                   /protein_id="ACL74690.1"
FT                   /translation="MKLSGADVIIECLKEQGVDTVFGYPGGQAIIIYDALYRARNEIRH
FT                   ILTSHEQGASHAADGYARATGKVGVCIATSGPGATNLVTGIATAYMDSVPMVAITGQVP
FT                   TALLGKDSFQEVDITGITMPVTKHNFIVKDVTKLAQTIRRAFSIAKEGRPGPVLVDVCK
FT                   DVTGAEVEYIPQKPDKDEYRSIKLTEITTDDFELAIQAINEAKRPLLLSGAGVGIAGAE
FT                   SEISELAENASIPVCTSLMGMGTFPGTHPLYTGMVGMHGTKASNYAVHSCDLLIVVGSR
FT                   FSDRIVSNVSTFAPEAKIMHIDVDPAEVGKNVRVDYPLVGDIKRILKTLLKGLVYKKDT
FT                   DWIKKILEWKEKYPLKYQKSDTILKPQYIIERIHELTKGDAIITTEVGQHQMWAAQYFK
FT                   YSRFRQFISSGGLGTMGYGLGACIGAQLARPDKKIINIAGDGSFRMNCSELATAVEYKL
FT                   PIIIALFNNKSLGMVRQWQELFFGGRFSQTSIDRGTDFAALAEAFGAKGINVNHPEQVD
FT                   KAISSALSETYRPVLLNFEIDKDDKVFPIVPAGAGLNEVIDC"
FT   gene            complement(351792..353420)
FT                   /locus_tag="Ccel_0304"
FT   CDS_pept        complement(351792..353420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0304"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   cbt:CLH_1287 ATP-dependent RNA helicase DbpA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74691"
FT                   /db_xref="GOA:B8I5B1"
FT                   /db_xref="InterPro:IPR000629"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014014"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5B1"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACL74691.1"
FT                   /translation="MNNTFNELGISAPILKAIDDMGFKTPTEVQSKAIPHILNNEDLIV
FT                   MSKTGSGKTAVFGVSILQLTNPEEAGPQGLILTPARELAVQVDNDIRKMAKYLKHKTTA
FT                   IYGQHNINLETQILNKGVSIVTGTPGRVFDHISHGTLSTKNIRFLVLDEADRMLDMGFL
FT                   DQVVRIVKTLPKERITLLFSATMPPEIHNICKRYMNNPVTIEIESQTKTVDTIHQVYYR
FT                   VNYNEKNTQLNRLLIVEKPESCMIFCNTKAAVDRVQSFLGKKGYSSRALHGDIPQSKRL
FT                   NTIQQFKQGKFHILVATDVAARGIHIEDLSLVINYDVPNDKDNYVHRIGRTGRAGHEGR
FT                   AFSLVTGDDIISLYEIEEHIGTLILEEELPDEEAFTKAREEAAQWIKANSLKEKAPRSA
FT                   SADSSVKQKRTGQNSKSNRIPNGRPEYSKRPDGQSRHTGKSASSEQRSERIKSVNTVHS
FT                   DKQPGRTPVTPIRTAKPPIRSVSRHVSPNATGLNSPDMRRNSAAAPSVSKVQTRNTSKT
FT                   ESAANNTKANKQPLLKRILHKIFGN"
FT   gene            353647..353796
FT                   /locus_tag="Ccel_0305"
FT   CDS_pept        353647..353796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0305"
FT                   /product="ribosomal protein L33"
FT                   /note="PFAM: ribosomal protein L33; KEGG: cac:CAC3151 50S
FT                   ribosomal protein L33"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74692"
FT                   /db_xref="GOA:B8I5B2"
FT                   /db_xref="InterPro:IPR001705"
FT                   /db_xref="InterPro:IPR011332"
FT                   /db_xref="InterPro:IPR038584"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5B2"
FT                   /inference="protein motif:PFAM:PF00471"
FT                   /protein_id="ACL74692.1"
FT                   /translation="MRVKITLACTDCKQRNYSNIKNKKNDPDRLELKKYCKFCHKHTVH
FT                   KETK"
FT   gene            353898..354128
FT                   /locus_tag="Ccel_0306"
FT   CDS_pept        353898..354128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0306"
FT                   /product="preprotein translocase, SecE subunit"
FT                   /note="TIGRFAM: preprotein translocase, SecE subunit; PFAM:
FT                   protein secE/sec61-gamma protein; KEGG: cth:Cthe_2718
FT                   preprotein translocase, SecE subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74693"
FT                   /db_xref="GOA:B8I5B3"
FT                   /db_xref="InterPro:IPR001901"
FT                   /db_xref="InterPro:IPR005807"
FT                   /db_xref="InterPro:IPR038379"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5B3"
FT                   /inference="protein motif:TFAM:TIGR00964"
FT                   /protein_id="ACL74693.1"
FT                   /translation="MAENEVKKVSRLKKSGQGIVRLYKEIRAELKKVIWPNRTQLINNT
FT                   VTVLIFCLIVGTIIWVADFGFTKLAEVVFTR"
FT   gene            354189..354707
FT                   /locus_tag="Ccel_0307"
FT   CDS_pept        354189..354707
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0307"
FT                   /product="NusG antitermination factor"
FT                   /note="TIGRFAM: transcription termination/antitermination
FT                   factor NusG; PFAM: KOW domain protein; NGN domain protein;
FT                   KEGG: cth:Cthe_2719 transcription antitermination protein
FT                   NusG"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74694"
FT                   /db_xref="GOA:B8I5B4"
FT                   /db_xref="InterPro:IPR001062"
FT                   /db_xref="InterPro:IPR005824"
FT                   /db_xref="InterPro:IPR006645"
FT                   /db_xref="InterPro:IPR008991"
FT                   /db_xref="InterPro:IPR014722"
FT                   /db_xref="InterPro:IPR015869"
FT                   /db_xref="InterPro:IPR036735"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5B4"
FT                   /inference="protein motif:TFAM:TIGR00922"
FT                   /protein_id="ACL74694.1"
FT                   /translation="MSEETKWYVVHTYSGYENKVKANLEKIVENRSMQDYIVDIVVPME
FT                   EQIEIKDGKKKATLKKVFPGYVLVKMIMSDESWYIVRNTRGVTGFVGPGSKPVPLSDEE
FT                   VKAMGVEEFAPEVDYEVNDNVRVTSGPLENFIGIVEEINLEKKKVRVSVSMFGRETPVE
FT                   LELTQIQKI"
FT   gene            354795..355220
FT                   /locus_tag="Ccel_0308"
FT   CDS_pept        354795..355220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0308"
FT                   /product="ribosomal protein L11"
FT                   /note="PFAM: ribosomal protein L11; KEGG: cth:Cthe_2720 50S
FT                   ribosomal protein L11P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74695"
FT                   /db_xref="GOA:B8I5B5"
FT                   /db_xref="InterPro:IPR000911"
FT                   /db_xref="InterPro:IPR006519"
FT                   /db_xref="InterPro:IPR020783"
FT                   /db_xref="InterPro:IPR020784"
FT                   /db_xref="InterPro:IPR020785"
FT                   /db_xref="InterPro:IPR036769"
FT                   /db_xref="InterPro:IPR036796"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5B5"
FT                   /inference="protein motif:PFAM:PF00298"
FT                   /protein_id="ACL74695.1"
FT                   /translation="MAKKIAGYVKLQIPAGKATPAPPVGPALGQHGVNIMGFCKEFNER
FT                   TAKDAGLVIPVVITVYADRSFSFITKTPPAAVLLKKACKIESGSGKPNKDKVAKITMDE
FT                   VRKIAEQKMPDLNAASVDAATKMIAGTARSMGIVVVE"
FT   gene            355334..356026
FT                   /locus_tag="Ccel_0309"
FT   CDS_pept        355334..356026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0309"
FT                   /product="ribosomal protein L1"
FT                   /note="PFAM: ribosomal protein L1; KEGG: cth:Cthe_2721 50S
FT                   ribosomal protein L1P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74696"
FT                   /db_xref="GOA:B8I5M9"
FT                   /db_xref="InterPro:IPR002143"
FT                   /db_xref="InterPro:IPR005878"
FT                   /db_xref="InterPro:IPR016095"
FT                   /db_xref="InterPro:IPR023673"
FT                   /db_xref="InterPro:IPR023674"
FT                   /db_xref="InterPro:IPR028364"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5M9"
FT                   /inference="protein motif:PFAM:PF00687"
FT                   /protein_id="ACL74696.1"
FT                   /translation="MFRGKKYQESSKLIDRLKLYEPSEALELAQKTAKAKFDETIEVHI
FT                   KLGVDSRHADQQVRGAVVLPHGTGKKVRVLVFAKGDKAKEAEQAGADFVGGEELISKIQ
FT                   NENWFDYDVVVATPDMMGVVGRLGKVLGPKGLMPNPKAGTVSMDVAKAIADIKAGKIEY
FT                   RLDKTNIIHCPIGKASFGNEKLMDNFRTLLGAIIKAKPAAAKGQYLKSVVVTSTMGPGI
FT                   KINPLRVE"
FT   gene            356276..356806
FT                   /locus_tag="Ccel_0310"
FT   CDS_pept        356276..356806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0310"
FT                   /product="ribosomal protein L10"
FT                   /note="PFAM: ribosomal protein L10; KEGG: cth:Cthe_2722 50S
FT                   ribosomal protein L10P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74697"
FT                   /db_xref="GOA:B8I5N0"
FT                   /db_xref="InterPro:IPR001790"
FT                   /db_xref="InterPro:IPR002363"
FT                   /db_xref="InterPro:IPR022973"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5N0"
FT                   /inference="protein motif:PFAM:PF00466"
FT                   /protein_id="ACL74697.1"
FT                   /translation="MPSNRILEQKKQVVSDLTEKIKSAQSIVLADYRGLTVEQDTELRT
FT                   ALRKAGVEYKVVKNKLTSLAMKESGLELDEFLTGPTAMAISSADAVAPAKVLSEFSKKF
FT                   DKLELKVGVVEGKVIDLDGIKALAELPSREVLIAKVLGGFNAPISGFVNVLNGNMRGLV
FT                   VALNAISEQKANA"
FT   gene            356873..357256
FT                   /locus_tag="Ccel_0311"
FT   CDS_pept        356873..357256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0311"
FT                   /product="ribosomal protein L7/L12"
FT                   /note="TIGRFAM: ribosomal protein L7/L12; PFAM: Ribosomal
FT                   protein L7/L12; KEGG: cth:Cthe_2723 50S ribosomal protein
FT                   L12P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74698"
FT                   /db_xref="GOA:B8I5N1"
FT                   /db_xref="InterPro:IPR000206"
FT                   /db_xref="InterPro:IPR008932"
FT                   /db_xref="InterPro:IPR013823"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR036235"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5N1"
FT                   /inference="protein motif:TFAM:TIGR00855"
FT                   /protein_id="ACL74698.1"
FT                   /translation="MASEKVVKLIEDVKNLTVLELSELVKALEEEFGVSAAAPVAVAAA
FT                   PAAGGAAPAAEEKTEFDVILKEVGADKIKVIKVVREATGLGLKEAKDLVDGAPKTIKEN
FT                   VSKDEAASIEAKFKEVGATVEIK"
FT   gene            357744..361484
FT                   /locus_tag="Ccel_0312"
FT   CDS_pept        357744..361484
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0312"
FT                   /product="DNA-directed RNA polymerase, beta subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, beta subunit;
FT                   PFAM: RNA polymerase Rpb2 domain 6; RNA polymerase Rpb2
FT                   domain 7; RNA polymerase Rpb2 domain 2; RNA polymerase beta
FT                   subunit; RNA polymerase Rpb2 domain 3; DNA-directed RNA
FT                   polymerase beta subunit; KEGG: cth:Cthe_2724 DNA-directed
FT                   RNA polymerase subunit beta"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74699"
FT                   /db_xref="GOA:B8I5N2"
FT                   /db_xref="InterPro:IPR007120"
FT                   /db_xref="InterPro:IPR007121"
FT                   /db_xref="InterPro:IPR007641"
FT                   /db_xref="InterPro:IPR007642"
FT                   /db_xref="InterPro:IPR007644"
FT                   /db_xref="InterPro:IPR007645"
FT                   /db_xref="InterPro:IPR010243"
FT                   /db_xref="InterPro:IPR014724"
FT                   /db_xref="InterPro:IPR015712"
FT                   /db_xref="InterPro:IPR019462"
FT                   /db_xref="InterPro:IPR037033"
FT                   /db_xref="InterPro:IPR037034"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5N2"
FT                   /inference="protein motif:TFAM:TIGR02013"
FT                   /protein_id="ACL74699.1"
FT                   /translation="MVQPVKLGRNTRMSYSKIREVLEMPNLIEVQKNSYQWFLDEGLRE
FT                   VFRDISPITDYTGNLILDFVDYSLDDTPKYSVEECKERDTTYSAPLKAKVRLINKESGE
FT                   VKEQEIFMGDFPLMTDTGTFIINGAERVIVSQLVRSPGIYYSMKFDRVGKKLYSNTVIP
FT                   NRGAWLEYETDSNDILSVRIDRTRKLPLTVLLRALGYGTDFAITQLLGEDERILATIQK
FT                   DNAKTTEEGLLEIYKRLRPGEPPTVDSARSLLNSLFFDPKRYDLAKFGRFKFNKKLSVA
FT                   NLITGQVAAENIVSAETGEILVTEGELIEREKAVEVQNSGVNVVHLSVEGKSIKVVGNN
FT                   TVDIRAFIDFDVSDIGITENVQYAVLKEILESTSGEVQIKKALGERINDLIPKHITVED
FT                   IISSINYIINLDYGIGSIDDIDHLGNRRLRSVGELLQNQFRIGLSRMERVVRERMTIQD
FT                   IDIVTPQALINIRPVAAAIKEFFGSSQLSQFMDQTNPLAELTHKRRLSALGPGGLSRER
FT                   AGFEVRDVHHSHYGRMCPIETPEGPNIGLIGSLSTYARVNEYGFIEAPFRKVDKKNRKV
FT                   TNEIVYLTADVEDPFVVAQATEPLDEEGKFISNKVVARIRHEILEVESNKIDFMDVSPK
FT                   QMVSVATAMIPFLENDDANRALMGSNMQRQAVPLIKADSPIIGTGIEYKAARDSGVCVI
FT                   ARTSGVVDKVSASEIVIKTKSGQKDSYKLLKYMRSNQGTCLNQRPIVRKGEVVEKGDII
FT                   ADGPSTDNGEIALGRNVLIGFMTWEGYNYEDAILINEKLVKEDVYTSIHIEEYEAESRD
FT                   TKLGPEEITRDIPNVGEEALKDLDDRGIIRIGAEVRSGDILVGKVTPKGETELTAEERL
FT                   LRAIFGEKAREVRDTSLRVPHGESGIIVDVKVFTRENGDELPPGVNQLVRCYIAQKRKI
FT                   SVGDKMAGRHGNKGVISRILPEEDMPFLPDGTPLEIVLNPLGVPSRMNIGQVLEVHLGY
FT                   AAKALGWKIATPVFDGATEEDIRETLIKAGKDPDGKTVLYDGRTGEPFDNRVTVGYMYY
FT                   LKLAHLVDDKIHARSTGPYSLVTQQPLGGKAQFGGQRFGEMEVWALEAYGAAYTLQEIL
FT                   TVKSDDVVGRVKTYESIVKGENVPEPGIPESFKVLIKELQSLALDVKVYSEEQEEIAIK
FT                   EYVEDDLEDLNVNIEGREDEVILTNDFDNELREDVLEEELDIDDLDIGSISTGDNLEEE
FT                   LTEELFAEDDLSDDFEDDEDL"
FT   gene            361501..365010
FT                   /locus_tag="Ccel_0313"
FT   CDS_pept        361501..365010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0313"
FT                   /product="DNA-directed RNA polymerase, beta' subunit"
FT                   /note="KEGG: cth:Cthe_2725 DNA-directed RNA polymerase
FT                   subunit beta'; TIGRFAM: DNA-directed RNA polymerase, beta'
FT                   subunit; PFAM: RNA polymerase alpha subunit; RNA polymerase
FT                   Rpb1 domain 3; RNA polymerase Rpb1 domain 1; RNA polymerase
FT                   Rpb1 domain 5; RNA polymerase Rpb1 domain 4; SMART: RNA
FT                   polymerase I subunit A domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74700"
FT                   /db_xref="GOA:B8I5N3"
FT                   /db_xref="InterPro:IPR000722"
FT                   /db_xref="InterPro:IPR006592"
FT                   /db_xref="InterPro:IPR007066"
FT                   /db_xref="InterPro:IPR007080"
FT                   /db_xref="InterPro:IPR007081"
FT                   /db_xref="InterPro:IPR007083"
FT                   /db_xref="InterPro:IPR012754"
FT                   /db_xref="InterPro:IPR038120"
FT                   /db_xref="InterPro:IPR042102"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5N3"
FT                   /inference="protein motif:TFAM:TIGR02386"
FT                   /protein_id="ACL74700.1"
FT                   /translation="MFELNNFDSIRIGLASPEKVREWSKGEVKKPETINYRTLKPERDG
FT                   LFCERIFGPQKDWECHCGKYKRIRYKGIVCDRCGVEVTRSKVRRERMGHIELAAPVSHI
FT                   WYFKGIPSRMGLILDMSPRSLEKILYFASYVVIDPGQTPLSKKQVLTEKEYRDSVDKFG
FT                   LNFRAAMGAEAVKELLVEIDLESLSKELRTELTESTGQKRIRAVKRLEVVEAFRLSGNR
FT                   PEWMILDVVPVIPPELRPMVQLDGGRFATSDLNDLYRRVINRNNRLKRLLDLGAPDIIV
FT                   RNEKRMLQEAVDALIDNGRRGRPVTGPGNRPLKSLSDMLKGKQGRFRQNLLGKRVDYSG
FT                   RSVIVVGPDLKIFQCGLPKEMALELFKPFVMKKLVNDGLAHNIKSAKRMVERVRNEVWD
FT                   VLEEVIKEHPVLLNRAPTLHRLGIQAFEPVLVEGRALKLHPLVCSAYNADFDGDQMAVH
FT                   VPLSAEAQSEARFLMLSANNLLAPKDGKPITVPTQDMVLGSYYLTIEKSDEPGDGRVFC
FT                   DIDEVLMAYEEGALGLHAQIKVRVEKEIDGVKKRKIISCTPGRLIFNEAIPQDLGFVDR
FT                   SDESNLFDLEINFLVGKKELGKIIDKCIRVHGTTKTAVILDKIKALGFKYSTRGAITIS
FT                   VSDMVIPEIKKQYLQETENTIDNIVKQYKRGLISDEERYNSVISAWTETGESITKALID
FT                   NLDRFNPVYMMSQSGARGNINQIKQLAGMRGLMADTSGKTIEIPIKSNFREGLNVLEFF
FT                   ISTHGARKGLADTALRTADSGYLTRRLVDVSQDVIVRELDCGTDKGIEVHDIKDGGETI
FT                   EPLSERLVGRYLTDDLYDSETNELLASKDEAMDEKKASLVTKSLAKSGIKKVKIRSVLT
FT                   CHSEVGVCAKCYGANLATGDAVNIGEAVGIIAAQSIGEPGTQLTMRTFHTGGVAGDDIT
FT                   QGLPRVEELFEARKPKGLAIISEIAGGVKLSDSKKKREVIITSEDGESKSYQIPYGSRI
FT                   KVYDGDVVEAGDELTEGSVNPHDILKIKGIKGVQSYLLQEVQRVYRMQGVDINDKHIEV
FT                   IVRQMMRKVKIEDAGDTSMLPGGLVDIFEFEKENQKAVEAGLAPATSERTLLGITKASL
FT                   ATDSFLSAASFQETTRVLTEAAIKGKIDPLVGLKENVIIGKLIPAGTGMSRYKDISISS
FT                   VVE"
FT   gene            365219..365461
FT                   /locus_tag="Ccel_0314"
FT   CDS_pept        365219..365461
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0314"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   cth:Cthe_2726 50S ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74701"
FT                   /db_xref="GOA:B8I5N4"
FT                   /db_xref="InterPro:IPR000948"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5N4"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ACL74701.1"
FT                   /translation="MLDDLKHCKKAVGVKQSTKAVENGVASSVIIARDCEQRVVRGIIE
FT                   LCENKSVPITYVDSMKQLGKACGIDVDAAVACIFK"
FT   gene            365540..365968
FT                   /locus_tag="Ccel_0315"
FT   CDS_pept        365540..365968
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0315"
FT                   /product="ribosomal protein S12"
FT                   /note="TIGRFAM: ribosomal protein S12; PFAM: ribosomal
FT                   protein S12/S23; KEGG: cth:Cthe_2727 30S ribosomal protein
FT                   S12"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74702"
FT                   /db_xref="GOA:B8I5N5"
FT                   /db_xref="InterPro:IPR005679"
FT                   /db_xref="InterPro:IPR006032"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5N5"
FT                   /inference="protein motif:TFAM:TIGR00981"
FT                   /protein_id="ACL74702.1"
FT                   /translation="MPTFNQLVRKGRKVIEKKSNSPALQKGFNSKKKKPTDVNSPQKRG
FT                   VCTVVKTSTPKKPNSALRKVARVRLTNGIEVSAYIPGIGHNLQEHSVVLIRGGRVKDLP
FT                   GVRYHIVRGTLDTAGVAKRMQARSKYGAKRPKAGAASK"
FT   gene            366193..366663
FT                   /locus_tag="Ccel_0316"
FT   CDS_pept        366193..366663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0316"
FT                   /product="ribosomal protein S7"
FT                   /note="PFAM: ribosomal protein S7; KEGG: cth:Cthe_2728 30S
FT                   ribosomal protein S7"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74703"
FT                   /db_xref="GOA:B8I5N6"
FT                   /db_xref="InterPro:IPR000235"
FT                   /db_xref="InterPro:IPR005717"
FT                   /db_xref="InterPro:IPR020606"
FT                   /db_xref="InterPro:IPR023798"
FT                   /db_xref="InterPro:IPR036823"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5N6"
FT                   /inference="protein motif:PFAM:PF00177"
FT                   /protein_id="ACL74703.1"
FT                   /translation="MPRKGHISKRDVLPDPIYGSKTVTKLINNVMYDGKKGIAQQICYD
FT                   AFDIIKEKTGRDPLEVFEEAMANIMPVLEVKARRVGGATYQVPMEVRPDRRQALGLRWL
FT                   VDYSRKRGERTMRERLSGEILDAINNMGGAYKKKEDTHKMAEANRAFAHYRW"
FT   gene            366719..368800
FT                   /locus_tag="Ccel_0317"
FT   CDS_pept        366719..368800
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0317"
FT                   /product="translation elongation factor G"
FT                   /note="TIGRFAM: translation elongation factor G; small
FT                   GTP-binding protein; PFAM: elongation factor G domain
FT                   protein; protein synthesis factor GTP-binding; elongation
FT                   factor Tu domain 2 protein; elongation factor G domain IV;
FT                   KEGG: cth:Cthe_2729 translation elongation factor 2
FT                   (EF-2/EF-G)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74704"
FT                   /db_xref="GOA:B8I5N7"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004540"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR005517"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009022"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035649"
FT                   /db_xref="InterPro:IPR041095"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5N7"
FT                   /inference="protein motif:TFAM:TIGR00484"
FT                   /protein_id="ACL74704.1"
FT                   /translation="MPRQFDLEHTRNIGIMAHIDAGKTTTTERILFYTGRVHKIGETHE
FT                   GSATMDWMEQEQERGITITSAATTAQWKGNRINIIDTPGHVDFTVEVERSLRVLDGSVT
FT                   VFCAKGGVEPQSETVWRQADKYGVPRMAYVNKMDIMGADFYNVIAMMKDRLQCNAVPIQ
FT                   LPIGSEDCFVGMVDLVTMTSHIFKDDLGQVIEDQPIPDDMIEISNKYREQLLEAVAEQD
FT                   EELMMKYLEGEEFTLEEIKAGIRKATIAVKMIPVTCGSSYKNKGVQQMLDAVIDFMPSP
FT                   TDIPAIKGISVDGDTEIERPADDNGPFAALAFKIMTDPYVGKLCFFRVYSGTLNSGSYV
FT                   LNSTKNKRERIGRILQMHANHREEIQVVHSGDIAAAVGLKDTTTGDTLCEENNPVILES
FT                   MEFPEPVIEVAIEPKTKAGQEKMGVALQKLAEEDPTFRVHTDAETGQTIIGGMGELHLD
FT                   IIVDRMLREFKVEANVGNPQVSYKETIRKAVKSEMKYARQSGGKGQYGHCVIELEPREP
FT                   GAGYEFVNKITGGAIPKEYIAPIDAGIQEAMNTGVLAGYNVVDIKVTLIDGSYHEVDSS
FT                   EMAFKIAGSMAFKDGCRKANPVLLEPIMKVDVSVPEEYMGDVMGGLNARRGRIEGMEAR
FT                   GGAQNIRAVVPLSEMFGYATALRSSTQGRGTFSMQTSHFEEVPKSIQEKVISSRTTGV"
FT   gene            368924..370126
FT                   /locus_tag="Ccel_0318"
FT   CDS_pept        368924..370126
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0318"
FT                   /product="translation elongation factor Tu"
FT                   /note="TIGRFAM: translation elongation factor Tu; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; elongation factor Tu domain protein;
FT                   elongation factor Tu domain 2 protein; KEGG: cth:Cthe_2730
FT                   elongation factor Tu"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74705"
FT                   /db_xref="GOA:B8I5N8"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004160"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR004541"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR033720"
FT                   /db_xref="InterPro:IPR041709"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5N8"
FT                   /inference="protein motif:TFAM:TIGR00485"
FT                   /protein_id="ACL74705.1"
FT                   /translation="MAKAKFERNKPHVNIGTIGHVDHGKTSLTAAITKVLGFLGSAEYK
FT                   AYDQIDAAPEERERGITINTSHVEYQTETRHYAHVDCPGHADYVKNMITGAAQMDGAIL
FT                   VVSAADGPMPQTREHILLSHQVGVPYIIVFLNKCDMVDDDELIELVEMEVRELLSSYEF
FT                   PGDDTPIIRGSALVALESTSTDINSPEYAPIVALMKEVDNYIPTPERATDKAFIMPVED
FT                   VFSITGRGTVATGRVEKGIVKVGDEVEIVGLMEAPKKTVVTGVEMFRKLLDQAEAGDNI
FT                   GALLRGVQRTDIERGQVLAKPGSIKPHTYFEGQVYVLTSAEGGRHKPFFNGYRPQFYFR
FT                   TTDVTGVIEIPEGTEMVMPGDHITMKIKLITPIAMEEGLKFAIREGGRTVGAGNVSKII
FT                   E"
FT   gene            370295..371209
FT                   /locus_tag="Ccel_0319"
FT   CDS_pept        370295..371209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0319"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbo:CBO0408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74706"
FT                   /db_xref="InterPro:IPR021328"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5N9"
FT                   /inference="similar to AA sequence:KEGG:CBO0408"
FT                   /protein_id="ACL74706.1"
FT                   /translation="MLSREEYIRLSLELNLFFGRIAKEHSIFIESSFTSKNSKLAQEAD
FT                   DFKIQFERLLAETISLANGVVSPDIVISRELVTPYTLNAERVSQFYTGIPINISLTQAE
FT                   SSLQGNADMMPVPMLEQRVFMLNQKAINLTTALAQFKSRILNDVLACKLFTTNYPLLLD
FT                   HILREAKFYLRTLSRLQNREDIATAKDLIEQEVFWNRIMAEHSKFIRGLLDPTENDLIN
FT                   TANKYGREFDELTREAIKATEQTNLLPEVTIDSLNATKGLRDFKATGTKGLIECKIKAI
FT                   AYPLLGDHVLREANHYIRILQKS"
FT   gene            371303..371848
FT                   /locus_tag="Ccel_0320"
FT   CDS_pept        371303..371848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0320"
FT                   /product="YdaE"
FT                   /note="KEGG: dth:DICTH_0546 YdaE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74707"
FT                   /db_xref="InterPro:IPR010864"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P0"
FT                   /inference="similar to AA sequence:KEGG:DICTH_0546"
FT                   /protein_id="ACL74707.1"
FT                   /translation="MINKEEHLRALEDTLAYFNKASIVLTEYEKKQIEIADFGLNDLRH
FT                   TGLQLITFVNTDRVCAKEMVLFPRQTCPEHKHPNRNGIPGKEETFRCRSGRVYLYVEGE
FT                   KSQEIHCKVPPGSEKYYTVWHEIILNPGEQYTLYPDTLHWFQAGEEGAVISEFSTNSDD
FT                   LSDIFTDDRIKRIPEIDR"
FT   gene            372068..373258
FT                   /locus_tag="Ccel_0321"
FT   CDS_pept        372068..373258
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0321"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein;
FT                   flavodoxin/nitric oxide synthase; KEGG: drm:Dred_2942
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74708"
FT                   /db_xref="GOA:B8I5P1"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR016440"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL74708.1"
FT                   /translation="MIEIKKNIYWCGIRDWGLSVFHGHELSTHRGTSYNSYIIRDKKTV
FT                   LIDTVWDPYKEQFVEDLDKSIGLSNIDAIVINHMEPDHGGSLGLLMSKIPNTPIYCTKN
FT                   GSEIIKKYFEKDWNFNIVKTGDVLDLGEHKLHFVDMQMIHWPDSMLVYVEGAKLVISND
FT                   AFGQHYCGTALFNDQVDTCELYQEAIKYYANILTPFRPLIKKKIEQIMAMNLDIDMIAP
FT                   SHGVIWRDNPSQIIKKYVEWADPNFNEGYAAIIYDTMYHTTRAMAEAIGRGFEEEGVSY
FT                   RIINAATRDKSDLNVEIFKANAVLIGSCTVNNTVTRPIAALLEEIKSLKIKSKLAAGFG
FT                   AYGWSGEAHKKISKELGDAGLTIGAEPLGFRYKMLEQEVEQCVEMGRNIARQLKAK"
FT   gene            373484..374176
FT                   /locus_tag="Ccel_0322"
FT   CDS_pept        373484..374176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0322"
FT                   /product="NifU-like domain-containing protein"
FT                   /note="KEGG: cth:Cthe_1768 NifU-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74709"
FT                   /db_xref="GOA:B8I5P2"
FT                   /db_xref="InterPro:IPR002871"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P2"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1768"
FT                   /protein_id="ACL74709.1"
FT                   /translation="MNYSHEVENMCVVKKGPNHGPAPIPEEGRWVKAKEVKDISGLSHG
FT                   IGWCAPQQGTCKLTLNVKEGIIEESLVETIGCSGMTHSAAMAAEILQGKTILEALNTDL
FT                   VCDAINVAMREIFKQLVYGRTQSAFSEDGLVIGAGLEDLGKGLRSQVGTMYATKAKGAR
FT                   YLEMAEGYILSIGLDADNEIIGYKFVHLGKMMDMIKKGVDPKEAYEKNVGQYGRYDEAV
FT                   KVIDPRHE"
FT   gene            374198..375196
FT                   /locus_tag="Ccel_0323"
FT   CDS_pept        374198..375196
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0323"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1767 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74710"
FT                   /db_xref="InterPro:IPR025964"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P3"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1767"
FT                   /protein_id="ACL74710.1"
FT                   /translation="MVRFEGYERRIAQIEKCLAEYGFKSLEEVKDLCTSKGIDVDSIVR
FT                   GVQPIAFENAVWAYTLGCGIALKKGAKDAAEAAEAIGLGLQAFCIPGSVADSRQVGIGH
FT                   GNLAAMLLKEETKCFCFLAGHESFAAAEGAIGIAKTANKVRKEPLQVILNGLGKDAAYI
FT                   ISRINGFTYVETDYDFATNTLNVVKTKAYSNGDKSKVRVYGANDVLEGVAIMMKENVDV
FT                   SITGNSTNPTRFQHLVAGTYKKWSNENNKKYFSVASGGGTGRTLHPDNMAAGPASYGLT
FT                   DSMGRMHGDAQFAGSSSVPAHVEMMGLIGMGNNPMVGATVAVAVAIEESTK"
FT   gene            375532..375990
FT                   /locus_tag="Ccel_0324"
FT   CDS_pept        375532..375990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0324"
FT                   /product="transcriptional repressor, CtsR"
FT                   /note="PFAM: Firmicute transcriptional repressor of class
FT                   III stress genes; KEGG: cth:Cthe_1792 firmicute
FT                   transcriptional repressor of class III stress genes"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74711"
FT                   /db_xref="GOA:B8I5P4"
FT                   /db_xref="InterPro:IPR008463"
FT                   /db_xref="InterPro:IPR040465"
FT                   /db_xref="InterPro:IPR041473"
FT                   /db_xref="InterPro:IPR041902"
FT                   /db_xref="InterPro:IPR041908"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P4"
FT                   /inference="protein motif:PFAM:PF05848"
FT                   /protein_id="ACL74711.1"
FT                   /translation="MASLSDLIEAFIKQMIADTNGSIELQRNELANQFNCVPSQINYVI
FT                   STRFTADRGYYVESRRGGGGHVKIKRVNISIPGNYLMHIVSSMRSSISQQSAEVFINNF
FT                   VDYEVISEREGFLMKAAVSDKVLGGLSMPDRDIIRASLLKNMIMSLLV"
FT   gene            376033..376521
FT                   /locus_tag="Ccel_0325"
FT   CDS_pept        376033..376521
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0325"
FT                   /product="UvrB/UvrC protein"
FT                   /note="PFAM: UvrB/UvrC protein; KEGG: cth:Cthe_1791
FT                   UvrB/UvrC protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74712"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR025542"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P5"
FT                   /inference="protein motif:PFAM:PF02151"
FT                   /protein_id="ACL74712.1"
FT                   /translation="MLCQNCQQRIASVHLTQIKNNTKLDIYLCEECAQEMSQQDFISPF
FT                   GFNDLISGLFGAQLKHEPYVKLKCKNCGMEYNEFLKTSRLGCSQCYKVFADKLDPIVKR
FT                   LHGNGEHHGKVPSRVSSNVSITNEMDKLKQLLNEAIKNEKYEEAAKIRDRIKSLEVEE"
FT   gene            376518..377540
FT                   /locus_tag="Ccel_0326"
FT   CDS_pept        376518..377540
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0326"
FT                   /product="ATP:guanido phosphotransferase"
FT                   /note="PFAM: ATP:guanido phosphotransferase; KEGG:
FT                   cth:Cthe_1790 ATP:guanido phosphotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74713"
FT                   /db_xref="GOA:B8I5P6"
FT                   /db_xref="InterPro:IPR000749"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022414"
FT                   /db_xref="InterPro:IPR022415"
FT                   /db_xref="InterPro:IPR023660"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P6"
FT                   /inference="protein motif:PFAM:PF00217"
FT                   /protein_id="ACL74713.1"
FT                   /translation="MSKKPSEKGPEFDIAVSSRVRLARNFADIPFSARINPKQQAELIK
FT                   RMQEIMEEFTTYGKLMFADMNTLHPVDRLSLMERHLISPELADSKGSSGAFINENENVS
FT                   IMVNEEDHLRVQSIFPGIQLEKGYKVCDEIDSLIAEKADYAFDDKYGYLTSCPTNLGTG
FT                   MRASVMLHLPALVMTGYMKSILESCNKVGVAVRGIYGENSEAVGDMFQVSNQITLGRKE
FT                   EETISSIDGICKQIIDREKALRLQLYKKNLYKFEDKIFRSYGILKNARVLSSQECFKLL
FT                   SDVRLGVSMGIIKDIDIVTLNETIVLSQPATLQKISGNQLEQDQRDIKRAELIRMKITK
FT                   "
FT   gene            377562..379994
FT                   /locus_tag="Ccel_0327"
FT   CDS_pept        377562..379994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0327"
FT                   /product="ATPase AAA-2 domain protein"
FT                   /note="PFAM: UvrB/UvrC protein; AAA ATPase central domain
FT                   protein; Clp domain protein; Torsin; ATPase associated with
FT                   various cellular activities AAA_5; ATPase AAA-2 domain
FT                   protein; SMART: AAA ATPase; KEGG: cth:Cthe_1789 ATPase
FT                   AAA-2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74714"
FT                   /db_xref="GOA:B8I5P7"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P7"
FT                   /inference="protein motif:PFAM:PF07724"
FT                   /protein_id="ACL74714.1"
FT                   /translation="MYQRFTEKAERAIGFSQQAAVDLGHNYVGTEHILLGLVKEGTGVA
FT                   ARVLQGQGITEEKILKEIEELIGKGDAEGTQPVGFTPRTKRVLELAFKEARRMGQGYIG
FT                   TEHLLLGIMKEGESVAVRILMDLGVDPQKLLNELVKILTEETPGSNGSAKGNSSNSNTP
FT                   TLNQFGRDLTDMARDGKIDPVIGRDKEIERVIQILSRRTKNNPCLIGEPGVGKTAIAEG
FT                   LAQKIVEGNIPEILSNKRVVTLDLSSMVAGAKYRGEFEDRLKKAMEEIRKAANVILFID
FT                   ELHTIVGAGAAEGAIDASNILKPSLARGEIQVIGATTLNEYRKHIEKDAALERRFQPIT
FT                   VGEPSKEEAVEILKGVRDKYEAHHRVKITDDALEAAVKLGDRYITDRFLPDKAIDLIDE
FT                   AASRIRLKTFTAPPDLKEMEERVEKLGKEKEDAIRCQEFEKAARIRDDEQKLKSELEKI
FT                   RDQWHQKNQTKTDTVTEDDIADIVASWTGIPVRRLAEEESERLLKMEDTLHKRVIGQDE
FT                   AVKSISKAIRRGRVGLKDPKRPVGSFIFMGPTGVGKTELCKALAEAMFGDEKSMIRVDM
FT                   SEFMEKHSVSKLVGSPPGYVGYDEGGQLTERVRRKPYSVLLFDEIEKAHPDIFNILLQI
FT                   LEDGRLTDSQGRVVDFRNTIIIMTSNVGARTITEPKRLGFSASNDESAKNYEDMKSNVM
FT                   SELKKMFRPEFLNRIDDIIVFHPLSKENIKEIVRLMLDVLVNRLKANEIIMEVSEEAMG
FT                   YLAQKGFDPVFGARPLRRAIQSMVEDKLAEDMLEGKVKAGDSIRIDLDGENIVVIKK"
FT   gene            380199..381605
FT                   /locus_tag="Ccel_0328"
FT   CDS_pept        380199..381605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0328"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   cpy:Cphy_2677 radical SAM domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74715"
FT                   /db_xref="GOA:B8I5P8"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024001"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL74715.1"
FT                   /translation="MIIYKLIKTPLQYYVYDRNKNKILNISKEEYQELDRLNKKEITEK
FT                   EAVCLKKFQKYGYLKDSILEEIVHPETKYIKHHLDHRVQFLILQVTQSCNLRCNYCTYS
FT                   GNYTNRVHSGKSMSWELAKKSIDYLYDHSNEIEKVRISFYGGEPLLRFDLIKRCVQYVK
FT                   EAYPDRITDYGITTNGTLLSGEIAEFLIDNQFSITISLDGSKKDHDANRKFANGEGSFN
FT                   TIINNIKDISKHNKGFIKNIRFNTVLNPKSDYGTVRNYFNSEDVVCDAGVGLSLMEEIN
FT                   YKGDISFSNEFINIRRYDYFLLLMTMVKKLKKEAIPKFMSEIKAGIDIDYSTMEDVNNL
FT                   NKTWHHGGPCIAGAMRMFVNTDGVIYPCEKAVETSEAMKIGEMDEGTDSQKVSEIMNIG
FT                   KISEKDCKSCWAINWCSMCALYAEKDGKFDVATKRKNCAKSFIEVQEKLLNICALKEFG
FT                   YKFGKEEMYV"
FT   gene            381598..382680
FT                   /locus_tag="Ccel_0329"
FT   CDS_pept        381598..382680
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74716"
FT                   /db_xref="InterPro:IPR023823"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5P9"
FT                   /inference="similar to AA sequence:KEGG:Cphy_2676"
FT                   /protein_id="ACL74716.1"
FT                   /translation="MYKLLVYPFSMEDYCITKYRNMLQGYELTSLVCLEGACETGRDAG
FT                   EFNEVESGLIITDDYSAEIDKCNVVLLLDKNFNEFEETYIKRINTAVSKNKIVLTNKKI
FT                   YDFCVKEFSDNKNIRILDNIQEYGLNYFTNDRKITQPDIPVITVMSMGESCNKFEAQLD
FT                   LRKKFQDKGYKVLQFGTKDYCDLYGFRNIPSFLMSKDISIDRKIYLFNYYINKEVLKDD
FT                   YDVIIIGVAGGILPVNRYVTNYFGEIPLIVSSALNIDINVLCLYHNNEIKKENLYECRE
FT                   FNKGRLGCFTDYYYMSDRQFRITYEHDIVYFMLDRKNCINSMPVINDESLKFCHVLDTD
FT                   VKENMLNSLVEELEGNVALV"
FT   gene            382694..382969
FT                   /locus_tag="Ccel_0330"
FT   CDS_pept        382694..382969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74717"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74717.1"
FT                   /translation="MNKCEVMNEIKKTVLRITGIIIEDENDNIIGCHHIYPIVYAIYIV
FT                   EELEKVFGKEVSDIFTENDYTIWELTNLADAIMNKCRSSVETLQVI"
FT   gene            382969..383067
FT                   /locus_tag="Ccel_0331"
FT   CDS_pept        382969..383067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0331"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74718"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74718.1"
FT                   /translation="MIAGGISFILLNDYIKTIKEVFLWRNYPKEMS"
FT   gene            383037..383228
FT                   /locus_tag="Ccel_0332"
FT   CDS_pept        383037..383228
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0332"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74719"
FT                   /db_xref="InterPro:IPR023968"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74719.1"
FT                   /translation="MEKLSKRNELVPNTVMAFSCPCASVCSCASRCGGNGTADSAISSS
FT                   LRSSEYIVASSAISSTFG"
FT   gene            complement(383282..384544)
FT                   /locus_tag="Ccel_0333"
FT   CDS_pept        complement(383282..384544)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0333"
FT                   /product="glycosyl transferase family 2"
FT                   /note="PFAM: glycosyl transferase family 2; KEGG:
FT                   cth:Cthe_1788 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74720"
FT                   /db_xref="GOA:B8I5Q3"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q3"
FT                   /inference="protein motif:PFAM:PF00535"
FT                   /protein_id="ACL74720.1"
FT                   /translation="MQNIFFNIIYYISEFIQILIFIAGCYFFGISIFGWVKRRQKSPQN
FT                   IIPTKRFALVVAAHNEELVIGHIVDSLFKLNYPKNLYDVFVIADNCTDNTAGIARRFGA
FT                   KVHIREDASKKGKGHALEWMFHRIFHMDTSYDAIAVFDADNLVSQNFLLEMNKQMCKGF
FT                   KVVQGYIDSKNPYDSWITCSYSIAFWLSNRIYQLPRYYLKLSCGLCGTGFCIDTSILKT
FT                   LKWGATCLTEDLEYTMKMALNGVKIGWAHEAVVYDEKPITLKQSWHQRKRWMQGHAECA
FT                   QKYLGALFKKALFKGDLTSLDCALYLFQPIRFIFVGLMTVMMWVQTVYPQFPLYSVQYV
FT                   FPVQVWYLMGLFEMFYGPLVILAEKKFSLKVILGFIIYPYYCLTWIPITIQGILEKNNK
FT                   EWNHTVHTRQISINELENSNG"
FT   gene            complement(384992..386275)
FT                   /pseudo
FT                   /locus_tag="Ccel_0334"
FT   gene            386508..388442
FT                   /locus_tag="Ccel_0335"
FT   CDS_pept        386508..388442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0335"
FT                   /product="glycoside hydrolase 15-related"
FT                   /note="PFAM: glycoside hydrolase 15-related; KEGG:
FT                   cth:Cthe_1787 glycoside hydrolase 15-related"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74721"
FT                   /db_xref="GOA:B8I5Q4"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011613"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q4"
FT                   /inference="protein motif:PFAM:PF00723"
FT                   /protein_id="ACL74721.1"
FT                   /translation="MQKSYYNNAITGNSSMLACFSERAELLRLFWPDIDYIQNLDKMFL
FT                   GLFEKNKTGSTVWLNDIRCEHHQEYLPDSNIIKNMVTNFFDGYKVVLYDFVHPEMDVLV
FT                   RRFEIENLRGESRELGLMSFSAATSSDSEVACSLFDFMNEALVHYKPDSYIAVTSDIPV
FT                   YQFQIGNNANDAAVNTYLYGKDDIGMMKDAAISWDLGVFQPHAVKTTNVYLCAADTLKS
FT                   CKALVRRVKTVGGLTAFRETGRYWKDYLEKTTKLKSGNTLLDDLYKRSLLVFRLMYSKK
FT                   SGGLMAAPEVDEYFTKCGKYAYCWGRDAAFITGALDIGGLCESVDHFYKWAVNVQDEDG
FT                   SWQQRYHMNGNLGPCWGLQVDETGTIIWGMLNHYNYTKNTDFLKSVWDSVKAAADFLVR
FT                   FIDSETGLPRPSFDLWEERYGEHAYSSASVCAGLKSASEMARILGKPSQEYIQWETTAD
FT                   SIKKAIVKYFWKEDYRRFIRSIRVKLNGFGQEPSSDTMLIKVNPKGYVRDVTKEDWIVD
FT                   VSLVGLGIPFEIFELNDPMLRDTVSLIEQVLTAQGVGGIKRYENDTYIGGNPWILTTLW
FT                   IALYHAKSGNYKKAKEYLIWAASGKTELGLLPEQINRDTGKPEWIIPLTWSHAMYVHVY
FT                   SELINAGVL"
FT   gene            388460..389860
FT                   /locus_tag="Ccel_0336"
FT   CDS_pept        388460..389860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0336"
FT                   /product="AAA ATPase"
FT                   /note="SMART: AAA ATPase; KEGG: cbe:Cbei_0126 DNA repair
FT                   protein RadA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74722"
FT                   /db_xref="GOA:B8I5Q5"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004504"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020588"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041166"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q5"
FT                   /inference="protein motif:SMART:SM00382"
FT                   /protein_id="ACL74722.1"
FT                   /translation="MQKVGLINIKNKTVFKCSNCGYVSPKWVGRCPECDNWNTFEEREI
FT                   QNQKNSRSASARITKPLVRLTQVKAGNSDRIVTGINEFNRVMGGGIVKDSITIITAKPG
FT                   AGKSTLLLQVAGDVASKGLKVLYASGEESESQIKSRADRIFNKIEDGVWVYSDNSMDNV
FT                   LNVVSQVDPDLLIVDSIQTFILEGFPGSRAGSPTQTMECANELLKLAKDPVRPRAVFLV
FT                   GQMNKSEEIAGLRALEHLVDTVLILDGDNEEELRGLSVSKNRFGSTWERGYFSMTENGL
FT                   ESIDNPSEYFMTSRDKNEKVSGCALTVVKDGSRPIIVEIESLVSKTYTPYPSRIGECVR
FT                   REQLNTLISILEQRGRISLYDKDVVIKTTGGLKFKEPAVNLSIIMSIVSSVYDKEIPND
FT                   TAFISDVGLTGELKKVPSLELRIRELDRRGFGHVYVAKNALIRSLDIKNIEVHEVKSIQ
FT                   EVIGMVFK"
FT   gene            389977..391062
FT                   /locus_tag="Ccel_0337"
FT   CDS_pept        389977..391062
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0337"
FT                   /product="protein of unknown function DUF147"
FT                   /note="PFAM: helix-hairpin-helix motif; protein of unknown
FT                   function DUF147; KEGG: cth:Cthe_1785 DNA integrity scanning
FT                   protein DisA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74723"
FT                   /db_xref="GOA:B8I5Q6"
FT                   /db_xref="InterPro:IPR000445"
FT                   /db_xref="InterPro:IPR003390"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR018906"
FT                   /db_xref="InterPro:IPR023763"
FT                   /db_xref="InterPro:IPR036888"
FT                   /db_xref="InterPro:IPR038331"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q6"
FT                   /inference="protein motif:PFAM:PF02457"
FT                   /protein_id="ACL74723.1"
FT                   /translation="MRLERLKNDSFLDVLKMMAPGTTLREGLENILKAKTGALIVIGDS
FT                   PEVIKIVDGGFTINKPYTSSHLYELAKMDGAIVVSKDLKVILYANALLIPDPTIVTTET
FT                   GTRHKTAERFAKQTGEIVVCISQRRNVITLYKDSKKYILRDTSTILTRANQALQTLEKY
FT                   KSVLDAGIKKLNVLELEDIVTLNDVTYVIQRTEMVMRIVDEIDRYICELGNEGRLVSMQ
FT                   LEELVQNVENNVWLVIEDYSIKKDGINTNDIVKHLRNLSNDELVDQTSVAKLLGFSGAT
FT                   VSLDTSVLPKGYRMLSRLPKLPVTIMKNMINEFQNLQGVVKASIEDLDKVEGIGEVRAK
FT                   SITEGLLRIKEQTTMDKRSIY"
FT   gene            391180..392226
FT                   /locus_tag="Ccel_0338"
FT   CDS_pept        391180..392226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0338"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: lpf:lpl2033
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74724"
FT                   /db_xref="GOA:B8I0K1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8I0K1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL74724.1"
FT                   /translation="MTAQDRIVKNKMSLIELAEYLQNVSEACKIHGVSRQHFYDIKKAY
FT                   EENGLEGLKDKTRRKPCMKNRVAPETEEAVLRIAYEKPAYGQLRASNELRKQGVLVSAG
FT                   GVRSIWQRYNIETFDKRLKKLEEKAAKEGILYTEDQLAALEKAQQEKNISIDEIDTQHP
FT                   GYLLAQDTFYVGYIKGVGRIYQQTAIDTYSAVGFAKLYTAKVPVTAADILNDRVLPFFE
FT                   NHMIPIMRVLTDRGTEYCGAPEKHLYELFLQMNDIEHTMTKAKSPQTNGICERFNQTIL
FT                   NEFYKPAFRRTMYKSVEQMQEDLDFYMLEYNEERTHQGKRCKGKTPMQTFLDSLPLARE
FT                   KLLNDPAS"
FT   gene            complement(392416..392811)
FT                   /locus_tag="Ccel_0339"
FT   CDS_pept        complement(392416..392811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0339"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74725"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q8"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1784"
FT                   /protein_id="ACL74725.1"
FT                   /translation="MKDILVDDFQYTAQELLVRNKSILDLITKYQDSNSRVNRAVIKTV
FT                   TQCGCLSINAHKQDVSDDASFDEMKNSANGHVEGTLCDNCRDAIERDMGRNLFYLASIC
FT                   NTLDLNLYDIILKENDRIRMLGKYNLR"
FT   gene            393148..393627
FT                   /locus_tag="Ccel_0340"
FT   CDS_pept        393148..393627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0340"
FT                   /product="transcriptional regulator, CarD family"
FT                   /note="PFAM: transcription factor CarD; KEGG: cth:Cthe_2940
FT                   CarD family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74726"
FT                   /db_xref="InterPro:IPR003711"
FT                   /db_xref="InterPro:IPR036101"
FT                   /db_xref="InterPro:IPR042215"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Q9"
FT                   /inference="protein motif:PFAM:PF02559"
FT                   /protein_id="ACL74726.1"
FT                   /translation="MYNVGDKIVYPMHGAGVIESIEEKEILGKTCSYYVMKIPIGDLKV
FT                   MIPTNNITDIGIRDVISVSEADSVFDFLKNGQHEIPSNWNKRYRENMVKIKSGDIFEVA
FT                   DVVRGLMQREKEKGLSTGERKMLSSAKQILISELVLAKGINQHDVEVKIQEYLYG"
FT   gene            393652..394692
FT                   /locus_tag="Ccel_0341"
FT   CDS_pept        393652..394692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0341"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein;
FT                   deoxyribonuclease/rho motif-related TRAM; SMART: Nucleotide
FT                   binding protein PINc; KEGG: nth:Nther_0165 PilT protein
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74727"
FT                   /db_xref="GOA:B8I5R0"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="InterPro:IPR041120"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R0"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACL74727.1"
FT                   /translation="MLNRIIKISFSILGAITGVTILNTILLMNFKIGENLKVPLMLLFS
FT                   SVFCALFYFMAAKIIEVLIGFIDKIERGIQNVTMSELILGAAGLILGLIVANLVSTPII
FT                   KIQIIGLPIAVIINILFGLMGVILSQRKKNESIMDIFKEQSSARNTKLIDTCTIIDGRI
FT                   VDIFNAGFLEGDMVIPTYVLEELRHIADSQDGLRRARGRRGLDILNMLQKDNNNIVKID
FT                   ETDYPDIQETDEKLLRTAQKLKCKLVTIDYNLTKVAALKGIQVLNINDLANAVKPLALP
FT                   GEEMNILVVKDGKENGQGVGFLEDGTMIVVDGGKKYLGQTISVMVTSVLQTSAGRMVFV
FT                   KPNISD"
FT   gene            394722..395432
FT                   /locus_tag="Ccel_0342"
FT   CDS_pept        394722..395432
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0342"
FT                   /product="2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /note="TIGRFAM: 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase; PFAM:
FT                   4-diphosphocytidyl-2C-methyl-D-erythritol synthase; KEGG:
FT                   cth:Cthe_2941 2-C-methyl-D-erythritol 4-phosphate
FT                   cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74728"
FT                   /db_xref="GOA:B8I5R1"
FT                   /db_xref="InterPro:IPR001228"
FT                   /db_xref="InterPro:IPR018294"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR034683"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R1"
FT                   /inference="protein motif:TFAM:TIGR00453"
FT                   /protein_id="ACL74728.1"
FT                   /translation="MNQIIQSEKVTAIITAAGKGTRMKSSINKQYIEIAGVPVLARTIS
FT                   AFENCSEVDNIILVVNEEDINFCKNEIVEEFNFTKVISLVSGGAERQNSVYKGLCSIRD
FT                   KDGVVLIHDGARPFVTNENIVDCINAVREYGACGIGVRSKDTIKISDENGFVQLTPDRS
FT                   SLWSIQTPQGFMYEIIKNAHDKAVQNGYIGTDDMVLVEKLGIPVKIVEGNYQNIKITTP
FT                   EDLIMGESLLSSGK"
FT   gene            395452..397086
FT                   /locus_tag="Ccel_0343"
FT   CDS_pept        395452..397086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0343"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; SMART: AAA ATPase; KEGG: cac:CAC1558
FT                   ABC-type transport system,membrane ATPase component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74729"
FT                   /db_xref="GOA:B8I5R2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74729.1"
FT                   /translation="MGSLKSLLKIIPFIKKYRLFFCIGMVGTILCSVASVPIPYFIGYI
FT                   LDNVVAGSKSYKALYYYIGLIALLYVLRYVISFVAQYMFAKVSNEVTNEMRYSVIGKVL
FT                   DLPMNYLSSTEKGYVQSRIGECGNVSVVFSPSNIGLVLGLVDAVAAAIAMFSLNFKLAL
FT                   VTVVLSPVFYFSSKASAGGFMKVTHQMLESNAVLNGECFEIINGIEDIKILNGKENQLK
FT                   RFKTKLDDLVKKSIKQSKSILIFIENITIANNIGTLIILLIAGILIIRGQFTIGLYTSF
FT                   SLYIGRVFGASQGLATAGTTIKPACMSIERLYELLDMKGEDDGKTKNIENIIDSIKAEN
FT                   VTFRYNNNDRNVINSLSFEINKGEKVLLRGENGSGKSTLIKLLVGLYTPNEGNILFNNT
FT                   DLTTINNKSLRDRIGIVSQSIFLFRGTVLDNILYGQNEKKREDVELLIKKLNLEAYINR
FT                   LPKGLDSEISQNTAGISGGQAQVIAFIRAMLLEKDVVILDEPISNVDVETRDIILNILK
FT                   NNEYKGILIVVSHIVDNMEFINKVIEF"
FT   sig_peptide     395452..395556
FT                   /locus_tag="Ccel_0343"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.886 at
FT                   residue 35"
FT   gene            complement(397373..397879)
FT                   /locus_tag="Ccel_0344"
FT   CDS_pept        complement(397373..397879)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0344"
FT                   /product="2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase"
FT                   /note="TIGRFAM: 2C-methyl-D-erythritol 2,4-cyclodiphosphate
FT                   synthase; PFAM: MECDP-synthase; KEGG: cth:Cthe_2946
FT                   2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74730"
FT                   /db_xref="GOA:B8I5R3"
FT                   /db_xref="InterPro:IPR003526"
FT                   /db_xref="InterPro:IPR020555"
FT                   /db_xref="InterPro:IPR036571"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R3"
FT                   /inference="protein motif:TFAM:TIGR00151"
FT                   /protein_id="ACL74730.1"
FT                   /translation="MCLNILKEMENTMKVGIGQDSHRFDFQNNSKKFILGGVIFDDVTP
FT                   LDGNSDADVVLHALTNAISGVTCVNILGKVSDEMCLERGITDSSEYLREALKYLVDVKV
FT                   VHVSISIECSYPKISPKIAEMRKSISELLGIPENCVGITATTGEGLTAFGQGKGVQAFC
FT                   IVTAI"
FT   gene            398062..399498
FT                   /locus_tag="Ccel_0345"
FT   CDS_pept        398062..399498
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0345"
FT                   /product="prolyl-tRNA synthetase"
FT                   /note="TIGRFAM: prolyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (G H P and S); Anticodon-binding domain
FT                   protein; Prolyl-tRNA synthetase, class II-like; KEGG:
FT                   cpy:Cphy_3837 prolyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74731"
FT                   /db_xref="GOA:B8I5R4"
FT                   /db_xref="InterPro:IPR002314"
FT                   /db_xref="InterPro:IPR002316"
FT                   /db_xref="InterPro:IPR004154"
FT                   /db_xref="InterPro:IPR004499"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR016061"
FT                   /db_xref="InterPro:IPR017449"
FT                   /db_xref="InterPro:IPR033721"
FT                   /db_xref="InterPro:IPR036621"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5R4"
FT                   /inference="protein motif:TFAM:TIGR00408"
FT                   /protein_id="ACL74731.1"
FT                   /translation="MAKDKKLVEEITSMNDDFGQWYTDVIKKAELVDYSSVRGCMVIKP
FT                   YGYAIWENIQKSLDTRFKETGHENVYMPMFIPESLLLKEKEHVEGFAPEVAWVTHGGDE
FT                   KLTERLCVRPTSETLFCEHYSNSIQSYRDLPKLYNQWCSVVRWEKTTRPFLRTLEFLWQ
FT                   EGHTAHATAEEAQEETIRMLNVYADVLENVLAIPVIKGRKTEKEKFAGAHATYTVESLM
FT                   HDGKALQSGTSHNFGDGFAKAFDIQYTDKNNQLQYVHQTSWGVTTRLIGAIIMVHGDDS
FT                   GLVLPPAIAPTQLVIIPVSQHKEGVLEKANELKQKLSAKFRVKMDDSDKMPGWKFSEYE
FT                   MKGVPLRIEIGPKDIEKNQAVLVRRDNREKIFVSLDNLEETVVNTLADVQKSLLEKARE
FT                   LRDKKTYIAATLEEFDQIINSTPGFVKGMWCGERECEDLVKEKTGATARCMPLEQEQLS
FT                   DKCMCCGKPAKSMVYWGKAY"
FT   gene            399663..400448
FT                   /locus_tag="Ccel_0346"
FT   CDS_pept        399663..400448
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0346"
FT                   /product="SCP-like extracellular"
FT                   /note="PFAM: SH3 type 3 domain protein; SCP-like
FT                   extracellular; SMART: SH3 domain protein; KEGG:
FT                   cth:Cthe_2948 allergen V5/TPX-1 related"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74732"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR007397"
FT                   /db_xref="InterPro:IPR014044"
FT                   /db_xref="InterPro:IPR035940"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R5"
FT                   /inference="protein motif:PFAM:PF00188"
FT                   /protein_id="ACL74732.1"
FT                   /translation="MKKRKKAAIVLIVLVSAFTLLPIGTLQYRVDASQSYQNLASSAGM
FT                   ITAQDVNLRTGPNTKFDSLYKLKKGHKLTVMGKLGDWYAVYDSANGNIGAVSARYLKVA
FT                   QPKAVAKAKKVNTVKSNSNETVQKAVAAKVIDVSPDEKALLDMVNNARREEGLNPLTID
FT                   ENLVKIARLKATDMKNNNYFSHTSSYYGTPFDMMKKYGVKFSIAGENLAGNQSMEKALT
FT                   AWLKENGNNLYNKEFTHTGIGVVESPTYGKLFVEMFMKK"
FT   sig_peptide     399663..399737
FT                   /locus_tag="Ccel_0346"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.987) with cleavage site probability 0.351 at
FT                   residue 25"
FT   gene            complement(400581..401492)
FT                   /locus_tag="Ccel_0347"
FT   CDS_pept        complement(400581..401492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0347"
FT                   /product="pseudouridine synthase, RluA family"
FT                   /note="TIGRFAM: pseudouridine synthase, RluA family; PFAM:
FT                   pseudouridine synthase; KEGG: cth:Cthe_1962 RluA family
FT                   pseudouridine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74733"
FT                   /db_xref="GOA:B8I5R6"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR006145"
FT                   /db_xref="InterPro:IPR006224"
FT                   /db_xref="InterPro:IPR006225"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R6"
FT                   /inference="protein motif:TFAM:TIGR00005"
FT                   /protein_id="ACL74733.1"
FT                   /translation="MRSITAEENHEGKKIDRVVRDFFPNLASGMLYKALRKKDIKVNGV
FT                   RIKEDYIVSFGDKIDIYIIDDYLIGRDDDGFSVVYDDDNLLIVNKETGIPVHPDKNQKE
FT                   ATLIDKLQSIYGPNLALCHRLDRNTSGLVIIAKNPATLEVMLEKIKNREIQKYYTCIVS
FT                   GKMEKKNAELVDYLEKNEKLSRVFINPEKTRNSVQIITRYRILASMNSLNLLEVELVTG
FT                   RTHQIRAHLAYYGHPIIGDGKYGKNAENKQYNAKYQLLCASRLTFNFQSSARHLNYLNK
FT                   KTVSIDPPFSLEQVAGRQNKKL"
FT   gene            complement(401494..403926)
FT                   /locus_tag="Ccel_0348"
FT   CDS_pept        complement(401494..403926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0348"
FT                   /product="Nucleotidyl transferase"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; Nucleotidyl transferase;
FT                   phosphoglucomutase/phosphomannomutase alpha/beta/alpha
FT                   domain I; KEGG: cth:Cthe_1961 nucleotidyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74734"
FT                   /db_xref="GOA:B8I5R7"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="InterPro:IPR036900"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R7"
FT                   /inference="protein motif:PFAM:PF00483"
FT                   /protein_id="ACL74734.1"
FT                   /translation="MKAIIMAGGEGSRLRPLTCDLPKPMVPIMNKPVLEHTIGLLKSYG
FT                   ITDIGITLLYHPQIIKDYFGSGHSCGVNIYYFLEESPLGTAGGIKNAREFLDETFIVIS
FT                   GDSLTDLNIENALEYHRSKKSIATLILTKVDVPLEYGVVLTDEDGSIKGFVEKPSWGEI
FT                   FSDMVNTGIYILEPEILSYIEVGKNTDFSRDVFPALLSSSKKIFGYVSNDYWCDIGDTR
FT                   SYINSHYDILNKNLKIDIGEELDENIWVGPGTVIDKNARIIPPCVIGSNCKIGSGTVIG
FT                   SYTVIGNNTIVKNDVSVVRSILWDNCYIEYGSELRGAILCNHVNLKNYVSVFENSVIGE
FT                   GCKINERAIIKPNIRLWPEKIVEPLAIVDRNMIWGSRHNSKIFGENGISGIINVDISPE
FT                   YATRLGAAYGSHLKTGSKVVVSSTNSNSARMFKHAFISGILSVGVEVFNMSSLLTPISR
FT                   YAIGFLKADGGIHIKTDMDNPNVVRVDFMDSRGTSISRSSERKIENSFFREDFKRCSSQ
FT                   QISRLNNITDFSSYYVRNLIQNTNVNAIKQHNPKVCIFSRSEFVRSIVGPMLTNMGCQV
FT                   ISHQNCVDISLVTSVLVETDCEFGAIIDSNGENLTLISREGIIVKDDLFQAFISLIVFK
FT                   RSPGTTFYVPITSSEVIERLALRYRCVVKRTKNCLQAVMDEILNRRNNSADFDQLVLNF
FT                   DAIAGLVKIIEYMCVSGITLNQLLLEIPKIYIDRKSIYCPWELKGTVMRRIINDNKDKK
FT                   AELIDGIKLYLEDGWVLIIPDADTPAFKIISEGSSAVTAKEHCVRFHNIVERIITNS"
FT   gene            complement(403990..404286)
FT                   /locus_tag="Ccel_0349"
FT   CDS_pept        complement(403990..404286)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0349"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74735"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74735.1"
FT                   /translation="MQEELVFLYNNISDAKNILGSLKDKGIQRAYLTTTEFGLLAGIDQ
FT                   KQSIKKFPGAFLSTVVKLVVEVEPDNKQNALSLLEGSFGVEDIKILKDYYNKR"
FT   gene            complement(404384..404797)
FT                   /locus_tag="Ccel_0350"
FT   CDS_pept        complement(404384..404797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0350"
FT                   /product="GtrA family protein"
FT                   /note="PFAM: GtrA family protein; KEGG: pdi:BDI_1652
FT                   putative GtrA family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74736"
FT                   /db_xref="GOA:B8I5R9"
FT                   /db_xref="InterPro:IPR007267"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5R9"
FT                   /inference="protein motif:PFAM:PF04138"
FT                   /protein_id="ACL74736.1"
FT                   /translation="MNSFGILKDKFGNIMRQMVKYGLVGVINTIITMIVLFVLQNAFGV
FT                   SYKLANGAGYVCGFINSFILNKFWTFKGNQKSTLSQFIRFSLVFAVCYAMQLGFVVLLV
FT                   EKMHIEKNISQLIGMVFYTLISFLLNKVFTFKN"
FT   gene            404956..405642
FT                   /locus_tag="Ccel_0351"
FT   CDS_pept        404956..405642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0351"
FT                   /product="putative integral membrane protein"
FT                   /note="KEGG: tbd:Tbd_2287 putative integral membrane
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74737"
FT                   /db_xref="GOA:B8I5S0"
FT                   /db_xref="InterPro:IPR014509"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S0"
FT                   /inference="similar to AA sequence:KEGG:Tbd_2287"
FT                   /protein_id="ACL74737.1"
FT                   /translation="MSKFMKKISLLDTSKNQVPFSKNRALHTMMAAYAIVFIILSIKPV
FT                   NTFEWWYESIVPLTVIILLGLFYSKNRLTNTAYLCILTVLVLHAVGAHYTYTACPIGMW
FT                   MSRIFGFNRNHFDSIVNFFFGLLISIPVLESIYYRIRIRYIGACMLSVVIILAASAFYE
FT                   LFQMFSTMILSDGRMEIFLGIQGDLWDSQKDMAFVVLGAFMSMSTCIIFRINKNHKIHM
FT                   VRYRKN"
FT   gene            405659..406621
FT                   /locus_tag="Ccel_0352"
FT   CDS_pept        405659..406621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0352"
FT                   /product="UV-endonuclease UvdE"
FT                   /note="PFAM: UV-endonuclease UvdE; KEGG: cth:Cthe_1958
FT                   putative UV damage endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74738"
FT                   /db_xref="GOA:B8I5S1"
FT                   /db_xref="InterPro:IPR004601"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S1"
FT                   /inference="protein motif:PFAM:PF03851"
FT                   /protein_id="ACL74738.1"
FT                   /translation="MIFRLGFVAMTLDLEDCSPSGTVTYAAYNKLKDEAAKHARLVRVA
FT                   RCNINNTLRILKNSLALDIKVYRLTSKLIPLATHSELKDWNYVSDFCEEFERLGEYIRA
FT                   NNFRISAHPDHFTILNPIKPEILESSLRDLDYHVRLFEAMGLYDCRYKLVLHVGGLYGD
FT                   KEKSIARFKENFLKLPDRISKRIILENDDKSFTAADVLEICEDLKIPMVLDVHHHRCVN
FT                   YGEKLGELLDRIYKTWDLQDDPPKVHYSSPKNEKEFRSHADYVDLTEFLDFLHTAKKSE
FT                   RDIDIMLEAKMKDKALQKLSGELAEIPEITRLDKATFQI"
FT   gene            406744..406863
FT                   /pseudo
FT                   /locus_tag="Ccel_0353"
FT   gene            407009..409165
FT                   /locus_tag="Ccel_0354"
FT   CDS_pept        407009..409165
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0354"
FT                   /product="RNA binding S1 domain protein"
FT                   /note="PFAM: RNA binding S1 domain protein; SMART:
FT                   Resolvase RNase H domain protein fold; KEGG: cth:Cthe_1955
FT                   RNA binding S1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74739"
FT                   /db_xref="GOA:B8I5S2"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR006641"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018974"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR023319"
FT                   /db_xref="InterPro:IPR023323"
FT                   /db_xref="InterPro:IPR032639"
FT                   /db_xref="InterPro:IPR037027"
FT                   /db_xref="InterPro:IPR041692"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S2"
FT                   /inference="protein motif:PFAM:PF00575"
FT                   /protein_id="ACL74739.1"
FT                   /translation="MTDIVGQLIREFNLKPFQVQNTVKLIDEGNTIPFIARYRKEVTGE
FT                   LNDQVLRELNERLVYLRNLDERREDVRRLIEEQGKLTEEIVKSLDSAMTLQEIEDIYRP
FT                   YKLKRKTRASVAREKGLEPLATIIYSQLPTKTSINEIASRYINEEKGINSVDEAIKGAL
FT                   DIIAEEVSDNAEFRKVLREIIFKNGLVMSFGKKDEDSVYRMYYDFKEPVSKIARHRVLA
FT                   LNRGEKEDFLSVKIDLNEDLCLNFLKSNTLKNTNTEMSKYVESAVEDSFKRLIFPSLER
FT                   DIRNQLTELAEDQAIKVFSENLRNLLLQPPVKDRVVLGLDPAYRTGCKLAVVDGTGKVL
FT                   ETTVIYPTPPQNKIDEAKKKVKELIKKYEVDIISIGNGTASKESEIFVADLLKEIDREV
FT                   YYMVVSEAGASVYSASKLGAEEFPDFDVALRSAVSIARRLQDPLAELVKIDPKAIGVGQ
FT                   YQHDMNQKRLDESLGGVVEDCVNNVGVDLNTASAPLLSYVSGISTAIAKNVVEYREENG
FT                   KFKARNELKKVKKLGNKTFEQCAGFLRITDGENILDNTSVHPESYKAAKLLLEKMGYSL
FT                   EDVRAKKLSGLDNKVQQAGMSRIAEELGIGVPTLKDIINELLKPGRDPRDELPKPMLHS
FT                   DVLHMEDLKQGMILTGTVRNVADFGAFVDIGVHQDGLVHISQLADKYVKNPMDVVAVGD
FT                   IVKVKILEVDVERKRISLTMKEIN"
FT   gene            409244..410131
FT                   /locus_tag="Ccel_0355"
FT   CDS_pept        409244..410131
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0355"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74740"
FT                   /db_xref="GOA:B8I5S3"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S3"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1954"
FT                   /protein_id="ACL74740.1"
FT                   /translation="MGTVNKALHLIAKRPSVLLLTALISIVVCVFEYFFMTLFYGITMF
FT                   KTGSPFDDYVNIIQFVINAVSVPETAVKIILVLAIAVVSASLILGLIFSGCFNILYNAV
FT                   QGKEKKAGSEFVHGVKKYFLRMISLNLWTICAVFIFVIYVLIATIPAAIVVDNSISGTM
FT                   NPLAGVVLSIITAIVLFFSYTFFRQYIAFWYPSAIAYEKSHFKMAKKVSDRNFWPLLSK
FT                   FIAFDIILVLFDILYIIANFTLANTQVVSGTINTILIVVNIVFKTIVFAILICFVFSSF
FT                   KKCNDDYKYKEQIR"
FT   gene            complement(410128..410514)
FT                   /locus_tag="Ccel_0356"
FT   CDS_pept        complement(410128..410514)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0356"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74741"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74741.1"
FT                   /translation="MVYRKRPPNSRRYNKNHSAQQQSGHEQNEQNLTITEEQTVNPQTE
FT                   EALPPKEPASRETKTPKPLSFLSSILGTGDRTERSGSPLFTVFDYDIYFDDLLLVGLIV
FT                   LLFTDKVEDELLLIILLYLLLDIF"
FT   gene            complement(410568..410969)
FT                   /locus_tag="Ccel_0357"
FT   CDS_pept        complement(410568..410969)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0357"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1951 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74742"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S5"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1951"
FT                   /protein_id="ACL74742.1"
FT                   /translation="MSDDMGDKIKQIAEMLGQDSNSGIPDNVKGLLNMFMSANNSKDET
FT                   SSDDNSSEKSNPPEETSRADTDDLADMARKMKKAMNMLNTAKDPRVNLLNAVKPYLNDN
FT                   RQKKLQKCMKIIKIGSLTKMLDESEGRSV"
FT   gene            complement(411006..411320)
FT                   /locus_tag="Ccel_0358"
FT   CDS_pept        complement(411006..411320)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1950 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74743"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S6"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1950"
FT                   /protein_id="ACL74743.1"
FT                   /translation="MGDSLGKKIQEMMQDKMVQSKVNKAIDMLKKDSTKDLEKKLSAIN
FT                   KDELMEKVNEFDEEKLKNIKIDKDEIKKKITQKDLDKLQKILGKDSDVIMKKVNDFLNS
FT                   "
FT   gene            complement(411480..411686)
FT                   /locus_tag="Ccel_0359"
FT   CDS_pept        complement(411480..411686)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0359"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cbf:CLI_3364 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74744"
FT                   /db_xref="GOA:B8I5S7"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S7"
FT                   /inference="similar to AA sequence:KEGG:CLI_3364"
FT                   /protein_id="ACL74744.1"
FT                   /translation="MGCFGGSSNGFDWWWILILIIIICCCCGGNNGFFGGNFFNEDCDW
FT                   LVCLAVILLIFFLCNNQDDCCRD"
FT   gene            411861..412736
FT                   /locus_tag="Ccel_0360"
FT   CDS_pept        411861..412736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0360"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: cth:Cthe_1945 thioredoxin-disulfide
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74745"
FT                   /db_xref="GOA:B8I5S8"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S8"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACL74745.1"
FT                   /translation="MVDVIIIGKGPAGISASLYTVRAGLRTLVIGLDNSVLNKADRIEN
FT                   YYGFAEPVSGKYLLEQGEKQARRLGVKFIQSEVIALEKAEYFEVYTTQDNYSAKAVLMA
FT                   TGQQTKKVNIDGLEKFEGRGVSYCTTCDGFFYRGLKVGLVGFKDYAIHEVMELEPLTKD
FT                   ITIYTNGNELQLTDKYKFHASRFTINDKKITSVVGKEVVEGIVFEDGSVANLDGLFVAF
FT                   ESASSIDFARKLGVITKNNSIVVDENQSTNLKGLFAAGDCIGGFKQISTAVGQGAMAGK
FT                   RIIEFVRNNS"
FT   gene            412913..414319
FT                   /locus_tag="Ccel_0361"
FT   CDS_pept        412913..414319
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0361"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   KEGG: afl:Aflv_2620 sporulation histidine kinase A"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74746"
FT                   /db_xref="GOA:B8I5S9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5S9"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL74746.1"
FT                   /translation="MFGIFILLWIISILIIYANPKEYWAWCASLCLLFNGFGGLSAVLG
FT                   DKLIPYLEACGNENLIFASRIFKGTADILQHYFATYVFLIFVLLFTNFLNIQMKSIIKK
FT                   TIVGLLSVPSILMLFLYPITPDFNPNYGILSCWVCVYTLLANIILIISIVKEKDDYTKT
FT                   QRILTSLYAVPSTICVLWTSYISVAIGYSRVWKANVWVIAGEFILFIVFCLKYGMLGIH
FT                   FKIERINIDNNIDSIIGGMSIVSHAIKNEVSTINLCVETIMCVEKTSPGMAHKLSIIKN
FT                   SCKNLLEFTRKVSEIKLYKMNFKPCLLSEITTEVINQVAPSICEKNIQIINESKIDITM
FT                   LIDPVHVSEVLKNLIINAIEAIPSEGIISVNAEFLNNKKLCIRVSDNGIGIPKDFINKV
FT                   MTPFFSTKKGKNNFGLGLSYCFKVMKSHNGNLQIKSKENQGTDMCLIFPINKVVHVYSK
FT                   SLPKNKSYHL"
FT   gene            414453..415190
FT                   /locus_tag="Ccel_0362"
FT   CDS_pept        414453..415190
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0362"
FT                   /product="cytochrome b5"
FT                   /note="PFAM: cytochrome b5; KEGG: cth:Cthe_1942
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74747"
FT                   /db_xref="InterPro:IPR019606"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T0"
FT                   /inference="protein motif:PFAM:PF10646"
FT                   /protein_id="ACL74747.1"
FT                   /translation="MRKLICLFMVFGTIFTMLTGCGFKSEETQSDELTPVSSLTIGQEE
FT                   ANGLKDKTPVQLYFINEQGIKLAAETRYIQNTDVGKGNEHMATVILKELISGPAKGSLL
FT                   KASVPKEAKVLTDIKIKDGVATVDLSKDFIEKHPGGKKNEQLTLYSIVNTLTEIKDITS
FT                   VQFRVNGKVTKEFKGSYQIDIAYSRDTHLISNEPGKDSTIKTTAEDKDNTRDKTAQPTK
FT                   EDETKKTNSDAETNADLEDEILE"
FT   sig_peptide     414453..414527
FT                   /locus_tag="Ccel_0362"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.845) with cleavage site probability 0.583 at
FT                   residue 25"
FT   gene            complement(415298..415513)
FT                   /locus_tag="Ccel_0363"
FT   CDS_pept        complement(415298..415513)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0363"
FT                   /product="regulatory protein, FmdB family"
FT                   /note="TIGRFAM: regulatory protein, FmdB family; PFAM:
FT                   Putative regulatory protein FmdB; KEGG: cth:Cthe_1941 FmdB
FT                   family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74748"
FT                   /db_xref="InterPro:IPR013429"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T1"
FT                   /inference="protein motif:TFAM:TIGR02605"
FT                   /protein_id="ACL74748.1"
FT                   /translation="MPFYDLKCSKCGSEFNVMAKMSQRENREIKCPDCGSNDLETIFKN
FT                   VNIIQSRKDSGGDCPKRHVCGGCCNH"
FT   gene            415648..416586
FT                   /locus_tag="Ccel_0364"
FT   CDS_pept        415648..416586
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0364"
FT                   /product="Ku protein"
FT                   /note="TIGRFAM: Ku protein; PFAM: Ku domain protein; KEGG:
FT                   bha:BH2208 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74749"
FT                   /db_xref="GOA:B8I5T2"
FT                   /db_xref="InterPro:IPR006164"
FT                   /db_xref="InterPro:IPR009187"
FT                   /db_xref="InterPro:IPR016194"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T2"
FT                   /inference="protein motif:TFAM:TIGR02772"
FT                   /protein_id="ACL74749.1"
FT                   /translation="MHTVWKGSISFGLVNIPVKMFTATEDKDIRFKYIHKECHSPVKYK
FT                   KVCPVCNKEVQPEDIVRGFEYEPGKYVIMTGEDFESLQVKSEKTVEIIDFVKLEEVDPV
FT                   YFDKTYFLAPQETGGKAYTLLREALGQKEKIAVSKITIRDRESLAVIRVYKNVLVLETI
FT                   FYPDEVKDSAQVPGIPEATKTTPAELDMATQLIDNLTTAFDPSKYVDTYREKLVELINA
FT                   KVEGKQVVARKEVEKENVVSLMEALQRSIQMSKGTNKNEKDKDADKADKSVKNVKNSKK
FT                   DQVSKVENTKNITTEEKPKKRTRKTREKVES"
FT   gene            416583..417557
FT                   /locus_tag="Ccel_0365"
FT   CDS_pept        416583..417557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0365"
FT                   /product="ATP dependent DNA ligase"
FT                   /note="PFAM: ATP dependent DNA ligase; KEGG: nth:Nther_0138
FT                   ATP dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74750"
FT                   /db_xref="GOA:B8I5T3"
FT                   /db_xref="InterPro:IPR012309"
FT                   /db_xref="InterPro:IPR012310"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR016059"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T3"
FT                   /inference="protein motif:PFAM:PF01068"
FT                   /protein_id="ACL74750.1"
FT                   /translation="MKWIIPMEPVICPNVKTGADYIHEIKWDGIRGMVYIQDGSVKIYT
FT                   KKGKERTGFYPELDVFKKGLGGQNAVFDGELVVLDENGVPSFYKSLIRERVRNSGKLKY
FT                   YTNAYPVCYMVFDILQYGDNILVNMPLMDRKQILDKNLSSITGNDTGIFLTKVYPNGKD
FT                   LFEKMKEQNMEGIVSKKTDSLYIGGKKHEAWFKTKFIKKMLCVVGAIQWKSLQPNSLVL
FT                   GIKPGDSQKLVYVGKASIGLKQSDLMLIREYSGQLEQEQCPFTSEEMVQLDRTGEKFTW
FT                   LYPALTCWISFLELTNDGHLRHPKIEGFALLPAEEADGKVLTE"
FT   gene            417557..418471
FT                   /locus_tag="Ccel_0366"
FT   CDS_pept        417557..418471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0366"
FT                   /product="DNA polymerase LigD, polymerase domain protein"
FT                   /note="TIGRFAM: DNA polymerase LigD, polymerase domain
FT                   protein; PFAM: DNA primase small subunit; KEGG:
FT                   swo:Swol_1124 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74751"
FT                   /db_xref="InterPro:IPR014145"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T4"
FT                   /inference="protein motif:TFAM:TIGR02778"
FT                   /protein_id="ACL74751.1"
FT                   /translation="MATVTDVLKVEIENKVIDIKNPDKLFWPEAGITKLEYVKTMTKLA
FT                   PFLIKYSKHRMLTSIRYPHGINDKSFFQKEKPQGTPEWVETVEFNQKNYINLNSAATLV
FT                   WLCTQAALELHTSFNVHEKPNHPSSLVFDLDPDDDLHFEDVAELAGRIHETLEALGIMD
FT                   FIKTSGATGLQIFVPVAAKFDYDTARSLNEFFAQYFAEKLRSTVTIERMKKKREGKIYF
FT                   DWQQMWTGKSMITAYSARAVKSAAVSAPIEWSELNDVRPEMFTLKNIINRLEQKGDIFE
FT                   PSLKCDNSPQLNEISKQIEAAKK"
FT   gene            418584..419597
FT                   /locus_tag="Ccel_0367"
FT   CDS_pept        418584..419597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0367"
FT                   /product="UDP-glucose 4-epimerase"
FT                   /note="TIGRFAM: UDP-glucose 4-epimerase; PFAM:
FT                   NAD-dependent epimerase/dehydratase; short-chain
FT                   dehydrogenase/reductase SDR; 3-beta hydroxysteroid
FT                   dehydrogenase/isomerase; polysaccharide biosynthesis
FT                   protein CapD; dTDP-4-dehydrorhamnose reductase; Male
FT                   sterility domain; KEGG: drm:Dred_3002 UDP-glucose
FT                   4-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74752"
FT                   /db_xref="GOA:B8I5T5"
FT                   /db_xref="InterPro:IPR005886"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T5"
FT                   /inference="protein motif:TFAM:TIGR01179"
FT                   /protein_id="ACL74752.1"
FT                   /translation="MKVLVTGGAGYIGTHTCVELLEAGFEVIVVDNLCNSKETAIERVE
FT                   KITGKKIKFYKVDILDKEALEQVFINNQPDSVIHFAGLKAVGESVSIPLKYYHNNITGT
FT                   LILCELMEKYGVKNLVFSSSATVYGDPASVPISEEFPLSVTNPYGRTKLMIEEILKDLH
FT                   VADASWNIALLRYFNPIGAHESGTIGEDPNGIPNNLVPYITQVAVGKLKEVNVFGNDYD
FT                   TVDGTGVRDYIHVVDLAKGHIKALEKLTNEHIGIREYNLGTGNGYSVLQVIKAFSEACG
FT                   KEIPYKITGRRPGDIAECYAKPDRAKSELGWTAEKGLSEMCVDSWRWQSQNPEGYK"
FT   gene            419626..420555
FT                   /locus_tag="Ccel_0368"
FT   CDS_pept        419626..420555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0368"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cpy:Cphy_0247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74753"
FT                   /db_xref="GOA:B8I5T6"
FT                   /db_xref="InterPro:IPR005835"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T6"
FT                   /inference="similar to AA sequence:KEGG:Cphy_0247"
FT                   /protein_id="ACL74753.1"
FT                   /translation="MENNTALVIMAAGMGSRYGGLKQIDPVGPNGEIIMEYSIYDAIRA
FT                   GFNKVVFIIKKEIEDTFREVIGKKIEGIIDVEYVYQKVDNLPQGFSVPDGRVKPWGTGH
FT                   AVLSAKDAVKTPFAVINADDFYGAETHRLLKGFLTNNQDADNKYKYCMVGFVIENTLTE
FT                   NGHVARGVCNVDSQGNLIDIHERTKIVKFGNETKYTEDDTNWIKIPEKSIVSMNTWGFN
FT                   PSILHELEDRFPDFLRKNKENILKAEYFLPTVVDDLIKEGKADVKVLSTADKWYGVTYK
FT                   EDKPIVKKSISDMVSGHKYPNRLWENIK"
FT   gene            420696..420959
FT                   /locus_tag="Ccel_0369"
FT   CDS_pept        420696..420959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0369"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: csc:Csac_2372 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74754"
FT                   /db_xref="InterPro:IPR025306"
FT                   /db_xref="InterPro:IPR026363"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T7"
FT                   /inference="similar to AA sequence:KEGG:Csac_2372"
FT                   /protein_id="ACL74754.1"
FT                   /translation="MYTDKTLVCKECENEFIFSAGEQEFYAEKGFQNEPTRCKACRSKR
FT                   DHSSKRELFEAVCAECGQTTKVPFKPHLDKPVLCSKCFANKK"
FT   gene            421335..421865
FT                   /locus_tag="Ccel_0370"
FT   CDS_pept        421335..421865
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0370"
FT                   /product="sigma 54 modulation protein/ribosomal protein
FT                   S30EA"
FT                   /note="TIGRFAM: ribosomal subunit interface protein; PFAM:
FT                   sigma 54 modulation protein/ribosomal protein S30EA; KEGG:
FT                   cth:Cthe_2875 sigma 54 modulation protein / SSU ribosomal
FT                   protein S30P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74755"
FT                   /db_xref="GOA:B8I5T8"
FT                   /db_xref="InterPro:IPR003489"
FT                   /db_xref="InterPro:IPR032528"
FT                   /db_xref="InterPro:IPR034694"
FT                   /db_xref="InterPro:IPR036567"
FT                   /db_xref="InterPro:IPR038416"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T8"
FT                   /inference="protein motif:TFAM:TIGR00741"
FT                   /protein_id="ACL74755.1"
FT                   /translation="MNIIISGKNIEITEALREKVTKKVKKLEKFFNSDTEVHVTLSVQR
FT                   VSQIVEITIPFNGVTLRAEDQNEDMYTSIDRVIDLIERQIRKNKTRLERRLHDHDFKVD
FT                   NSKFTYDVQEETEFKVVRSKRFAVKPMDVEEAILQMNLLGHEFFMFYNADSRQVNVVYK
FT                   RKDGNYGLIEPEF"
FT   gene            422059..423936
FT                   /locus_tag="Ccel_0371"
FT   CDS_pept        422059..423936
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0371"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: cac:CAC2802 phosphoglycerol
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74756"
FT                   /db_xref="GOA:B8I5T9"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR012160"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5T9"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACL74756.1"
FT                   /translation="MLGKPSYGIVMVNRRRLGRKTGLVNYLAQEWMAILTLAVLLFKSI
FT                   VLMGFVYSPDKSVIDITRGFNNIRYMSVCVAFLIIIVSFNYLAKGKGRLWLLLILNFLC
FT                   SFLYVFDAVYLRANGNFLSTQLLRQTGNVNNLWGSIFAMFRPCDIVFFIDIPILVAILI
FT                   ITRKMYYSSPLFTSMKTRLIAFGSLFAMSVAFIIGSYIVIDVYGNNKYAYIFHTYWKPE
FT                   ATICNASPLGYHLYDCYVFFADFRPYEISEKERTEIQKWIDDKKENLPDNSYKGMYQGK
FT                   NLLVLQVESLENFVIGQSVNGQEITPILNKLLKNSIYFDNYYTQVNEGTSSDAELMTNT
FT                   SVFPVRKGSTFFRFPYTEYNSLPKIMGKYGYSTKAIHPDDGAYWNWKEALTNMGFQQCI
FT                   DSKSFKMDEIIFLGLSDGSYFRQIKDTIIQQKQPFYNFMITLTSHSPFEMPKEHQYLNL
FT                   DSYLENTRLGGYFQSINYTDRYIGTFLDELDKAGILDNTVVAIYGDHDSVHKYFDDQIR
FT                   EIKPSQSWWLENDKKIPLILYEKGQTPQVIHTTGGQIDLMSTLLYSFGIEKSEYESTSF
FT                   GRNLLNTQQDYVLLADGEFRGNIDKAKQKELLDGLEYADMAIKTNFFKK"
FT   gene            423954..424457
FT                   /locus_tag="Ccel_0372"
FT   CDS_pept        423954..424457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0372"
FT                   /product="shikimate kinase"
FT                   /note="PFAM: shikimate kinase; KEGG: mem:Memar_2255
FT                   shikimate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0372"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74757"
FT                   /db_xref="GOA:B8I5U0"
FT                   /db_xref="InterPro:IPR000623"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031322"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U0"
FT                   /inference="protein motif:PFAM:PF01202"
FT                   /protein_id="ACL74757.1"
FT                   /translation="MKNIILIGMPSAGKSTVGVIVAKHRGMSFVDTDVLIQTTQGRLLQ
FT                   EILNNDGTDAFLKIEESSVLSLNCSDTVIATGGSAVYSEKAMDYLKRTGTVIYLYVDME
FT                   TVNKRLKNLKTRGVVLGPGESLEYIYSKRQPLYEKYADIIIDCSETTIDSTVEMIHERL
FT                   DSLS"
FT   gene            424571..426928
FT                   /locus_tag="Ccel_0373"
FT   CDS_pept        424571..426928
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0373"
FT                   /product="ATP-dependent DNA helicase PcrA"
FT                   /note="TIGRFAM: ATP-dependent DNA helicase PcrA; PFAM:
FT                   UvrD/REP helicase; KEGG: cth:Cthe_2876 ATP-dependent DNA
FT                   helicase PcrA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74758"
FT                   /db_xref="GOA:B8I5U1"
FT                   /db_xref="InterPro:IPR000212"
FT                   /db_xref="InterPro:IPR005751"
FT                   /db_xref="InterPro:IPR013986"
FT                   /db_xref="InterPro:IPR014016"
FT                   /db_xref="InterPro:IPR014017"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR034739"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U1"
FT                   /inference="protein motif:TFAM:TIGR01073"
FT                   /protein_id="ACL74758.1"
FT                   /translation="MDLLNGLNKEQKEAVLHNEGPLLILAGAGSGKTRVLTHRIAYLIE
FT                   QHGIYPSNILAITFTNKAAREMKERIAGLIGDLSNDMWVGTFHSICIRILRRDIEKLGY
FT                   DRSFVIYDTQDQQVVIKECIKELSINEKNFPPKSVLETIGKQKDELIDAVHYEKLYASD
FT                   FRMGKIAKIYKLYEKKLKANNALDFDDIIMNTIKLFDKYPEVLDYYQRRFRYILVDEYQ
FT                   DTNTAQYTLVRKLSEAQENLCVVGDDDQSIYGWRGANIRNILDFEKDFKKCCTIKLEQN
FT                   YRSTQNILDAANHVIGNNTGRKCKSLWTDNKGGSKIVICENDNEHEEALYAAREIQRLI
FT                   FDEDRKYKDFAVLYRINAQSRVLEEMFMREGIPYKIVGGQKFYDRKEIKDIIAYMRLVQ
FT                   NPGDNVSLKRVINVPKRGIGDTTVENAEILAYQGDVSLFTVISNAEEFPSLKRAAQKLG
FT                   NFSLMINKFRTMKEHMTISQMLDMVVEDSGILREYELENTVEAQSRIENIKELKSVAIE
FT                   FEKQSEDNSLEEFLAHISLVSDIDSLQEDQDYVVLMTMHSAKGLEFPVVFIPGMEEGVF
FT                   PGYRAITEGPEQLEEERRLCYVGITRAREKLYLSNARFRTLFGNSSYNRPSRFLAEIPE
FT                   ELVEYPFKSTSHTRNTSQNSGSAFKQSGDRIPRTNPAVASGTPTGSGSLKDLLNSNLVT
FT                   RGFGGSSAGTSGKNPSGQQSNSFGRTPMKSSSGASDSSVAFSVGDKVEHKKFGKGTISK
FT                   VTADSNDQILEIQFEGAGMKRLMASMANLVRL"
FT   gene            426951..428303
FT                   /locus_tag="Ccel_0374"
FT   CDS_pept        426951..428303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0374"
FT                   /product="beta-galactosidase"
FT                   /note="TIGRFAM: beta-galactosidase; PFAM: glycoside
FT                   hydrolase family 1; KEGG: amr:AM1_2790 beta-glucosidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74759"
FT                   /db_xref="GOA:B8I5U2"
FT                   /db_xref="InterPro:IPR001360"
FT                   /db_xref="InterPro:IPR017736"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018120"
FT                   /db_xref="InterPro:IPR033132"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U2"
FT                   /inference="protein motif:TFAM:TIGR03356"
FT                   /protein_id="ACL74759.1"
FT                   /translation="MAFKEGFVWGTATASYQIEGAVNEGGRGESVWDEFCRMKGKIDDD
FT                   DNGDSACDSYHRYSEDIQLMKEIGIKAYRFSISWTRILPDGIGEINMEGVNYYNNLING
FT                   LLENGIEPYVTLFHWDYPMELQYKGGWLNPESPLWFENYAAICSRLFSDRVKYWITSNE
FT                   SQCYIGFGYGTGWHAPGFKLPVNQVVRAWHHNLKGLGLAAKAIRENAKGEVKVGLVACG
FT                   EVGIPASDSEADMQAARNVLFDREHSEDSIDFGYGDLFEPALKGEYPKSLIPYLPKGWQ
FT                   EDMKDICVPLDFLGVNAYIGSIVEACENKKYRHLKLPVGIGKTSMEWPFKPETLYWVTR
FT                   FISERYKLPVYITENGMANNDWISTDGKINDTQREDYLNQYLSALSKSIDDGADVRGYF
FT                   YWSLLDNFEWAYGYAKRFGLVYVDYSNFSRTLKQSALRYKKIIELNGEVLK"
FT   gene            428407..428976
FT                   /locus_tag="Ccel_0375"
FT   CDS_pept        428407..428976
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0375"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   dsy:DSY4418 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74760"
FT                   /db_xref="GOA:B8I5U3"
FT                   /db_xref="InterPro:IPR000838"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U3"
FT                   /inference="protein motif:TFAM:TIGR02937"
FT                   /protein_id="ACL74760.1"
FT                   /translation="MDVSDIAILKEYKKNRRRGLELVYDRYKKYVYTIAFHYAGNKEDA
FT                   LDITQEVFISVFKSMEGFKEQFSMLPWIKKITVNKCLNFLRSKKPNLSLNEINENGDEL
FT                   QSIISSNEKTDDEVLCKETRQILEQSIGSLPERERMVVLLRHIKQMKYSEIAIVMKLPP
FT                   GTVKTLIHRARKTIKENMISLGIWEV"
FT   gene            428979..429377
FT                   /locus_tag="Ccel_0376"
FT   CDS_pept        428979..429377
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4419 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74761"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U4"
FT                   /inference="similar to AA sequence:KEGG:DSY4419"
FT                   /protein_id="ACL74761.1"
FT                   /translation="MSCDKVDASLLQEYLESTIDPLEKIFIGNHLKICKECRRELSELK
FT                   LLLYDLDDKSNYIIEYPPELETMRDDIIDSFLGKRKSPSKRIIEMQVETIKTTGKFIEF
FT                   LPGSKQAPKVLKQASKGLKKGVKKLIAK"
FT   gene            429400..430101
FT                   /locus_tag="Ccel_0377"
FT   CDS_pept        429400..430101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0377"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74762"
FT                   /db_xref="GOA:B8I5U5"
FT                   /db_xref="InterPro:IPR021338"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U5"
FT                   /inference="similar to AA sequence:KEGG:DSY4420"
FT                   /protein_id="ACL74762.1"
FT                   /translation="MVALIITLKIISYVFLIIAALILLIIFVPFKYYAEGAKNETIVVK
FT                   GYANWLFGAVTIRFNYNTQDGFDTKFNLFGIKKGFKKKNESEPLKQVRESKLKKTKDKP
FT                   AYSYFTYEVFMRGLKSVFKILNHFKPSIFRIDAEVGFEDPMYTGLLCAIRNTWFASFNK
FT                   DSIRIETNFEEETLEGSFLIGGGIQIFYLILVGIEFVFSKPFKSILFKNMKYKIKRRLK
FT                   KWRKVSIFVKT"
FT   sig_peptide     429400..429504
FT                   /locus_tag="Ccel_0377"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.773) with cleavage site probability 0.763 at
FT                   residue 35"
FT   gene            430068..430457
FT                   /locus_tag="Ccel_0378"
FT   CDS_pept        430068..430457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0378"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY4421 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74763"
FT                   /db_xref="InterPro:IPR014229"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U6"
FT                   /inference="similar to AA sequence:KEGG:DSY4421"
FT                   /protein_id="ACL74763.1"
FT                   /translation="MAKGFDFCENMSVIFDKLENFLKTKTVIGEPIKIGDVTLIPFINM
FT                   SFGLGLGGGTGNDDKGMGGEGGGGGTGVRISPTAVLVISGDKVELLPIKKSGGLDKLLD
FT                   MVPGIVEKIQEKKEEEDSKNELKEE"
FT   gene            430768..432966
FT                   /locus_tag="Ccel_0379"
FT   CDS_pept        430768..432966
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0379"
FT                   /product="protein of unknown function DUF291"
FT                   /note="PFAM: coagulation factor 5/8 type domain protein;
FT                   glycoside hydrolase family 5; cellulosome protein dockerin
FT                   type I; protein of unknown function DUF291; KEGG:
FT                   cth:Cthe_0821 coagulation factor 5/8 type-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74764"
FT                   /db_xref="GOA:B8I5U7"
FT                   /db_xref="InterPro:IPR000421"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR005102"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5U7"
FT                   /inference="protein motif:PFAM:PF03442"
FT                   /protein_id="ACL74764.1"
FT                   /translation="MNKLFFIVSLLAALLIFPITASAATDSTHPGFRVEGRFLYDNTGE
FT                   KVILYGVNKMCIWTDKDGVPSFSEIAKTGANCVRITWGLDGSAEDLDTVIRNCRAEHMI
FT                   PIIELHDATGDWSKLPLLVNYWVRPDIVNVIKKHQEYLLVNIGNEVGQTVTEETFKADY
FT                   ESAVKKMRDAGIHVPLVIDASSYGQSIDMLQACGPYLISADPDKNLMFSVHMWWPYMWG
FT                   HSDQEVIDEIAQSVNINLPLIVGEFGHMWDETENGKIPYKTIMEQCYKNQIGYLPWEWG
FT                   PGNNPQTFLDMTSDSTFATLNDYGKEVMLNNQYSVKNIAKRPASMLSNLPPVLPKEPLP
FT                   YGNLAYKKPVTASSIESTQNNESNIVDGDFETRWASQISDPSWICVDLGAKKDINRLII
FT                   CWEAAYATQYKIQVSDDKSTWTDVITQYNGTGKTEDIKLSCSGRYLRIYGMQRINYQWP
FT                   YSIWEIGVYGPESELSASISPAVAVFDKNPTNAADISVTLDSKSNTFNEVLNGTSVKLV
FT                   AGQDYVIQDKTTLIIKKEYLLGLSEGTTKLIFDYSDGVDPVLAIAVGNTTPDGSVQNPI
FT                   ISPSSVTYDRTSATDLRVTISPNGNTLTSIINGSEPLVPNVDFTISGDTVTIMRSYLAT
FT                   QPSDNLNLTFDFSGNGIDPVLTVTFLKDTICGDANQDGVIDALDYVILKQHLLGLVTLN
FT                   NDVINILDLNLDGTTDAIDLSIFKQYLLGKITYLPVTP"
FT   sig_peptide     430768..430839
FT                   /locus_tag="Ccel_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.968 at
FT                   residue 24"
FT   gene            433147..434406
FT                   /locus_tag="Ccel_0380"
FT   CDS_pept        433147..434406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0380"
FT                   /product="histidyl-tRNA synthetase 2"
FT                   /note="TIGRFAM: histidyl-tRNA synthetase 2; PFAM: tRNA
FT                   synthetase class II (G H P and S); KEGG: cth:Cthe_2880 ATP
FT                   phosphoribosyltransferase regulatory subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74765"
FT                   /db_xref="GOA:B8I5U8"
FT                   /db_xref="InterPro:IPR004516"
FT                   /db_xref="InterPro:IPR004517"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR041715"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5U8"
FT                   /inference="protein motif:TFAM:TIGR00443"
FT                   /protein_id="ACL74765.1"
FT                   /translation="MSRWKIYTPDGVQDILFDECYKKREIEKRIRNTFRSYGYYEIETP
FT                   TIEFFDVFSSEIEHFPQESMVKFFDQKGRILVLRPDITVPVARITATKNRDVQVPIKYS
FT                   YIGNVFRFNEVGGGRQNEFTQAGVEMLGDSSSESDAEIIAMAINTLKSVGLKEFKIEIG
FT                   QVEFFKGLAEEAGFSNEDIDAISKQIDKKDLVGVEEILNRYDISTELREIVLKLTGLFG
FT                   SVDVIKEFKKASINGRSLKAIENVEEVVSILCDYGLSEYVSIDLGMLKSLNYDTGITFR
FT                   GFTNGVGFPILSGARYDNLTSSFGKECPATGFSLRINMLMTAMEKAGHTFERPSVDSLV
FT                   CYEKTNRKRAIEIAEALRKQDMKIETFVLTKGIDQAKKYAASKKIGGIIYIRDNDKITV
FT                   YDIKNNITEETSFDTLLNNQ"
FT   gene            434437..435081
FT                   /locus_tag="Ccel_0381"
FT   CDS_pept        434437..435081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0381"
FT                   /product="ATP phosphoribosyltransferase"
FT                   /note="TIGRFAM: ATP phosphoribosyltransferase; PFAM: ATP
FT                   phosphoribosyltransferase catalytic region; KEGG:
FT                   cth:Cthe_2881 ATP phosphoribosyltransferase catalytic
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74766"
FT                   /db_xref="GOA:B8I5U9"
FT                   /db_xref="InterPro:IPR001348"
FT                   /db_xref="InterPro:IPR013820"
FT                   /db_xref="InterPro:IPR018198"
FT                   /db_xref="InterPro:IPR024893"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5U9"
FT                   /inference="protein motif:TFAM:TIGR00070"
FT                   /protein_id="ACL74766.1"
FT                   /translation="MRYLTIALSKGRLTDMSVEIFEKIGIDCTELKSSTRKLILSDEKN
FT                   KIKFFLAKPADVPTYVEYGAADIGIVGKDTLLEEGRNLYEVLDLGFAACRMALAGPAEL
FT                   QGKIDELNIKRVGTKYPNITRNYFEKTRRESVEIIKLNGSVELAPLVGLSEVIVDLVES
FT                   GRTLKENGLVVLDTIADISARMVVNRVSMKMENERIQKIIDGVRDELSVRG"
FT   gene            435086..436390
FT                   /locus_tag="Ccel_0382"
FT   CDS_pept        435086..436390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0382"
FT                   /product="histidinol dehydrogenase"
FT                   /note="PFAM: histidinol dehydrogenase; KEGG: cth:Cthe_2882
FT                   histidinol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74767"
FT                   /db_xref="GOA:B8I5V0"
FT                   /db_xref="InterPro:IPR001692"
FT                   /db_xref="InterPro:IPR012131"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR022695"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5V0"
FT                   /inference="protein motif:PFAM:PF00815"
FT                   /protein_id="ACL74767.1"
FT                   /translation="MLNIVDLRSDFDGSAAKNLYKKLTQRTATQNGGNIIDIVAEIIDN
FT                   VKQNGDSALKEYTKKFDKAEIETIKVTEEEITSAYKNVDPQLVETIKKSKQNIWSFHVR
FT                   QLQNSWIDPKENGTMLGQLVRPLEKVGLYVPGGTAPLISSVLMTAVPAKVAGVEKLIMC
FT                   TPPSQDGSINPAILVAAREAGVDEVYRAGGAQAVAAMAYGTETIPAVDKVCGPGNVYVA
FT                   TAKRLVFGDCDIDMFAGPSEILVIADSSAVPEYVAADLLSQAEHDMLASSVLVTDDVSL
FT                   LDSVKTEIEKQLVILKRNEIIEKSLKDYGFGILVDNIEEAIEVSNNIAPEHLELCVKEP
FT                   MSILGMIKNAGAIFVGNYSPEPLGDYMAGPSHVLPTSGTARFSSPVNVDQFIKKTSLIY
FT                   YNKQSLETTSSDIIRFAEAELLDAHANAIKVRFKK"
FT   gene            436433..437509
FT                   /locus_tag="Ccel_0383"
FT   CDS_pept        436433..437509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0383"
FT                   /product="histidinol-phosphate aminotransferase"
FT                   /note="TIGRFAM: histidinol-phosphate aminotransferase;
FT                   PFAM: aminotransferase class V; aminotransferase class I
FT                   and II; KEGG: cth:Cthe_2883 histidinol phosphate
FT                   aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74768"
FT                   /db_xref="GOA:B8I5V1"
FT                   /db_xref="InterPro:IPR001917"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR005861"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5V1"
FT                   /inference="protein motif:TFAM:TIGR01141"
FT                   /protein_id="ACL74768.1"
FT                   /translation="MIEELIRSEIRSFIPYNANQQPYKIKLDANESPFTLPPQMRKKLA
FT                   EYILEDPQLNLYPDTDSVQLRQALGEYWSVDKENIIVGTGSDQLIQIIANVFLEKGDKV
FT                   LYPTPSFGMYKDSCVIAGGRAVDYILDQNDNFSYSADKIIKTYELEQPKVIYICNPNNP
FT                   TGNLMPQDEILRVLKACTKSVVVVDEAYAEFSDTTVIPFIKEYENLLILRTFSKAFGLA
FT                   GIRCGYSIASEKLTRAVNLTRPPYNISSLSQFTAALILSYKEEIQNNIQYLVEERERVL
FT                   SKLKEIDGLKVYSSAANFILIKVQNSKDIYRKLCEKGIFVRAFSSSPLLSDCMRITIGT
FT                   QEQNSILLDELYAICYNK"
FT   gene            437571..438155
FT                   /locus_tag="Ccel_0384"
FT   CDS_pept        437571..438155
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0384"
FT                   /product="imidazoleglycerol-phosphate dehydratase"
FT                   /note="PFAM: imidazoleglycerol-phosphate dehydratase; KEGG:
FT                   cth:Cthe_2884 imidazoleglycerol-phosphate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74769"
FT                   /db_xref="GOA:B8I5V2"
FT                   /db_xref="InterPro:IPR000807"
FT                   /db_xref="InterPro:IPR020565"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR038494"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5V2"
FT                   /inference="protein motif:PFAM:PF00475"
FT                   /protein_id="ACL74769.1"
FT                   /translation="MREGLVTRNTKETQINVKISLDGKGDCQANTGIGFFDHMLVLFTK
FT                   HGLMDAYFDVKGDLHVDSHHTIEDTGIAMGLAIRQALGDKKSIRRYGTAYVPMDEALVL
FT                   VSLDLSDRPYLVFDAQFSQPMVGQMDTQMVEEFFRAVAFNAGITLHIKVLHGSNCHHII
FT                   EAMFKAFGRAIDDATRLDTRIEGVLSTKGTL"
FT   gene            438189..439085
FT                   /locus_tag="Ccel_0385"
FT   CDS_pept        438189..439085
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0385"
FT                   /product="phosphoribosylaminoimidazole-succinocarboxamide
FT                   synthase"
FT                   /note="TIGRFAM:
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase;
FT                   PFAM: SAICAR synthetase; KEGG: cth:Cthe_2885
FT                   phosphoribosylaminoimidazole-succinocarboxamide synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74770"
FT                   /db_xref="GOA:B8I5V3"
FT                   /db_xref="InterPro:IPR001636"
FT                   /db_xref="InterPro:IPR018236"
FT                   /db_xref="InterPro:IPR028923"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5V3"
FT                   /inference="protein motif:TFAM:TIGR00081"
FT                   /protein_id="ACL74770.1"
FT                   /translation="MLINNTNFIRLPLFVKGKVRNVYDLGDQLLIVVTDRISAFDVVFD
FT                   ELIPNKGTVLNSISAFWFDFTKDVIGNHVITTDVSKYPKELSAFKDELQGRSMLVKKVQ
FT                   MLPAECIVRGYLEGSGLKEYQKTGTVCGIKLPSGLKQADKLPEPIFTPSTKESEGHDIN
FT                   VSFEVLCEKIGTEMAQKLKDASLKLYEKASKHAESKGLILADTKFEFGMLDGELVVGDE
FT                   MFTPDSSRFWARDEYQPGRAQKSFDKQYLREYLENITWDKQPPAPELPQEVIRKTEEKY
FT                   IEAYERITGKKFQGDKL"
FT   gene            439082..439696
FT                   /locus_tag="Ccel_0386"
FT   CDS_pept        439082..439696
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0386"
FT                   /product="imidazole glycerol phosphate synthase, glutamine
FT                   amidotransferase subunit"
FT                   /note="TIGRFAM: imidazole glycerol phosphate synthase,
FT                   glutamine amidotransferase subunit; PFAM: glutamine
FT                   amidotransferase class-I; CobB/CobQ domain protein
FT                   glutamine amidotransferase; KEGG: cth:Cthe_2886 imidazole
FT                   glycerol phosphate synthase subunit HisH"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74771"
FT                   /db_xref="GOA:B8I5V4"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5V4"
FT                   /inference="protein motif:TFAM:TIGR01855"
FT                   /protein_id="ACL74771.1"
FT                   /translation="MIAIIDYGVGNLASVNKAFSFIEYDSIITSDHEEIFAADKVVLPG
FT                   VGAFADAMDSLDKTGMISVIKQIAQKGTPLLGICLGMQLLFDYSTEGGEKVEGLGLLKG
FT                   YVNHFPIDMGLKVPHIGWNSLDIRQENGIFSGIGPKSHVYFVHSYYLTAENQSDVAAVC
FT                   EYGIRFDAAVGRGNIMGTQFHPEKSGDVGLNILKNFAEINT"
FT   gene            439708..440418
FT                   /locus_tag="Ccel_0387"
FT   CDS_pept        439708..440418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0387"
FT                   /product="phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase"
FT                   /note="TIGRFAM: phosphoribosylformimino-5-aminoimidazole
FT                   carboxamide ribotide isomerase; PFAM: histidine
FT                   biosynthesis protein; KEGG: cth:Cthe_2887
FT                   1-(5-phosphoribosyl)-5-[(5-
FT                   phosphoribosylamino)methylideneamino]
FT                   imidazole-4-carboxamide isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74772"
FT                   /db_xref="GOA:B8I5V5"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR006063"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023016"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5V5"
FT                   /inference="protein motif:TFAM:TIGR00007"
FT                   /protein_id="ACL74772.1"
FT                   /translation="MIIYPAIDIIDGKCVRLQQGSYSDVTVFGDSPVDMARKWESLGAG
FT                   YLHVVDLDGARSGKSENAEIIKQIAKTLKIPVQTGGGIRNLETVETYLSGGLSRIILGT
FT                   SAVSNREMLISALKEYKGKIAVGIDAKDGKVAIHGWEKTSDYTAVEFAKEVESLGAKTI
FT                   IYTDISRDGMLKGPNLQAMKEMADSVSMDVIASGGVSRLKDIIDLKQTGVSGVIVGKAI
FT                   YTGNVDLKEAILAI"
FT   gene            440468..441229
FT                   /locus_tag="Ccel_0388"
FT   CDS_pept        440468..441229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0388"
FT                   /product="imidazoleglycerol phosphate synthase, cyclase
FT                   subunit"
FT                   /note="TIGRFAM: imidazoleglycerol phosphate synthase,
FT                   cyclase subunit; PFAM: histidine biosynthesis protein;
FT                   KEGG: cth:Cthe_2888 imidazole glycerol phosphate synthase
FT                   subunit HisF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74773"
FT                   /db_xref="GOA:B8I5V6"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5V6"
FT                   /inference="protein motif:TFAM:TIGR00735"
FT                   /protein_id="ACL74773.1"
FT                   /translation="MLTKRIIPCLDVHAGRVVKGVQFVNIIDAGDPVEAAAFYDKAGAD
FT                   ELTFLDITASSDARSIMLDVVSRVAEQVFIPFTVGGGIRTAEDFRRILKAGADKVGVNS
FT                   AALKRPELISEAAWKFGSQCVVLAIDAKKRADGSGWDTYLNGGRVNTGKDAVEWAIEAE
FT                   KLGAGEILLTSMDKDGTKDGYDIELTRTVSENVKIPVIASGGAGKMEHFKDALVDGKAD
FT                   AVLAASLFHFREMEIRDLKGYLKNNGIEIRL"
FT   gene            441310..441945
FT                   /locus_tag="Ccel_0389"
FT   CDS_pept        441310..441945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0389"
FT                   /product="phosphoribosyl-ATP diphosphatase"
FT                   /note="TIGRFAM: phosphoribosyl-ATP diphosphatase; PFAM:
FT                   phosphoribosyl-AMP cyclohydrolase; phosphoribosyl-ATP
FT                   pyrophosphohydrolase; KEGG: cth:Cthe_2889 bifunctional
FT                   phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP
FT                   pyrophosphatase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74774"
FT                   /db_xref="GOA:B8I5V7"
FT                   /db_xref="InterPro:IPR002496"
FT                   /db_xref="InterPro:IPR008179"
FT                   /db_xref="InterPro:IPR021130"
FT                   /db_xref="InterPro:IPR023019"
FT                   /db_xref="InterPro:IPR026660"
FT                   /db_xref="InterPro:IPR038019"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5V7"
FT                   /inference="protein motif:TFAM:TIGR03188"
FT                   /protein_id="ACL74774.1"
FT                   /translation="MNNLKSSVKFDEKGLVPVVTQDTKTKEVLMVAYMNEEAFDKTLET
FT                   GKVHYYSRSRSKLWLKGETSGHFQLVKSIKLDCDGDTILVEAEQIDVACHTGNKTCFFR
FT                   TMVDGEWKENTEEKPTAAILHEVYNVILDRTVHPKEGSYTNYLFTKGLDKILKKVGEET
FT                   AEVIIAAKNKSKEEIRYEVSDLMYHLMVLLVERGLTLEDIYGELKGRR"
FT   gene            441946..443367
FT                   /locus_tag="Ccel_0390"
FT   CDS_pept        441946..443367
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0390"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: csc:Csac_0946 TPR repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74775"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5V8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74775.1"
FT                   /translation="MKNNLLSIDEYRNNPEFYFYKGLRCANKRNLNEAYKHLVRASELS
FT                   PENMEYKFNIACFLSEMQRPREANRIFKDILLHYDPTMYDCYFGMGCNSFELGDMKKAA
FT                   EYFEKYIYFDSDGEFSEEVSEMIFYLKLYNDISGDNRFLRLSQINFKKAEKSLLNNKTD
FT                   HAVSELYRAIAFNPLNTEARNLLVLIMLEQQNYKRAASFVSTVLNIYSEDIWANTLKIY
FT                   NLYCTRKYSRVEKLLKILPFRRVHNRKDLLCIVTTLIVFNKIDEMILLLETYIVEYNDL
FT                   IIYLTLLLGYVSVKNYSKANQMIKNLLSFKTLNKDISDWLKKISRIMKENTVEISVLDE
FT                   YKEIFGIIGETEDYMYSPTGYSKILENAFVPRQRASRRIPAKYNSVVKCTVLNKEIMYV
FT                   PDYEKEIIHLLCNIIKGTEELLPENEKDITALSAVVEYIYCKENFIEMGKEELIQKYGI
FT                   TSISFNRVLKKIKYK"
FT   gene            443580..443864
FT                   /locus_tag="Ccel_0391"
FT   CDS_pept        443580..443864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0391"
FT                   /product="chaperonin Cpn10"
FT                   /note="PFAM: chaperonin Cpn10; KEGG: cth:Cthe_2891
FT                   co-chaperonin GroES"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74776"
FT                   /db_xref="GOA:B8I5V9"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR018369"
FT                   /db_xref="InterPro:IPR020818"
FT                   /db_xref="InterPro:IPR037124"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5V9"
FT                   /inference="protein motif:PFAM:PF00166"
FT                   /protein_id="ACL74776.1"
FT                   /translation="MKIKPLGDRVVIKMLESEETTKSGIVLPGSAKEKPQVAEIVAVGP
FT                   GTVVDGKEVKMEVKVGDRVLTSKYSGTEVKFDGQEYTILKQGDILAIVE"
FT   gene            443888..445519
FT                   /locus_tag="Ccel_0392"
FT   CDS_pept        443888..445519
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0392"
FT                   /product="chaperonin GroEL"
FT                   /note="TIGRFAM: chaperonin GroEL; PFAM: chaperonin
FT                   Cpn60/TCP-1; KEGG: cth:Cthe_2892 chaperonin GroEL"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74777"
FT                   /db_xref="GOA:B8I5W0"
FT                   /db_xref="InterPro:IPR001844"
FT                   /db_xref="InterPro:IPR002423"
FT                   /db_xref="InterPro:IPR018370"
FT                   /db_xref="InterPro:IPR027409"
FT                   /db_xref="InterPro:IPR027410"
FT                   /db_xref="InterPro:IPR027413"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I5W0"
FT                   /inference="protein motif:TFAM:TIGR02348"
FT                   /protein_id="ACL74777.1"
FT                   /translation="MAKEIKFGEEARRSLEKGVNQLADTVKVTLGPKGRNVVLDKKFGS
FT                   PLITNDGVTIAKEVELEDKFENMGAQLVKEVATKTNDVAGDGTTTATLLAQAIIREGMK
FT                   NVAAGANPMILKKGLQKAVDTAVAGIKENSRKVKGKEDIARVATISANEELIGTLIADA
FT                   MEKVTNDGVITVEESKTMGTNLEVVEGMQFDRGYLSAYMVTDTDKMEAVLDDPYILITD
FT                   KKLTNIQDLLPILEEIVKQGKKLLIIAEDIEGEALTTLILNKLRGTFVCVAVKAPGFGD
FT                   RRKAMLQDIAILTGGEVITEELGLDLKETQITQLGKARQVIVQKENTIIVDGNGSAEDI
FT                   KSRINSIKTQIEDTTSDFDREKLQERLAKLSGGVAVIQVGAATETEMKEKKLRIEDALA
FT                   ATRAAVEEGIVAGGGTAFINVIPEVAKLLESTSGDEKTGVQIILRALEEPVRQIAENAG
FT                   LEGSVIVEKIKTSEKGMGFDALNEKYIDMIEGGIVDPAKVTRSALQNAVSVAAMVLTTE
FT                   SVVADKPEPEAPAVPAGMPGGMGGMY"
FT   gene            445690..446193
FT                   /locus_tag="Ccel_0393"
FT   CDS_pept        445690..446193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: tte:TTE1989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74778"
FT                   /db_xref="GOA:B8I5W1"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W1"
FT                   /inference="similar to AA sequence:KEGG:TTE1989"
FT                   /protein_id="ACL74778.1"
FT                   /translation="MDIFMEKIVKRRKTAMDSIIIAATIVVGLLLIVIVGSVSFLQSFM
FT                   PILLVAIGYLGYVLIRNRNVEYEYIVTNGDLDIDMIIAQRKRKRVFSGSCKDFEIIAKM
FT                   TSGQYNQSYDNIKNRLNAVTTMESNEVYFISTVKDGEKILVFFEPHPKMIESFKKYIPR
FT                   KVFE"
FT   gene            446309..447811
FT                   /locus_tag="Ccel_0394"
FT   CDS_pept        446309..447811
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0394"
FT                   /product="IMP dehydrogenase/GMP reductase"
FT                   /note="PFAM: CBS domain containing protein; IMP
FT                   dehydrogenase/GMP reductase; KEGG: dsy:DSY2052
FT                   inositol-5-monophosphate dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74779"
FT                   /db_xref="GOA:B8I5W2"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR001093"
FT                   /db_xref="InterPro:IPR005990"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR015875"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W2"
FT                   /inference="protein motif:PFAM:PF00478"
FT                   /protein_id="ACL74779.1"
FT                   /translation="MAFYYNEPSRTFSEYLLVPNLSTKECVPDNVILKTPVVKHKVGEK
FT                   STLELNIPVVSAIMQSVSDQNMAIALAKCGGISFIYGSQSIESQAEMVRKVKKYKAGFV
FT                   VSDSNLRPDNKLRDVVAMKQKTGHSTIAITEDGTPTGKLLGIVTSRDYRLSRASLDEEI
FT                   STFMTPFSHLIYGNEKTTLKEANDLIWEHKLNCLPIIDSNQKLMYFVFRKDYDSHKQNP
FT                   NELLDKSKSLIVGAGINTRDYKERVAALVEAGVDIVCIDSSDGYSEWQSDTIKWIKETY
FT                   NGQVKVGAGNVVDREGFRYLVDAGADFIKVGIGGGSICITREQKGIGRGQASAVIEVSS
FT                   ARDEYMKETGIYVPICSDGGIVHDYHMVLALAMGADFIMLGRYFARFDESPTRKLKVGG
FT                   NFVKEYWGEGSNRARNWQRYDMGGDAKLGFEEGVDSYVPYAGKLKDNLDTTIYKIKSTM
FT                   CNCGALSVSELQQKARITLVSATSIKEGGAHDVILKDKEISS"
FT   gene            448093..448569
FT                   /locus_tag="Ccel_0395"
FT   CDS_pept        448093..448569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0395"
FT                   /product="transcription elongation factor GreA"
FT                   /note="TIGRFAM: transcription elongation factor GreA; PFAM:
FT                   transcription elongation factor GreA/GreB domain protein;
FT                   KEGG: cth:Cthe_2897 transcription elongation factor GreA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74780"
FT                   /db_xref="GOA:B8I5W3"
FT                   /db_xref="InterPro:IPR001437"
FT                   /db_xref="InterPro:IPR006359"
FT                   /db_xref="InterPro:IPR018151"
FT                   /db_xref="InterPro:IPR022691"
FT                   /db_xref="InterPro:IPR023459"
FT                   /db_xref="InterPro:IPR028624"
FT                   /db_xref="InterPro:IPR036805"
FT                   /db_xref="InterPro:IPR036953"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W3"
FT                   /inference="protein motif:TFAM:TIGR01462"
FT                   /protein_id="ACL74780.1"
FT                   /translation="MSAKEVVLTYEGLKKLEEELEFLRGTKRKEVAERIKQALSFGDIS
FT                   ENSEYDEAKNEQAQVEGRIVQLESMLKHARIIDEDEVNTDVVSIGSKVRIFDIEFDEEV
FT                   EYLIVGSTEANPLKSKISNESPVGAALIGHTKGETVEVQVPDGVLKFKILEISK"
FT   gene            448698..450197
FT                   /locus_tag="Ccel_0396"
FT   CDS_pept        448698..450197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0396"
FT                   /product="lysyl-tRNA synthetase"
FT                   /note="TIGRFAM: lysyl-tRNA synthetase; PFAM: tRNA
FT                   synthetase class II (D K and N); nucleic acid binding
FT                   OB-fold tRNA/helicase-type; KEGG: tpd:Teth39_0318
FT                   lysyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74781"
FT                   /db_xref="GOA:B8I5W4"
FT                   /db_xref="InterPro:IPR002313"
FT                   /db_xref="InterPro:IPR004364"
FT                   /db_xref="InterPro:IPR004365"
FT                   /db_xref="InterPro:IPR006195"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR018149"
FT                   /db_xref="InterPro:IPR034762"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W4"
FT                   /inference="protein motif:TFAM:TIGR00499"
FT                   /protein_id="ACL74781.1"
FT                   /translation="MSEENLQENQQNEEDLSEILRVRRAKLKDLQEKNSDPFKIVKYDV
FT                   TNSSQNIINNFDSLEGQNASIAGRLMSKRGMGKAGFCDLQDRDGRIQLYVRKDEVGDEV
FT                   YEMFKKYDIGDIVGVQGEIFKTHKGEISIKVKEITLLSKSLLPLPEKWHGLKDTDLRYR
FT                   QRYVDLIVNPEVKNTFILRSKIIKSIRKFLDDRGFLEVDTPLLNTIPGGAAARPFITHH
FT                   NTLDIDMYLRIAPELYLKRLIVGGMEKVYEMGRMFRNEGMSVKHNPEFTMMEVYEAYND
FT                   YKGMMELTENLVSTVAMETLGTTKIQYQGQEIDLTPPWNRMTMIEAVKEYTGIDFDTIK
FT                   TDEEAKAAAESKKVHVKEGMVRGEILNLMFEEFVESNLVQPTFIYDYPVEISPLTKRKP
FT                   DCPELTERFEFFITGREMGNAYSELNDPIDQKERFVSQVKKRDSGDEEANMMDEDYVTA
FT                   LEYGMPPTGGLGIGVDRLVILLTDSASIRDILLFPTMKPRD"
FT   gene            450291..451202
FT                   /locus_tag="Ccel_0397"
FT   CDS_pept        450291..451202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0397"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tpd:Teth39_0253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74782"
FT                   /db_xref="GOA:B8I5W5"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74782.1"
FT                   /translation="MKYTLKESRAIMEIPANSTKEDIEKKYDVILKKYRQMKIDGTLTE
FT                   EAQEEFQKKTDAYRILMGYEAEEPKEPKKETYVDKAFVKAGMDRKKVDNFFHYHKYHIL
FT                   VTIAVVIIIASTVYSVVTKVEPDITIGILGEVNEQATNTLKQKITNSLPEIKEVGSETV
FT                   MLSDRINDPNSAAYIQKAMILFAASDTDVFLLSKYVFDRYASDGAFMALDDVVRDLSID
FT                   VKSSEYLKLKVVEEWNQPQAPTEKRTVKSYSDSEPRLYGIDVTNSKFFKDVDVLGPEKI
FT                   LAVRAEPEKLELILKLIKLFAK"
FT   gene            451241..451558
FT                   /locus_tag="Ccel_0398"
FT   CDS_pept        451241..451558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0398"
FT                   /product="anti-sigma-factor antagonist"
FT                   /note="TIGRFAM: anti-anti-sigma factor; PFAM: Sulfate
FT                   transporter/antisigma-factor antagonist STAS; KEGG:
FT                   cth:Cthe_2898 anti-sigma-factor antagonist"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74783"
FT                   /db_xref="GOA:B8I5W6"
FT                   /db_xref="InterPro:IPR002645"
FT                   /db_xref="InterPro:IPR003658"
FT                   /db_xref="InterPro:IPR036513"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W6"
FT                   /inference="protein motif:TFAM:TIGR00377"
FT                   /protein_id="ACL74783.1"
FT                   /translation="MEHSELSVQKILDGSKCKIVLSGEIDIYTSQRFKNELNEAVKTCN
FT                   DDLYIDCKELTYIDSTGLGILVGALKEVRKENNHIYICNLKDNIKKLFLITGLDKLFKI
FT                   E"
FT   gene            451644..452030
FT                   /locus_tag="Ccel_0399"
FT   CDS_pept        451644..452030
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0399"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: cth:Cthe_2899 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74784"
FT                   /db_xref="GOA:B8I5W7"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W7"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2899"
FT                   /protein_id="ACL74784.1"
FT                   /translation="MESIINDNVTLILPAKSEYVSTARLTASSVATRVGFNIDEVEDIK
FT                   VSVSEVCNIILSRTDKKISQYRISFDIIANNLKITFMAENSTLDCFEESIENEYGLYIM
FT                   KALMDSVELCNDDHSIVMTKKIGV"
FT   gene            452033..452782
FT                   /locus_tag="Ccel_0400"
FT   CDS_pept        452033..452782
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0400"
FT                   /product="RNA polymerase, sigma 28 subunit, Sig B/F/G
FT                   subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; RNA polymerase sigma-70 factor, sigma-B/F/G
FT                   subfamily; PFAM: sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   KEGG: cth:Cthe_2900 RNA polymerase, sigma 28 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74785"
FT                   /db_xref="GOA:B8I5W8"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR014322"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W8"
FT                   /inference="protein motif:TFAM:TIGR02980"
FT                   /protein_id="ACL74785.1"
FT                   /translation="MENKTQNTLNYDEVQLFSQYISTGNLEYRNEIVSNYLSLAEYLSK
FT                   KFLNRGVDFDDIYQVACLALINAVERFSPDKGVKFISFATPTILGEIKRFFRDKSTTIK
FT                   IPRRIYESRQGVNKARDELTQKLSRVPRADEIAEYMGIPVETVLEIIEAGSSTIVKSLD
FT                   QTINQDNDAELGDTLGYDEKTYEMIDNKDFLEKVLISFNDVERQFVTYRYIQNKTQKQI
FT                   AEILGVSQMYVSRMERKILDKFRKYLK"
FT   gene            452853..453287
FT                   /locus_tag="Ccel_0401"
FT   CDS_pept        452853..453287
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0401"
FT                   /product="putative anti-sigma regulatory factor,
FT                   serine/threonine protein kinase"
FT                   /note="KEGG: cth:Cthe_2901 putative anti-sigma regulatory
FT                   factor, serine/threonine protein kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74786"
FT                   /db_xref="GOA:B8I5W9"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5W9"
FT                   /inference="similar to AA sequence:KEGG:Cthe_2901"
FT                   /protein_id="ACL74786.1"
FT                   /translation="MRAITYIINDPVNVSDIVTLILDYITLGNSVSEDTLFEIKVILNE
FT                   LIVNALQHGNKSNHNKHTYVTFKLIDDDYLYVSVMDEGSGFNYSKFSLVKDLDCTNSLY
FT                   CDHGRGLVIVRQLCDKIKFNKCGNKVSIIKNLHLQQPKNI"
FT   gene            453791..455431
FT                   /locus_tag="Ccel_R0007"
FT   rRNA            453791..455431
FT                   /locus_tag="Ccel_R0007"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            455609..455684
FT                   /locus_tag="Ccel_R0008"
FT                   /note="tRNA-Ala1"
FT   tRNA            455609..455684
FT                   /locus_tag="Ccel_R0008"
FT                   /product="tRNA-Ala"
FT   gene            456205..459117
FT                   /locus_tag="Ccel_R0009"
FT   rRNA            456205..459117
FT                   /locus_tag="Ccel_R0009"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            459369..459484
FT                   /locus_tag="Ccel_R0010"
FT   rRNA            459369..459484
FT                   /locus_tag="Ccel_R0010"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            459490..459565
FT                   /locus_tag="Ccel_R0011"
FT                   /note="tRNA-Asn1"
FT   tRNA            459490..459565
FT                   /locus_tag="Ccel_R0011"
FT                   /product="tRNA-Asn"
FT   gene            460175..461293
FT                   /locus_tag="Ccel_0402"
FT   CDS_pept        460175..461293
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0402"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpu:BPUM_3575 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74787"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74787.1"
FT                   /translation="MKTILRTIVSIFMVAVLVSSSLTAFAESGDSANTANINIADVNIK
FT                   SHVNIDYSRPAIKLKANKVTKAAKAVSGVSAFLTSNVVSPTVFLQNNPRLIQNGILTAE
FT                   NNTNYIYFTVTKDTFIWAKLASSNSDYTISLYKIDDTTGQALPTDIVENSNSIIANSGL
FT                   EQGDYLFLISSNGSVGDNYDLQINATNPAGEFSSINTITPSLQQLVISYTNQEVYANGI
FT                   YVFSWDSAASNRHLNWRRDVMAVKELVTETKKMILENVKVRTISAPVTYTSQYASSDNA
FT                   ILLYLNEGTAYTYYETITENANPLNYSKSFVDPNGKITPRNLDSSDFVNATHILVLDLN
FT                   TGKPIDFFSSLNYFYNDKSVDREDSPKITYNQ"
FT   sig_peptide     460175..460255
FT                   /locus_tag="Ccel_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.995 at
FT                   residue 27"
FT   gene            461451..461642
FT                   /pseudo
FT                   /locus_tag="Ccel_0403"
FT   gene            462382..462588
FT                   /locus_tag="Ccel_0404"
FT   CDS_pept        462382..462588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0404"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74788"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74788.1"
FT                   /translation="MSELVKFEVKKLPRIKLVGKELRYNMEAHMKGDNRMPAFWDKCFA
FT                   NEIFLLLEKQTEFVYDSAYVGVI"
FT   gene            complement(462779..463928)
FT                   /locus_tag="Ccel_0405"
FT                   /note="ribosomal slippage"
FT   CDS_pept        complement(join(462779..463648,463650..463928))
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /ribosomal_slippage
FT                   /locus_tag="Ccel_0405"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   cth:Cthe_0590 transposase IS3/IS911"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74789"
FT                   /db_xref="GOA:B8I5F9"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5F9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACL74789.1"
FT                   /translation="MKKRRTFTPEQKTKIVLEVLKEAQTLTEIAAKYEIQPNQLTRWKS
FT                   EFIKNANRAFSDDADETEQLKQVHEAQIDELHRQIGQLTVERNWLKKKLNNSACRQSRQ
FT                   SMVDKKHKKLTITRQCQLLGLNRSTLYYQPHEPDRSEEYRIKWLIDEIYTRDSSLGYRR
FT                   MTHILHRDHGININKKRTRRYMREMNIYGICPGPNLSKRGRLKYVHPYLLRGLTIDRPN
FT                   QVWSVDITYCRMPKGHMYLAAIIDWHSKYIVGYELSNTMDKSLVLNLVKRTITAHGKPE
FT                   IINSDQGSQFTCEDYINLLKENNIKVSMDGKGQALDNICIERFWRSLKWEKLYLEEYST
FT                   PKQLRNIIQEYIAYYNIYRPHQTLEYRTPGEVYYRTLAEKTA"
FT   gene            463988..464308
FT                   /locus_tag="Ccel_0406"
FT   CDS_pept        463988..464308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0406"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: dsy:DSY1945 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74790"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029441"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X3"
FT                   /inference="similar to AA sequence:KEGG:DSY1945"
FT                   /protein_id="ACL74790.1"
FT                   /translation="MTDWDKGDGDFSYIVGMLMKDGVSVPEGYYYKDIEETDVAIGWIK
FT                   GRDTADVHSSAHPLTEEAIKENGYKCDKMKWCMELYNCPRYSTPHENGDITLDYYIPIN
FT                   DN"
FT   gene            464657..465013
FT                   /locus_tag="Ccel_0407"
FT   CDS_pept        464657..465013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0407"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74791"
FT                   /db_xref="GOA:B8I5X4"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74791.1"
FT                   /translation="MLNKNNKKMFLIMLIPLYLLISISIFGMSIGGINWISALEYSLLF
FT                   ILAAWSLSRNDSLIINLAGFLIYAIIGGNSIYSTLTRTTRIGPWTFSIYTGVALILFGL
FT                   LAFSYNTVRVVRKR"
FT   sig_peptide     464657..464752
FT                   /locus_tag="Ccel_0407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.458 at
FT                   residue 32"
FT   gene            465221..466162
FT                   /locus_tag="Ccel_0408"
FT   CDS_pept        465221..466162
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0408"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: esi:Exig_0300 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74792"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X5"
FT                   /inference="similar to AA sequence:KEGG:Exig_0300"
FT                   /protein_id="ACL74792.1"
FT                   /translation="MRNYIIAFLVIIALLTGCSVENLPERNESTSTLTKNSASLTSASP
FT                   SENKTNIPGKATVQEPSKPIESAPTEGKYKEIKVAGGDTSGTRKPMVVVDIGYGSRVYW
FT                   AYTNKFGQLIRVTAKEIILQDAKTEPVLKNGRYYPDEAKVPGTERADLDQGHVIADSLG
FT                   GVSNAYNITPQNSVLNRHGDQAYMEKNIRDAGGCTNFEAIITYPNTKTQIPSHYRYTYT
FT                   IKGNVIKDDFANVDPDEANKSLNEKPKETPKTTPKPSTTDKNHNIDSIDKNHNGKVSIA
FT                   EAKAAGFKMPITKDHWLYKYMDDRDGDGMVGE"
FT   sig_peptide     465221..465286
FT                   /locus_tag="Ccel_0408"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.734) with cleavage site probability 0.379 at
FT                   residue 22"
FT   gene            466412..467458
FT                   /locus_tag="Ccel_0409"
FT   CDS_pept        466412..467458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0409"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG: lpf:lpl2033
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74793"
FT                   /db_xref="GOA:B8I0K1"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8I0K1"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL74793.1"
FT                   /translation="MTAQDRIVKNKMSLIELAEYLQNVSEACKIHGVSRQHFYDIKKAY
FT                   EENGLEGLKDKTRRKPCMKNRVAPETEEAVLRIAYEKPAYGQLRASNELRKQGVLVSAG
FT                   GVRSIWQRYNIETFDKRLKKLEEKAAKEGILYTEDQLAALEKAQQEKNISIDEIDTQHP
FT                   GYLLAQDTFYVGYIKGVGRIYQQTAIDTYSAVGFAKLYTAKVPVTAADILNDRVLPFFE
FT                   NHMIPIMRVLTDRGTEYCGAPEKHLYELFLQMNDIEHTMTKAKSPQTNGICERFNQTIL
FT                   NEFYKPAFRRTMYKSVEQMQEDLDFYMLEYNEERTHQGKRCKGKTPMQTFLDSLPLARE
FT                   KLLNDPAS"
FT   gene            complement(467726..468184)
FT                   /locus_tag="Ccel_0410"
FT   CDS_pept        complement(467726..468184)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0410"
FT                   /product="transcriptional regulator, MarR family"
FT                   /note="PFAM: regulatory protein MarR; SMART: iron dependent
FT                   repressor; KEGG: cbk:CLL_A1371 transcriptional regulator,
FT                   MarR family"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74794"
FT                   /db_xref="GOA:B8I5X7"
FT                   /db_xref="InterPro:IPR000835"
FT                   /db_xref="InterPro:IPR022689"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X7"
FT                   /inference="protein motif:PFAM:PF01047"
FT                   /protein_id="ACL74794.1"
FT                   /translation="MNEQPNIDIRRFVETFEKLARAERRKQSLFGLKQSEVRVLLCIEQ
FT                   LSHENKQIITVSEISKKMLVTSPTVTELIKSLSTNGYIERCVDPQDKRVSDIKLTDKGE
FT                   KIVQKLITYFTSLFSGLIEKIGVEQSETLLDLLDQVCLYLNETNLESY"
FT   gene            complement(468358..469953)
FT                   /locus_tag="Ccel_0411"
FT   CDS_pept        complement(468358..469953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0411"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   deh:cbdb_A1621 major facilitator family transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74795"
FT                   /db_xref="GOA:B8I5X8"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X8"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACL74795.1"
FT                   /translation="MHQLTQKRKTTVMIALMATMFFAAINQTIISAALPKVIAQLGGMD
FT                   YYSWVITGYMLTSTISTVIFGKLSDIYGRKIFLLSGIIIFLIGSFLTGLSANIFQMIAF
FT                   RGIQGIGGGILMSISLTAVGDLYPPQERAKWTGVMMSIFGISSILGPVLGGVMVDYVAW
FT                   KWLFWIFLPLGVIALIMIWSLFPKLSGNSSESIDYLGSIFLALSITSLLLGFSWAGTKY
FT                   AWALPQSLGLFAATLVGILVLILIERNAKSPVMPLSMFKNKGVTISFVASFVMSGGMMG
FT                   AMSYIPFFIQGVKGHSATTSGLLNIPMSLMMIIFSTLVGRWMSKYGNYRLFAVLGLGIM
FT                   SASMIIMANMNNIVWAAISLIIFGVGLGFGMTVFTTTAQNSAPTSQLGVVTASCTLFRN
FT                   LGGTIFIAIFGSIMNTSMARNMEKVMSSGSGIDLTKLDVETAEKFKAMANPQLLLDNTK
FT                   LEAIQASMPEQVQLLFSKVMDLVRTVMGDALTSVFYIGALLLLVGVVLSLFLKVQTADK
FT                   DNNEEFEEKEEAAA"
FT   sig_peptide     complement(469873..469953)
FT                   /locus_tag="Ccel_0411"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.994) with cleavage site probability 0.701 at
FT                   residue 27"
FT   gene            complement(470192..470470)
FT                   /locus_tag="Ccel_0412"
FT   CDS_pept        complement(470192..470470)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74796"
FT                   /db_xref="GOA:B8I5X9"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5X9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74796.1"
FT                   /translation="MPYFGKSNKLANILICCSVILFVIAAVVFVRGSVLDQVFEFSNGN
FT                   YISSGIYFTIFMLLALFTFIIGIALKCVVKDAKYEFTNIKSEQRGES"
FT   sig_peptide     complement(470393..470470)
FT                   /locus_tag="Ccel_0412"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.909) with cleavage site probability 0.445 at
FT                   residue 26"
FT   gene            470718..471698
FT                   /locus_tag="Ccel_0413"
FT   CDS_pept        470718..471698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0413"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: ypm:YP_3381 pyridoxal-phosphate dependent
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74797"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y0"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACL74797.1"
FT                   /translation="MSLKEKISEVTFSNEVGNTKMVKIANLLKNSSSNIYAKCEYLNPS
FT                   GSHKDRTFNYIIEQLEKRGEISPGMTLVDCSTGNGGGALARCGKLKGYKIIVFMPEGMT
FT                   EERISQIKSFDAEIIETPREKFLNGSVEAAGEYARIHENCYFLDQASNPLNREAWDNCG
FT                   KEIVKSFDSLGEKVDYFICAIGTGGTFSGIAKQLKIYYPDIITVGIEVDKSAPLFSKRH
FT                   NKEFKHKHHNMMGLGAGVLSSNTDENLVDIIETVSGEDSWTMMKKVIQDENLQIGPTSG
FT                   ANILMSLKYAKEYGSKNIVTVLFDSAWKYYSRWDGVYPEYQNLNL"
FT   gene            471712..472275
FT                   /locus_tag="Ccel_0414"
FT   CDS_pept        471712..472275
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0414"
FT                   /product="phosphoribosyltransferase"
FT                   /note="PFAM: phosphoribosyltransferase; KEGG:
FT                   ypg:YpAngola_A4140 putative phosphoribosyl transferase
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74798"
FT                   /db_xref="GOA:B8I5Y1"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y1"
FT                   /inference="protein motif:PFAM:PF00156"
FT                   /protein_id="ACL74798.1"
FT                   /translation="MLLKEIYENAKVVSSGKHFTTVNEFTDQIPALRPRVLWEAALKIS
FT                   QICDFKADKIVTEEDKGTPLATVVSLISGLPMAIARWYNYSLEEESQIAVNIDSEYFNG
FT                   KLFLNGVNKKDKVIIIDDTLSTGGTIVSLVKAIRESGAEVVDVVCVIEKEGYGGRERVL
FT                   ESTGIEVKTIHKILVNQNGVKVIS"
FT   gene            472332..473009
FT                   /locus_tag="Ccel_0415"
FT   CDS_pept        472332..473009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0415"
FT                   /product="alanine racemase domain protein"
FT                   /note="PFAM: alanine racemase domain protein; KEGG:
FT                   bcs:BCAN_A1846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74799"
FT                   /db_xref="GOA:B8I5Y2"
FT                   /db_xref="InterPro:IPR001608"
FT                   /db_xref="InterPro:IPR011078"
FT                   /db_xref="InterPro:IPR029066"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y2"
FT                   /inference="protein motif:PFAM:PF01168"
FT                   /protein_id="ACL74799.1"
FT                   /translation="MNQESILNQYKLIVQNIEKSAEKVKRDAKNINLLAVSKFHEVNKI
FT                   IPLLEIGHCHFGESRVQEAKSKWIDLKKLYPQTILHLIGPLQTNKVKDAIQLFDIIETL
FT                   DREKLAEKIADELRKTGKNPKIFIQVNIGMEVQKSGIAPEELKMFLNKCRNDYALDIKG
FT                   LMCIPPAGEDSVKYFLDLYNLAQKNGLEEISMGMSDDYQEAILSGATQVRIGSSLFGKR
FT                   NYT"
FT   gene            473086..475266
FT                   /locus_tag="Ccel_0416"
FT   CDS_pept        473086..475266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0416"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: phosphoribosylglycinamide synthetase; protein
FT                   of unknown function DUF6 transmembrane; KEGG:
FT                   ypi:YpsIP31758_4090 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74800"
FT                   /db_xref="GOA:B8I5Y3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y3"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL74800.1"
FT                   /translation="MNNKHFTGVFYILLFCILSAFLDVYVGNISQNIDPILLLFCNFLI
FT                   LTTFFAITHKRTEIPLIKETINSWKPILMLNIAAAASWIGLFYSLKYLEPAVVGIVSAA
FT                   VGPVITIVLNPFFDSGNRITKLEKTIATCIVIVISVLLYFTYGGISGIGEVSSINFIFG
FT                   SICVIMCGIGMAATTLVTKKLMNERWHPSRILVSRSYIMLLISLFIILTKINQLQFSFS
FT                   LIPAVLLIAFIGNIIPLYIYQLGVQRVEPFKISIMLLFLPIFTFILQLFDQRLEFSFPT
FT                   LVCIIITIGFILLELIIKPKRTELKTVPSKNCAIVDAYSSGRYLAAEFKNLGYKVFHIQ
FT                   SVKNTPAFFKSSFIEEDFFDNIIIDNDLDKKIEQIKQLNPEFIFAGCESGVLTADMINN
FT                   KLNLTMCNDYKLSKHRRNKFMMIDMLHRNGISAPKQLKSSDLNEIKEWINEHNAWPVVL
FT                   KPLESAGSDNIWFCYDFNIVGKAFEKIINDVNKMGIKNESVLVQEFLDGTEYVVNTVSS
FT                   NGEHVISEIVKYKKVKTEDNGILYDIDELQSSDSEIYSIMSQYINRVLNVLGVKYGPCH
FT                   AEVMLTENKIPKLVEIGSRTDGILRPDVSSVTTGLGQIKLTALAYADTEEFKKYLTCPY
FT                   LIKNNTINVALISHVEGTLQSLPHIEFIKSLPSFFLINLSVAVGEKIDKTKDVFSQPGT
FT                   IYLVHESMDVIMQDYYKIRYYEKNGLYKVLSA"
FT   sig_peptide     473086..473154
FT                   /locus_tag="Ccel_0416"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.696) with cleavage site probability 0.598 at
FT                   residue 23"
FT   gene            475628..478174
FT                   /locus_tag="Ccel_0417"
FT   CDS_pept        475628..478174
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0417"
FT                   /product="cellulosome protein dockerin type I"
FT                   /note="PFAM: cellulosome protein dockerin type I; KEGG:
FT                   cth:Cthe_0246 carbohydrate-binding family 6 protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74801"
FT                   /db_xref="GOA:B8I5Y4"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR018247"
FT                   /db_xref="InterPro:IPR034641"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="InterPro:IPR041624"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y4"
FT                   /inference="protein motif:PFAM:PF00404"
FT                   /protein_id="ACL74801.1"
FT                   /translation="MKYFKKVCITLAAFLISTGFAVGIGTQSVNAASTTIPCRQLEQLD
FT                   RGIVAVNQGNGKVYVSWRLLGTEPSNTAFNLYRKTAGGTEVKLNSSPITSCTNYVDNGV
FT                   DTTKDNTYTVRTVLNGIENNESEQYTLAANTSVRQYIPIKLKPLPTGYYTMHVNVGDLD
FT                   GDGKYDYIVKRMNDDRSPVQVEAYKSDGTFLWRIDLGPNIETYNTAMTSPLVVSDLNSD
FT                   GKAEVLIKTGESTRFGDGTLIGDTNNDGITNYCNTSSTSYQVLSGPEFISVIDGMTGKE
FT                   LSRADFIARGQVTDWGDNYGNRASFIFMTVAYLDGIHPSVVMSRGPGNVMKVEAWDFKD
FT                   GKLSQRWKWDARNQVLPSGKNFPDFHAIRAVDVDKDGKDEISWGGSMLNDDGKLLYATE
FT                   LTHGDRFVIGDIDPDRDGLECYAIQQNNPSLLGAALYDAGNGTMIKKMYMSAVGDVGRG
FT                   DCADIDPNYRGMECWSTLENLYNCKGGVIGSEKSFPFLSIWWDGDLLREFFIGVDSNGF
FT                   NAAINKWNYTTKTSNRLYSVYQEGVKSTYAGRPPFYGDIMGDWREEVILETTDNTELRI
FT                   YTTNIPTNYRIYTLMHNPAYRNSVDVKGYLSSVYPDYYLGEGMSTPPTPNIYTGDGELI
FT                   KSLRVNDSNNAADWCIQSNLQVGDTVYGDRTYKYTKIPQSLTGTEWIRTACDSKSYLDE
FT                   EANFTAKKDISVYIGLDSRITSIPAWLSDWTKTGETLSDDSSITFNLYKKDFTSGSVVR
FT                   LGTNGGSSSFVNYTVIVKPNTAPAFLYGDVNGDGIVDVLDYSTMRSYLLQITNSMPSAY
FT                   WQMAGDLNSDGAIDSMDYLYLKMYLLGTINSLPVSP"
FT   sig_peptide     475628..475723
FT                   /locus_tag="Ccel_0417"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.971 at
FT                   residue 32"
FT   gene            complement(478396..479592)
FT                   /locus_tag="Ccel_0418"
FT   CDS_pept        complement(478396..479592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0418"
FT                   /product="transposase mutator type"
FT                   /note="PFAM: transposase mutator type; KEGG: glo:Glov_3450
FT                   transposase mutator type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74802"
FT                   /db_xref="GOA:B8I268"
FT                   /db_xref="InterPro:IPR001207"
FT                   /db_xref="UniProtKB/TrEMBL:B8I268"
FT                   /inference="protein motif:PFAM:PF00872"
FT                   /protein_id="ACL74802.1"
FT                   /translation="MSEKIIQLNEGIIKEELKNLVRSSVEETLNNLLDKEAEDLTNAAK
FT                   YERTQERQGYRSGHYTRSLQTTSGEVTLRVPKLKGVPFETAIIERYRRRESSVEEALIE
FT                   MYLAGVSVRRVEDITEALWGTKVSPGTISELNKKAYVHIENWRNRPLQDGKYPYVYVDG
FT                   IYLKRNWGGEYENVSILVAIAVNQEGYREVIGAREGMKEDKASWKEFLQWLKGRGLDGV
FT                   KLIVGDKCLGMLESVNEVFPEAKYQRCTVHFYRNIFSVTPRSKMKLVAKMLKAIHAQES
FT                   KASAREKAKLVAEELKSMKLREAAKKLEDGIEETLTYMEFPYEHWTRIRTNNTIERLNR
FT                   EIRRRTRVVGTFPDGNSALMLVCARLRHVAGTQWGSKKYLNMKHLENMDSDESDFIAG"
FT   gene            479706..480701
FT                   /locus_tag="Ccel_0419"
FT   CDS_pept        479706..480701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0419"
FT                   /product="metal-dependent protein hydrolase"
FT                   /note="PFAM: metal-dependent protein hydrolase; KEGG:
FT                   amt:Amet_0463 metal-dependent protein hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74803"
FT                   /db_xref="GOA:B8I5Y6"
FT                   /db_xref="InterPro:IPR003226"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y6"
FT                   /inference="protein motif:PFAM:PF03690"
FT                   /protein_id="ACL74803.1"
FT                   /translation="MDTIKEFKKVGTHSGRFHADEVMATAILKQVFEIKLTRTRDPEIL
FT                   EKQDLIYDIGNGEFDHHQLEKEYRDNGTPYAACGLIWRKFGRQAILSKHPEVSENEIES
FT                   IFRYVDAVLIEGIDAADNGIRTTENIIPTMCISAIIGGYNPTWDSPESVDAAFSDAVGF
FT                   AEDILENLIDQKVSTLKARTFVIQAYNNRKRPELLILDNSYPWERTLKEIDINKEVLFV
FT                   IYPKEEGFYIQTVREYGEVRRDRKSLPRQWAGKREEELCNIIGIKDAVFCHSSRFIAKA
FT                   GSFESILKMADIAISMPETEIENRRADRSVFDILKLILKNKLVIKIRRNR"
FT   gene            complement(480762..496747)
FT                   /pseudo
FT                   /locus_tag="Ccel_0420"
FT   gene            complement(481263..481676)
FT                   /locus_tag="Ccel_0421"
FT   CDS_pept        complement(481263..481676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74804"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74804.1"
FT                   /translation="MNQMVTLLQEIVHTAVKTQQTLKTIVLYIEPSSIQHIDHLDLLLN
FT                   KIKISSISSEHDIIADTDEMSIRYSIQTLFSCMHSIDEISNTLKLTTFNTLPEDLTRRL
FT                   DKNMQSLRNTFLQLNSCFTQTFGEDKSYLANIL"
FT   gene            complement(481847..483079)
FT                   /locus_tag="Ccel_0422"
FT   CDS_pept        complement(481847..483079)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0422"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   aoe:Clos_0840 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74805"
FT                   /db_xref="GOA:B8I5Y8"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y8"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL74805.1"
FT                   /translation="MNSIVHTEQNLHNDEKFVLFLFSQGVSSFGDAFQFIAATSLIVNI
FT                   TGSGFSAAFGLICSPILSILFSALAGYISDNKKDKTLLVLIDLIRGLIVLIFIYKHTIS
FT                   EIYSLIIVLSILDIFYNPPKRKFTTRILKNSQLMKGNSLLTGLTGGVYIVAPILAGILI
FT                   NNYGTDIAFFINSISFFISAFCIIIIKCKINKHDVTSKIKMSFKNTTDSLFEGIAYCLN
FT                   TYTLRKTIFIGTVICFATTSVNIAFYPFAFNTLKVSNKIWGIMMSIFYGANLLAMPISL
FT                   VGCFKIKTYYKIIIPLSLMGISVIWFSYGSTSEISLILFLQLLEGTILSYLSIILLSQI
FT                   QIKSKNDFLGRIVGINDFINNLGKVLGIGCTYTLLRMTSSYAVFLLCAIITSAYAVYTF
FT                   MSTKIHRLEEL"
FT   gene            complement(483154..484098)
FT                   /locus_tag="Ccel_0423"
FT   CDS_pept        complement(483154..484098)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0423"
FT                   /product="VanW family protein"
FT                   /note="PFAM: VanW family protein; KEGG: aoe:Clos_0839 VanW
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74806"
FT                   /db_xref="InterPro:IPR007391"
FT                   /db_xref="InterPro:IPR011098"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Y9"
FT                   /inference="protein motif:PFAM:PF04294"
FT                   /protein_id="ACL74806.1"
FT                   /translation="MLYKRYFKPAIIFMFVFTYTILPFATGESLSANDVNKDHLQTSIK
FT                   QCENNGNGQEEGLKNPSKSGTTFYVPWEGSENFLSCQSKNGTPIMMVAYQTVLRDPLPG
FT                   EEENVHLAARLLAGTVVKPGEVFSQNNKIGPYVIARGFKKGPTYIGTKLTTTIGGGVCK
FT                   MASTLYNVAILSNLPVVERHAHSMPVPYVPYGQDATVSYGNKDLKFKNDTSSPIMIWAQ
FT                   GVDNILYVAFYSSTKPPEVEWHHEMLKLIKADKVYKMSSTLPKGREKLLMEGMDGAIVK
FT                   SWVTVKNPDGTVIKRDLRKSYYNPMPHVYEKGK"
FT   sig_peptide     complement(484000..484098)
FT                   /locus_tag="Ccel_0423"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.666) with cleavage site probability 0.312 at
FT                   residue 33"
FT   gene            484286..484699
FT                   /locus_tag="Ccel_0424"
FT   CDS_pept        484286..484699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0424"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: swo:Swol_1359 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74807"
FT                   /db_xref="GOA:B8I5Z0"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z0"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL74807.1"
FT                   /translation="MVFLLAFIGMTCWGIAPLFVKLGLKDVNPLMGLAVRTTFTLIVIS
FT                   SIMFINGSIYSLKNISSTALILLAVEAIFATLIGDLAYFAAIKRGAVSSVTIIMASSPL
FT                   ITIICSILFLDEQITFSRITGAVLVIIGIIIAI"
FT   gene            complement(484709..486175)
FT                   /locus_tag="Ccel_0425"
FT   CDS_pept        complement(484709..486175)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0425"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /note="PFAM: aminotransferase class V; Orn/Lys/Arg
FT                   decarboxylase major region; Orn/Lys/Arg decarboxylase
FT                   domain protein; KEGG: cth:Cthe_1918 arginine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74808"
FT                   /db_xref="GOA:B8I5Z1"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z1"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACL74808.1"
FT                   /translation="MEETSQNSTPLFDAVKRYVDSDVTPFHVPGHKHGRGISELRKYVG
FT                   KRILEMDVNGMEDLDYANNPTGVISQSQKLLADAFGADNAYFLVNGTTSGVQAMIMSVC
FT                   EPGSKIIIPRNAHKSTIGGIILSGAIPVYVQPVINKQLGIAMGVTTKSIEHAIKNNPHA
FT                   KAVFIINPSYYGIASDLKSIVSLAHHHDMAVLVDEAHGAHMYFHCDFPMTAMQAGADIS
FT                   AVSIHKTAGSLTQSSALLLKSNLIDPNTVKKVMSLTYTSSASYLLMCSIDIARKQLAVN
FT                   GRDILEKVLKLSRYAREEINKIRGLYAFGNELIGTPGCFAFDETKLSINIAGLGYTGYQ
FT                   LENKLRKEYNIQMELSDICNILAIISLGDRKQDLDLFINSLKDISAKAKPNTYPYQNAL
FT                   PDSPEMVVCPREAFYSPKKTVSLENSIGEISGEMIMVYPPGIPLVCMGERITKDIIEYI
FT                   KVLKNERCQIQGTADPYVNYVKVLGSNFIT"
FT   gene            486550..486705
FT                   /locus_tag="Ccel_0426"
FT   CDS_pept        486550..486705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0426"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74809"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74809.1"
FT                   /translation="MTIKNNRIELTSEESNIFTRQFKIGVIRQLYKENLLTAEQYDQVI
FT                   KAINSY"
FT   gene            486775..488379
FT                   /locus_tag="Ccel_0427"
FT   CDS_pept        486775..488379
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0427"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   spj:MGAS2096_Spy1103 site-specific recombinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74810"
FT                   /db_xref="GOA:B8I5Z3"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z3"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL74810.1"
FT                   /translation="MKIKVGAYCRVSTEKDDQVNSLQSQKKYFEEYIRNRPDWEFVDIY
FT                   ADEGISGTQAENRIEFQRMISDAKYKRLDLILTKEISRFARNTKISIDYTRMLKELGVG
FT                   VIFISDNINTLDGDGELRLTIMSAIAQDESRKTSERVKWGQKRRMEQGVVFGRELFGYN
FT                   LYKGTLTVNEEEAEIVRLIFRKYTIEGKGTHVIARELYEDNIQSKSYKNRWSNTVILRL
FT                   LKNEKYVGDLAQKKTITPNYLNHKKKYNRGEEEIVYIKNHHTPIIPRELWDATQEQIIQ
FT                   RSASKEQKSKYSNRYWCSGKLLCGECGSNFVGRSKKLENGQVYKVWKCSRAKSYGSLKI
FT                   DVNGNQVGCNNKSINHIVLGKIVKNVLYSINSNKEKIISELVSEIRKLNKLTNIKSTDS
FT                   FTRKIKDLNRKKQEVINLMIEGSISKDDMVLMNKRYDLEINKVKTDIKNIEEINLINSR
FT                   NADKLHIYLDRINSLVNQREENDSDEVFKLTVKKVILYKNNILELYFTCIPEPIKLKYK
FT                   SKGKNGNYSVEYSFMDN"
FT   gene            complement(488508..491300)
FT                   /locus_tag="Ccel_0428"
FT   CDS_pept        complement(488508..491300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0428"
FT                   /product="glycoside hydrolase family 5"
FT                   /note="PFAM: S-layer domain protein; glycoside hydrolase
FT                   family 5; Carbohydrate binding family 17/28; KEGG:
FT                   csc:Csac_0678 cellulase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74811"
FT                   /db_xref="GOA:B8I5Z4"
FT                   /db_xref="InterPro:IPR001119"
FT                   /db_xref="InterPro:IPR001547"
FT                   /db_xref="InterPro:IPR005086"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR018087"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z4"
FT                   /inference="protein motif:PFAM:PF00150"
FT                   /protein_id="ACL74811.1"
FT                   /translation="MFRNINKRILAFVIVVAMLMSFIPTMAFAAEPDSSHLITSQAEKP
FT                   STAGALQILDKNGTKTLCDKDGNPIQLRGMSTHGLQWYPEIINDNAFAALSNDWGSNVI
FT                   RIAMYVAEGGYSKDPETIKKRVIDGIDLAIANDMYAMLDWHVLTPGDPNADIYKGAMDF
FT                   FKEISQKYPNNPHIIYELANEPSPNDPGVTNDAAGWAKVKSYAEPIIKMLRDSGNKNLV
FT                   IVGSPNWSQRPDLAADNPINDNNTIYTVHFYSGTHKPSADSSDRGNVMSNARYALEHGV
FT                   AVFASEWGTSEASGNNGPYLKEADEWLEFLNANNISWCNWSLTNKNETSGSFIPFISGK
FT                   SDATSLDPGDDQVWSPKELSVSGEYARARIKGIKYEPIDRAEKEEFTTNVWDFNDGTTQ
FT                   GFGINGDSPVKADSITIANEKNTLKITGLNTSKDLTEGNYWANVRLSADGTSNKPNILG
FT                   AEKLTMDIITAAPATVSIAAIPQNSTHGWANPTRAIAVKPADFVKQEDGTYKAVLTITP
FT                   ADSPNFDSIAKDSKDSTMTNIILFVGADTNVISLDNITVSGNRTTVEAPVEHAPIGKAT
FT                   LPSIFEDSTRQGWAWDAASGVQSALTIKDANGSKAISWEVKYPEVKPVDGWASAPRIML
FT                   SNINATRGNNKYLAFDFYLKPTQASKGSLSINLAFAPPTLGYWAQASVNFDIPLTKLSK
FT                   MKKTKDGLYHFQVKYDLDKVNDGKVLAADTVLRDITIVVADGNSDFAGTMYVDNVRFEN
FT                   DSKSELNNAIAMLVSKGIIKSSDVKKINLNKSISRGEFLNWLVKTLDLNAKYSVNFSDV
FT                   HKKDSYYNPVGIAKALGITNGVGHNKFNPNKAISREDMLVLTFKALKLVNKNLVKGNAD
FT                   DLKQFTDASKVSRNSVESISTIVKNGFYSGDAKKLNLKASVSKAETALMLYKIYTSLHK
FT                   "
FT   sig_peptide     complement(491211..491300)
FT                   /locus_tag="Ccel_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 30"
FT   gene            492172..494757
FT                   /locus_tag="Ccel_0429"
FT   CDS_pept        492172..494757
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0429"
FT                   /product="PKD domain containing protein"
FT                   /note="PFAM: PKD domain containing protein; cellulosome
FT                   protein dockerin type I; KEGG: cth:Cthe_0624 glycoside
FT                   hydrolase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74812"
FT                   /db_xref="GOA:B8I5Z5"
FT                   /db_xref="InterPro:IPR000601"
FT                   /db_xref="InterPro:IPR002105"
FT                   /db_xref="InterPro:IPR008979"
FT                   /db_xref="InterPro:IPR013780"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR016134"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR022409"
FT                   /db_xref="InterPro:IPR024745"
FT                   /db_xref="InterPro:IPR035986"
FT                   /db_xref="InterPro:IPR036439"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z5"
FT                   /inference="protein motif:PFAM:PF00801"
FT                   /protein_id="ACL74812.1"
FT                   /translation="MAKVTKMRKVGALVVGSALLFTTMVPTSIFSAAASDAINVSIDTT
FT                   AERAAISPYIYGGNWEFNNAKLTAKRFGGNRTTGYNWENNYSNAGSDWQQSSDTYMLTS
FT                   NKIPEDKWSEPGVVITDFHDKNLAAGEPYSLVTLQAAGYVSADANGTVAEDEVAPSERW
FT                   KEVKFKKDAPLSLTPDTTDNYVYMDELVNLLVNKYGSASTATGIKGYAIDNEPALWSGT
FT                   HPRMHPNNATCAEVIDKNINLAKTVKGVDPSAETFGLVAYGFAAYNDFQSATDWKDLKG
FT                   NYTWFLDYYLDSMKKASTEAGTRLIDALDLHWYPEAKGGGQRICFGEDPTNILCNKARL
FT                   QAARTLWDPTYKEDSWIAQWCSFGLPLIPKVQESIDKYNPGTKLAFTEYSYGADNHITG
FT                   GIAEADVLGVFGKYGVYLATVWGGGSYTAAGVNIYTNYDGNGSKYGDTKVKAETSDVEN
FT                   SSVYASVDSKDDSKLHVILINKNYDSPMTVNFGINSDKQYTSGRVWSFDRSSANITEKD
FT                   AIDAISGNKLTYTIPALTVCHIVLDSSAQTTLYGDANHDETVDAIDYAYFKKILLNPDS
FT                   EYDKTCDLNLDNAVDAVDFGILKQYLLGKIQSLPYKTITENKPPVAAFTVSPKEAFTGD
FT                   NINFDATASTDPDGNVHIYSWDFGDGTEGSGANITHKYKAPGTYTIKLTAFDEKGLSNS
FT                   VTDTVTITSATGDNADVNFEDGELNGFITNDATITTLSVTSDKAFQGNKSLKWDAVGSK
FT                   DGKVDAEINSSVHVLKPGQTMTFRIWIPEGAPIKSIQPYYMPHNADWTAAEWNSSWKGY
FT                   DMVKKGDWNEFTVTLPLTTDVTLTECQFGIQVETSAEGNFTMYVDSIDW"
FT   sig_peptide     492172..492276
FT                   /locus_tag="Ccel_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 0.811 at
FT                   residue 35"
FT   gene            494963..496570
FT                   /locus_tag="Ccel_0430"
FT   CDS_pept        494963..496570
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0430"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   pth:PTH_0181 site-specific recombinases"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74813"
FT                   /db_xref="GOA:B8I5Z6"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z6"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL74813.1"
FT                   /translation="MEYIPPLVIANNFEQYNDIRNSIGEVGLEVGGYIRISTKKDSQIT
FT                   SIENQKKYIMEWASVNGYKIVDFYIDMKTGAYSYLRQEMVRMKNDISSGKIKGIVSKEI
FT                   SRTSRDILDIIELKRSLANQGAFFISIKEGYDSRTDDDEFLLVIHAGLAQKERKVTGSR
FT                   VKITQMIKAKEGKTNVPTPALGYKLSPDGQHIIINPATAEIYQLIVKKFLEGWGRLKIC
FT                   KYLNSQGIRTNRGNASWSTNSIYAILTNPVYLGITMYNITLTVRDDTGKAKRMVRPRDQ
FT                   WIVKENTHQPLITKEKFERIQQLIQDKKQKELKEWSCTKKYLLSGLVYCGSCGSKLYGG
FT                   RFPKKTAKLKIESERTPKDYYYYYFDRKTSGVCRNSKANFHMDIVEQKVIEKVKEILLS
FT                   YDQLDEIINKKHYLFDTRYIKEKKENERLRDRLQTVNSAIRREQSAYEADVITLDEYKT
FT                   RLDELRRQKLSLDEKLEKINSTPAQSGSLEVANKLKETIRSLHNLEQDFQYEIIRKLIN
FT                   KIYIKDNYSLEFEFTFSD"
FT   gene            complement(496754..497023)
FT                   /locus_tag="Ccel_0431"
FT   CDS_pept        complement(496754..497023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0431"
FT                   /product="putative spore-coat protein"
FT                   /note="KEGG: cdf:CD0597 putative spore-coat protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74814"
FT                   /db_xref="InterPro:IPR016571"
FT                   /db_xref="InterPro:IPR024207"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z7"
FT                   /inference="similar to AA sequence:KEGG:CD0597"
FT                   /protein_id="ACL74814.1"
FT                   /translation="MKPMNEREALLWKVQAYEFACIEVGLFLNTNPNDKTALAYFKQYR
FT                   DMKHQLESEFTKRFGPLTAGHMDNDLSTWRWIENPWPWEIGREV"
FT   gene            complement(497157..497366)
FT                   /locus_tag="Ccel_0432"
FT   CDS_pept        complement(497157..497366)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0432"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: tte:TTE1799 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74815"
FT                   /db_xref="InterPro:IPR020256"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74815.1"
FT                   /translation="MDDLVNEYNYQERDKSAIKPFNPSKIALAMAFVPSQLWERPYDVN
FT                   EGLDRGTLFPSLDKPFLGGGNRYE"
FT   gene            497558..498499
FT                   /locus_tag="Ccel_0433"
FT   CDS_pept        497558..498499
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0433"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: afl:Aflv_0291 uncharacterized conserved two
FT                   domain fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74816"
FT                   /db_xref="InterPro:IPR032250"
FT                   /db_xref="UniProtKB/TrEMBL:B8I5Z9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74816.1"
FT                   /translation="MKNSAKKVLTVLVFITCVVALVIILVFASKGNTPGIIDSNNSTKI
FT                   NASGQVYNADYLFENKTPYVGNNSKVLHIIDNLQFGNYRGEVSLQTEKIPYGVTVNYDF
FT                   QNLVKEDYQKAKIENEERLKLAFKRNAAMMFCLIENLDKITFVCRTVKGTAEYGFTREE
FT                   IQKDYNEDLKEYSKDKNKFGRFAITLNNDNLIIHSMKKYSPTMSSVVGLKIMSTYEGKA
FT                   DNIRYTATDGKLILFDGNSAGKQGNTLTVEKNTPIFWSPLSGDDTSFKADKIVVKVEVL
FT                   NQGIKIAEQNLNIKKEGITYIIEENINVIADI"
FT   sig_peptide     497558..497644
FT                   /locus_tag="Ccel_0433"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.640 at
FT                   residue 29"
FT   gene            498617..505965
FT                   /pseudo
FT                   /locus_tag="Ccel_0434"
FT   gene            complement(498993..499763)
FT                   /locus_tag="Ccel_0435"
FT   CDS_pept        complement(498993..499763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0435"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cth:Cthe_2804 ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74817"
FT                   /db_xref="GOA:B8I6C5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6C5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74817.1"
FT                   /translation="MFIDIKNVSKEYLQNNSIFKALDHVSLQIKKGEFICLLGPSGCGK
FT                   TTLLSSVAGFEKVNSGTIQIDGKQVSEPCISNVTIFQNYGLLPWRTVQKNVELGLESKK
FT                   LSKKERYDIASRYIDLVGLSKFSKSHPSQLSGGMQQRVAIARALAVDPEIIFMDEPFGA
FT                   LDALTRLKMQDEISNIWEHEKKTIIFVTHDIEEAVFLADRIVIMTPNPGKIKSIISVPL
FT                   ARNRDRTSHDFLKIRDRVFSEFNMKNPDKTEYYI"
FT   gene            complement(499753..500520)
FT                   /locus_tag="Ccel_0436"
FT   CDS_pept        complement(499753..500520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0436"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: cth:Cthe_2803
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74818"
FT                   /db_xref="GOA:B8I6C6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6C6"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL74818.1"
FT                   /translation="MKKLIHILVSFALILILWQGAVSLGYWNQALLPSPPDVGNGFLEL
FT                   VSSGTLFAGVKSSMYRFFVGYLLAAFSAVTLGLVLGWFRNAWSFVNPVVQLVRPISPIA
FT                   WFPFIVLIFGIGDLPAIVIIFIAAFFPILLATVNAVGKVDQTYIKVAKNFGIKQPMLLT
FT                   KIVLPAAFPSIASGLHIALGTAWVFLVAGEMVGAQTGLGFMIIDARNNLRADLLLANIL
FT                   SIGIIGLILDSFIGLAEKQLLKRWGVIGGNNVY"
FT   sig_peptide     complement(500443..500520)
FT                   /locus_tag="Ccel_0436"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.974) with cleavage site probability 0.694 at
FT                   residue 26"
FT   gene            complement(500544..501503)
FT                   /locus_tag="Ccel_0437"
FT   CDS_pept        complement(500544..501503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0437"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="SMART: extracellular solute-binding protein family
FT                   3; KEGG: cth:Cthe_2802 NlpA lipoprotein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74819"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6C7"
FT                   /inference="protein motif:SMART:SM00062"
FT                   /protein_id="ACL74819.1"
FT                   /translation="MSIKKSIVAALIFGLIAGTAACGNSGGVKESGLSNIKTIKIAYLP
FT                   LTHALPVFVEKELQDKKENKYKIELVKYGSWPELMDALNTGHVDGASVLIELAMKAKEQ
FT                   SIGVKAVALGHKDGNVIVVSKNIKSPSDLKGKNFAIPHRQSSHNILLGQMLKNVGLSYK
FT                   DVNIVELPPPEMPAALAQGQIAGYSVAEPFGAKSIALDTGKVLFESNELWKDSICCSLV
FT                   LSDKFINSNKDVAKEVVSSFRDAGEYIGSHKDEANAIAKKYLNLDDKVLTLSLKWISFN
FT                   DLEITREAYDSLTSKIKEFGISSNPPAYDDFVDSSLLR"
FT   sig_peptide     complement(501432..501503)
FT                   /locus_tag="Ccel_0437"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.718 at
FT                   residue 24"
FT   gene            complement(501546..503537)
FT                   /locus_tag="Ccel_0438"
FT   CDS_pept        complement(501546..503537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0438"
FT                   /product="carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /note="TIGRFAM: carbon-monoxide dehydrogenase, catalytic
FT                   subunit; PFAM: Prismane; KEGG: cth:Cthe_2801
FT                   carbon-monoxide dehydrogenase, catalytic subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74820"
FT                   /db_xref="GOA:B8I6C8"
FT                   /db_xref="InterPro:IPR004137"
FT                   /db_xref="InterPro:IPR010047"
FT                   /db_xref="InterPro:IPR011254"
FT                   /db_xref="InterPro:IPR016099"
FT                   /db_xref="InterPro:IPR016101"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6C8"
FT                   /inference="protein motif:TFAM:TIGR01702"
FT                   /protein_id="ACL74820.1"
FT                   /translation="MNFRYHHTKFDHSENHHHNDSGCNDYATAVAEYRKSFASKKEVLE
FT                   QTPDPAVKAMLLYMEEKGCETVFDRFDAQKPQCGFGLAGVCCRICNMGPCKITKKSPKG
FT                   VCGADADVIVARNILRSVAAGAAEHGARGRESMLALKYASEGRIKFPIEGENKVLATAK
FT                   AFGLDTENKSIKELAGLIADILLEDLSRTIPGPHHTLNAFASKERINVWSNLDIIPISP
FT                   YHEVFESLNRTGTGNDSDWENIMKQMLRTGVAFAWSCVLGSSIAMDSLFGLPVRSTSKV
FT                   NIGALEKGYVNIGIHGHSPVLVSEIVKLGNSDEFQELARQNGALGIKFYGICCSGLSAM
FT                   YRYGGVIPLSNAIGAELVLGTGALDLWVADVQDVFPSIMEVASCFKTTVVTTSDSARLP
FT                   GAEHYGFDHHHSNIDQTSELATKILNRAIESFTQRREVPVYIPPYEIEAEVGFSVEYIN
FT                   RHFGSVKPIAEALKNGEILGIVNLVGCNNPRIVYEKAIVELTDILLENNVLVLTNGCAS
FT                   FPLMKLGYCSTAALERTGDNLKGFLKDLPPVWHMGECLDNARASALFKAVAETSDIYIK
FT                   DMPYAFASPEWSNEKGICAALSFRLLGIDSYHCVYAPTQGSDNVTEFMSNGTKDILGSR
FT                   MIVNVNHIELANEIVNDLKVQRKALGWD"
FT   gene            503743..503931
FT                   /locus_tag="Ccel_0439"
FT   CDS_pept        503743..503931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0439"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74821"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6C9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74821.1"
FT                   /translation="MGKQKKDYEIVIFTPDTQEQIMHLKNEIGKAYGEFIIEHLTELDI
FT                   SYKQITSIYRKIIKEIR"
FT   gene            503940..505598
FT                   /locus_tag="Ccel_0440"
FT   CDS_pept        503940..505598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0440"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   drm:Dred_0913 resolvase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74822"
FT                   /db_xref="GOA:B8I6D0"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR025827"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="InterPro:IPR038109"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D0"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL74822.1"
FT                   /translation="MRAAIYSRKSRITGRGESIENQIQICKEYAINNLGLSENDFVIFE
FT                   DEGFSGGNTNRPEFKHMMSEARNKKIDIVICYRLDRISRNVSDFSQLINELERYNVSFI
FT                   SVKEQFDTTKPMGRAMMYIASVFSQLERETIAERIRDNMLQLAKTGRWLGGVSPTGYKS
FT                   EMILKKDSALKQTRMFCLRIIPEEAELVKDIYDKFIIFKSMTKVEKSLLENRLRTKNGV
FT                   DFSRFSLRFLLTNPVYAIADAKLYYYLSEQGYEIYSDLRAFNGVNGVMAYNKTRQGKNT
FT                   LSEKYRDPKEWVIAVGMHPGIIPSGKWIEVQKLLQRNKTKAYRNIKNTSALLSGILKCE
FT                   NCGSFMRPKTMTRMNSNGDKIFYYICELKEKSNKTRCDTQNLNGNILDSLILERVANMT
FT                   KKYIPAVSHNISVNRLGMKMEQKPEIKLIKDKLTAAETEMKNLIRLASKQADEKVQTMI
FT                   LKRMQSISQDINIYRSKIKKYDDVTNKSGIEPADERNLIRILSDPGYCIMNMMKIKQKR
FT                   SIIKSAVDVITWDGRQIKLRLKGSSEMLPDCKDCK"
FT   gene            506116..507456
FT                   /locus_tag="Ccel_0441"
FT   CDS_pept        506116..507456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0441"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: cbe:Cbei_2413
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74823"
FT                   /db_xref="GOA:B8I6D1"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D1"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACL74823.1"
FT                   /translation="MYTNKDLLRLFFPALTEQFLSTAIGVVNTMMVSGLGAFAVSAVGI
FT                   VDSINFVVMNLFVAVSTGATVTIAQHLGASNREDASKTASQAITAVLIMSIIAGLGLYI
FT                   FGNQIINFLFGDAEKIVKTAARTYMICSAISYPILGLFDVCTGILRASNNFRAAMYAVV
FT                   ASNLVNFLVGALFIFVFDFGVLGAGIGLICARLTGTIIVAYSICKSHHLDVLRSSFKIK
FT                   YKILKPVLYIGLPAGIDSLVFNGGKLLVQAIVASLGTAALAANSIAGSINSLLNIPGNA
FT                   MTIVAVTVVGHYAGAGLKEELNKIMKKLMVYAMLLLGAVSLIFFPFVHHFLKLYSPAPD
FT                   VASLALNITYLTLICIPVFWPAAFLLPSCLRSTRDVIFVTIVSIMSMWIVRVFGGYMLV
FT                   RYTGLGLMGIWIAWCFDWVTRGIPFLERVAAKRYEKYLPKTNSEPSS"
FT   gene            507604..508362
FT                   /locus_tag="Ccel_0442"
FT   CDS_pept        507604..508362
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0442"
FT                   /product="ribosomal protein S2"
FT                   /note="PFAM: ribosomal protein S2; KEGG: cth:Cthe_1006 SSU
FT                   ribosomal protein S2P"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74824"
FT                   /db_xref="GOA:B8I6D2"
FT                   /db_xref="InterPro:IPR001865"
FT                   /db_xref="InterPro:IPR005706"
FT                   /db_xref="InterPro:IPR018130"
FT                   /db_xref="InterPro:IPR023591"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6D2"
FT                   /inference="protein motif:PFAM:PF00318"
FT                   /protein_id="ACL74824.1"
FT                   /translation="MAVISMKQLLEAGVHFGHQTRRWNPKMAEYIFTERNGIYIIDLQK
FT                   TVKKVDDAYFFIREIAMNGQDVLFVGTKKQAQDSIREEAERSGQFFVNNRWLGGMLTNF
FT                   KTITKRINRLHQLNAMETDGTFEVLPKKEVSKLKKEMADLEKNLGGIKNMKKLPGAMFV
FT                   VDPRKERNAILEAKRLGIPVVAIVDTNCDPDEVDFVIPGNDDAIRAVKLIAAKMADAVI
FT                   EGRQGEQLAETPVETAEVAEEAQVAVEAAE"
FT   gene            508482..509129
FT                   /locus_tag="Ccel_0443"
FT   CDS_pept        508482..509129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0443"
FT                   /product="translation elongation factor Ts"
FT                   /note="TIGRFAM: translation elongation factor Ts; PFAM:
FT                   ubiquitin-associated- domain-containing protein;
FT                   Translation elongation factor EFTs/EF1B dimerisation; KEGG:
FT                   cth:Cthe_1005 elongation factor Ts"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74825"
FT                   /db_xref="GOA:B8I6D3"
FT                   /db_xref="InterPro:IPR001816"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="InterPro:IPR014039"
FT                   /db_xref="InterPro:IPR018101"
FT                   /db_xref="InterPro:IPR036402"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D3"
FT                   /inference="protein motif:TFAM:TIGR00116"
FT                   /protein_id="ACL74825.1"
FT                   /translation="MITAEMVRQLRERTGAGMMDCKRALTDANGDAEKAIELLREKGLS
FT                   AAAKKAGRVAAEGLVEAYIHGDGRIGVLVEVNIETDFAARGDEFKQFVKDIAMQIAASK
FT                   PEYVKKEDVPASVIESEKEILRAQARNEGKPEKIIDKMVEGRIEKFYAENCLLEQSFIK
FT                   DPDMTVGQLVTEKIAHIGENITIRRFARFERGEGVEKKEENFADEVLKQING"
FT   variation       509297
FT                   /note="SNP"
FT   gene            509314..510021
FT                   /locus_tag="Ccel_0444"
FT   CDS_pept        509314..510021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0444"
FT                   /product="uridylate kinase"
FT                   /note="TIGRFAM: uridylate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; KEGG: cth:Cthe_1004
FT                   uridylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74826"
FT                   /db_xref="GOA:B8I6D4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR011817"
FT                   /db_xref="InterPro:IPR015963"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D4"
FT                   /inference="protein motif:TFAM:TIGR02075"
FT                   /protein_id="ACL74826.1"
FT                   /translation="MSELKYKRIMLKISGEALAGDKGHGIDTDTVNEICDRISVVHKLG
FT                   AEIAIVVGGGNFWRGRSGKGMDRTTADHMGMLATVINSLGLQDALESRDIPVRVQTAIE
FT                   MRQIAEPYVRRKAVRHLEKKRIVIFACGMGNPYFSTDTAAALRAAEIDAQVILMAKNVD
FT                   GIYDSDPSKNSHAIKYNKLSYQEYLNKGLCAIDLTAASFCKDNAIPTLVFGLNDPDNII
FT                   KAAKGQEIGTTIY"
FT   gene            510074..510631
FT                   /locus_tag="Ccel_0445"
FT   CDS_pept        510074..510631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0445"
FT                   /product="ribosome recycling factor"
FT                   /note="PFAM: ribosome recycling factor; KEGG: cth:Cthe_1003
FT                   ribosome recycling factor"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74827"
FT                   /db_xref="GOA:B8I6D5"
FT                   /db_xref="InterPro:IPR002661"
FT                   /db_xref="InterPro:IPR023584"
FT                   /db_xref="InterPro:IPR036191"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D5"
FT                   /inference="protein motif:PFAM:PF01765"
FT                   /protein_id="ACL74827.1"
FT                   /translation="MDKELYKPIEEKMKKTINVLRDNLAGIRAGRANPAILDKLTIDYY
FT                   GAPTPIQQVATVSIPEARVILIQPWEAKLLKDIEKEIQKSDIGINPNNDGKVLRLVFPA
FT                   LTEERRRELTKQAKKEGEESKIAIRSIRRDSIETMKAKKKSGEITEDDLKDAEKDIQNI
FT                   TDRYIAEIDRVIEAKDKEIMEV"
FT   gene            510637..510900
FT                   /locus_tag="Ccel_0446"
FT   CDS_pept        510637..510900
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0446"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1002 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74828"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74828.1"
FT                   /translation="MSYTEIDKNNGCTVNKEVQLTSFCNSLIGYTLKDALKAASDRRYP
FT                   IDCIFISSPPKMNITEYDDSFRVIRVKALKNKSLNILVCKPL"
FT   gene            510975..511730
FT                   /locus_tag="Ccel_0447"
FT   CDS_pept        510975..511730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0447"
FT                   /product="undecaprenyl diphosphate synthase"
FT                   /note="TIGRFAM: undecaprenyl diphosphate synthase; PFAM:
FT                   Di-trans-poly-cis-decaprenylcistransferase; KEGG:
FT                   cth:Cthe_1001 undecaprenyl pyrophosphate synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74829"
FT                   /db_xref="GOA:B8I6D7"
FT                   /db_xref="InterPro:IPR001441"
FT                   /db_xref="InterPro:IPR018520"
FT                   /db_xref="InterPro:IPR036424"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D7"
FT                   /inference="protein motif:TFAM:TIGR00055"
FT                   /protein_id="ACL74829.1"
FT                   /translation="MGFFNRIFPQKKLSDDFQCVPKHIAIIPDGNGRWAKKRGLPRNVG
FT                   HREGSMTLKKVVIYCSNIGVKHLTIYAFSTENWKRPQSEVDALMNLLLEFLRNAERELE
FT                   GSNVRIKVIGDINGLPGELQNEIARVEKFTGVNNGLNLNIALNYGSRFEILNAVRNIAQ
FT                   EIKNGKLSINDIDEKQLEQHLYTKGIPEPDLLIRTSGEQRISNYLLWQCAYTEFWFTDT
FT                   LWPDINDRHIADAIKAFEKRNRRYGGVEN"
FT   gene            511789..512616
FT                   /locus_tag="Ccel_0448"
FT   CDS_pept        511789..512616
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0448"
FT                   /product="phosphatidate cytidylyltransferase"
FT                   /note="PFAM: phosphatidate cytidylyltransferase; KEGG:
FT                   cth:Cthe_1000 phosphatidate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74830"
FT                   /db_xref="GOA:B8I6D8"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6D8"
FT                   /inference="protein motif:PFAM:PF01148"
FT                   /protein_id="ACL74830.1"
FT                   /translation="MARTRIISGLVGLVLLIGVLYMGSVVLGIVVSIIAAIGLYEFYNS
FT                   ISNTKGIHPIKIVGYLSIVPLFVLGLQSTGWYNIDLGIMTGISVCLIIFVSMASIVFGH
FT                   KKYNIVDACATVFGIAYIPFLMSFLIMLRNMDNGNILIWLIFIGAWGTDTLAYTFGRLF
FT                   GKRKIIPEISPKKTLAGALGGILGCTLLMVIYGIVVNNYFNLDITYFTLILLGLLCGVI
FT                   SQIGDWAASAIKRYVNVKDFGNIMPGHGGVLDRFDSILFVAPVIYYVLALFIK"
FT   sig_peptide     511789..511872
FT                   /locus_tag="Ccel_0448"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.918) with cleavage site probability 0.418 at
FT                   residue 28"
FT   gene            512654..513799
FT                   /locus_tag="Ccel_0449"
FT   CDS_pept        512654..513799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0449"
FT                   /product="1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /note="TIGRFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase; PFAM: 1-deoxy-D-xylulose 5-phosphate
FT                   reductoisomerase domain protein; KEGG: cth:Cthe_0999
FT                   1-deoxy-D-xylulose 5-phosphate reductoisomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74831"
FT                   /db_xref="GOA:B8I6D9"
FT                   /db_xref="InterPro:IPR003821"
FT                   /db_xref="InterPro:IPR013512"
FT                   /db_xref="InterPro:IPR013644"
FT                   /db_xref="InterPro:IPR026877"
FT                   /db_xref="InterPro:IPR036169"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6D9"
FT                   /inference="protein motif:TFAM:TIGR00243"
FT                   /protein_id="ACL74831.1"
FT                   /translation="MAKIISIIGSTGSIGRQTLEAAKNLGIKVAALSANSNIDLLEKQV
FT                   HEFKPDVVSVGNSELAKEMSNRLQGFGIEVLWGQDGMKRVVEHSEADTVVTSVVGTAGL
FT                   IPTIHAIRHKKNIALANKETLVTAGQLVMEDAKKNNVKIFPVDSEHSAIYQCLLGNKDK
FT                   QVEKIILTASGGPFRGKNIKELKNITPAQALKHPNWSMGNKITIDSATLMNKGLEVIEA
FT                   KWLFQRDLDSIQVLVHPQSIIHSMVQYVDGSVMAQLGSPDMRIPIQLALTYPDRCQNNF
FT                   NKLDFLKCPPLTFEEPDIDTFKCLRLAYKSLEIGGTMPAALNAANEIAVAAFLENHIGF
FT                   TEIAETIEQVMQRHNVNICPCLEDIIEVDCWARTTARQLII"
FT   gene            513835..515121
FT                   /locus_tag="Ccel_0450"
FT   CDS_pept        513835..515121
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0450"
FT                   /product="membrane-associated zinc metalloprotease"
FT                   /note="TIGRFAM: membrane-associated zinc metalloprotease;
FT                   PFAM: PDZ/DHR/GLGF domain protein; peptidase M50; KEGG:
FT                   cth:Cthe_0998 peptidase RseP"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74832"
FT                   /db_xref="GOA:B8I6E0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR004387"
FT                   /db_xref="InterPro:IPR008915"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6E0"
FT                   /inference="protein motif:TFAM:TIGR00054"
FT                   /protein_id="ACL74832.1"
FT                   /translation="MGILLAILALSFLIIIHELGHFLVAKAFNVRVNEFSLFMGPKIFS
FT                   FVRGETTYSLRLIPLGGYVKMEGEEEASDDDRAFNKKPIGVRSAIIAAGPIMNIIIAVV
FT                   FAFIIMAQSGFYTNEVKTVLPGSAGEKAGIQVGDVLEKYNGKNIYQVNDLEIFAYPLTN
FT                   ESIDLQVRRNGESKTIHFKPDRMSGYKLGFSPKAESGSESNVVANVSNKSPAMKAGVKD
FT                   GDRIVKLNGTPVKSRQDIASALDKIELNNVTITVDRNGKEIDLAPVVPMQGKNPEYYAI
FT                   GVDFNHTKSGIFASLSQSVKYNISIARSIYYSIGWLFTGTVPASDLMGPVGITTTIKDV
FT                   VQLGPSIMDKLLNLLSFTAMISLNLGLVNLIPFPALDGSKLVLLLVEGIRKKPLSPERE
FT                   ALISMIGFVFLIMLMIYATFNDILRIGRG"
FT   gene            515132..516193
FT                   /locus_tag="Ccel_0451"
FT   CDS_pept        515132..516193
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0451"
FT                   /product="1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate
FT                   synthase"
FT                   /note="TIGRFAM: 1-hydroxy-2-methyl-2-(E)-butenyl
FT                   4-diphosphate synthase; PFAM: IspG family protein; KEGG:
FT                   cth:Cthe_0997 4-hydroxy-3-methylbut-2-en-1-yl diphosphate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74833"
FT                   /db_xref="GOA:B8I6E1"
FT                   /db_xref="InterPro:IPR004588"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR016425"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6E1"
FT                   /inference="protein motif:TFAM:TIGR00612"
FT                   /protein_id="ACL74833.1"
FT                   /translation="MEDCIKRNQTKKIKVGDIFIGGDSPISVQSMTNTDTRDVKATIHQ
FT                   IKSLEEAGCDIVRLAILDNEAATAIGEIKKHVKIPLVADIHYDYRLAVECMKNGVDKIR
FT                   LNPGNIGGNDRVRTVAGMAKERGIPIRIGVNSGSVEKRILEKFGGVTAEGMVESALAHV
FT                   AMLENVDFNDIAISIKASSVPMTIAAYRLLSEKCLYPLHVGVTEAGTVYKGTIKSAVGI
FT                   GCLLAEGIGDTIRVSLTGDPVEEIKVGKQILKSLDLLKEGIEIVSCPTCGRTQVNLIDI
FT                   ANSIEPLLEKLNKNIKVAIMGCAVNGPGEAKDADIGIAGGVNEVLLFKKGRIIRKIPQE
FT                   NVVEELIKEISEM"
FT   gene            516268..520569
FT                   /locus_tag="Ccel_0452"
FT   CDS_pept        516268..520569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0452"
FT                   /product="DNA polymerase III, alpha subunit"
FT                   /note="KEGG: cth:Cthe_0996 DNA polymerase III PolC;
FT                   TIGRFAM: DNA polymerase III, epsilon subunit; DNA
FT                   polymerase III, alpha subunit; PFAM: PHP domain protein;
FT                   nucleic acid binding OB-fold tRNA/helicase-type; DNA
FT                   polymerase III alpha subunit; Exonuclease RNase T and DNA
FT                   polymerase III; SMART: phosphoesterase PHP domain protein;
FT                   Exonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74834"
FT                   /db_xref="GOA:B8I6E2"
FT                   /db_xref="InterPro:IPR003141"
FT                   /db_xref="InterPro:IPR004013"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006308"
FT                   /db_xref="InterPro:IPR011708"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR024754"
FT                   /db_xref="InterPro:IPR028112"
FT                   /db_xref="InterPro:IPR029460"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR040982"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6E2"
FT                   /inference="protein motif:TFAM:TIGR01405"
FT                   /protein_id="ACL74834.1"
FT                   /translation="MDSTNNINRFLYDLFPDAMDFDGEFSALKQLKVERMSVFIKANRL
FT                   EIHTISSDIVSIALIMKAEECLKQKLGAPNLTLKVKCSRSYSVEEYLSIMWSELMQMLT
FT                   SKVALCRGILHGSKYEISGNKIIINLLTSGADILKAQNCHTMLEQHIKGTICQSVKVEF
FT                   CDMHVDHVIIEEYVAEKVKNEAKVVSSAITALPENQKQKKYEFKSYGSGDMPSKAVITG
FT                   KPFTDSIMKISEVTPDSGKVAVAGEVFRTEYREIRGGKYIYIFDVTDFTSSVTVKMFLE
FT                   KKDFGNISERITEGVCLRIRGEAQYDKFSKELAIMAFDIVETEREIRHDDAEEKRVELH
FT                   LHTQMSSMDGVTAVKDLVKRAAQWGHKAIAVTDHGIVQAYPDAYAASKKNNIKVIYGLE
FT                   CYLLDDSVPIVYGIKEHSLDDDFVVFDIETTGLNPQQDRITEIGAVKVRNGQIVDRFSA
FT                   FVNPGVSIPSFIVKLTGITNDMVKDAPPIEQVLNEFMEFIQGSVLVAHNANFDVGFIKH
FT                   NAKIIGEKVKNPYLDTLELCRKMFPELGRYKLNIVAKHLKIELENHHRAVDDSMATAKI
FT                   FIHCLNELKEKGCKNIKDIQNAFDGEVNLKASSYHAIILVKNKVGLKNLYKIVSQSHLK
FT                   YLYKKPRVPKKLLMEYREGLILGSACEAGELYRAILNNKSEDEISKIVRFYDYLEIQPL
FT                   GNNQFLINNGKVSSQEELKKINKKIIRLGERHRKPVVATCDVHFMDPRDEVFRRILMSG
FT                   RGFTDADNQAPLYFRTTEEMLEEFSYLGEEKAREVVIENTNLIADMIESIAPVLEGTFP
FT                   PKIEGAEQDIENMAMNRAKEIYGEELPEVVAKRLEKELNSIIKNGFAVMYLIAQKLVSK
FT                   SLNDGYLVGSRGSVGSSFVANMSGITEVNSLQPHYVCEKCKYSEFILDGSYDCGFDLPE
FT                   KDCPNCGNKLKKDGYDIPFETFLGFDGDKEPDIDLNFSGDYQPVAHKYTEELFGEGYVF
FT                   RAGTIASVAEKTAYGYVKNYLDERSIVVTNAEINRLVKGCTGIKRTTGQHPGGIMIVPK
FT                   DKEIFDFSPIQRPADDIKSEIITTHFDYHFLHGSILKLDILGHDDPTVIRMLEDLTGVD
FT                   ARTIPIGEKKTMSLFSSTEALGVKPEDIGSETGTFAVPEFGTKFVRQMLLDTKPQSFSE
FT                   LIRISGLSHGTDVWLNNAQELIRDGITTLSQSICCRDDIMIYLMHAGLPPKTAFKIMED
FT                   VRKGKGVKEEYEAIMKENNVPDWYIQSCKKIKYMFPKAHAAAYVMMAFRIAWFKVYYPE
FT                   AFYATYFTVRADDFDAEMMTYGQDKVRNKIKEFEMKGNNITTKEKNVLTILEVVNEMYA
FT                   RGINFLPINLYLSEATKFRIEDKSIRPPMNALQGLGGAAAQNIIEARKNGEFLSIDELR
FT                   TRAKISKSVIEILERNNVLEGMPESNQLCLF"
FT   gene            520889..521347
FT                   /locus_tag="Ccel_0453"
FT   CDS_pept        520889..521347
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0453"
FT                   /product="protein of unknown function DUF150"
FT                   /note="PFAM: protein of unknown function DUF150; KEGG:
FT                   cth:Cthe_0995 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74835"
FT                   /db_xref="GOA:B8I6E3"
FT                   /db_xref="InterPro:IPR003728"
FT                   /db_xref="InterPro:IPR028989"
FT                   /db_xref="InterPro:IPR028998"
FT                   /db_xref="InterPro:IPR035956"
FT                   /db_xref="InterPro:IPR036847"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6E3"
FT                   /inference="protein motif:PFAM:PF02576"
FT                   /protein_id="ACL74835.1"
FT                   /translation="MKKNIQQTVTELVSPVVESLNYELVDIEYVKEGANWYLRVYIDKP
FT                   GGISIDDCQAVSEQVSDLLDKDDPIDQSYFLEVSSPGLDRPLKTEKDFAKYKGELVEVK
FT                   VFQPIDGKKIFEGELVGLKDNIIVINQDGHNVQFERDEVAIVKRVIKF"
FT   gene            521381..522529
FT                   /locus_tag="Ccel_0454"
FT   CDS_pept        521381..522529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0454"
FT                   /product="NusA antitermination factor"
FT                   /note="KEGG: cth:Cthe_0994 NusA antitermination factor;
FT                   TIGRFAM: transcription termination factor NusA; PFAM: RNA
FT                   binding S1 domain protein; NusA domain protein; SMART: KH
FT                   domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74836"
FT                   /db_xref="GOA:B8I6E4"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR004087"
FT                   /db_xref="InterPro:IPR009019"
FT                   /db_xref="InterPro:IPR010213"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013735"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="InterPro:IPR025249"
FT                   /db_xref="InterPro:IPR030842"
FT                   /db_xref="InterPro:IPR036555"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6E4"
FT                   /inference="protein motif:TFAM:TIGR01953"
FT                   /protein_id="ACL74836.1"
FT                   /translation="MSAELILALEQLEKEKGIKKEIIIEAIEAALISAYKKNFGSAMNV
FT                   KVNIDRVTGDVKVFALRKVAEDPDVEAMDISIGEAAKLNPTLDIGDYVESEVTPRSFGR
FT                   IAAQTAKQVVVQKLREAERGIIYDEFYNKESDIVTGIIQRIEKRNVIVDLGKTEAVLGS
FT                   TEQTPGEEYRFNERLKSYIVEVKKTTKGPQIMLSRTHPGLVKRLFELEVPEIHDGTVEI
FT                   KSISREPGSRTKLAVYSKDENVDPVGACVGQKGTRVQAIVDELRGEKIDIIKWSNDPKD
FT                   YISSSLSPAKVVRVDVDEEEKSAKVVVPDYQLSLAIGKEGQNARLAAKLTGWKIDIKSE
FT                   SQLRQSIEKQLFDDSLNNGYLDETDTDSMNYDNDDHENNIID"
FT   gene            522592..522864
FT                   /locus_tag="Ccel_0455"
FT   CDS_pept        522592..522864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0455"
FT                   /product="protein of unknown function DUF448"
FT                   /note="PFAM: protein of unknown function DUF448; KEGG:
FT                   cth:Cthe_0993 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74837"
FT                   /db_xref="InterPro:IPR007393"
FT                   /db_xref="InterPro:IPR035931"
FT                   /db_xref="InterPro:IPR037465"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6E5"
FT                   /inference="protein motif:PFAM:PF04296"
FT                   /protein_id="ACL74837.1"
FT                   /translation="MKQKKIPLRMCLGCKEMKPKRELIRVVKNNEGEISIDLVGKKPGR
FT                   GAYICRSADCLEQAIKAKRLEKAFETTIDMDIYNILKNQLEENDE"
FT   gene            522857..523195
FT                   /locus_tag="Ccel_0456"
FT   CDS_pept        522857..523195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0456"
FT                   /product="ribosomal protein L7Ae/L30e/S12e/Gadd45"
FT                   /note="PFAM: ribosomal protein L7Ae/L30e/S12e/Gadd45; KEGG:
FT                   cth:Cthe_0992 50S ribosomal protein L7AE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74838"
FT                   /db_xref="GOA:B8I6E6"
FT                   /db_xref="InterPro:IPR004038"
FT                   /db_xref="InterPro:IPR029064"
FT                   /db_xref="InterPro:IPR039107"
FT                   /db_xref="InterPro:IPR039109"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6E6"
FT                   /inference="protein motif:PFAM:PF01248"
FT                   /protein_id="ACL74838.1"
FT                   /translation="MNKVYSLLGLAKKAGQLLSGDETCERTVKSGKAELVIVADDASEN
FT                   TKDKFKSMCNYHSIPYREYGQKLQLGKYTGKDIRAVVSIVSKDFKNGLLKLIDNSTNET
FT                   GGEGFGKS"
FT   gene            523182..526667
FT                   /locus_tag="Ccel_0457"
FT   CDS_pept        523182..526667
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0457"
FT                   /product="translation initiation factor IF-2"
FT                   /note="TIGRFAM: translation initiation factor IF-2; small
FT                   GTP-binding protein; PFAM: protein synthesis factor
FT                   GTP-binding; GTP-binding protein HSR1-related; elongation
FT                   factor Tu domain 2 protein; translation initiation factor
FT                   IF-2 domain protein; Miro domain protein; KEGG:
FT                   cth:Cthe_0991 translation initiation factor 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74839"
FT                   /db_xref="GOA:B8I6E7"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036925"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6E7"
FT                   /inference="protein motif:TFAM:TIGR00487"
FT                   /protein_id="ACL74839.1"
FT                   /translation="MEKARIYELAKELNTTSKRLMEKLAEIDISVKNHMSLLEPHELDA
FT                   LYKHIGVIRHDDKKNEVEEKKTVAESTNTTEKKKEVKKEVKKENKNAPRIIRTTEIIID
FT                   SSTEDSSGANNFPKNETKNVQKKNYKNNFVKVESSTSGLRPGFVRDVKPDLRNKQNAAS
FT                   SKNEVKKALPKETSAPKEEVLNSKIINEDIHKEEKTVADNKGNGSKVLKGSSNTESAQL
FT                   NNKVAAVEKEEQKSINKPESAQISTQSENKPQQSNGAKQPEEAVVSVNKDSIGKSEQVT
FT                   AQNDVPSVNKVHPQEKPVHRTDRPQGQYNNQRSDRPQGQYNNQRSDRPQGQYNNQRSDR
FT                   PQGQYNNQRSDRPQGQYNNQRSDRPQGQYNNQRSDRPQGQYNNQRSDRPQGQYNNQRSD
FT                   RPQGQYNNQRSDRPQGQYNNQRSDRPQGQYNNQRSDRPHGQYNNQRSDRPQGQYGNKRP
FT                   DRPQGQHRQQNLDIPKPDASVAQEAFDSQRNEARREFQGRDFDKNVKREEKQKKEAPKS
FT                   NTATKQRFRPQKIVIEKKGVSEILSEDYIFNEFYNDDGKKKKHRNKRNDKVQVKYIPPK
FT                   AVLTSITIPESLTVKDLAESLKKTSTEIIKKLMAYGVMATLNNEVDFETATIIAEEYGV
FT                   KTEKAIQVSEEDILFDDDEVQDESKLQPRPPVVVVMGHVDHGKTSLLDAIRSEHVIDSE
FT                   AGGITQHIGAYTVKANDRAITFLDTPGHEAFTAMRARGAQVTDIAILVVAADDGVMPQT
FT                   IEAINHAKAANVTIIVAINKIDKPSANPDKVKQELTEYGIVAEEWGGDAIMVPVSAKKR
FT                   ENIDQLLEMVLLAADMLELKADPERQAKGTVIEAKLDKERGPVATVLVQRGTLKTGDSL
FT                   IAGSTFGRIKAMTSDKGHAIKAAGPSIPVEILGMDEVPEAGEVFYAVTEDKVAKHLVEK
FT                   RKFKQKEQQFKATSKVTLEDLFTQIKEGKVKDLNIIIKADVQGSVEAVKQSLEKLSNDE
FT                   VRVKTIHGAVGAITESDVTLAQVSNAIIIGFNVRPGANVTEAAKNAEVDMRLYSVIYKA
FT                   IEDVQAAMNGMLEPTYKEVILGHIEIRQIFKVSGVGTIGGAYVTDGKVQRNSEVRVVRE
FT                   GIVIHEGKLASLKRFKDDVKEVAQGFECGVSIERFNDIKEGDVIEAFVMEEVKR"
FT   gene            526895..527248
FT                   /locus_tag="Ccel_0458"
FT   CDS_pept        526895..527248
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0458"
FT                   /product="ribosome-binding factor A"
FT                   /note="PFAM: ribosome-binding factor A; KEGG: cth:Cthe_0990
FT                   ribosome-binding factor A"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74840"
FT                   /db_xref="GOA:B8I6E8"
FT                   /db_xref="InterPro:IPR000238"
FT                   /db_xref="InterPro:IPR015946"
FT                   /db_xref="InterPro:IPR020053"
FT                   /db_xref="InterPro:IPR023799"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6E8"
FT                   /inference="protein motif:PFAM:PF02033"
FT                   /protein_id="ACL74840.1"
FT                   /translation="MADRIVRISEEVKKEISNIIQNDIKDPRLPSMVSIVSCSVTKDLR
FT                   YAKVYVSVFGNDEQKKNAISALKSAAGFIRRELGHRVQLRYTPEIHFELDTSIEHGFHI
FT                   NKLLDDAKKEFTE"
FT   gene            527281..528243
FT                   /locus_tag="Ccel_0459"
FT   CDS_pept        527281..528243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0459"
FT                   /product="phosphoesterase RecJ domain protein"
FT                   /note="PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: cth:Cthe_0989 phosphoesterase,
FT                   RecJ-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74841"
FT                   /db_xref="GOA:B8I6E9"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6E9"
FT                   /inference="protein motif:PFAM:PF01368"
FT                   /protein_id="ACL74841.1"
FT                   /translation="MEKGLIKAIETAESIAIFPHTSADGDAIGSSLALALALKKTGKKV
FT                   IVYMEESIPDTYKFLPGSELAVFISENDDIMGLNIALDTGDTARLASRAALFFKAPATI
FT                   NIDHHITNTKFAQYNHVDASAASTGELVFLLLKEMNYEIDADMAKCLYTAIVTDTGGFK
FT                   YGNTTAETHRTAAELLSTGIDVADLSQKLFDNTTFVKLKLTQKAIELLELYENDLLAVT
FT                   VITQDVLQSTGAKDEDCDGLVNIGRSIEGVEVSVLIKEKSTNEIRVNLRSKTYVDVSEI
FT                   AAAFGGGGHKRAAGCTIKGRITDVKEQLINTIKDKLKRR"
FT   gene            528246..529175
FT                   /locus_tag="Ccel_0460"
FT   CDS_pept        528246..529175
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0460"
FT                   /product="tRNA pseudouridine synthase B"
FT                   /note="TIGRFAM: tRNA pseudouridine synthase B; PFAM:
FT                   pseudouridylate synthase TruB domain protein; KEGG:
FT                   cth:Cthe_0988 tRNA pseudouridine synthase B"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74842"
FT                   /db_xref="GOA:B8I6F0"
FT                   /db_xref="InterPro:IPR002501"
FT                   /db_xref="InterPro:IPR014780"
FT                   /db_xref="InterPro:IPR020103"
FT                   /db_xref="InterPro:IPR032819"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F0"
FT                   /inference="protein motif:TFAM:TIGR00431"
FT                   /protein_id="ACL74842.1"
FT                   /translation="MNGILNVLKPAGMTSFDVIGYMRKLTGQKKIGHAGTLDPSAVGVL
FT                   PLCIGNATKALEFMINKDKVYRAELTLGISTDTQDSSGTVLSFHSVDVTENDIKKSIIS
FT                   FMGTIEQLPPMYSAIKIGGKKLYELARQGQTIERESRTIQIYNIDIIRIWDDSEVFESE
FT                   GIPQEFAIKKVLLDIHCSKGTYIRTLCHDIGEKLGCGGHMSFLVRTRAGQYDLDNSLTI
FT                   EEVAQLSETKSLEVHLLPVEKVFEEYDRIELNKEELFKYNNGVWLEVEKNKYKNTFYRV
FT                   YNNNSFLGLGEVFEKGNTLYLKSKKFFK"
FT   gene            529197..530132
FT                   /locus_tag="Ccel_0461"
FT   CDS_pept        529197..530132
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0461"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG: cth:Cthe_0987
FT                   riboflavin kinase / FMN adenylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74843"
FT                   /db_xref="GOA:B8I6F1"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F1"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACL74843.1"
FT                   /translation="MQVINSNNSNNIFSCYTGVGLGNFDGLHIGHMALINTLIRESKLN
FT                   GLSSVVYTFTRHTENILRKKLITPLLLTESKKIELLSETTLDYLYLDEFNEAFSRMSPE
FT                   EFVIKILKSKLNIKLAVAGHDYRFGYKGEGDIPLLEQFGKKYGFKVVVIPPITCDNEII
FT                   SSTSIRQSIINGNLETAYKLLGRNYSIIAEVVNGRRVGNTIGFPTANIHPEKYLVLPHN
FT                   GVYITKTLLNGHLYNSMTNVGYNPTFEDVQQKTIETHIMDFHQDIYGEKIEVFFLKKIR
FT                   DEKKFSNVEELIIQITKDMRVARDYLNIDS"
FT   gene            530153..532525
FT                   /locus_tag="Ccel_0462"
FT   CDS_pept        530153..532525
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0462"
FT                   /product="(NiFe) hydrogenase maturation protein HypF"
FT                   /note="TIGRFAM: [NiFe] hydrogenase maturation protein HypF;
FT                   PFAM: acylphosphatase; SUA5/yciO/yrdC domain; zinc finger
FT                   HypF domain protein; KEGG: gsu:GSU0306 hydrogenase
FT                   maturation protein HypF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74844"
FT                   /db_xref="GOA:B8I6F2"
FT                   /db_xref="InterPro:IPR001792"
FT                   /db_xref="InterPro:IPR004421"
FT                   /db_xref="InterPro:IPR006070"
FT                   /db_xref="InterPro:IPR011125"
FT                   /db_xref="InterPro:IPR017945"
FT                   /db_xref="InterPro:IPR017968"
FT                   /db_xref="InterPro:IPR036046"
FT                   /db_xref="InterPro:IPR041440"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F2"
FT                   /inference="protein motif:TFAM:TIGR00143"
FT                   /protein_id="ACL74844.1"
FT                   /translation="MTGYRIIITGIVQGVGFRPFIFNLAERFGMKGWVGNTDSNVIIEI
FT                   DSDFQKVVDFINEIKKSAPVLSRIKSIEYKDIVYQGFKNFEIRHSQKNSKGPVFISPDV
FT                   ATCCDCLREMKDKSDRRYRYPFINCTNCGPRFTIIKNIPYDRDNTTMKYFEMCENCRQE
FT                   YTKPSDRRYHTQPVSCHECGPHLSIADETGKIMREIQSSRECITFTADLVKKGNIVAVK
FT                   GIGGYHLACDGLNKKAVDRLRTRKHRDDKPFAVMAKDLRTAEKYCKINYVEKNILTSTA
FT                   SPIVLLEKKDGVILPESLAHLNRYLGVMLPYTPVHHLLFEEKGFPELLVMTSGNLSNEP
FT                   IFYKDEEAVEGLQGIADAYLTNNREIYIRTDDSVTRVFNAKEYIIRRARGHVPNPVSIN
FT                   VHELLDMDKTIEIPSVLACGGELKNVFCLNKGKNFYLSHHIGDLENESTNIAFRNGIEH
FT                   FKRLFDISPQLIAYDLHPNYYSSQYALKQRYVEKVSIQHHKAHIASCMAENKLKGDVIG
FT                   VSFDGTGYGEDGNIWGGEFFTGGYYGFRRAGHLAYVMMPGSDSAVRHPWRMALSYLYAS
FT                   VQGVPDKVMEITNKLPAFMDRSKEEIIFTIKMLEKRINSPFTSSMGRFFDAVSALLGIK
FT                   TNISYEGQAAIELEYYADLSCTDPYLFDIEKTVFEESFTINTGCTIKQIVDDILAGKGL
FT                   GYISSRFHTTIAHIVLEGCLNIRSRKGLKNVVLSGGVFQNITLLKMTVDSLEKQGFKVF
FT                   IHSEVPSNDGGISLGQSIMAIAQMIKKRQVDFPALED"
FT   gene            532624..532848
FT                   /locus_tag="Ccel_0463"
FT   CDS_pept        532624..532848
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0463"
FT                   /product="hydrogenase assembly chaperone hypC/hupF"
FT                   /note="TIGRFAM: hydrogenase assembly chaperone hypC/hupF;
FT                   PFAM: hydrogenase expression/formation protein (HUPF/HYPC);
FT                   KEGG: deb:DehaBAV1_1241 hydrogenase assembly chaperone
FT                   HypC/HupF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74845"
FT                   /db_xref="InterPro:IPR001109"
FT                   /db_xref="InterPro:IPR019812"
FT                   /db_xref="InterPro:IPR037254"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F3"
FT                   /inference="protein motif:TFAM:TIGR00074"
FT                   /protein_id="ACL74845.1"
FT                   /translation="MCLGLPAKVVSIDGNSSNVEMMGVTNKVSIDLLESVKVGDYVLVH
FT                   AGCAIQVLDEEEALKTIDIFNEIKELGIK"
FT   gene            532845..533930
FT                   /locus_tag="Ccel_0464"
FT   CDS_pept        532845..533930
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0464"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypD; PFAM: hydrogenase formation HypD protein; KEGG:
FT                   cac:CAC0811 hydrogenase expression-formation factor (HypD)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74846"
FT                   /db_xref="GOA:B8I6F4"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F4"
FT                   /inference="protein motif:TFAM:TIGR00075"
FT                   /protein_id="ACL74846.1"
FT                   /translation="MRNYIDDFRDSEVISRIVQSLQGYSGPKLKIMEVCGTHTMAISRY
FT                   GLRSLLPRQIELVSGPGCPVCVTPTSYIDSATELADSKNVIITTFGDMMRVPGNNSTLL
FT                   HKKAQGSNVQMVYSPLNAVELARNNPDKEVVFLSVGFETTTPVIALSVLKAKSEGIKNY
FT                   SVLTANKTMPEAIKALADDKELQIDGFLYPGHVSAIIGTDFFSYVAYNMEKAGVVAGFE
FT                   PLDILYSIKVLVDNIANGSIVFENMYSRIVAREGNIKAQQKMYEVFEPVDVVWRGIGMI
FT                   PRSGLGLVKDYEQFDAAKKFDIKSKDIPEPKGCLCGEVLKGKKRPGDCKLFKKRCTPET
FT                   PVGSCMVSSEGTCAAYYKYGE"
FT   gene            533970..534983
FT                   /locus_tag="Ccel_0465"
FT   CDS_pept        533970..534983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0465"
FT                   /product="hydrogenase expression/formation protein HypE"
FT                   /note="TIGRFAM: hydrogenase expression/formation protein
FT                   HypE; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: npu:Npun_R0359
FT                   hydrogenase expression/formation protein HypE"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74847"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR011854"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F5"
FT                   /inference="protein motif:TFAM:TIGR02124"
FT                   /protein_id="ACL74847.1"
FT                   /translation="MEKNMVTIAHGSGGAATSRLIEQTFKKHFDNDILSQGDDCARLDI
FT                   GDARNLVFTTDSFVVTPIFFNGGNIGKLAVCGTVNDLATSGAKPLYLSCGFIIEEGFDL
FT                   EDLEEIVKTMSATARECGVKIVTGDTKVVQKGAADKVFINTSGIGVIPDGLNISGKNAK
FT                   AGDKIIISGTIGDHGSSIFLERENMGFQAKIQSDCAPLSGMVQDILSVVPDVHVLRDPT
FT                   RGGVATTLNEIAVQSNVSILIREDSLPVKREVQGVCELLGMDPLYMANEGKMLCFVSED
FT                   KSERVLEVLRKNKYGKDARIIGEVTEERQPKVLLKALSGGNRIISVLAGDQLPRIC"
FT   gene            535022..535750
FT                   /locus_tag="Ccel_0466"
FT   CDS_pept        535022..535750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0466"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: cth:Cthe_1763 ABC transporter related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74848"
FT                   /db_xref="GOA:B8I6F6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74848.1"
FT                   /translation="MIISIKDLGKVYKNGQIEVEALRNVDVNIDKEEFVAIMGPSGSGK
FT                   STLMNIIGCLDKSTTGEYWLDGVNISTLNETELARVRNRKIGFVFQSFNLLPRITALQN
FT                   VELPMIYAGVGAKERRKRAMLALERVGLEKRVHHKPNEMSGGQKQRVAIARSLVNSPAI
FT                   ILADEPTGNLDSTAGEEIMTVFQDLNREGVTIVLVTHEPDIAEHTKRVLRFKDGMLRSD
FT                   EIVQNPLDARSVLSQYKEEA"
FT   gene            535810..536547
FT                   /locus_tag="Ccel_0467"
FT   CDS_pept        535810..536547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0467"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bay:RBAM_014080 YknW"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74849"
FT                   /db_xref="GOA:B8I6F7"
FT                   /db_xref="InterPro:IPR006977"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74849.1"
FT                   /translation="MEENTQVSVSGAVSLTQSSQMSFIKRVAGVLFWPGKTMDNLAERP
FT                   RIAFPFIFLPIVQLAAIFAMFPMYREFVRISTEKLIANGLEIPADTLETTLNVSTVSGI
FT                   IGGAIGVVISWVLGSLILWGIIKLFKGQGYFKQILSITGYAGVITVLSAVVQVIQTNIA
FT                   GVYDNMSYTSIAVLMPRMDGNFIFGMAKFLDVFSIWHYAVIAIGVATVSKLPKKKAYLI
FT                   VGAIFVIQLLYAGVTEFRIAGLM"
FT   gene            536575..537912
FT                   /locus_tag="Ccel_0468"
FT   CDS_pept        536575..537912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0468"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   cth:Cthe_1762 RND family efflux transporter MFP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74850"
FT                   /db_xref="GOA:B8I6F8"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F8"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACL74850.1"
FT                   /translation="MKKKIIIGVSLAVVIVALIAVGVVKNAGSVGSGAVFAVQTGEIKK
FT                   GDVSSFISANGTVSEIEKSEVYIDNPVKVTKLYVKQNDTVKKGQKLADIDVDDLNTQLE
FT                   TQKLQKKSQELLLKKAKTADTTISTLNHQNEITAAEKDVASKQRAYEQALKNRNEKKAL
FT                   FDADAISKVELDSAENTLRDAEDMLGVSKLTLQAKKDAQNETSKTNSKSKAAQQIDIES
FT                   QQVAIQTTEVAIKDLENKIKKYKAAMFSTMDGVVSQVNVAEGSYTMAGQPVFVVINPDK
FT                   LEVKLSINEFNAKLMKPGQAVEISGDSIPDTEKVTGKVKSVAPMAKANTTNTGSSETVI
FT                   PVVISFDSVTPSIKPGITVSCDIKTVDISNVLTVDLDMLGQDKDDSKYVFVISPDKKTM
FT                   QKKKIELGTTSDMKAELVGGGLKEGDLVVMNPNPAYKDGARIKIKD"
FT   sig_peptide     536575..536643
FT                   /locus_tag="Ccel_0468"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.996) with cleavage site probability 0.554 at
FT                   residue 23"
FT   gene            537942..539159
FT                   /locus_tag="Ccel_0469"
FT   CDS_pept        537942..539159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0469"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   cth:Cthe_1761 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74851"
FT                   /db_xref="GOA:B8I6F9"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR025857"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6F9"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACL74851.1"
FT                   /translation="MNIIESFKQALSSLRANKLRSVLTMIGIIMGVFSVITIVAIGNAT
FT                   QSYVDSEFAKIGANILIVSYKTSSLNTNDMLKSDDLKAISKSVKEIKNVGTDINRSGTI
FT                   RLDNKTRNASINGISSQYKDIVPVEMAQGRMINEIDNSTRSNVVVIDEEFAKANFGNQD
FT                   PIGQKLKVTLGSGSTLRLRVVGVTKIEETPFGGMIDNESRPVRLTIPMTTLQSYHPDSD
FT                   QFNYIYVSVDEKDKTVLKKIADKITKTLESKHGNKDKYSIQFYSDFQDGLNTVLNVISS
FT                   VLLVIAVITLIVGGIGIVNILLVSVTERIREIGVRKALGARKRDIVVQFITESIILTGI
FT                   SGVIGIIMGILGGFIISSLVKIPPVLNIQVIVLAFLGSIALGLLFGVYPAKRAADLDPI
FT                   ESLRYE"
FT   gene            complement(539226..539402)
FT                   /locus_tag="Ccel_0470"
FT   CDS_pept        complement(539226..539402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74852"
FT                   /db_xref="GOA:B8I6G0"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74852.1"
FT                   /translation="MNERNRKYARTTKKCNQIPESSEDTDFSLSTTMALGIVGGAFLIG
FT                   MVSGTLVSKCRSM"
FT   gene            539573..540877
FT                   /locus_tag="Ccel_0471"
FT   CDS_pept        539573..540877
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0471"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   cth:Cthe_0986 peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74853"
FT                   /db_xref="GOA:B8I6G1"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G1"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL74853.1"
FT                   /translation="MIRTHVEEKLCRLFEKNGIAVYNINSDRFKTNTINIFFQDNLNKD
FT                   SVALNALFPSVLRRGCKGLPTIKEINLYLEKLYGAVFDCGIVKKGERQIIHFYFEYISD
FT                   KYTNDSQRNFEKAFEFLMNIIFRPELKDGTFNEQYVEQEKNNLKMIIEGRTNDKVQYSM
FT                   ERCYELMCMDEPFGLYEYGTVEQIDEITNDRLYEHYKKKIESLPAEIFITGEIDDKDIA
FT                   FIKEKLSKVERSTPQKLNSSIILKCVKDVREYEDKMDVNQAKLCMGFRTHVQPADNDYY
FT                   ALMVFSGLLGGGMHSKLFQNVREKAGLAYYVFAGLEKFKGLMVIASGIDINNKNTAQEI
FT                   IMKQLDEIRLGNITEYEFEATLKSLKTGIMSLKDSQLYVVDFYLSQLINGTHDTMETLV
FT                   EKINRVTVDDIIKVANKVQLDTVYFLTSKSHERIK"
FT   gene            540905..542188
FT                   /locus_tag="Ccel_0472"
FT   CDS_pept        540905..542188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0472"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   cth:Cthe_0985 peptidase M16-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74854"
FT                   /db_xref="GOA:B8I6G2"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G2"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL74854.1"
FT                   /translation="MKFDTIEYKKYNELFYRYEHSSGLNCIVIPKKGYYKKYATFSTQY
FT                   GSVDNEFIIPGENEPIRVPDGIAHFLEHKLFEQKDGSVMDKFAALGSKPNAFTSFNQTV
FT                   YLFSCTDLFSENFKLLLNFVQNPYITDESVEREKKIIGQEINMYRDDPGWRVNFNLLKA
FT                   MYKHHPVRYDIAGTTDSISEITKETLYQCYETFYHPSNMIITVVGDVDHIKVFEQVENG
FT                   IQTSDKASEIKRIFPKESEGVNKRYFEQNMPVATPLFYMGFKDSNFDLEGGEILRYEIA
FT                   VKLLLSMIMGKSSKLYEKLYDKGLINASFEMDFSLEKSYAYSMFGGESVNPEEVQEMIT
FT                   NEIKILKKQGLDEEAFNRLLKASKGRFLRQLNSLENISRSFINLYFKGVTMFDYLDVYD
FT                   KMKFDYITDVFDSHFDIKHMALSVVKQK"
FT   variation       541745
FT                   /locus_tag="Ccel_0472"
FT                   /note="SNP"
FT   gene            542213..543286
FT                   /locus_tag="Ccel_0473"
FT   CDS_pept        542213..543286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0473"
FT                   /product="prolipoprotein diacylglyceryl transferase"
FT                   /note="PFAM: prolipoprotein diacylglyceryl transferase;
FT                   KEGG: cth:Cthe_0984 prolipoprotein diacylglyceryl
FT                   transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74855"
FT                   /db_xref="GOA:B8I6G3"
FT                   /db_xref="InterPro:IPR001640"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G3"
FT                   /inference="protein motif:PFAM:PF01790"
FT                   /protein_id="ACL74855.1"
FT                   /translation="MDSTLLRFPELGWSFDVPRVAFNIFGKPIYWYGIIIAAAFLICVL
FT                   WAMKDSTKYDLVPDTIIDLMLFAAPAAIICARIYYVIFSWSEYSDNLIDILNLRKGGLA
FT                   VYGGIIGAIVAAYFVARYKRIPTMKLFDFAIPYVALGQAIGRWGNFFNQEAFGTNTTLP
FT                   WGMTSPTINAYLTNKAASIQETVGITVNPELPVHPTFLYESLWNIAVFAFLMWMRKRKK
FT                   FSGEIFCLYFITYSIGRAFIEGLRTDSLMFGNLRISQFLSIILVIVFVILVVVLRNKAK
FT                   NAVDQEEVEVGQSAYAKVLKYMEEEQEVETNEHSSQKMQESDSTQEIPQEPAERGNQQE
FT                   SSENPQEEDNNKLSDSQ"
FT   gene            543306..544442
FT                   /locus_tag="Ccel_0474"
FT   CDS_pept        543306..544442
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0474"
FT                   /product="rod shape-determining protein RodA"
FT                   /note="TIGRFAM: rod shape-determining protein RodA; PFAM:
FT                   cell cycle protein; KEGG: cth:Cthe_0983 cell cycle protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74856"
FT                   /db_xref="GOA:B8I6G4"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR011923"
FT                   /db_xref="InterPro:IPR018365"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G4"
FT                   /inference="protein motif:TFAM:TIGR02210"
FT                   /protein_id="ACL74856.1"
FT                   /translation="MYFVEKSQASNPYKRFDYVLFISVLLLSAIGLIVLSSAVRTRPGM
FT                   LKSQILAMIMGVALCLILSIIDYKDLKVLSLFIFFATMALMVLVLFLGTGEELGNKNWI
FT                   KIAGFSIQPSEYAKIAYIILVSVFLERIKDSTEKNKSDIIKFIVYSGVAVGFVLLQKDL
FT                   GTALVFGFIFLIFIYIAGIPYRYIFILGGMLLLSLPFVWVYILNGYRRERILTFISPDR
FT                   DPQGTGFNVIQSKIAVGSGQLFGQGYGNGLQTQSRNVPVNESDFIFSVVGEEFGFIGGI
FT                   IIIILGLIILLRCIYIAKNSSDTYGSFLVMGVTGMLGFHFIENIGMSIGLLPVTGLPLP
FT                   FVSQGGTAVLANYIAIGIVLSVSSRRKKSLFSTKDKRR"
FT   gene            544670..545101
FT                   /locus_tag="Ccel_0475"
FT   CDS_pept        544670..545101
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0475"
FT                   /product="MraZ protein"
FT                   /note="TIGRFAM: MraZ protein; PFAM: protein of unknown
FT                   function UPF0040; KEGG: cth:Cthe_0982 MraZ protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74857"
FT                   /db_xref="GOA:B8I6G5"
FT                   /db_xref="InterPro:IPR003444"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR020603"
FT                   /db_xref="InterPro:IPR035642"
FT                   /db_xref="InterPro:IPR035644"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="InterPro:IPR038619"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6G5"
FT                   /inference="protein motif:TFAM:TIGR00242"
FT                   /protein_id="ACL74857.1"
FT                   /translation="MFYGEYQHTIDPKGRAIVPSKFREGLGEKFILTKGLDGCLFAYSS
FT                   EEWTSLENKLKSLPFTDKDVRAFIRFFFSGATECEVDKQGRILIPQNLREYAALEKDTY
FT                   IIGVSSRVEIWDKTAWEAYNSDENISADKIAEKMALLGI"
FT   gene            545124..546065
FT                   /locus_tag="Ccel_0476"
FT   CDS_pept        545124..546065
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0476"
FT                   /product="S-adenosyl-methyltransferase MraW"
FT                   /note="TIGRFAM: S-adenosyl-methyltransferase MraW; PFAM:
FT                   methyltransferase; KEGG: cth:Cthe_0981
FT                   S-adenosyl-methyltransferase MraW"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74858"
FT                   /db_xref="GOA:B8I6G6"
FT                   /db_xref="InterPro:IPR002903"
FT                   /db_xref="InterPro:IPR023397"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6G6"
FT                   /inference="protein motif:TFAM:TIGR00006"
FT                   /protein_id="ACL74858.1"
FT                   /translation="MEFKHTSVLLDECIEYLNINQEGIYVDGTIGGAGHSSEIYKRLGE
FT                   KGCLVGLDQDSFAVETSIKRLDEIKSNADFKVVNTNFKNIKSACSGLGINEVDGILLDL
FT                   GVSSHQLDEASRGFSYQHDAPLDMRMNTKSELSAYDVVNKYSEQDIYRIIRDFGEEKWA
FT                   SRIAKFITEARQNEPVETTYDLVDIIKKAVPSSARRDGPHPAKRTFQAIRIEVNNELGI
FT                   LNKTIEDCVDLLKRGGRLCIITFHSLEDRIVKMQYNKMVNPCTCPPAFPVCACGKKPKA
FT                   VLINKKPIVSDIRELDKNPRARSAKLRVLQKI"
FT   gene            546237..546728
FT                   /locus_tag="Ccel_0477"
FT   CDS_pept        546237..546728
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0477"
FT                   /product="cell division protein FtsL"
FT                   /note="KEGG: cth:Cthe_0980 cell division protein FtsL"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74859"
FT                   /db_xref="GOA:B8I6G7"
FT                   /db_xref="InterPro:IPR011922"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G7"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0980"
FT                   /protein_id="ACL74859.1"
FT                   /translation="MFKVAETKNDYVYGSLAEKIKYDPYEENAILKSKKIARDNSKIKV
FT                   RIIFNIFLVFAMFIVVMLRYAQISQINYDINIMKSEYTKIQNENQLLSIDIQNAMDLKN
FT                   IRHIAETKLDMHKPNKSQIVYVSIPKKDVTITAHKEQSKLTVLFNIVNKSLNKFLNIIN
FT                   "
FT   gene            546888..549092
FT                   /locus_tag="Ccel_0478"
FT   CDS_pept        546888..549092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0478"
FT                   /product="penicillin-binding protein transpeptidase"
FT                   /note="PFAM: penicillin-binding protein transpeptidase;
FT                   Penicillin-binding protein dimerisation domain; PASTA
FT                   domain containing protein; KEGG: cth:Cthe_0979
FT                   peptidoglycan glycosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74860"
FT                   /db_xref="GOA:B8I6G8"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR005311"
FT                   /db_xref="InterPro:IPR005543"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR036138"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G8"
FT                   /inference="protein motif:PFAM:PF00905"
FT                   /protein_id="ACL74860.1"
FT                   /translation="MAGVNLKIKKRLLFILCVFTIMTLILVLRIAWIQIYSGKEYQEFA
FT                   YNQQTKNRTISAKRGTIYDRNMKPLAVSGSVDTVSASPQEISKQKLDIDKISSELANIL
FT                   EMDKETVKKKLTKNSQYEIIKQKIDREIGNKVREWKSKDKISGIYIDEDTKRFYPNRNL
FT                   AAHVIGFTNIDNDGLDGVERMMEKYLKGVPGKILSETDASGMALSMSDEKFIQPQDGND
FT                   VILTIDETIQYFAEKALEKAISDNNVLNGATAIVMDPRNGEILALASKPDFDLNNPRGV
FT                   PKGKDPETWTGKSKEDVEYLQQTVWRNKAVVDTYEPGSTFKPVTAAAGLEEGAITPDTQ
FT                   VTDATVKVGGWNINCWKPNAHLHETFREGVYNSCNPVFVRLSQKLGVPLFFKYVKAFGF
FT                   YDKTGIDLPGEARGIMFTNPTEVNMATASFGQRFQITPIQLVQAYGAIANGGDLITPHV
FT                   VKEVVDETGSVIKKYEPNVVRRVISRQTSDTLKSILYGVVDVGTGKNAKIPGYKIGGKT
FT                   GTSETIMDPKLLKLNIVGKNKRYIVSFSAIAPTDNPSLCVLVVLDYPDVYNPGGGMLVA
FT                   PVVGKLIDDILSYKGVEKEYTEQDKKMLLQEVQVPNVKGKTVEEAVKLLKESKLEYKIE
FT                   GSDTDKKAIVQDQTPKSSALLHERSIVVLYTYKPQEEAMVKVPDVKNKPVYDATQAFKK
FT                   LGLNIRVNGTGTAVSQSMDAGTKVKKGTVIEVIFRNVVSD"
FT   gene            549160..550620
FT                   /locus_tag="Ccel_0479"
FT   CDS_pept        549160..550620
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0479"
FT                   /product="UDP-N-acetylmuramyl-tripeptide synthetase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramyl-tripeptide synthetase;
FT                   PFAM: cytoplasmic peptidoglycan synthetase domain protein;
FT                   Mur ligase middle domain protein; KEGG: cth:Cthe_0978
FT                   UDP-N-acetylmuramoylalanyl-D-glutamate--2,
FT                   6-diaminopimelate ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74861"
FT                   /db_xref="GOA:B8I6G9"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005761"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6G9"
FT                   /inference="protein motif:TFAM:TIGR01085"
FT                   /protein_id="ACL74861.1"
FT                   /translation="MKLRELVMNLNIKAINGNLDVEVDSIAYDSRKTKQGSLFVCIEGT
FT                   VVDGHKYINDAIENGTKAFLVQKHVVVPEGITTIEIDDTRFGLAAVSDAFFGHPSSKFN
FT                   LIGITGTKGKTTTTYMVKAIMEAAGRNMGLVGTLANLIGSEVLYTSRTTPESYDLQSLF
FT                   SDMVEKKVDSTVMEVSSQGLELHRVAKCDFDIGVFTNFSRDHIGPKEHATLEEYFNAKA
FT                   KLFKMCRKAVINIDSEHGRKMAELAKCKVFTYGLSDKADIWASDIVKKTGHTYFTLNSP
FT                   WGSIDIETDLQGEFNIYNALAAIGSCCLIPGITLEHVRLGLTKVTVPGRMESVKTGGNY
FT                   SVLIDYAHTPDSLEQVLKTVKEFAHGRVVSLFGCGGDRDKGKRPAMGEISGNIADFTII
FT                   TSDNPRTENPEQIIEDIEAGIKNTNGKYIKITDRRQAIKFALENAVDGDIIILAGKGHE
FT                   TYQQFAEKTIHFDEREVVNELLIELGRR"
FT   gene            550625..552004
FT                   /locus_tag="Ccel_0480"
FT   CDS_pept        550625..552004
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0480"
FT                   /product="UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanyl-D-glutamyl-2,
FT                   6-diaminopimelate/D-alanyl-D-alanyl ligase; PFAM:
FT                   cytoplasmic peptidoglycan synthetase domain protein; Mur
FT                   ligase middle domain protein; KEGG: cth:Cthe_0977
FT                   UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74862"
FT                   /db_xref="GOA:B8I6H0"
FT                   /db_xref="InterPro:IPR000713"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005863"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR035911"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H0"
FT                   /inference="protein motif:TFAM:TIGR01143"
FT                   /protein_id="ACL74862.1"
FT                   /translation="MISFNCSELIEAVGGKLLWGKPGINFYGVTTDSRKVTKDNLFIPL
FT                   IGEKFDGHDYIEQCFNAGATVCLTSKQIPTVTGCTAILVDDTAKALRDLAAWYRRKFDI
FT                   PVVGITGSVGKTSTKDMVSCVLSQQYKVLKTQGNFNNEIGLPLTVFNIDYSHEAAVIEM
FT                   GMSGFGEISRLTAIARPHIAIITNIGVSHIEKLGSQEGILKAKLEILEELDKDGLVVLN
FT                   GDDPLLSSLKGKLSFRTVFYGMNVGSDYTALNYQPKGEQGTTFEISVNDCLYNVEIPVP
FT                   GIHNVYNALAAIAAGIEMKIPMEIIINGIKQFSPGNMRQSIINHNGIKIINDAYNASPQ
FT                   SMQAAINVLQEISSESRSIAVLGDMFEMGDMSKDMHYSVGDFIKNKKINYLVTVGLDSR
FT                   MISQAVADYGNSQTEIHHFENNKEALKYILEIVMPGDYILIKGSRGMKMEEIADGIMKS
FT                   E"
FT   gene            552030..553013
FT                   /locus_tag="Ccel_0481"
FT   CDS_pept        552030..553013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0481"
FT                   /product="phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /note="TIGRFAM:
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase; PFAM:
FT                   glycosyl transferase family 4;
FT                   phospho-N-acetylmuramoyl-pentapeptide transferase; KEGG:
FT                   cth:Cthe_0976
FT                   phospho-N-acetylmuramoyl-pentapeptide-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74863"
FT                   /db_xref="GOA:B8I6H1"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="InterPro:IPR003524"
FT                   /db_xref="InterPro:IPR018480"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H1"
FT                   /inference="protein motif:TFAM:TIGR00445"
FT                   /protein_id="ACL74863.1"
FT                   /translation="MLTFSLTSEHIIAFAASFVLALIAGPILIPFLRRLKFGQTVRDDG
FT                   PQTHLKKMGTPTIGGLIFIIPLTLTSIYFYQSYPQIIPILMSTLGFAAVGFIDDFIKVV
FT                   KKRKDGLFAGQKTFFQLIVCVSFAFYVMRYTEAGSSIVIPFTNIIIQPWIYFVFIILFM
FT                   YFFSNAVNITDGLDGLCAGVTLVVAIFFTIVSLTNGEWGYIKVFSAAIAGGCLGFLAFN
FT                   IHPAKVFMGDTGSLALGGALTSIAVMMRMPLIIFLVGGIYLIEALSVILQVASFKLTGK
FT                   RIFKMAPIHHHFELKGWKETKVVAVFIIATVLLAIASLIVIGSDIF"
FT   gene            553083..554195
FT                   /locus_tag="Ccel_0482"
FT   CDS_pept        553083..554195
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0482"
FT                   /product="cell division protein FtsW"
FT                   /note="TIGRFAM: cell division protein FtsW; PFAM: cell
FT                   cycle protein; KEGG: cth:Cthe_0975 stage V sporulation
FT                   protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74864"
FT                   /db_xref="GOA:B8I6H2"
FT                   /db_xref="InterPro:IPR001182"
FT                   /db_xref="InterPro:IPR013437"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H2"
FT                   /inference="protein motif:TFAM:TIGR02614"
FT                   /protein_id="ACL74864.1"
FT                   /translation="MRNKNTKPFDFWIFAAVILLLSLGTIMVFSSSYYFSTQRTGESFM
FT                   LLRPQLIYMALSIAVLVGTMNFDYRKWGKISPIILMISIGLLILVLIPGIGKVQNGAQR
FT                   WLGVGTKTVQPSELAKLGIIMFLSFSLSKRKDVLQSFTKGLLPYILLIGFVAGLVVVEP
FT                   HLSGALIIVITSFIILFCAGAKISHFVAMAIPGAVAVAGAILMAAYRMNRVKAWLHPFD
FT                   FYKDEGWQTVQSLLAIGSGGLFGRGLGQSMQKYLWIPEPYNDYIFAVLSEELGFVGALV
FT                   VMLLFLIFIWRGIKVAMNAPDTFGSLMATGITCLIGLQFLFNVAVVTNFIPPTGISLPF
FT                   FSYGGTSLVFLMFGVGILLNISRYSNYERF"
FT   sig_peptide     553083..553193
FT                   /locus_tag="Ccel_0482"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.462 at
FT                   residue 37"
FT   gene            554207..555301
FT                   /locus_tag="Ccel_0483"
FT   CDS_pept        554207..555301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0483"
FT                   /product="UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase"
FT                   /note="TIGRFAM:
FT                   UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide)
FT                   pyrophosphoryl-undecaprenol N-acetylglucosamine
FT                   transferase; PFAM: glycosyl transferase family 28;
FT                   Glycosyltransferase 28 domain; KEGG: cth:Cthe_0974
FT                   N-acetylglucosaminyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74865"
FT                   /db_xref="GOA:B8I6H3"
FT                   /db_xref="InterPro:IPR004276"
FT                   /db_xref="InterPro:IPR006009"
FT                   /db_xref="InterPro:IPR007235"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6H3"
FT                   /inference="protein motif:TFAM:TIGR01133"
FT                   /protein_id="ACL74865.1"
FT                   /translation="MKVLIAGGGTGGHINPGLAIAKYIKQKEAEADITFVGTKKGLETK
FT                   LVPREGYPLETITVRGFKRKLSLDTLIAIKELIQSFFQASRLLKRIKPDVVIGTGGYVC
FT                   GPVLYMAAKKGIPTLIHESNAFPGVTNRLLERYVSYVAISFKDAEKYFKNKKKLVLTGN
FT                   PVREELLNSGRDKVASNLGIVEGKPLIVAMGGSRGARRINETIADMLNNYFKGEFNLIF
FT                   ATGEAQFDDISSTVKIDEKYRDMVKVVPYIYNVDQVYVASDLMICRAGAITISELQVMG
FT                   IPSILIPSPYVTANHQEHNARSLERDGGAVVILENELNADLLYKQICSLIFNKDVLKKM
FT                   SKNTSKNRVTDSAEKIYHLIKEII"
FT   gene            complement(555338..555532)
FT                   /locus_tag="Ccel_0484"
FT   CDS_pept        complement(555338..555532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0484"
FT                   /product="small acid-soluble spore protein alpha/beta type"
FT                   /note="PFAM: small acid-soluble spore protein alpha/beta
FT                   type; KEGG: cth:Cthe_3176 small acid-soluble spore protein,
FT                   alpha/beta type"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74866"
FT                   /db_xref="GOA:B8I6H4"
FT                   /db_xref="InterPro:IPR001448"
FT                   /db_xref="InterPro:IPR018126"
FT                   /db_xref="InterPro:IPR038300"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H4"
FT                   /inference="protein motif:PFAM:PF00269"
FT                   /protein_id="ACL74866.1"
FT                   /translation="MANNRSGGRSSGAFDNMKYEVAREVGVNLKEGYNGDITSREAGKI
FT                   GGTIVKKVFSSFREQNPQA"
FT   gene            555876..557252
FT                   /locus_tag="Ccel_0485"
FT   CDS_pept        555876..557252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0485"
FT                   /product="uracil-xanthine permease"
FT                   /note="TIGRFAM: uracil-xanthine permease; PFAM:
FT                   Xanthine/uracil/vitamin C permease; KEGG: drm:Dred_1317
FT                   uracil transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74867"
FT                   /db_xref="GOA:B8I6H5"
FT                   /db_xref="InterPro:IPR006042"
FT                   /db_xref="InterPro:IPR006043"
FT                   /db_xref="InterPro:IPR029935"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H5"
FT                   /inference="protein motif:TFAM:TIGR00801"
FT                   /protein_id="ACL74867.1"
FT                   /translation="MKKEIPVIEVDQKVPFLKAIPLSLQHLFAMFGASVLVPFLFNGYA
FT                   KSDFLKNVLNTTVDKLTPDQLIQYNNIQVIDPALVLLLNGIGTLIYLLLCKGKAPAFLG
FT                   SSFAFLSPTASIIASSTNYNENFSKALGGYIVCGLIFAIVALIIGKVGTSWLDIVLPPA
FT                   AMGPIVALIGLELSGNAAKMAGLLPNDKGAFDTKTIIISLVTLAIVIIGNLCFRGFLSV
FT                   IPVLVAVVAGYGLAAAMGYVDTTPFTSAQWFSVPTFVTPSFSFNAMLILAPAALVVLSE
FT                   HIGHLFVTSNIVGRDLTKDPGLHRSLLGDGLSTMLSGLCGSCPTTTYGENMGVMAITRV
FT                   YSVWVIGGAGVISIIIAFIGKLSGIISSIPEPVMGGVSLLLFGVIAASGIRMIVEAKID
FT                   YSKSKNLILTAVVFVIGISGTTVKLPGNVELKGMVLATLVGIVISTLFYILEKLKLTND
FT                   "
FT   gene            complement(557333..558523)
FT                   /locus_tag="Ccel_0486"
FT   CDS_pept        complement(557333..558523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0486"
FT                   /product="Monogalactosyldiacylglycerol synthase"
FT                   /note="PFAM: Monogalactosyldiacylglycerol synthase; KEGG:
FT                   cth:Cthe_3177 monogalactosyldiacylglycerol synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74868"
FT                   /db_xref="GOA:B8I6H6"
FT                   /db_xref="InterPro:IPR009695"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H6"
FT                   /inference="protein motif:PFAM:PF06925"
FT                   /protein_id="ACL74868.1"
FT                   /translation="MKNVIIISSDYTGHGHKSISEALQEQFCIHEDVCLNIIDGFELGG
FT                   NMWIKVGKSYGMVTRNAKEIWKLAWKISKRNQTFIHEFTELTIRENFIKLLRKLKPDLI
FT                   LSVHPVFNTPIINILKEYKVNIPFATFVADLVSISPMWADSRADCIICPTEEAKQRCIG
FT                   FGVPEHKLEVIGFPVRSRFTQHVSQNMSHNDYTLDRPLECLIMSGGEGSGDMNNVAKIL
FT                   LDNFNCNIRIIAGRNESLKDKLEKTISQQYPGRVEVYGYVTNIQDYMLKSDIAFTRGSP
FT                   NVMMEAVACNVPLIITGALPGQEQENPDFAVNNNLGIYCDDLSSLAAVVSGLLADNAKR
FT                   LNEIKQAQREYFDHAAAGKIVDHVLSLIKNEVFIYPSELRRKKKFLTLKLQSRKSS"
FT   gene            558764..559969
FT                   /locus_tag="Ccel_0487"
FT   CDS_pept        558764..559969
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0487"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; Penicillin-binding protein 5 domain
FT                   protein; KEGG: cth:Cthe_3179 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74869"
FT                   /db_xref="GOA:B8I6H7"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H7"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACL74869.1"
FT                   /translation="MKKTARVVLIVLIILSNLLCANMVKGDDTNDDGPITNDILKSESW
FT                   EVAGNQAPRVSAGAAIVMDVQSGRVLYEKNAYKRSSIASTTKIMTAIVALENGSDGEDV
FT                   IVSKKAASIWGSRVGLKMGKIYKLGNLLNALMIRSGNDAAIAIAEHVGGSVEAFAEMMN
FT                   RKAAEIGATNTNFVTPHGLDAPQHYSTPYDLALITQYALKNKKFCKIVSTKSSTFEGNP
FT                   INNTNEMLSLYPGADGVKTGYTGQAGRCLVTSATHSGWRIISVVLNCSTRSVRAQSSKI
FT                   LLDYAFGNYKIYEYLKKGGQISQVGIHKGLSNAVGICSDKDISIPLKKDEADRIKVEYD
FT                   IPKTLEAPIQKGCRIGTVNYVLDGKVLASTDVKSTATIKRKDFYYYFDRIFKTWARLVH
FT                   QH"
FT   sig_peptide     558764..558829
FT                   /locus_tag="Ccel_0487"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.980) with cleavage site probability 0.495 at
FT                   residue 22"
FT   gene            560024..561751
FT                   /locus_tag="Ccel_0488"
FT   CDS_pept        560024..561751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0488"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: cobalamin B12-binding domain protein; Radical
FT                   SAM domain protein; SMART: Elongator protein 3/MiaB/NifB;
FT                   KEGG: cth:Cthe_3186 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74870"
FT                   /db_xref="GOA:B8I6H8"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR025288"
FT                   /db_xref="InterPro:IPR034466"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H8"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL74870.1"
FT                   /translation="MKTLLVGINSKYIHTCLAIWYLKASITENSTIAVREFTINDIQDN
FT                   ILSEIYREKPGIIAFSCYIWNVGLVLSISKEIKKLLPDCRIILGGPEVSYSSKKVMEEN
FT                   QYIDFVISGEGEDVFPALLKDLCDGTENYKTLPGLAYRMSGSIICNEGFNLVYELDRIP
FT                   SPYTDELMKTTLNRIVYYESSRGCPFSCSYCISSTFNGVRFFSLERVKRDIYRILEYKP
FT                   RLIKFVDRTFNCHKERAKEILRFLASLNCETVFHFEAAADLFDSEMLHILRKAPKGRIQ
FT                   LEIGIQTINTQTLKEIDRITDIDLLTENVKKILSGGNIHVHLDLIAGLPYEDFKSFKKS
FT                   FNHVYGLKPHQLQLGFLKMLKGSRIRKNSQKHSFYFRDNAPYEVLKNKYISYDEILLLK
FT                   DVEETFERYYNSNRFKNSLNFLEELFFEGDSFAMYEKLAAYCRKNGFLNRPVSYKENIN
FT                   ILYSFLKENCKSNINCEKFRQYMVLDFLSTDSSGAIPECLKREEDFLSPVEIHSMLRDE
FT                   ELIDRYLPQYKGTQAKNILKRVFFVKLNLLLPPDEALLFDYSAKDAVSGKYRNVSVKI"
FT   gene            561965..563899
FT                   /locus_tag="Ccel_0489"
FT   CDS_pept        561965..563899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0489"
FT                   /product="putative serine protein kinase, PrkA"
FT                   /note="PFAM: PrkA serine kinase; PrkA AAA domain protein;
FT                   KEGG: cth:Cthe_1205 putative serine protein kinase, PrkA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74871"
FT                   /db_xref="GOA:B8I6H9"
FT                   /db_xref="InterPro:IPR010650"
FT                   /db_xref="InterPro:IPR013153"
FT                   /db_xref="InterPro:IPR016230"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6H9"
FT                   /inference="protein motif:PFAM:PF08298"
FT                   /protein_id="ACL74871.1"
FT                   /translation="MTRPEFDFSELIKKDREEHVRKQFEGTFLDYLQIVKSNPEVAILS
FT                   HQRLYELISSKGVEAVKTEENPRLRRIYGNDVIKKYTFFEDDFFGIDKTIMKIVRYFHS
FT                   AAMAGEEARQVLYLVGPVGAGKSSLMEALKKALEAARHIYALKDCPMREEPLHLIPKHL
FT                   RKDFEEKLNIKIEGDLCPVCRYRLRNEYNEEYEKFPVTSTGFSIRSRKGIGVVPPVDPN
FT                   NQDTSILTGSVDISKIDLYPEDDPRVLSLNGAFNAGNRGIVEFIEVFKNETEYLHTMIT
FT                   ATQEKSIPSPGKGAMIYFDGVILAHSNEAEWNKFKSDHTNEAIMDRIVRIEVPYCLELN
FT                   EEIKIYEKMLSKSKFKAHIAPHTIEIASMFAILTRLSPSNKVDPLTKLKIYNGEEILEK
FT                   GMTRKIDIFELREEAPREGMTGISTRFIMKALDTALSESENDCINPIAVMEALIKSVKE
FT                   LGIGDDEKERYLRLIYDSVKKEYNKILEKEVTKAFIHGYREQAESLFNNYLDHAEAFVN
FT                   KTKIKDKNTGEELEPDEKFMRSIEEQIGISDTAVKGFRSDVTAYMFFVMRNGGSLDYTS
FT                   YEPLKDAIEKKLTASVRDLSRIITQAKVRDKEQTQKYNTMVEEMKKNGYCDHCCNVILK
FT                   YAANNLWKD"
FT   gene            563915..565111
FT                   /locus_tag="Ccel_0490"
FT   CDS_pept        563915..565111
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0490"
FT                   /product="sporulation protein YhbH"
FT                   /note="TIGRFAM: sporulation protein YhbH; PFAM: protein of
FT                   unknown function DUF444; KEGG: cth:Cthe_1204 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74872"
FT                   /db_xref="InterPro:IPR006698"
FT                   /db_xref="InterPro:IPR014230"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6I0"
FT                   /inference="protein motif:TFAM:TIGR02877"
FT                   /protein_id="ACL74872.1"
FT                   /translation="MAIFRDCSNIGKDRSAEDRRRHRELVEDSIKKNLGSIIAEESIIG
FT                   KSKDKKIKIPIKGIKEFQFIYGKSKPGVGAGDGNEKRGDKFPGDSQEGKGKGNAGNSEG
FT                   EEVYETEITIEEVIKYLFDDMNLPDIAKKQLSQLEEKSYRKLGYQHKGIPPRLAKKRSV
FT                   IEKIKRKQASKRSEDGEDITHDKEYGKERFPFIEEDLRYYRIKEDNKRDYNAVVLCIMD
FT                   VSGSMDQTKKYLARSFYFLLYQFLRLKYANVDVVFIAHTTTAKEVNEREFFHRGESGGT
FT                   YISSGYEKALEIISERYSPTNWNIYAFHCSDGDNWSEDNRKAVESANKLCEVCNLFGYG
FT                   EIVPGYYNIGSTIKNEFLNKIKSKNFAAININKKEDVLPALKKLLDKASDKDEKTGLK"
FT   gene            565145..566533
FT                   /locus_tag="Ccel_0491"
FT   CDS_pept        565145..566533
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0491"
FT                   /product="SpoVR family protein"
FT                   /note="PFAM: SpoVR family protein; KEGG: cth:Cthe_1203
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74873"
FT                   /db_xref="InterPro:IPR007390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I1"
FT                   /inference="protein motif:PFAM:PF04293"
FT                   /protein_id="ACL74873.1"
FT                   /translation="MADFSLKELEYWNERIEQIAVDSGLNFYNQEFEIINYEDMIGYES
FT                   YVGMPSHYPHWSYGKSYERIKTLHKYNLTGLPYEMVINSNPCIAYLMKDNSLLVQILTI
FT                   AHVYAHNDFFKNNRLFKQGTKAEYSVETFKNHANRIRDYISDPSIGYAKVEKILNAAHA
FT                   VKLQTERIIDFRNKIEEKNKSKSALAENKSDFPNLEKYSQNEKKDDTEAGRQEIKIPEE
FT                   PQEDILNFITEYGRLQDWEKDILSIVREEAQYFIPQIETKIMNEGWASFWHYTILTKLE
FT                   LPQSLHFEFLRKHNEVIRPLKSSINPYYIGFKIIENLYNTQGKDKIFEVRENERDQSFI
FT                   RRYLTQELCGEMNLFEYIAAGNDYMISEVSDEEGWKQVRDTLCNTVGIGSIPTIKVIEW
FT                   SPKENTLLLEHEFDGRELELSYAYETLKHLVDLWKGKVVLTTHLEEKKKNIACDEMKRI
FT                   SLYT"
FT   gene            566657..568561
FT                   /locus_tag="Ccel_0492"
FT   CDS_pept        566657..568561
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0492"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: cth:Cthe_0550 heat shock
FT                   protein 90"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74874"
FT                   /db_xref="GOA:B8I6I2"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I2"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ACL74874.1"
FT                   /translation="MKHESGSISINTENIFPIIKKWLYSEKDIFIRELVSNASDAISKM
FT                   KKLDAIGEAELPEGNKFEIKVVVNKNDKTIKVIDNGLGMTEEEVKKYINQIAFSGAVDF
FT                   LEKYKDKSDDGQIIGHFGLGFYSAFMVSQRVQIDTLSYQKDAAAVRWVSDGGTEFEMSD
FT                   SDRNERGTTITLYLSDDGLEFTDEYKMRTTLEKYFAFLPYELYLEDSAKEEEKKEENKE
FT                   EPKEGDDQANAEPKKPEPLNDTKPLWLKNPKDCTDEEYKQFYTKVFHDFNEPLFWIHLN
FT                   MDYPFNLKGILYFPKLKHEFETMEGQIKLYYNQVFVADNIKEVIPEFLLLLKGVLDCPD
FT                   LPLNVSRSFLQNDGYVNKISTHITKKVADKLTSLFENDRENYNKYWDDINPFVKYGCVR
FT                   EEKFYDRVKDALIFKSTKGGYTTLKEYLENNKEKHENKVFYVSDEKQQAQYIKLFNENG
FT                   MEAVILTNMIDNHFMSLLESKGSGLQFNRIDADISASMKQENTGIPEDNVSYLENLFKE
FT                   TVNDEKLKIQVESLKNETIPAVVLLSEQSRRMQEMSKMFGGMDMGHMFPKEQTLVLNSS
FT                   NKLVKALLDLKDKDERKDDVKLVSEHIYDLAMMSHQTLEPDAMAKFIQRSNEILMKVL"
FT   gene            568831..570306
FT                   /locus_tag="Ccel_0493"
FT   CDS_pept        568831..570306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0493"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: chemotaxis sensory transducer; KEGG:
FT                   lsp:Bsph_3073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74875"
FT                   /db_xref="GOA:B8I6I3"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I3"
FT                   /inference="protein motif:PFAM:PF00015"
FT                   /protein_id="ACL74875.1"
FT                   /translation="MKKNLSISKKSDFLNLVIIWTAIVPIILISLYSGTDFAITIIPPI
FT                   VLGIVVSVVYFIHISSNIKAFIYAIIILLIAISGFIFTANDISNHYILFASISMITIYF
FT                   NKRLVFIFGIIINIILISFYIIFPEAIIGKLGYWTNFVYEIIYINCSLVCLYCLTKWGN
FT                   ELVLQSKSKEAETEILLNKLRKTMDKVETSTKFLNENIKSVNESIESSEAASSNITKAM
FT                   HEMASATQQQAASINDINFLMNDTVNDVKNTKSISESIYNDSQNMTKEVQNGISKVDEM
FT                   ENQIKTIEQAVSISHTTVIDLQKKMHRITDFLENINQIAEQTNLLALNASIEAARAGEQ
FT                   GKGFAVVADEVRKLAEGSTKIVKDINVVIQDISLQTETAVESSVNGYNAVKEGEKLTND
FT                   VSTYFTEFKKVFNKTNQSLIDEAKMIEKISDSFIHIKEQVENVACISEENAASTQVVVS
FT                   TVQTANSGIVNIGQSIKDINELSSELSSMVQNI"
FT   sig_peptide     568831..568947
FT                   /locus_tag="Ccel_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.619) with cleavage site probability 0.539 at
FT                   residue 39"
FT   gene            complement(570422..572080)
FT                   /locus_tag="Ccel_0494"
FT   CDS_pept        complement(570422..572080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0494"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   cth:Cthe_0551 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74876"
FT                   /db_xref="GOA:B8I6I4"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I4"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL74876.1"
FT                   /translation="MLEKYLSQVDFTSYEDFYENFKIKVPENFNFAYDVVDEYAKTDPD
FT                   KVAIIWCDKSGAETTFTFGQLKEYSDKTANFFQSLGIKRGDPVMLILKRRYEFWFCILA
FT                   LHKLGAVTIPATHLLTSKDIVYRANAADIKMIVCVNEPEVIKHIEDSESKTPTVKYKAL
FT                   INGAKDGWLDFSSGIQEASSQFERPRGDLGSHNSDISLLYFTSGTTGMPKMVQHDYEYP
FT                   LGHILTASYWQNVSEGGLHLTVADTGWAKAVWGKIYGQWLAGCAVFVYDFDKFVPKELL
FT                   EVISKYNVTSFCAPPTIYRFFIKEDLSKFDLSSLKYCTVAGEPLNPEVYSQFYKATGIK
FT                   LMEAFGQTELTVTLSTFPWMEPKPGSMGKPSPGYDIDLIDENGNSCQDGEEGQIVVRTS
FT                   KRKPAGMFGGYYRDEALTKSVWHDGVYYTGDMAWRDEDGYYWFVGRADDVIKSSGYRIG
FT                   PFEVESALLEHPAVLECAITAVPDLIRGQIVKATVILAKNYNPSDELVKELQDHVKKVT
FT                   APYKYPRIIEFVSELPKTISGKIRRVEIRQTDDNK"
FT   gene            complement(572100..572654)
FT                   /locus_tag="Ccel_0495"
FT   CDS_pept        complement(572100..572654)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0495"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: cth:Cthe_0552
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74877"
FT                   /db_xref="GOA:B8I6I5"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I5"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL74877.1"
FT                   /translation="MSEQIKLIASRIKELREISEISVEALAAELKITEESYRSYESGET
FT                   DIPVSFLYQIANKFNVELSAIITGDAPRLHTYQLVRDSKGVSVERREHYKYHSLAYNFV
FT                   GKRAEPFIVTVEPETADSPLHFNSHKGQEFNYIIEGTLKIIINGRELIMNEGDSVYFDS
FT                   SASHAMKAMNGKKARFLAIIL"
FT   gene            572993..574237
FT                   /locus_tag="Ccel_0496"
FT   CDS_pept        572993..574237
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0496"
FT                   /product="methyl-accepting chemotaxis sensory transducer"
FT                   /note="PFAM: histidine kinase HAMP region domain protein;
FT                   chemotaxis sensory transducer; KEGG: cac:CAC1600
FT                   methyl-accepting chemotaxis-like protein (chemotaxis
FT                   sensory transducer)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74878"
FT                   /db_xref="GOA:B8I6I6"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR004089"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I6"
FT                   /inference="protein motif:PFAM:PF00672"
FT                   /protein_id="ACL74878.1"
FT                   /translation="MSIGKKILFIVIGCTIIVGGGTALYIIWDFPVYTITAMFCIFAVA
FT                   IGVWLTFSLTVPIKVLSRVVERTANFDLSHDKTYNQIKGRKDEIGFLARNLSTMRGSLR
FT                   EILGLMGDASKKVIENSQQVEQMTEDLKEKADDTLSTTEHISASMQESAATSHQINFST
FT                   QEIKKNINLIAQNSEEGAQTANEVSIKASEIKESAVLSAQNANNVYLEVKQQLQGAIDK
FT                   AGEVSHIDQLAQAILQITEQTNLLSLNAAIEAARAGEAGKGFAVVADEIRKLADQSSKT
FT                   AADIKNIVKTVNESVDALTDSAGVLLEFVDKEVLNDYKKLIDTSEQYYTDSAQFSKIMN
FT                   EFNDSAKAMNSSIANIVNALEQVTSSVNESAEGVEVITVKTAEIVGHFANVKVSTQDNL
FT                   IASEKLKDQVSKFTL"
FT   gene            574444..575493
FT                   /locus_tag="Ccel_0497"
FT   CDS_pept        574444..575493
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0497"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: cac:CAC3650 HD-GYP domain-containing protein;
FT                   TIGRFAM: metal dependent phophohydrolase; PFAM:
FT                   metal-dependent phosphohydrolase HD sub domain; SMART:
FT                   metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74879"
FT                   /db_xref="GOA:B8I6I7"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR037522"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I7"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACL74879.1"
FT                   /translation="MEREYVKVSKDIIDSILADDVYTRGGNMIVPSDTFISEHIIKKLN
FT                   AFRVERVTIYRSHSILGNEYLSDKSISESQKQYIEDVNATKSILRGLASGKELDMDNVK
FT                   TITDSVYERLGDVGSIIECINSIKVADQYTYSHSVNVAFYAMLLGKWMNLSKLQIKDLA
FT                   MAGLLHDIGKTKISAEIINKKGPLNENEFEVIKRHPIYGYDIIKGFSDIAIDIKRAVIL
FT                   HHEKENGTGYPFGIQGNKKNLYAKIITAADIFDAITSERVYKEKQTPFSAFKEMEKIGY
FT                   DIVDPMVMGVMFDNMPRYYIGSKVKLDNGEIGEVVYVPSSCAYAPVVKIKEDFVDFAKE
FT                   KEALISELL"
FT   gene            complement(575495..576373)
FT                   /locus_tag="Ccel_0498"
FT   CDS_pept        complement(575495..576373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0498"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: cth:Cthe_0553 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74880"
FT                   /db_xref="GOA:B8I6I8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL74880.1"
FT                   /translation="MDINFELYKIFYHCAENKSFSAAARKLFITQSAVSQSVKSLEKQL
FT                   GITLFHRKSRNIQLTNEGELLFSYVSQAYNFLKTAEEKLKEFEGLTAGEIRIGVSDSIC
FT                   KYFVMPYIKKFGQMYPNIMVKVINRTTPQLLDVLKGGLIDIAISTLPVNEDTFNAAPFI
FT                   SVQDIFVASDKFKELKGREISLQELNGYPLVLLQSDSSTRKSVDRFFQNQGLTCSPEIE
FT                   LESLDLLVEFAKIGTGIACVLKESAVDAIKSGDLFQIKSKEPLPPRSIGVVTMKNVVLS
FT                   KAVKTFISELI"
FT   gene            576490..580260
FT                   /locus_tag="Ccel_0499"
FT   CDS_pept        576490..580260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0499"
FT                   /product="phosphoribosylformylglycinamidine synthase"
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase;
FT                   PFAM: AIR synthase related protein domain protein; KEGG:
FT                   cth:Cthe_0554 phosphoribosylformylglycinamidine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74881"
FT                   /db_xref="GOA:B8I6I9"
FT                   /db_xref="InterPro:IPR010141"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6I9"
FT                   /inference="protein motif:TFAM:TIGR01857"
FT                   /protein_id="ACL74881.1"
FT                   /translation="MKSTVKRLFVVKKHPYDVEAQGLLKDFRETLGIESLESLKIVNRY
FT                   DVEGISDSEYQLARNTIFSEPTVDSAYDEEFKIPSNCRAFAVEFLPGQYDQRADSAAQC
FT                   IQLLTQGDRPEINTARVIVLQGSINEKEFNSIKEYYINPVESREAKMEKPETLKAEVEQ
FT                   PEDVATLEGFTSMNEKQLSELLREMGFAMSFDDIIFCQNYFKNSEKRDPSVTEMRMIDT
FT                   YWSDHCRHTTFLTCIDSVKFEKGRFTEIIEETYKDYIEKREDIYKDRNDKDICLMDIAL
FT                   MAMKALKKQGKLNDLDLSDEINACSIVVNADINGKNEEWLVMFKNETHNHPTEIEPFGG
FT                   AATCLGGAIRDPLSGRVYVYQAMRVTGSGDPRTKLEDTIQGKLPQKKITTGAASGYSSY
FT                   GNQIGLATGQVAEIYDEGYVAKRMEIGAVIGAAPRKNVVRMQPEAGDKIILLGGRTGRD
FT                   GCGGATGSSKAHTEESLITCGAEVQKGNAPTERKIQRLFRNPNASTLIKRCNDFGAGGV
FT                   SVAIGELADGLEINLDAVPKKYEGLDGTELAISESQERMAVVVEACDVEKFIGFAAEEN
FT                   LEAVVVAEVKAEPRLKMSWRGKQIVDLSREFLNSNGAKQRIDIEISAPDEETYFDKCNE
FT                   IEIDNLKEYWIKNLQNLNRCSQKGLVERFDSTIGANTVLMPFGGKTQLTPAEGMAAKLP
FT                   LMEGDTTTGTLMSFGYNPDIAKWSPFHGAVYAVVESIAKIVAMGGDYSKARLTLQEYFE
FT                   KPGKDAKRWGKPLSALLGAYYAQMKLGTAAIGGKDSMSGSFMDMDVPPTLVSFAVNTVN
FT                   VDNVISNEFKGVGSRVVLLKVKLDDNILPDFDELDRVYSRVNKLAKEKAILSASSVRSG
FT                   GIAEIISKMAFGNMIGFTLKGIADVSLLFKPFYGSLILEIPENIDLTKALEGLRYTVLG
FT                   VTTANSEININGTVIDLGELSHKWQEPLEKVFPTRVSEVQGTTVQYNFEAKTKAKPSVK
FT                   IAKPRVFIPVFPGTNCEYDTKKVFENAGGIVETMVIKNMTHKDIEESIKRMEKLIDNSQ
FT                   IIMIPGGFSAGDEPEGSGKFIATAFRNPVVSEAVMKLLKNRDGLVLGICNGFQALIKLG
FT                   LLPFGEIREIDEVCPTLTFNTIGRHQSCLVKTRIASNLSPWLNNVKVGDIHTIAISHGE
FT                   GRFTANSEVMAGLEANGQIATQYVDLNGKPTLDISFNPNGSINAVEGITSPDGRVFGKM
FT                   GHSERIGTNLYKNVPGEKDQQLFRAGIEYFG"
FT   gene            580364..581164
FT                   /locus_tag="Ccel_0500"
FT   CDS_pept        580364..581164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0500"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: cth:Cthe_0234 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74882"
FT                   /db_xref="GOA:B8I6J0"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J0"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL74882.1"
FT                   /translation="MKISFSTLGCPGWSWEDMLSTAKDIGFDGVEVRGIGNELYVPKVK
FT                   HFSNDNIELTKKKLSKIGLEIPCLTSACFLFDKENIDKHIKEGIDYINLAEKLGTPYIR
FT                   VLGDAQPQPSDIDIDFVVKNLKNLAAAAKEKGVKLLVETNGVFADSKVMKSLLDKVDSD
FT                   SVGVLWDIHHPVRFFNESLEYTYGNLKEHICFVHIKDSIMMDGTVKYKMTGYGDIPVKQ
FT                   AVELLNQNGYNGYVSLEWVKRWCLDLEEPGIVFAHFAGYMKSII"
FT   gene            581303..582103
FT                   /locus_tag="Ccel_0501"
FT   CDS_pept        581303..582103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74883"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J1"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0502"
FT                   /protein_id="ACL74883.1"
FT                   /translation="MKRIPLCLVMAAFIILSSCGNDKIVLHKHSSYGYHNGDVKLDKTI
FT                   KTLDVNIDSGKLQIYCWDNNEIKYEAKHVARGNKSDEALQELLKKYSVKPNQKEKTMYI
FT                   TVAYGGKIKNPQDFYTEIKLTIPRNIKNIFIKQDVGSISVEDKIDGNITGDVDSVNTEI
FT                   KAMNGKLSWTCDTGSFRLGSGKLFSDSTVNIKAGNISSKAECQNNSQYLFKTDAGNVEL
FT                   SFPADSDVTVDSYGTLQNNQFTGINGNIKIKASTKMGKICVNGY"
FT   sig_peptide     581303..581365
FT                   /locus_tag="Ccel_0501"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.993) with cleavage site probability 0.979 at
FT                   residue 21"
FT   gene            582244..583380
FT                   /locus_tag="Ccel_0502"
FT   CDS_pept        582244..583380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0502"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cac:CAC0037 MinD family ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0502"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74884"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74884.1"
FT                   /translation="MALIKILIVDEDDEYSISLCNFLTHNYSETIALNYCKDIEEVKNR
FT                   INEIVPDVILASEKYHREIKNYSKNNVILLSSVKNSASTIQNDYIYKYKDVNQIAAEII
FT                   NIHTRSGNKIHDIGGNIAKVISVFSAAGNVGKTSLALAVSSICSFSGLSVFYLNLEQFQ
FT                   STNIFFNGNTQNSFSDIIYFAKEKDKNLVTKIPAVCSKAIDSGIHYFSQTNNVFDIKEI
FT                   QPEDIEFIVSAIKNCGYYDLIMVDMDSQLNENTMKVFEKSDEILYLITKEESCLHKTKQ
FT                   FIDSITLLSNSFENQAAIKNKIKYIANKVYKQAYLSEKFLLEQELLFQIVYDSDFPSLN
FT                   NLSQLNGGPEIILNTYRDIAGRYIKHNMEVRCETGTHQ"
FT   gene            583358..584593
FT                   /locus_tag="Ccel_0503"
FT   CDS_pept        583358..584593
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0503"
FT                   /product="type II secretion system protein E"
FT                   /note="PFAM: type II secretion system protein E; KEGG:
FT                   cth:Cthe_1339 type II secretion system protein E"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74885"
FT                   /db_xref="InterPro:IPR001482"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J3"
FT                   /inference="protein motif:PFAM:PF00437"
FT                   /protein_id="ACL74885.1"
FT                   /translation="MKQELINEIKTSINDKIDLKRNFTDDEINELTVRTVLDKSKQVFL
FT                   SSTEKKQIIESVFNSLRRLDILQPILDDNQVTEIMINGPNDIFIEKKGKISRLEMFFES
FT                   QQKLEDIIQIMVTAVNRTVNESNPIVDARLKDGSRLNVVLPPIAINGPIVTIRKFPGKP
FT                   IDVKSLIELGSLTEEAADALKILVRAKYNIFVAGGTGAGKTTYLNVLSNFIPADERIIT
FT                   IEDSAELQITNISNLVRLETRNANVEGRGEVTIKNLIRTALRMRPNRIIVGEVRGEEAI
FT                   DMLAAMNTGHDGSLSTGHANSSQDMFSRLETMILSSAPLPLEAVRKQIASAIDIIIFLS
FT                   RLRDGSRRTMEISEVLGIENGLIRLNPLFVFEETFQGDKKPINLVCGCLKRTLNPLINK
FT                   HKIINSGIYNDF"
FT   gene            584605..585348
FT                   /locus_tag="Ccel_0504"
FT   CDS_pept        584605..585348
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0504"
FT                   /product="Flp pilus assembly protein TadB-like protein"
FT                   /note="KEGG: cth:Cthe_1338 Flp pilus assembly protein
FT                   TadB-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74886"
FT                   /db_xref="GOA:B8I6J4"
FT                   /db_xref="InterPro:IPR018076"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J4"
FT                   /inference="similar to AA sequence:KEGG:Cthe_1338"
FT                   /protein_id="ACL74886.1"
FT                   /translation="MVDYNEYAIPTKMKLVYALSAATVVFAVSYLFYRSFTVSIAISPL
FT                   GIFYLNYRRKQIIEKRKNELNLQFKDLLISLSSSLSAGKPLEKAFVGALSDLYVLYPSD
FT                   DAYIVRETKIIINKLSLNVSIEEAVSDFAERSDIDDIKNFSDVIIICKRTGGNLVDAIK
FT                   NSSRIISEKIEMAQEIETLLSSRKLEQKVLNIMPIAMIFILSTTATEYINPVFTTVTGR
FT                   IAATLCLILLTAAYFISKRIINIKM"
FT   gene            585355..586080
FT                   /locus_tag="Ccel_0505"
FT   CDS_pept        585355..586080
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0505"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1337 type II secretion system
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74887"
FT                   /db_xref="GOA:B8I6J5"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74887.1"
FT                   /translation="MLSLWIVTGVTLSAYGLALLVVLIKNYPSYSQYCSVLDSKEYPLK
FT                   RLLPFGLYILDKISYSFNSAYDRRIIGRISEIYGQEYSAFHIRVFHAKKIVLIALIIPG
FT                   ELIVGILSHYQAVFNVYITLLFGILIFLDDSRLSRKIKKRHLEIQLSFPDFINKLALML
FT                   NAGLTMSKAWEKISFDSNKQDAFYKEVKKTVSHKASVSNDDNVLCNNYHCNYSCINIHA
FT                   GNIKFLENQFKAVFTNKED"
FT   gene            586082..586177
FT                   /locus_tag="Ccel_0506"
FT   CDS_pept        586082..586177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0506"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74888"
FT                   /db_xref="InterPro:IPR031564"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74888.1"
FT                   /translation="MIAALKRFIREEDGMGTVEVIIIIAVLVVKW"
FT   gene            586182..586778
FT                   /locus_tag="Ccel_0507"
FT   CDS_pept        586182..586778
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0507"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1336 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74889"
FT                   /db_xref="GOA:B8I6J7"
FT                   /db_xref="InterPro:IPR012495"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74889.1"
FT                   /translation="MKNNKGSFTVEASLVFSVVFLMVTAFVYLFVIMYQYVNMQSVANE
FT                   AATKGAYFYVNQTGNNYGSNKLDEMYWRIYDTNNNKKASGIIDYANKLLNKSLFPAENN
FT                   ISVNTYNKILIKNLKIEIVDKYTIPVSNMFDIFGLSPVLSLKVVTNSPLDDNAEFIRNM
FT                   DIVTDIHNCIKNSDTKWTGEGSKLENILEKLLKKN"
FT   sig_peptide     586182..586265
FT                   /locus_tag="Ccel_0507"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.601) with cleavage site probability 0.437 at
FT                   residue 28"
FT   gene            586792..588939
FT                   /locus_tag="Ccel_0508"
FT   CDS_pept        586792..588939
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0508"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1835 viral A-type inclusion
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74890"
FT                   /db_xref="GOA:B8I6J8"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74890.1"
FT                   /translation="MEQHKTKGAITVFLSIVLTAIFLVIGTFTDGARLRLAQSHVQRAN
FT                   KAAISSVLANYNNELKDEYGLFGVYLDEDSLQETYEEYLSKNLGIVGKGKSMYDFSIDN
FT                   IKLENPYSLENKEVIENQIMEFMKYRAPYKLATELIEKVKGIKNISKGSNVYSRKMQTD
FT                   KQAAEIGRIQLSLENKTKRINEFNLTTQLSALKDDFKKQNEVLNEKNKSIQNLENIYQN
FT                   ETNIKKKQDVGKLLQNVREEMQNINNTKNNIKNSILDGINEFKSLNSEAISEAAAIADK
FT                   KKLLCDRINGEMEQIEEHYEGIHELQNSYKKSMGKIKNMVEQDNSESVMGGFKQNIENC
FT                   NQIISSSESDEENFLNSLDKLSNIAVVNYSFIKTESAHSNDKDNRKKASDELKTAFKKD
FT                   GDSKKIPDDILKNLPSKKSGFKEETGARTWDNPNFEDESFAVDNFNYIAEKDNTFGDIA
FT                   NKISEELFLNEYIMGTFKHGIPILEGQTEKDAYNLRSKDKSQRISFFTNFEIEYIINGN
FT                   RDETINSMLTKSEIMAIRLISNVLHIYADSSKITRVTSLAAALSSWCAGLSTPLIQTML
FT                   VFSWAAFESLYDINILEKGGKVALFKTDVQWMTDISGAVSKKEKNKVSNDILCLSYQDY
FT                   LKIFLVTMDKDKKLMRVQDLVQLNKSVKSPGFLLADCKVFFKAYTGVSIKNLFVAFPMF
FT                   TTESRRKVSRSNINESMYLGY"
FT   gene            588953..590017
FT                   /locus_tag="Ccel_0509"
FT   CDS_pept        588953..590017
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0509"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cth:Cthe_1830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74891"
FT                   /db_xref="GOA:B8I6J9"
FT                   /db_xref="InterPro:IPR033799"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6J9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74891.1"
FT                   /translation="MKSKGLQDKGSITIEAAICLPFFILAVISFVFLIKVHFSHEIIQH
FT                   AITGACNEMSVYSLIYYNTNAEELVGGLEKFCKSDKVSNAVGNSVLSQYIQEFGKDASD
FT                   YVRVRTVLVPITKKLVRENLGTSSDNADIRLKNLSIRNGFDGIDFTHSRMAADGKSIDI
FT                   VAEYKLEFPFLSQLLPGIKICQTASACIWAGEDGVNSLKYNSDETNTECVWNLGNIKRG
FT                   REIRRLQGANLPFNFPVISKYENGTATSIKSLNLDKIYYHNTNNLEKKLKGYITKLQEF
FT                   NGGKNGSVEIDSNQILRKELILVVPETDILPVQLQTLNKCVDIAREKGIYLKIVKAYGK
FT                   QNNAENEVENAKGY"
FT   gene            590001..590549
FT                   /locus_tag="Ccel_0510"
FT   CDS_pept        590001..590549
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0510"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   cth:Cthe_1335 peptidase A24A, prepilin type IV"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74892"
FT                   /db_xref="GOA:B8I6K0"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K0"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ACL74892.1"
FT                   /translation="MQKVIKIENKKIRKFTTAMICVVIWIAGIVGTVGFIYKSKLPAAI
FT                   GVLLTVQLLAALWDIKSMTIPAKITVPAMVAGAVIVALTGEFLEGTAAAVLSFILMKLL
FT                   AIISRNQVGGGDIAIMTVTGLYTSIGALISILFASVTLSGVFSVIFIISGKADKKTEIP
FT                   FAPFILTATVLLTLSGYVN"
FT   gene            590582..592009
FT                   /locus_tag="Ccel_0511"
FT   CDS_pept        590582..592009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0511"
FT                   /product="FHA domain containing protein"
FT                   /note="PFAM: Forkhead-associated protein; KEGG:
FT                   cth:Cthe_1334 FHA domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74893"
FT                   /db_xref="GOA:B8I6K1"
FT                   /db_xref="InterPro:IPR000253"
FT                   /db_xref="InterPro:IPR008984"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K1"
FT                   /inference="protein motif:PFAM:PF00498"
FT                   /protein_id="ACL74893.1"
FT                   /translation="MYETLELNFDISYENDSTSNYLVLKPKNDRKLIDYQVQMLLNNRI
FT                   HGLLSLHINSVGNQVNCFYDITSKCTLVNIMNRKKYNRYEFLITMLTIIKSIIGLKDYL
FT                   LNDNNILLDENNIYVDPEALNLFFVYLPFENNSNDIRTFLINIIVKLVKFQEEDCDNYI
FT                   QKILENIKNELFNLTCLKELLENLLSQDITRNTPNESFSIDKPENEPLNEIKIKASKQK
FT                   QKSLIQRGEVKIPNLPSEECSPKNLNIKHKDFSKAFGKLTLMQIILQPIILLILFKILS
FT                   SNFVRMSDSPKTTTIILSLIFISIDILLIRILNEKKTENTESYKPLQYITEKMRENSAL
FT                   TVKQASEKDSKKAEEVHIKNINNRGGETVILKSNEPKDIPYLQEKDGEDIIKVNKTSIL
FT                   VGRMGSFVDHIVDNNAVGKVHAEIINEDGSYFVMDCSSRNGTYINDGRIKPNTKTSVNN
FT                   NDVIRFANKEFIFIIPS"
FT   gene            592045..592548
FT                   /locus_tag="Ccel_0512"
FT   CDS_pept        592045..592548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0512"
FT                   /product="peptidase A24A prepilin type IV"
FT                   /note="PFAM: peptidase A24A prepilin type IV; KEGG:
FT                   cth:Cthe_0545 prepilin peptidase CpaA"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74894"
FT                   /db_xref="GOA:B8I6K2"
FT                   /db_xref="InterPro:IPR000045"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K2"
FT                   /inference="protein motif:PFAM:PF01478"
FT                   /protein_id="ACL74894.1"
FT                   /translation="MIKYIILFLLVLFSVVSDIRTSKIRNIHTASAMLAGLVINTHLSG
FT                   MYGFKESMEGIILPVFLFGIFFYARLIGAGDIKLFSSIGAVFGIDFVIMVIAYSFLICG
FT                   LYSLVMLCIKRKFVSTFVPFIKEIRLCCLTLNLSVFENKTTRTYIRMSPAIAAGCVFQV
FT                   LLNL"
FT   gene            complement(592543..593412)
FT                   /locus_tag="Ccel_0513"
FT   CDS_pept        complement(592543..593412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0513"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: cno:NT01CX_0225 patatin-like
FT                   phospholipase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74895"
FT                   /db_xref="GOA:B8I6K3"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR037483"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K3"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACL74895.1"
FT                   /translation="MAKVNLILEGGGMRGLYTAGVLDCFLDHKILFKDIIGVSAGACNS
FT                   LSYITGQRGRNLEINAGYCMDNRYVSVMGLFTRGSIFNMDFLFNDIPNKLIPFDYDKFK
FT                   SSGCKLTVVTTDCETGKSYYAPVNDMKVDDVYVKASSSIPLVSPIVEAAGRKLVDGGPS
FT                   DSIPIHYSVNIGFDKHVIILTQHKGYEKKPNKLYPLCKIKLKKYPNLVEAIKNRHIHYN
FT                   KSIKLAEKLEEENRAVIIRPKKPIEISRFERNPENLKKLYAEGYKDAEDKFSDIARLCK
FT                   DCSNFSLL"
FT   gene            complement(593499..593933)
FT                   /locus_tag="Ccel_0514"
FT   CDS_pept        complement(593499..593933)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0514"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: tde:TDE2739 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74896"
FT                   /db_xref="GOA:B8I6K4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL74896.1"
FT                   /translation="MVKGGKNMWFAFALLSALFAAFTSILAKIGITGINSNLATAIRTI
FT                   VVLIVAWGMVFLTGAHHGITNISTKSWVFLILSGVATGLSWLFYYYALQIGEASKVVPV
FT                   DKFSVVISIVLAFVILHEAVTVKTVLGAVFITIGTFIMIL"
FT   sig_peptide     complement(593850..593933)
FT                   /locus_tag="Ccel_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.931 at
FT                   residue 28"
FT   gene            594208..594624
FT                   /locus_tag="Ccel_0515"
FT   CDS_pept        594208..594624
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0515"
FT                   /product="protein of unknown function UPF0047"
FT                   /note="PFAM: protein of unknown function UPF0047; KEGG:
FT                   cth:Cthe_0456 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74897"
FT                   /db_xref="InterPro:IPR001602"
FT                   /db_xref="InterPro:IPR035917"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K5"
FT                   /inference="protein motif:PFAM:PF01894"
FT                   /protein_id="ACL74897.1"
FT                   /translation="MKSFRKELFFNVPRRRAYINITQQVQQCIDESGIKEGMVLVNAMN
FT                   ITASVFINDDEAGLHADFETWLEKLAPEKPYSQYNHNGYEDNADAHLKRQIMGREVVVA
FT                   ITKGELDFGTWEQIFYGEYDGKREKRVLVKIIGE"
FT   gene            594681..595406
FT                   /locus_tag="Ccel_0516"
FT   CDS_pept        594681..595406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0516"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74898"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74898.1"
FT                   /translation="MLSQETKEFLMSCGIEKEMQQLEDCCSDYLIRFIHKMYPMPENTK
FT                   NMLGRNSMHYIQMALCRSKLLTDGVITALNAKNGLLAMLAARAHLEVTGALAFFLKKLN
FT                   NYYRNAISYQILNEALQRLILGTKSLELSENAPAPVNVMTLIDAADEYLSKTRNEETKE
FT                   FRENYNYLSEYCHPDFFGITMQSRINNAGITTYSLFYNLNEQDLTFLSSLMSSVSTFFL
FT                   LFDSILELLMENEELPEYQ"
FT   gene            complement(595476..596702)
FT                   /locus_tag="Ccel_0517"
FT   CDS_pept        complement(595476..596702)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0517"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: cbh:CLC_1710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74899"
FT                   /db_xref="InterPro:IPR024301"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74899.1"
FT                   /translation="MAKIRKITTISILFCIIVSCLCSLQAKPIDIRQAEQLTTEFLCTK
FT                   IQSVVSHNVDAINIYYTNSPTSQRNLLFIQKQLLEDYIISYASNDYTIEKVEPRVKINE
FT                   TLFDGKFANIRATLTADIYWNAANPLGNPIKGRKVEEHLLLLKNENDVWKIEQDKFQTK
FT                   KGSSVELTRESIADLHEQIRTLKFQAEKALDKARKSKPSKLTPETPEWKMSDLYTPRIS
FT                   QDYNRQEVYNWAYNHWNNYSKEYLNFGDEKWKGGDCTNFVSQCLRAGGAVNDKSGAFQW
FT                   YYDKKGTLASTNDTYSWTWSTARGLNSILSGNHNNEEFGPKATQKVISGDDQYDTSIGK
FT                   YVVPGDLIQYHWNNKSTITHAAVIVGMIYNSSKFRYEPVIAEHTEDSWFTPWTNNAYKT
FT                   YFVHITGIN"
FT   sig_peptide     complement(596622..596702)
FT                   /locus_tag="Ccel_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.945 at
FT                   residue 27"
FT   gene            596854..597645
FT                   /locus_tag="Ccel_0518"
FT   CDS_pept        596854..597645
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0518"
FT                   /product="3D domain protein"
FT                   /note="PFAM: 3D domain protein; KEGG: cth:Cthe_0664
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74900"
FT                   /db_xref="GOA:B8I6K8"
FT                   /db_xref="InterPro:IPR010611"
FT                   /db_xref="InterPro:IPR036908"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K8"
FT                   /inference="protein motif:PFAM:PF06725"
FT                   /protein_id="ACL74900.1"
FT                   /translation="MAEKDNENSTDVRVFKLLTIALILTSALLAVFCISVNNVVNQYKE
FT                   KYNNECIQSMRIMKSNQSLTANTNSYKSQSDELSKLNNDLKKQNEQIKKQLEELKKQNK
FT                   QLEATKRELADDNLHLQKSLKKAASVGVKPQSYKIYSSNNLETNSKGKFLGKFLGTAYT
FT                   PCAEECGNNKGITSSGQPIVPGVSIAIDNSHWPYGTIFYIKGLGYTVAMDTGSAIKGKN
FT                   RFDFAVLDKKFAYELGQQYYDVYLVKMGNGKINESIIAKPA"
FT   gene            598014..598868
FT                   /locus_tag="Ccel_0519"
FT   CDS_pept        598014..598868
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0519"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   cth:Cthe_1170 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74901"
FT                   /db_xref="GOA:B8I6K9"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6K9"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACL74901.1"
FT                   /translation="MKVCISGLGRTGKEIAKAILLQNEIQLVSAICSPTSKSLNKDLGE
FT                   ILGINKTGITVTGSDKLEEVIFRNKPDVVIDFSNPKSALKNALIFSKYRINIVVGTTGF
FT                   SDYQLKKLYVICRKFKNGIVYAPNITMGVNVLMLLSNLTASLLSSYDFQITELHHKNKL
FT                   DSPSGTAKKIAGEIQNGLSNKGVVVSHKDIPINSVRAGGVIGKHEVMIVGQEDKIEISH
FT                   ESFSRKAFAQGAISAAKYIHKKSGYYEMKDVLDLEKVLQTYIENNNRSSRRRRKYDAKP
FT                   ASN"
FT   gene            complement(598883..600103)
FT                   /locus_tag="Ccel_0520"
FT   CDS_pept        complement(598883..600103)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0520"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /note="PFAM: peptidase S11 D-alanyl-D-alanine
FT                   carboxypeptidase 1; KEGG: cth:Cthe_1171 serine-type
FT                   D-Ala-D-Ala carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74902"
FT                   /db_xref="GOA:B8I6L0"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR012907"
FT                   /db_xref="InterPro:IPR015956"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR037167"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L0"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACL74902.1"
FT                   /translation="MSKKILIVFVALILIFNCLPVFAWTPTEGLTSSSVVLMDTVRGQI
FT                   LFEKNAYAHLSPSVMCKLMTALVTIEKTDLNAKVTISKNAASFKGLNLVVGNQYTVEDL
FT                   LYAVMLSQGNDAAVALAEYVGDGDIQKFVRYMNTKAKELSLKDTYFVNPTGLYEKDQYT
FT                   SAKDIAVLVKAAISNNTFNLMFGARGFGWLNGNNSSILTNQNTLFWSYKGVDGGKIGTN
FT                   TNPQSISAVTTATLNEKRLIAVVFNTNEENAFSETAKLFDYGFSKFYTGVLVPKNIPQR
FT                   SIEVDNVKVDLVSKIDVYYTYPVGDSFINNISFTPNEKLKLPLNTETIAGVLKYTLNDN
FT                   TVIEVNLYSDKTVSAPEDYISKIKNIVTENRDLVIIVGILAIIELVLIAKNLLKFIFKA
FT                   KKTRTQK"
FT   sig_peptide     complement(600032..600103)
FT                   /locus_tag="Ccel_0520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            600333..602069
FT                   /locus_tag="Ccel_0521"
FT   CDS_pept        600333..602069
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0521"
FT                   /product="GerA spore germination protein"
FT                   /note="PFAM: GerA spore germination protein; KEGG:
FT                   cth:Cthe_0667 GerA spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74903"
FT                   /db_xref="GOA:B8I6L1"
FT                   /db_xref="InterPro:IPR004995"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L1"
FT                   /inference="protein motif:PFAM:PF03323"
FT                   /protein_id="ACL74903.1"
FT                   /translation="MGVVKKLSKYIIYDEKSIKHEFELKEKKSLNCEEVRNSASMDTFG
FT                   SEKFKDYFEECPVDDEFLEESVSDEIEHNKSIMKKIYNIPENSDIVYREFNITVKDKSF
FT                   QAFIVFIDGMTNSSIISDNILQPLMILSNLDIKEEAKDVGEFIFNRLIPFNQLKKAKDF
FT                   KEIVSNINFGGCTIFVDGLEYAYTADTKKWEHRNVGQPNSETVIRGPQEAFNEQIRANT
FT                   ALLRKILKDKDLTIKGLTIGKRSNTPCAVMYIRDIANESLVREVLKRVKSIEVDYIFDS
FT                   GELEQLLEDSTFLTAPQIFATERPDTVARMLAQGNIAVILDGSPYVLVMPATITEYLST
FT                   PEDINIRFPYVNFVRIIRIIGVAIALLLPGLYIAITNYHQEMIPTNLLFAIEASREIVP
FT                   FPTVIEILVMEFSFELIREAGIRVPGAIGSTIGIVGGLILGQAAVAANLVSPILIIVVA
FT                   ITALGSFSIPSFSMSFSIRIIRFAYIILGAIAGFSGIALGLLLNALLLASSKSFGVPFL
FT                   TPFGPITNGKYSDKILRKPMWKQEKRPDYLNTKNIKKQPEISRGWTVDDSGEDGGKDNE
FT                   EQ"
FT   gene            602056..603159
FT                   /locus_tag="Ccel_0522"
FT   CDS_pept        602056..603159
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0522"
FT                   /product="Spore germination protein"
FT                   /note="PFAM: Spore germination protein; KEGG: cth:Cthe_0670
FT                   spore germination protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74904"
FT                   /db_xref="GOA:B8I6L2"
FT                   /db_xref="InterPro:IPR004761"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L2"
FT                   /inference="protein motif:PFAM:PF03845"
FT                   /protein_id="ACL74904.1"
FT                   /translation="MRSNDGFGSWEAICILINMVFVQAILYFPKEAADFSGSAGWMIPI
FT                   GITIVAYIYFAIVTGFYRYSGSMDLLEISQRAAGRIMKIIVGLLTALLLIFLEASLLSR
FT                   YAHSLKTISLDKSPLSYVLLFFLIGMVAAAYYGIEAVARISAFIVPVCIIGFLLITIGV
FT                   IPEFNTDNLFPILGKGVDSIINGSTLSLRVFSPLLLVFFMIPFFKRRNLKRVGYLSITI
FT                   SGIVTLWSTLAFFLTFPYEMAVDKKIPVYQMARLIEFGNYIQRVESVFVLVFSLSSILY
FT                   MGALFAFITYIIAKTLDLERYRPIILPTVVIIYCLTFIIKRFSLNLLVSQLTNILWILA
FT                   LMLPIIVLIIGSIKKAGSENEGGKDYE"
FT   gene            603134..604333
FT                   /locus_tag="Ccel_0523"
FT   CDS_pept        603134..604333
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0523"
FT                   /product="germination protein, Ger(x)C family"
FT                   /note="TIGRFAM: germination protein, Ger(x)C family; PFAM:
FT                   spore germination B3 GerAC family protein; KEGG:
FT                   cth:Cthe_0669 spore germination B3 GerAC like"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74905"
FT                   /db_xref="GOA:B8I6L3"
FT                   /db_xref="InterPro:IPR008844"
FT                   /db_xref="InterPro:IPR038501"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L3"
FT                   /inference="protein motif:TFAM:TIGR02887"
FT                   /protein_id="ACL74905.1"
FT                   /translation="MKEGKIMSKITRLFCIISCITIYMITLTGCYDSREIEDLAYVVAI
FT                   GIDEADNNMFNLTFQTAVPKSITTGEGETTDIKSFKTDNFLSGFRKTGRYLSKKINLSH
FT                   TKIIVVSEEIAKRGLLPFLNGLQNYMELRPNVNIIVSANGAKNYIESLQPKLTASPTKF
FT                   YDMMFKSYQTDFRVPSSQLGDYLYRTDSSGSQPVTIYTEVDNSVIDSKKPEAGKPTEQQ
FT                   KEEKKNMSIKGLAVFNRDRMKGSLDSAETSLYALLTGSIDFIKLDVKDPLDERYKILSN
FT                   IRKDRSSKTNIQVYGNRPQINVDLNLRADIEAVQSNIDYSDPAKSARVKKAYEDYLKNE
FT                   MNNLLSKVSYKYKSDIFGFGQIAKMNYRSISQWDKIKWHEIFPNAVYRVRINVTVSDEE
FT                   "
FT   gene            605119..606759
FT                   /locus_tag="Ccel_R0012"
FT   rRNA            605119..606759
FT                   /locus_tag="Ccel_R0012"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            606937..607012
FT                   /locus_tag="Ccel_R0013"
FT                   /note="tRNA-Ala2"
FT   tRNA            606937..607012
FT                   /locus_tag="Ccel_R0013"
FT                   /product="tRNA-Ala"
FT   gene            607533..610445
FT                   /locus_tag="Ccel_R0014"
FT   rRNA            607533..610445
FT                   /locus_tag="Ccel_R0014"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            610697..610812
FT                   /locus_tag="Ccel_R0015"
FT   rRNA            610697..610812
FT                   /locus_tag="Ccel_R0015"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(610925..611395)
FT                   /locus_tag="Ccel_0524"
FT   CDS_pept        complement(610925..611395)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0524"
FT                   /product="amino acid-binding ACT domain protein"
FT                   /note="PFAM: amino acid-binding ACT domain protein; KEGG:
FT                   csc:Csac_1581 amino acid-binding ACT domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74906"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L4"
FT                   /inference="protein motif:PFAM:PF01842"
FT                   /protein_id="ACL74906.1"
FT                   /translation="MTILPVTSISTVYNVALVAVDNLPNDMVFISGIFNKIAEEKINID
FT                   MISQSPPYKGKINIYFSIPAENIIKVIAILNSFKIRAPNLRIEIDSDSTKISVFGEGMR
FT                   DKPGVAAKVFTLMAENEIEIKLITTSEVDISYLIYEKDADKAIKAIKQEFRL"
FT   gene            complement(611421..612185)
FT                   /locus_tag="Ccel_0525"
FT   CDS_pept        complement(611421..612185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0525"
FT                   /product="dihydrodipicolinate reductase"
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   cth:Cthe_0963 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74907"
FT                   /db_xref="GOA:B8I6L5"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L5"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACL74907.1"
FT                   /translation="MIKILLSGCNGKMGQVITRLSDNFSELKITAGFDINNNINNPYPV
FT                   FTSLADCNADVDVIIDFSNPKAFKPLVEYAQEKHIPLVLATTGLSSEQITILKTSVSNR
FT                   IPVFFSANMSLGVNLLIDLVKKAAKVLEDQFDIEIVEKHHNQKIDAPSGTALAIADAIN
FT                   DSLDEKYEYMYDRHSRRKKRSKQEIGIHAVRGGTIVGDHSVIFAGNDEIIEINHTALSK
FT                   EIFAVGALKASIFLASKKPGLYSMSELISETN"
FT   gene            complement(612214..613095)
FT                   /locus_tag="Ccel_0526"
FT   CDS_pept        complement(612214..613095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0526"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: cth:Cthe_0962
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74908"
FT                   /db_xref="GOA:B8I6L6"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR020624"
FT                   /db_xref="InterPro:IPR020625"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L6"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ACL74908.1"
FT                   /translation="MKKPIFTGSGVAIITPFTNDGTDYNKLSELIEYQIKEGTDAIIIC
FT                   GTTGEASTMYDEEHKAAIKFAVEKVNKRIPVIAGTGSNHTVHAVALSKYAEEVGADAIL
FT                   TVTPYYNKTTQKGLYEHFKMVADSIKIPVVLYNVPSRTNLNIIPETIHALSKIDNIVAV
FT                   KECNLSQVGDVINLCGDDITVYSGEDGAIVPFLSMGAKGVISVLANIAPKDTHDIVAKY
FT                   LSGDIEGSRKLQLKTLDLIKALFCEVSPIPIKAAMNLMGMNVGGCRLPLVDMSDSNLEI
FT                   LKTELIKYGLLL"
FT   gene            613548..615188
FT                   /locus_tag="Ccel_0527"
FT   CDS_pept        613548..615188
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0527"
FT                   /product="SpoIID/LytB domain protein"
FT                   /note="TIGRFAM: SpoIID/LytB domain protein; PFAM: Stage II
FT                   sporulation D domain protein; KEGG: cth:Cthe_0960
FT                   SpoIID/LytB domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74909"
FT                   /db_xref="GOA:B8I6L7"
FT                   /db_xref="InterPro:IPR013486"
FT                   /db_xref="InterPro:IPR013693"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L7"
FT                   /inference="protein motif:TFAM:TIGR02669"
FT                   /protein_id="ACL74909.1"
FT                   /translation="MKKMCLFLGIVMIFMMMPGFNNLNTSAAEATSVKIGLYYGSTAQS
FT                   QIDISADKGVAFSAFDAKAGKYYNVFNSNAGQTVTIRKDSYFIKSGTKYTPVAATGKPT
FT                   SGPFHIRLSGSFNSYNDTVLPIKSYSEKGIAAYPVYTDSGWQIWTGFYVSKSAAQTATS
FT                   TVKSKLGENTYTVIDELSSRIYCTDQNGNVLFMYSSSDSLLRGKSLSTANSNPVKIGTS
FT                   LYRGQVEFLRMSDSDMTIINVLPFEEYLYGVVPNEMPAYSNIEALKTQAVAARTYSYRS
FT                   INKHSKNGFNLCATTHCQVYKGFSSENANTNKAVDETRNMVVTYNGALAETVFSASTGG
FT                   RTEDAENVWGSSIPYLKSVEDKYESGKSYNYNWTMKFTTDEISTKLKSYGLGTVTGIEI
FT                   TKYSAAGRPIEMIIRGTLKPEGVTIKNERCRTFLGLPSQMYSISSDANINIQINNKTEN
FT                   VSLSQIKIITRDGEKTYNDPSQKVTIIGANGNKSVVSSSPGEYVFTGKGWGHAVGMSQE
FT                   GAMGMAKAGFTYDQILTHYYTGTKVELKK"
FT   sig_peptide     613548..613631
FT                   /locus_tag="Ccel_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.999) with cleavage site probability 0.888 at
FT                   residue 28"
FT   gene            complement(615248..616612)
FT                   /locus_tag="Ccel_0528"
FT   CDS_pept        complement(615248..616612)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0528"
FT                   /product="aspartate kinase"
FT                   /note="TIGRFAM: aspartate kinase; PFAM:
FT                   aspartate/glutamate/uridylate kinase; amino acid-binding
FT                   ACT domain protein; KEGG: cth:Cthe_1375 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74910"
FT                   /db_xref="GOA:B8I6L8"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR035804"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L8"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACL74910.1"
FT                   /translation="MKVAKFGGTSLANAEQIKKVCSIVLNDSERKVIVVSAPGKRDSSD
FT                   TKVTDLLIACAQKHLENGNAEAELEAVVMRFKNIANELGLDDEIVNLIRADLEERLKLD
FT                   TSHAGTFMDAMKAAGEDNSAKLVAAYLNSIGKKAEYVSPKKAGLLMSDKFGNAQVLPES
FT                   YENLKMINNIDGIVIFPGFFGYTKDGKVATFPRGGSDITGSILAAALKADLYENFTDVD
FT                   AVYAAHPGLVHNPVAVPELTYREMRELSYAGFSVLHEDTLVPVFKAGVPVCIKNTNNPS
FT                   APGTKISLVRDYSPNHVVGIASDAGFCCIYVSKFMMNREVGFGRKLLQILEDEGISYEH
FT                   TPSGIDNISIILKQNQLKEGMEQKIIDRIKAELKVDDVSIDHDLAMIIIVGEGMKNTVG
FT                   TASRATTALAKASISLEMINQGSSEITMMFAVRENEAHKAVISLYNEFFLNKQYK"
FT   gene            616871..617893
FT                   /locus_tag="Ccel_0529"
FT   CDS_pept        616871..617893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0529"
FT                   /product="S-adenosylmethionine/tRNA-ribosyltransferase-isomerase"
FT                   /note="TIGRFAM:
FT                   S-adenosylmethionine/tRNA-ribosyltransferase-isomerase;
FT                   PFAM: Queuosine biosynthesis protein; KEGG: cth:Cthe_0959
FT                   S-adenosylmethionine:tRNA ribosyltransferase-isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0529"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74911"
FT                   /db_xref="GOA:B8I6L9"
FT                   /db_xref="InterPro:IPR003699"
FT                   /db_xref="InterPro:IPR036100"
FT                   /db_xref="InterPro:IPR042118"
FT                   /db_xref="InterPro:IPR042119"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6L9"
FT                   /inference="protein motif:TFAM:TIGR00113"
FT                   /protein_id="ACL74911.1"
FT                   /translation="MNLHDFDYYLPEELIAQHPLEKRDMSRLMVLDKQTGEIEHKLFKD
FT                   LFNYLDEGDCLVLNNTRVIPARLLGEKEGTGGKIEFVLLKRVEGDNWEVILRPGKKAKP
FT                   GSKFVFGNGELKAEILEVLDEGNRLVRFIYDGVFEEILDRVGVMPLPPYITEKLDNPER
FT                   YQTVYAKVNGSAAAPTAGLHFTKELLDSLVHKGVKIAYVMLHVGLGTFRPVKVDDITQH
FT                   KMHSEYYSISQETCDIINVTREKGKKVVAVGTTSCRVLETIGKNGKIAPCDGWTDIFIY
FT                   PGYEFKVVDRLITNFHLPESTLIMLVSSLAGRDNVLHAYSVAVEEKYRFFSFGDAMFIK
FT                   "
FT   gene            617924..619045
FT                   /locus_tag="Ccel_0530"
FT   CDS_pept        617924..619045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0530"
FT                   /product="queuine tRNA-ribosyltransferase"
FT                   /note="TIGRFAM: tRNA-guanine transglycosylase, various
FT                   specificities; queuine tRNA-ribosyltransferase; PFAM:
FT                   Queuine/other tRNA-ribosyltransferase; KEGG: cth:Cthe_0958
FT                   queuine tRNA-ribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74912"
FT                   /db_xref="GOA:B8I6M0"
FT                   /db_xref="InterPro:IPR002616"
FT                   /db_xref="InterPro:IPR004803"
FT                   /db_xref="InterPro:IPR036511"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I6M0"
FT                   /inference="protein motif:TFAM:TIGR00430"
FT                   /protein_id="ACL74912.1"
FT                   /translation="MAAVTYELIKTCKQTGARLGKVHTPHGSFDTPVFMPVGTLATVKG
FT                   MSPEELKEIDARIILSNTYHCYLRPGQDIVKQAGGLHGFMNWDRPILTDSGGFQVFSLS
FT                   GLRKITEEGVTFRSHLDGSKHVFTPESVMDIENDLGADIIMAFDECAPYPAEYDYVKKS
FT                   MERTTRWAKRCKEAHTNTEKQSLFGIIQGGMYKELRIESANQLKELDFPGYAIGGLSVG
FT                   EPAEIMYEVLDYTAPLMPADKPRYLMGVGTPDYLIEGAIRGIDMFDCVLPTRIGRNGTV
FT                   LTSNGRVIIRDAKYSRDFSKLDPECDCYVCRNYSRAYIRHLIKCGELLGLRLTTWHNLY
FT                   FLINLMKQVRQAIMDDKLASFRDEFYLKYGYTK"
FT   gene            619108..619389
FT                   /locus_tag="Ccel_0531"
FT   CDS_pept        619108..619389
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0531"
FT                   /product="preprotein translocase, YajC subunit"
FT                   /note="TIGRFAM: preprotein translocase, YajC subunit; PFAM:
FT                   YajC family protein; KEGG: csc:Csac_0272 preprotein
FT                   translocase, YajC subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74913"
FT                   /db_xref="GOA:B8I6M1"
FT                   /db_xref="InterPro:IPR003849"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M1"
FT                   /inference="protein motif:TFAM:TIGR00739"
FT                   /protein_id="ACL74913.1"
FT                   /translation="MAVAALVQLVLPMALILGLMYVMLILPQKKKEKKTQQMLNSLQVG
FT                   WAVTTIGGIVGKIINIKDDEIYIESGVDKNKILVKRWAIKDVVKPVEG"
FT   gene            619494..619898
FT                   /locus_tag="Ccel_0532"
FT   CDS_pept        619494..619898
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0532"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74914"
FT                   /db_xref="GOA:B8I6M2"
FT                   /db_xref="InterPro:IPR023804"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M2"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0955"
FT                   /protein_id="ACL74914.1"
FT                   /translation="MSVQTPGLKKTLDEHINLLRVVKGLIIAFLITLPCFLGFALFLTY
FT                   TDFPEKHTYIAVLITTVISVLVASAYSTRNVKSKGWMNGCFVGILYVAILYIASSIVFL
FT                   SFHIDIQVILSVIIGAIVGCLGGIFGINLR"
FT   gene            619980..620120
FT                   /locus_tag="Ccel_0533"
FT   CDS_pept        619980..620120
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0533"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: amt:Amet_2345 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74915"
FT                   /db_xref="InterPro:IPR023975"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M3"
FT                   /inference="similar to AA sequence:KEGG:Amet_2345"
FT                   /protein_id="ACL74915.1"
FT                   /translation="MKHIKTINNATLKNSLAKGGCGECQTSCQSACKTSCTVANQSCEN
FT                   K"
FT   gene            620259..621602
FT                   /locus_tag="Ccel_0534"
FT   CDS_pept        620259..621602
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0534"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; KEGG:
FT                   cth:Cthe_0906 radical SAM family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74916"
FT                   /db_xref="GOA:B8I6M4"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR023885"
FT                   /db_xref="InterPro:IPR024025"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M4"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL74916.1"
FT                   /translation="MIHKYTMHDTNIVLDINSGAVHVFDDAAFDVVDLYKNKTKEQIIE
FT                   SLSENYTGQVIVDAYGEIAELESQGLLFSEDAYSDALQKWERKPVVKALCLHICHDCNL
FT                   RCKYCFASTGSFGGHRTMMDLETGKKAIDFLIEKSAGRRNLEVDFFGGEPLMNFDVVKG
FT                   IVKYARIREKEAGKNFRFTITTNAVLLNEEIKDFINANMHNVVLSIDGRKETNDRMRPR
FT                   VDGSGTYTKILPKILDMAESRNQDNYYVRGTFTRENLDFSNDVLHLADQGFKQISIEPV
FT                   VAAKDSGYDIREHDIPKLFEEYENLAREYVKRDSEKRGFNFFHFMVDLQQGPCVIKRLG
FT                   GCGSGHEYLAVTPEGDLYPCHQFVGDEKFKMGNVHEGVFNTDFQKNFQKSNVYTKKDCA
FT                   ECWAKFYCSGGCAANAYQFNNDINVPYKIGCELEKKRVECAIWIKTQE"
FT   gene            621614..622114
FT                   /locus_tag="Ccel_0535"
FT   CDS_pept        621614..622114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0535"
FT                   /product="transferase hexapeptide repeat containing
FT                   protein"
FT                   /note="PFAM: transferase hexapeptide repeat containing
FT                   protein; KEGG: tpd:Teth39_1022 carbonic anhydrase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0535"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74917"
FT                   /db_xref="GOA:B8I6M5"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M5"
FT                   /inference="protein motif:PFAM:PF00132"
FT                   /protein_id="ACL74917.1"
FT                   /translation="MVKDFNNITPKIHETAFVAPNSTVIGDVVLGENTTIWYNAVLRGD
FT                   IDSIVVGNNTNIQEGCILHCKKGIEVRLGSHVTIGHGAILHSCRIGDNTLVGMGAIVLD
FT                   SAEIGDNCLIAAGSVVTPRTKIPDGCLVSGSPAEVKRTLSEQEIADIKCNANEYINLLK
FT                   YYK"
FT   gene            622362..623687
FT                   /locus_tag="Ccel_0536"
FT   CDS_pept        622362..623687
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0536"
FT                   /product="protein-export membrane protein SecD"
FT                   /note="TIGRFAM: protein-export membrane protein, SecD/SecF
FT                   family; protein-export membrane protein SecD; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG:
FT                   cth:Cthe_0904 protein-export membrane protein SecD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74918"
FT                   /db_xref="GOA:B8I6M6"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR005791"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M6"
FT                   /inference="protein motif:TFAM:TIGR01129"
FT                   /protein_id="ACL74918.1"
FT                   /translation="MRGSNAVKFFSILVIIGILTWIAAYGSILGVEIPGVRDIRTGIDI
FT                   QGGVDARLYAVTKDNSKPKAEDLDAARIIIGKRLDSKNIFDRVITVDKDKGYVLVQIPH
FT                   KKGEAFDPQRSIEEIGKTALLTFQEVDESKKDSNGYLPTGKIILEGSDVKEASAEVDGE
FT                   NGGYCVALTLTSEGGKKFSEATGRLIGKPIAIFMDNDLISAPNVQTQISGNSARITLGG
FT                   TASNEQRDEAKNLAGLIKSGSLPFKLEARQVNNISPTLGSNALKVSIEAFIVALILICL
FT                   FMIFYYRLPGLIASIALILHTVMELLALSWTNIIVTLPGIAGLILTVGMAVDANVIIFE
FT                   RIKDELKNGKTLRAAIDVGFKRAFSAVLDSNITTLISAVVLWKFGSGPIQSFAYTLGIG
FT                   VVLSFLTAVTASRIMLQSIQDLEVAKHHWLYGVSMRGGKANG"
FT   gene            623680..624663
FT                   /locus_tag="Ccel_0537"
FT   CDS_pept        623680..624663
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0537"
FT                   /product="protein-export membrane protein SecF"
FT                   /note="TIGRFAM: protein-export membrane protein SecF; PFAM:
FT                   SecD/SecF/SecDF export membrane protein; KEGG:
FT                   cth:Cthe_0903 protein translocase subunit SecF"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0537"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74919"
FT                   /db_xref="GOA:B8I6M7"
FT                   /db_xref="InterPro:IPR005665"
FT                   /db_xref="InterPro:IPR022645"
FT                   /db_xref="InterPro:IPR022813"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M7"
FT                   /inference="protein motif:TFAM:TIGR00966"
FT                   /protein_id="ACL74919.1"
FT                   /translation="MVNLYAKRYYFFILSALIILAGVAMYFVEGFKLDIEFEGGTIIEM
FT                   RANEKMFTAANTQDLQTQIADFVTETINKPAKVQKSTAYDVSKNKNAESFDVITISIGS
FT                   KDTLSNSELTKVEEAVVKEFKLTAKDPVVSEESVEPYIGKEIMNNGLKAIVIAFILIIL
FT                   YVWYRFKAMSGLSAGVFAIVGVFHDLLIMLAVYVVFQIPLNESFIAAMLTVVGYSMNDT
FT                   VIIYDRIRENNRLLRKIPLPELVNSSIIQTLNRSINTVVTSLIAITTVYIFAKINGINS
FT                   MEQFSFPLIIGIAAGCYSSIFISSPLYVMWKESQKKKKITGKTAKA"
FT   gene            complement(624798..625082)
FT                   /locus_tag="Ccel_0538"
FT   CDS_pept        complement(624798..625082)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74920"
FT                   /db_xref="GOA:B8I6M8"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74920.1"
FT                   /translation="MNSNQNDKKAKLSMLKSAIYNMADLPKKMIKYATPIALLLIISGT
FT                   VFFIINRMSNSYSSIFDKTATSFIINSFYVLCEFLIAAFVIDIVIKRKT"
FT   gene            625359..625649
FT                   /locus_tag="Ccel_0539"
FT   CDS_pept        625359..625649
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: ctc:CTC02517 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74921"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6M9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74921.1"
FT                   /translation="MRDYETNLIYTKKVVVSEGIVKELYLRYYLIAREQTNSLTTYGIQ
FT                   VIMENDKGRIEKAFVPDVLSSETGINNLIYLLYSNSVTPVSVYDVIYDCIA"
FT   gene            625885..627699
FT                   /locus_tag="Ccel_0540"
FT   CDS_pept        625885..627699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0540"
FT                   /product="DNA primase"
FT                   /note="KEGG: cth:Cthe_0896 DNA primase; TIGRFAM: DNA
FT                   primase; PFAM: zinc finger CHC2-family protein; TOPRIM
FT                   domain protein; DNA primase catalytic core domain; SMART:
FT                   Toprim sub domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74922"
FT                   /db_xref="GOA:B8I6N0"
FT                   /db_xref="InterPro:IPR002694"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="InterPro:IPR006295"
FT                   /db_xref="InterPro:IPR013264"
FT                   /db_xref="InterPro:IPR019475"
FT                   /db_xref="InterPro:IPR030846"
FT                   /db_xref="InterPro:IPR034151"
FT                   /db_xref="InterPro:IPR036977"
FT                   /db_xref="InterPro:IPR037068"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N0"
FT                   /inference="protein motif:TFAM:TIGR01391"
FT                   /protein_id="ACL74922.1"
FT                   /translation="MANLFPDDLIEEIRVSNDIVGIISEYVKLEKKGKNFFGKCPFHNE
FT                   KTASFSVEPVKQIFHCFGCGKGGNVIHFIMSIENLEFPDALRFLADRAKILIPDMIEGN
FT                   RNDEKAGLKRELLQINLEAARFFRDNLNNDKNKLPNSYLINRKIQKNTVAKFGLGYAED
FT                   RFDTLYKHLKAKGFSDTSIKNSGLVIYKEESGNIYDRFRGRIMFPIFDIRGNVIAFGGR
FT                   VLDSSQPKYMNSPETEVYHKGKHLYALNFAKNTCSRRLILAEGYMDVISLHQSGILNSV
FT                   APLGTALTENQGRLLKKYTEEIVLSFDSDSAGRAAAFRSLDLLNEIGCNVKVLTIPSGK
FT                   DPDEFIKAYGVAEFKRLVDRSESLLDFKLGSLKNDIDTSTNEGKVRFLDKAVLILDKID
FT                   NNVEKELYVKKLSEELGVSTQSIFSEMAKQQRNSVIKVRQAASNKNFSRNQIRKSTVVK
FT                   NQEERLVRLQLMLLATICLDNSVYFSIKGSFDWDKFDSDEIKKAFKFAVERIESKAGIL
FT                   TGEILNKLSPGMAESFANIVQSQSIFEDNKKAALDIIRNIDLFGLEERKNEIIELKKRS
FT                   DLTEGDVELLNRELSGIVSNIAIMKKGL"
FT   gene            627725..628804
FT                   /locus_tag="Ccel_0541"
FT   CDS_pept        627725..628804
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0541"
FT                   /product="RNA polymerase, sigma 70 subunit, RpoD subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor RpoD; RNA
FT                   polymerase sigma factor, sigma-70 family; PFAM:
FT                   Bacterio-opsin activator HTH domain protein; sigma-70 1.1
FT                   domain protein; sigma-70 region 3 domain protein; sigma-70
FT                   region 2 domain protein; sigma-70 region 4 domain protein;
FT                   sigma-70 region 1.2; KEGG: cth:Cthe_0895 RNA polymerase
FT                   sigma factor RpoD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74923"
FT                   /db_xref="GOA:B8I6N1"
FT                   /db_xref="InterPro:IPR000943"
FT                   /db_xref="InterPro:IPR007127"
FT                   /db_xref="InterPro:IPR007624"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR007630"
FT                   /db_xref="InterPro:IPR009042"
FT                   /db_xref="InterPro:IPR012760"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR028630"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR042189"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N1"
FT                   /inference="protein motif:TFAM:TIGR02393"
FT                   /protein_id="ACL74923.1"
FT                   /translation="MKHSQESRKALLKELIDRGKQKGMLTYKEIMDAFEEIELEPEHIE
FT                   KIYETLETMGVDVIGDIDSEMEEIQLTDEELDISVPEGVSIDDPVRMYLKEIGKVPLLT
FT                   ADEEIDLAHRMENGDIEAKRRLAEANLRLVVSIAKRYVGRGMQFLDLIQEGNLGLIKAV
FT                   EKFDYRRGFKFSTYATWWIRQAITRAIADQARTIRIPVHMVETINKLIRVSRQLLQELG
FT                   REPQPDEIAKEIGMSVDKVREIMKISQEPVSLETPIGEEEDSHLGDFIPDDDAPAPAEA
FT                   AAFTLLKEQLIDVLDTLTPREEKVLRLRFGLDDGRARTLEEVGKEFNVTRERIRQIEAK
FT                   ALRKLRHPSRSKKLKDYLD"
FT   gene            629074..629149
FT                   /locus_tag="Ccel_R0016"
FT                   /note="tRNA-Asn2"
FT   tRNA            629074..629149
FT                   /locus_tag="Ccel_R0016"
FT                   /product="tRNA-Asn"
FT   gene            629154..629230
FT                   /locus_tag="Ccel_R0017"
FT                   /note="tRNA-Met1"
FT   tRNA            629154..629230
FT                   /locus_tag="Ccel_R0017"
FT                   /product="tRNA-Met"
FT   gene            complement(629306..629479)
FT                   /locus_tag="Ccel_0542"
FT   CDS_pept        complement(629306..629479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74924"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74924.1"
FT                   /translation="MSTFRKKHKENDIEHPMSSTLLGRDILGINPNNPALNKTTIDLQD
FT                   EKLSTDYTCRVK"
FT   gene            629611..630306
FT                   /locus_tag="Ccel_0543"
FT   CDS_pept        629611..630306
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0543"
FT                   /product="protein of unknown function DUF633"
FT                   /note="PFAM: protein of unknown function DUF633; KEGG:
FT                   cth:Cthe_0893 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74925"
FT                   /db_xref="GOA:B8I6N3"
FT                   /db_xref="InterPro:IPR006901"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N3"
FT                   /inference="protein motif:PFAM:PF04816"
FT                   /protein_id="ACL74925.1"
FT                   /translation="MILNLKGRLRLIADKVPKCNTVADIGTDHAYIPIYLVQNGVCRKA
FT                   IASDIKIGPVKIANSNISLYKLAEKIETRIGDGLNTIEVGEADSIIIAGMGGTLLTELL
FT                   EANKIKVVRATALVLQPMNDLDIVRKWLYDNAFDIYDEELVAEGPKFYCVLSAKFSGSK
FT                   KEYSDFDLHVGQGLINKKDVLLNQYCQMKVRQIDRVLEQLEGMEENVVLKNHYSRLKKE
FT                   YISLMEKIL"
FT   gene            630335..631129
FT                   /locus_tag="Ccel_0544"
FT   CDS_pept        630335..631129
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0544"
FT                   /product="protein of unknown function DUF34"
FT                   /note="PFAM: protein of unknown function DUF34; KEGG:
FT                   cpe:CPE2004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74926"
FT                   /db_xref="InterPro:IPR002678"
FT                   /db_xref="InterPro:IPR036069"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N4"
FT                   /inference="protein motif:PFAM:PF01784"
FT                   /protein_id="ACL74926.1"
FT                   /translation="MNVGDIINFLNEIAPWRYAEEWDSVGLMVGSRESYVTKILLCMDV
FT                   TSDVISEAAQCGAQMILSHHPFIFSKLKSIDMETFKGEQIANLIKNNISVVSAHTNLDT
FT                   APGGVNDTLAESLHLTNSRNLKPYMPKGLECDLGMGKVGELQNSKSFDEFVIDVKKSLC
FT                   IENLRIIGVKPKKVKKVAVFCGSFDDDLESLKSLKVDVLVTGDIKYHIALDAAQMGLCI
FT                   VDAGHFATERIILPKLRDTLNKRFKELDIICSKMETDPFTFA"
FT   gene            631829..632524
FT                   /locus_tag="Ccel_0545"
FT   CDS_pept        631829..632524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0545"
FT                   /product="protein of unknown function DUF710"
FT                   /note="PFAM: protein of unknown function DUF710; KEGG:
FT                   cth:Cthe_2088 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74927"
FT                   /db_xref="GOA:B8I6N5"
FT                   /db_xref="InterPro:IPR007838"
FT                   /db_xref="InterPro:IPR036192"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N5"
FT                   /inference="protein motif:PFAM:PF05164"
FT                   /protein_id="ACL74927.1"
FT                   /translation="MTNRNKTEVYIYGSKYTISGTESEEYILKLALHVDKKMRKFAEAN
FT                   NALSSGMISVLAAINIADDYFKTLDKLQNITKNQHIETELMEKEYKQKVEELTLQIQKF
FT                   KSDAVTMEEATTSQTYELEVIKNEFENKEKKLKQQIELLKIESGYKDEAIANQLEELEN
FT                   EHNQNKDELVDQIKRLKDENTSKEKAMTELYQKMEQLKSEYKQMEELYQEEYTQLKDEY
FT                   KKLEELMLK"
FT   gene            complement(632594..632785)
FT                   /locus_tag="Ccel_0546"
FT   CDS_pept        complement(632594..632785)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0546"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: cbe:Cbei_0065 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74928"
FT                   /db_xref="GOA:B8I6N6"
FT                   /db_xref="InterPro:IPR001080"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N6"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACL74928.1"
FT                   /translation="MKASVDQEGCISCELCTSICPAVFSMNDDNKAEAIEEDIPEENLQ
FT                   EAEDARDACPVSVIDLEE"
FT   gene            632961..633818
FT                   /locus_tag="Ccel_0547"
FT   CDS_pept        632961..633818
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0547"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: cth:Cthe_1291
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74929"
FT                   /db_xref="GOA:B8I6N7"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N7"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACL74929.1"
FT                   /translation="MNNNFEIIDCHVHTFANDDISAKIMTSFNKLYDIEFKNPGNGTIP
FT                   NVLKNMNEVGIDRTVMVNFAPPKILDSNNLWTIDTANSSEGRLVPLVNFHPDMEGCLSE
FT                   HFEKYVELGAKGIKLHPMAQGIDINDSRMDELYRKCSDNKFTILIHCGRVSNARLNEFS
FT                   DFQSLLPVIEKYPDIPIILAHMADGDKECVLKVSKQYENVYFDTSIVITGYPEIARVNE
FT                   PSWLDDSEVVDIINEVGADKILFGSDFPWGSSVHDVKRFMKLKLNDQQKKTILSENSKR
FT                   LFKL"
FT   gene            633957..634808
FT                   /locus_tag="Ccel_0548"
FT   CDS_pept        633957..634808
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0548"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein similar to fulmal1"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74930"
FT                   /db_xref="GOA:B8I6N8"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74930.1"
FT                   /translation="MKNKKLFISISYVVLLSLLIAGAILLSKPSKSNISPKNLLTEDNF
FT                   NNGILAYKSEINRKEDIKILNNPQNVDLQASLIENMNGEVTINISYKIDEKKLSRTIDT
FT                   SMIPEIRNLLRFREKYKKGYLIDKISVNNKAQRLYFYVRGKEDNRLTQTWLYTYNLKTA
FT                   NVDKLYYDTGDFSEFYFSPDGKYNAFAYRNNSEKQMEGQKNKVVIIRCDDNKIILNGDK
FT                   DINGKPIGQNSGLYIYRYDFQKWENTENCLLKQISEIKDGSHKIQEQKIYYNVVENKVK
FT                   AR"
FT   sig_peptide     633957..634055
FT                   /locus_tag="Ccel_0548"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.995) with cleavage site probability 0.478 at
FT                   residue 33"
FT   gene            634954..635553
FT                   /locus_tag="Ccel_0549"
FT   CDS_pept        634954..635553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0549"
FT                   /product="NADPH-dependent FMN reductase"
FT                   /note="PFAM: NADPH-dependent FMN reductase; KEGG:
FT                   cth:Cthe_0870 NADPH-dependent FMN reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74931"
FT                   /db_xref="GOA:B8I6N9"
FT                   /db_xref="InterPro:IPR005025"
FT                   /db_xref="InterPro:IPR029039"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6N9"
FT                   /inference="protein motif:PFAM:PF03358"
FT                   /protein_id="ACL74931.1"
FT                   /translation="MYIVGLNGSPNADGNTAFLVKKVLEECETRGAKTILLNVGKIMQE
FT                   QKCGFCTVCSNPCTGNCYKGTKLEEAFEILRNADGVVVASPVYFGSVSAQLKAMFDKTR
FT                   KVRSNKGLYNKVGLCVAVGASQYGGEETTIKAMHDMMLVNGMIIVGDGYIDDNCGHHGV
FT                   CATRPSKDDEQAVKRAVMSAKRLIEVCKATEIIRQS"
FT   gene            635606..636370
FT                   /locus_tag="Ccel_0550"
FT   CDS_pept        635606..636370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0550"
FT                   /product="UBA/THIF-type NAD/FAD binding protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein; KEGG:
FT                   cth:Cthe_3110 UBA/ThiF-type NAD/FAD binding fold"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74932"
FT                   /db_xref="GOA:B8I6P0"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR035985"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P0"
FT                   /inference="protein motif:PFAM:PF00899"
FT                   /protein_id="ACL74932.1"
FT                   /translation="MLHEFSRSELIIGTEGLEKLKNSKVAVFGVGGVGSFTVEALTRTG
FT                   VGHLVLIDDDCVCLTNLNRQLHATRKTVGKPKVEVMRDRVLEINPKCDVTIIQKFYMPD
FT                   VAEEILDSSFDYIVDAIDTVTAKIDLVVRANQFGIPIISAMGAGNKTDPTRFQVSDIFK
FT                   TTVDPLAKVVRKELRNRGIKKLKVVYSTEEPIKPVETDTSSCSAGCICPKGTARKCTVK
FT                   HQIPGSLSFVPSVMGLIIGGEVIKDLIGFIKD"
FT   gene            636394..637074
FT                   /locus_tag="Ccel_0551"
FT   CDS_pept        636394..637074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74933"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR033756"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P1"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0869"
FT                   /protein_id="ACL74933.1"
FT                   /translation="MFDKRINIFTGHFGSGKTEVAVNYAMKMSEAGYRTAIVDFDIINP
FT                   YFRTADAKDTLEEQSIKVILPMYANTNVDIPAIPPEIYSLFEDKDIKVVLDVGGDDLGA
FT                   KAVSRFKEEIISDDYEMFFVINTKRIMTDSPEKIIEMIALIEEGANIKVTKLLNNSNLL
FT                   EETTPEIILEGNRIISQVSKKSGIPIAITAGMEEVVNSIKKSEIATTEILTMRKQIHLP
FT                   WNRG"
FT   gene            637082..638749
FT                   /locus_tag="Ccel_0552"
FT   CDS_pept        637082..638749
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0552"
FT                   /product="DNA mismatch repair protein MutS domain protein"
FT                   /note="PFAM: DNA mismatch repair protein MutS domain
FT                   protein; KEGG: cpy:Cphy_2383 DNA mismatch repair protein
FT                   MutS domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74934"
FT                   /db_xref="GOA:B8I6P2"
FT                   /db_xref="InterPro:IPR000432"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036187"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P2"
FT                   /inference="protein motif:PFAM:PF00488"
FT                   /protein_id="ACL74934.1"
FT                   /translation="MKFFYIILAITAGCIILSIIGKISRTNKNRKQIRAQWGKAPVTKY
FT                   TADIYNSVRNYFDNNKDQGESFFIDDITWNDLDMNRIFSRLNITCTDVGEEYLYNILRE
FT                   LLYDQNELTERDRLIEYFRTNPSQREKIQLILSGLGKLRYLSISEYINGKRSGGGIKSI
FT                   YYKILSLIFIASIFATIFYPGAIAIFLISLAVNVVVYFKARDQIVGHLQSLGYIVNMLG
FT                   ISRRISKLNIKELNTYLNELKKCTAKVKGISVNAFYFLFYTSENYLFELIKIFLLGEPI
FT                   AFHSIFKIVNKYRHEIDSVYRTIGLLDSLISVASYRESLDYFTTPVLTKDNINNKKIEF
FT                   TDMYHPLIKNPVTNSFSVTGGALITGSNASGKSTFLKSVAINAIFAQTIFTCLAKDYYS
FT                   SYFNIYSSMALSDNLEMNESYYIVEIKSLKRILKGLNDHVPCFCVIDEVLRGTNTIERI
FT                   AASSEIMNFITDNNCICLCASHDIELTQILADKVENYHFQEFFEDDNIKFDYKIYPGKS
FT                   TTRNAIKLLKILGYDESIVDNAEQRACQFNQNGYWSKV"
FT   gene            638880..639086
FT                   /locus_tag="Ccel_0553"
FT   CDS_pept        638880..639086
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0553"
FT                   /product="4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein"
FT                   /note="PFAM: 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; KEGG: cth:Cthe_0867 2-oxoglutarate ferredoxin
FT                   oxidoreductase, delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74935"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P3"
FT                   /inference="protein motif:PFAM:PF00037"
FT                   /protein_id="ACL74935.1"
FT                   /translation="MAKVIFHEERCKGCKLCVTVCPKKIVIMKSDKLNQKGFHPAGVEE
FT                   VDKCIGCAFCATICPDCVIEVEK"
FT   gene            639165..640223
FT                   /locus_tag="Ccel_0554"
FT   CDS_pept        639165..640223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0554"
FT                   /product="pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein"
FT                   /note="PFAM: pyruvate flavodoxin/ferredoxin oxidoreductase
FT                   domain protein; Transketolase domain protein; KEGG:
FT                   cth:Cthe_0866 pyruvate flavodoxin/ferredoxin
FT                   oxidoreductase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74936"
FT                   /db_xref="GOA:B8I6P4"
FT                   /db_xref="InterPro:IPR002880"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="InterPro:IPR033412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P4"
FT                   /inference="protein motif:PFAM:PF01855"
FT                   /protein_id="ACL74936.1"
FT                   /translation="MAEKLLMKGNEVIAEAALRAGCRHYFGYPITPQTEVAHYMAKAMP
FT                   KINGTFVQAESEVAAINMVYGAAAAGARVLTSSSSPGVSLKQEGISYIAGAELPAVLVN
FT                   IVRCGPGLGGILPAQCDYFQSVKGGGHGDYKNVVLAPSSVQELYELTVEAFNISDKYRI
FT                   LTIILGDGMLGQMMEAVEFKDKEDIYQDDKKWACTGTKMERESNDVTSIYIQPEVLENH
FT                   NLKLQAKYKKIEENETRVETYNCENADIIVTAYGTVARIVKNVIKMAEKEGIKVGLIRP
FT                   ISLWPFPTAAFEKYAETPKAFLSVELSAGQMVEDVRLAVNGKRPVHFYGRMGGMIPSQK
FT                   EVLDKIKEILNK"
FT   gene            640244..640990
FT                   /locus_tag="Ccel_0555"
FT   CDS_pept        640244..640990
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0555"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; KEGG: cth:Cthe_0865 3-methyl-2-oxobutanoate
FT                   dehydrogenase (ferredoxin)"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74937"
FT                   /db_xref="GOA:B8I6P5"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P5"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACL74937.1"
FT                   /translation="MATVFKKPHALKDLSLHYCPGCTHGIIHRIVAEVIDELGIEGTTI
FT                   GVSPVGCAYNNYEYFHVDMVQAAHGRAPAVATGIKRVHPDNYVFTYQGDGDLAAIGTAE
FT                   IIHAATRGEKITTVFVNNAIYGMTSGQMAPTTLMNQVTTTSPYGRKPEIHGFPIKVCEL
FT                   LSQLEGAVYVERTSVHDVKNIKNTKEAIKKAFQVQKANKGFSIVEVLSTCPTNWGLNPV
FT                   DSLKWLENNMLPFYPLGNFKGKDLEV"
FT   gene            640993..641526
FT                   /locus_tag="Ccel_0556"
FT   CDS_pept        640993..641526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0556"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: cth:Cthe_0864 2-oxoglutarate ferredoxin
FT                   oxidoreductase, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74938"
FT                   /db_xref="GOA:B8I6P6"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P6"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACL74938.1"
FT                   /translation="MKQLELIIAGFGGQGILSAGRLLAYAGMLEGKNVSWLPSYGPEMR
FT                   GGTANCSVVISDEPVGSPILDTTNVLVVMNGPSLEKFEKSVVSGGLIISDSSLVEAKPK
FT                   RTDIEFIGIPATQLASDMGNLTFANIIILGKLLAKTGIVSKESFEAALKKVLSPKKHHM
FT                   IPDEMKALVMGHDY"
FT   gene            641686..642363
FT                   /locus_tag="Ccel_0557"
FT   CDS_pept        641686..642363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0557"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: ckl:CKL_3392 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74939"
FT                   /db_xref="GOA:B8I6P7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I6P7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL74939.1"
FT                   /translation="MSILKTDGLRKYYGKGENLVKALDGINLEILEGEFVAVVGTSGSG
FT                   KSTLLHMLGGLDKATEGKVTVAGKEFFDMNDEQKTVFRRRNIGFIFQNYNLVPILNVYE
FT                   NITLPVELDGGTIDKAFIDDIIKTLGLGGKLTNLPNNLSGGQQQRVAIARALATKPAII
FT                   LADEPTGNLDSKTGLEVVGLLKMTSKRFHQTIVMITHNEEIAQLADRVIRIEDGKIVGG
FT                   EDK"
FT   gene            642360..644855
FT                   /locus_tag="Ccel_0558"
FT   CDS_pept        642360..644855
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0558"
FT                   /product="protein of unknown function DUF214"
FT                   /note="PFAM: protein of unknown function DUF214; KEGG:
FT                   ckl:CKL_3391 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0558"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74940"
FT                   /db_xref="GOA:B8I716"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="UniProtKB/TrEMBL:B8I716"
FT                   /inference="protein motif:PFAM:PF02687"
FT                   /protein_id="ACL74940.1"
FT                   /translation="MMFPTDNRLVIKKITVRTIKANKVRNIFVITAIALTAFLLSTIFS
FT                   IGISGTESIQLQKIRTMGTIEHGGLTFPTDEQIKKLKSLDYIEDVGIMAHAGDIIETPD
FT                   MGNLSLSLFWFDKTEWEKLRVPAMNNIKGKYPQEYNEIMVSDWILKRIGITNPKIGMDI
FT                   PIKYGKVGGTDSEATNENFKLSAYYTEYSNLRSGNAGMLYVSKAFLDKNGVTPENSGTA
FT                   TIRFKSQKNIGEQFEKLSREVTASPNQKWKMVPLYETVNGDRLSTIIGLSALILFIMLS
FT                   SYLLIYNVLYISVSKDVRFYGLLKTVGTTPKQIRAIVTGQAMRLTALGIPLGLALGAAV
FT                   SFVAVPFALSGATIDTGIKISFNPIIYVGAAVFSLVTTLISSIKPAGMAATISPIEAVR
FT                   YTGTDVSRKLRKVSKVGKVQKMAFRNVFRNRRRAAVVFLSLFMGITTFILVNTLVLSMD
FT                   TENYVNSYIDNDFTLTNNTFFQNGTGIKQKFDNDFMSTFKRIEGITEIRKVSQKIVTLK
FT                   YDDNLYKEHLEEFGKRHNTQMPTGDEIEKNPRFFWSNLVGLDMEYIKKLNKTLGEPIDV
FT                   EAFEAGRIALFSTNNPKHFKVGSDIVFTADEKEYSLKLGGFLPERTAFNGGMGPAPLVY
FT                   ISNDYMKKLFNNPVFCSVTMNAEVDKEAHVLKQLKELTANDNEISLDSRLETLEQFRSS
FT                   KTMLYILGGGMSLILALIGILNFVNVMVTGVNTRRHEFAVLESIGMTPRQLKRMLSLEG
FT                   LIYAIISCGLVATLGAALNIWVFSLFKKQADYAIFTFPTIPLVLSVVIVFAVCILVPVA
FT                   AYVTTTKDTVTERLRSVEG"
FT   sig_peptide     642360..642512
FT                   /locus_tag="Ccel_0558"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.951) with cleavage site probability 0.388 at
FT                   residue 51"
FT   gene            644903..645589
FT                   /locus_tag="Ccel_0559"
FT   CDS_pept        644903..645589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0559"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: cdf:CD1957 two-component
FT                   response regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74941"
FT                   /db_xref="GOA:B8I717"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8I717"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL74941.1"
FT                   /translation="MARILIVEDDKLLNEGISIVLKKHGHTVLSGYSYNEALCLFLNNN
FT                   FELILLDINLPDRSGLELCNEIRKKSDVPIIFITANDTEQDIVNGFVNGCDDYIAKPFS
FT                   LEVMNRRIQAVLRRTGTEDKSIFRSGEISINYEKMVVSKGKISLKLTATEYKLLTLLTQ
FT                   NSGQVLTRDIILQRLWGTDEAFVDENAVSVNMRRLRQKIEDDPKNPKYIKTVFGIGYTW
FT                   GEESCR"
FT   gene            645589..646614
FT                   /locus_tag="Ccel_0560"
FT   CDS_pept        645589..646614
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0560"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG:
FT                   spj:MGAS2096_Spy1107 two-component system histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74942"
FT                   /db_xref="GOA:B8I718"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8I718"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL74942.1"
FT                   /translation="MKEIKKSEVALIAVIYGLCIGFMVYQLMVAKNFQAVIISIVFTAV
FT                   IAVLIAVLISMLHRYMQSVMVRLSDMVASLIDMRETEVFSVLNDDLLSKLQSQVLKLLR
FT                   ILKSQNTKLHNEKNEIKSLISDISHQLKNPLANLNIYVSLIKEEDIAPAMRKEYLKNIE
FT                   NQLEKLNWLMESMIKMTRLESGIIRLNREMSSLNDVLLTSLKQIYQKALKKNIDIVFIP
FT                   SEKDIKMSIDIRWTAEAITNILDNSVKYTQESGKIKIQVHKYELFARIDIEDNGAGFDE
FT                   KEVNDIFKRFYRGKNSNWIDGVGIGLYLTRRIISMQDGYIKAKSILGKGSTFSVFLPLE
FT                   S"
FT   gene            complement(646686..648779)
FT                   /locus_tag="Ccel_0561"
FT   CDS_pept        complement(646686..648779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0561"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   tpd:Teth39_1666 glutamine synthetase, catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74943"
FT                   /db_xref="GOA:B8I719"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR022147"
FT                   /db_xref="InterPro:IPR027303"
FT                   /db_xref="InterPro:IPR040577"
FT                   /db_xref="UniProtKB/TrEMBL:B8I719"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ACL74943.1"
FT                   /translation="MNLISQIFGSNVYNDSVMRERLPKATYKALKKTIDEGLPLDFEIA
FT                   DVVASSMKDWAIEKGATHYTHWFQPMTGITAEKHDSFINATADGKAILEFSGRELIKGE
FT                   ADGSSFPSGGLRVTFEARGYTAWDCTSPAFIKNNTLYIPTAFCSYTGETLDKKTPLLRS
FT                   IECLSKNAVRVLKLFGNENVTKATPTVGAEQEYFLIDKKMYDKRKDLIFTGRTLFGSKA
FT                   PKGQEMDDHYYGSIKARVSSFMKDLDRELWKLGIFAKTEHNEVAPAQHELAPIFTTSNI
FT                   ATDHNQLIMELLKTVALKHGLVCLLHEKPFAGVNGSGKHNNWSLSTNDGQNLFDPGKTP
FT                   HENVQFLLFLCAVIKAVDEYADLIRLSGANPGNDHRLGTSEAPPSIISIFLGDELTKIL
FT                   EQIVSGENIETNCLEKLMVGVKTLPELRKDTTDRNRTSPFAFTGNKFEFRMVGSSASIA
FT                   SANFFLNTAVADVLEQFADRLEKAKDFSKEVNSIIKDVVKENGRIIFNGNGYSDEWVKE
FT                   AERRGLPNIKSYVEAIACLLKEKNIAVMEKQKVFSRVEMHSRYEISLEKYIKTINIEAM
FT                   TMLEISKRQLLPACIKFETEIARSINEIKNCGVEVDISANTDLLKETASLVSQFKKEIS
FT                   LLENSLSKAQHSFEDTFEQAMFYRQDVFARMETLRTVVDELECIVASSIWPIPTYADIL
FT                   FNI"
FT   gene            649040..650236
FT                   /locus_tag="Ccel_0562"
FT   CDS_pept        649040..650236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0562"
FT                   /product="transglutaminase domain protein"
FT                   /note="PFAM: transglutaminase domain protein; KEGG:
FT                   cno:NT01CX_1704 transglutaminase-like enzyme, putative
FT                   cysteine protease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74944"
FT                   /db_xref="GOA:B8I720"
FT                   /db_xref="InterPro:IPR002931"
FT                   /db_xref="InterPro:IPR038765"
FT                   /db_xref="UniProtKB/TrEMBL:B8I720"
FT                   /inference="protein motif:PFAM:PF01841"
FT                   /protein_id="ACL74944.1"
FT                   /translation="MINILTNPVNLILILPVLVTLLSSLITKYNRERVIKSFYSIINNI
FT                   ELITGLLIALFLTKGILFDNNYRLFIYIRNHMPETVKASLEANNIYTYLCVAFIVLLIV
FT                   VLIIKAVMYPLYKHVFGTMAQGIYKVMSSMSSVTRRIIAFVCSIPKAAVSLICISFVLY
FT                   FFSYYFTVPGLSMWIDDSAVLRGVYKTALKPVVESDIAKKIPVIINDRFVSPTMNGQEV
FT                   EIAENIRDTLDSYNIKVIQYFNGVTLDDAVKSNDEIDKLALELTKGKTGDYEKAKAIYK
FT                   WITKNIKYDYPKAKQIAVKTEGTKSGSIICYETRKGICFDYSSLFISMCRANGIKVRLV
FT                   TGLGYSGLAWGDHAWNQFYDNAQKKWVNVDCTFGVSGNYFDSAKFSLDHKGDRVQEEW"
FT   gene            complement(650240..650560)
FT                   /locus_tag="Ccel_0563"
FT   CDS_pept        complement(650240..650560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0563"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: cth:Cthe_0862 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74945"
FT                   /db_xref="InterPro:IPR024307"
FT                   /db_xref="UniProtKB/TrEMBL:B8I721"
FT                   /inference="similar to AA sequence:KEGG:Cthe_0862"
FT                   /protein_id="ACL74945.1"
FT                   /translation="MVNHYHFYKFNCLTGEKHSHRLTGYTEYMFGIGLFHFHIYFGTTS
FT                   FNGHWHMYSGITGLSVKTSHGHKHKIAGRLNIVNSHCHYYENYTHENIEYKGGKTLKRV
FT                   LS"
FT   gene            650712..650975
FT                   /locus_tag="Ccel_0564"
FT   CDS_pept        650712..650975
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74946"
FT                   /db_xref="GOA:B8I722"
FT                   /db_xref="UniProtKB/TrEMBL:B8I722"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74946.1"
FT                   /translation="MEPIIAIVLLVANIPVYKKILRIIFRDQEDVNDSIKYSFTPDLFS
FT                   FFKGNYWKDKIGEAKITAFIFCCVSVVVIELLIIKWIIAIIV"
FT   gene            651027..652220
FT                   /locus_tag="Ccel_0565"
FT   CDS_pept        651027..652220
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0565"
FT                   /product="peptidase M24"
FT                   /note="PFAM: peptidase M24; KEGG: pca:Pcar_2614 Xaa-Pro
FT                   aminopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74947"
FT                   /db_xref="GOA:B8I723"
FT                   /db_xref="InterPro:IPR000587"
FT                   /db_xref="InterPro:IPR000994"
FT                   /db_xref="InterPro:IPR029149"
FT                   /db_xref="InterPro:IPR036005"
FT                   /db_xref="UniProtKB/TrEMBL:B8I723"
FT                   /inference="protein motif:PFAM:PF00557"
FT                   /protein_id="ACL74947.1"
FT                   /translation="MREILNREELKNRVKRLCAIATDKYPDWDAILIIGRINQYYLTGT
FT                   MQDGLIIIKRNGTLMYFARRSYERAKKESPISECIYPMGKYSDAAEICGKQLGNVLMDT
FT                   DIATIEVLDRLKVHFKINEIYPIKKILSEVRSIKSPYELEAVKDAGKRHQYLLEEVVPN
FT                   LLREGMSEVELSAELFEKMLKLGHNGVSRFNSFQTEMVIGQIAFGANSLYPTNFDGPGG
FT                   MKGLNSAVPLFGSHNALLKKGDLVFIDVAFCMEGYHSDRTQVYMFGSKPSDEILKTHRK
FT                   CVEIQKRTAALLKPNSIPSDIYSSIMSSLDSEFIENFMGFGERRVSFLGHGVGLYVDEL
FT                   PVIAKGFDKPIKENMVFALEPKKGISQVGMVGGEDTYIITPDGGECITGGGKDIISV"
FT   gene            652235..652739
FT                   /pseudo
FT                   /locus_tag="Ccel_0566"
FT   gene            652866..653642
FT                   /locus_tag="Ccel_0567"
FT   CDS_pept        652866..653642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0567"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   cth:Cthe_0557 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74948"
FT                   /db_xref="GOA:B8I724"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="UniProtKB/TrEMBL:B8I724"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACL74948.1"
FT                   /translation="MKIRLLWAKAKNIPKKVMIIFLLISALFVSIGYTAKSAGVFNPSK
FT                   HLPIYSVETEQNAVSITFDCAWGADDIPQILDTLKKDSIKATFFMVGQWAEKFPDAVKL
FT                   MANEGHDIANHGYSHLRMSTISKEKCKSEIEMCNKKLEEISGTKINLFRPPYGDYNNTV
FT                   IDTCNEMGCYPIQWNVDSLDWRKEMSRQAILDRILKRTKPGAILLFHNDTQYTAQLLPE
FT                   IIKGLKSQGLTFLPVSQLIMKDNYYIDDQGRQQRKK"
FT   sig_peptide     652866..652973
FT                   /locus_tag="Ccel_0567"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.997) with cleavage site probability 0.626 at
FT                   residue 36"
FT   gene            complement(653689..654180)
FT                   /locus_tag="Ccel_0568"
FT   CDS_pept        complement(653689..654180)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: noc:Noc_A0010 restriction endonuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74949"
FT                   /db_xref="GOA:B8I725"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:B8I725"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL74949.1"
FT                   /translation="MMLLLYFILLISFKVFDITKDYLYKRKINELLKVIDSKEDLLYLN
FT                   FRDYMSIIVEVLKRNGYKIKSTRECGIDGSGLILNNIQFAEIWKHGLKQIVDVELAMNL
FT                   AKCMQRNSVYRGMIITLGDFKPCTRVFCHKNVIECINGDELLNMCKAVQKTKVILQPAK
FT                   "
FT   gene            654800..656440
FT                   /locus_tag="Ccel_R0018"
FT   rRNA            654800..656440
FT                   /locus_tag="Ccel_R0018"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            656638..656714
FT                   /locus_tag="Ccel_R0019"
FT                   /note="tRNA-Ile1"
FT   tRNA            656638..656714
FT                   /locus_tag="Ccel_R0019"
FT                   /product="tRNA-Ile"
FT   gene            657239..660282
FT                   /locus_tag="Ccel_R0020"
FT   rRNA            657239..660282
FT                   /locus_tag="Ccel_R0020"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            660534..660649
FT                   /locus_tag="Ccel_R0021"
FT   rRNA            660534..660649
FT                   /locus_tag="Ccel_R0021"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(661635..661710)
FT                   /locus_tag="Ccel_R0022"
FT                   /note="tRNA-Trp1"
FT   tRNA            complement(661635..661710)
FT                   /locus_tag="Ccel_R0022"
FT                   /product="tRNA-Trp"
FT   gene            661867..662598
FT                   /locus_tag="Ccel_0569"
FT   CDS_pept        661867..662598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0569"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   cth:Cthe_1076 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74950"
FT                   /db_xref="GOA:B8I726"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:B8I726"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ACL74950.1"
FT                   /translation="MKVKDNLIILFIIFAVFGMLVTVQIRSTVSMQKQSALTLDYNRLK
FT                   NQLDSRVKEGERYKAQIAELEHKKEDFLKAYPGTNSSNTLKNDLDYLKFISGLTDVTGE
FT                   GVVITLNDAENPDLESQMNYIIHDYEIYGIINDLRDAGAQAISINDERLIATSEQICAG
FT                   PTIKINNNRYAVPFEIKAIGDPDKLHSAMKNSDVVSSLIQYKKRVTVESQSNIVIPKFM
FT                   NDINGLISKLEVAENESKKEQ"
FT   gene            662576..663286
FT                   /locus_tag="Ccel_0570"
FT   CDS_pept        662576..663286
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0570"
FT                   /product="protein of unknown function DUF881"
FT                   /note="PFAM: protein of unknown function DUF881; KEGG:
FT                   cth:Cthe_1075 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74951"
FT                   /db_xref="InterPro:IPR010273"
FT                   /db_xref="UniProtKB/TrEMBL:B8I727"
FT                   /inference="protein motif:PFAM:PF05949"
FT                   /protein_id="ACL74951.1"
FT                   /translation="MKAKRSSRNISIALVCVILGLALSWQFQSIRNNAKVMTLENQKKD
FT                   DLVVKILNEQKNNENLRAKLNELQTQLSKFENARGNSDENIKLLSDEIQKLKTVAGLTK
FT                   VKGKGVIVTFSKDDALSVEDNDLLFVLNELRATDAQALAVNDQRIIDTSEVRGSGGGGY
FT                   ININGRHVLPPYVIKAIVDPDDAVNALNMVGGVFEQIKVFIDVSVQKSDNIEIPPIGEE
FT                   LIKTDKLKIVENNN"
FT   sig_peptide     662576..662650
FT                   /locus_tag="Ccel_0570"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.992) with cleavage site probability 0.689 at
FT                   residue 25"
FT   gene            663461..664390
FT                   /locus_tag="Ccel_0571"
FT   CDS_pept        663461..664390
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0571"
FT                   /product="polysaccharide deacetylase"
FT                   /note="PFAM: polysaccharide deacetylase; KEGG:
FT                   cth:Cthe_1074 polysaccharide deacetylase"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74952"
FT                   /db_xref="GOA:B8I728"
FT                   /db_xref="InterPro:IPR002509"
FT                   /db_xref="InterPro:IPR011330"
FT                   /db_xref="InterPro:IPR014235"
FT                   /db_xref="UniProtKB/TrEMBL:B8I728"
FT                   /inference="protein motif:PFAM:PF01522"
FT                   /protein_id="ACL74952.1"
FT                   /translation="MKKNKAITVLAVIVGIALIFVFFIIKKNRNPKLDSVLSDFGGVYS
FT                   VSSKNVDFSTELTGRLIEGNRLAIDRDLSDKSSYPNDKKRCWGMARQPNNQIPRADPGT
FT                   PELLSKYGAKYLGDVSKKIIYLTFDEGYENGYTGQILDTLRDNNVKAAFFITGPYLKEH
FT                   QDLVRRMVEEGHTVGNHTIHHPSLPEKNDTQIEEEVVGLDRAFSEKFGVRMNFLRPPKG
FT                   EYSERTLSITSKLGYCNLFWSFAYDDWYRDRVRGPEYTYKVVMRNLHNGEVMLLHAVSK
FT                   DNADALGMIIKGARENGYEFGNVRDLAN"
FT   gene            664421..664744
FT                   /locus_tag="Ccel_0572"
FT   CDS_pept        664421..664744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0572"
FT                   /product="sporulation protein YqfC"
FT                   /note="TIGRFAM: sporulation protein YqfC; PFAM: protein of
FT                   unknown function DUF1429; KEGG: cth:Cthe_1073 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74953"
FT                   /db_xref="InterPro:IPR022476"
FT                   /db_xref="InterPro:IPR022477"
FT                   /db_xref="UniProtKB/TrEMBL:B8I729"
FT                   /inference="protein motif:TFAM:TIGR02856"
FT                   /protein_id="ACL74953.1"
FT                   /translation="MNSAGRSKKKSKTPSEKNNKPKLREKITEMLELPKEIVLNMPKLV
FT                   MLGNGDVIIENYKGIVEYAEGFIRVNTTAGIIKLTGTDIYIKEITAENIMVYGNILSLE
FT                   FLK"
FT   gene            664778..665974
FT                   /locus_tag="Ccel_0573"
FT   CDS_pept        664778..665974
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0573"
FT                   /product="sporulation protein YqfD"
FT                   /note="TIGRFAM: sporulation protein YqfD; PFAM: putative
FT                   stage IV sporulation YqfD; KEGG: cth:Cthe_1072 putative
FT                   stage IV sporulation YqfD"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74954"
FT                   /db_xref="GOA:B8I730"
FT                   /db_xref="InterPro:IPR010690"
FT                   /db_xref="UniProtKB/TrEMBL:B8I730"
FT                   /inference="protein motif:TFAM:TIGR02876"
FT                   /protein_id="ACL74954.1"
FT                   /translation="MLVWRLWNYIIGYVIIIVEGYFLEKFINICTHRQIKLWNVKWNSS
FT                   SKLTMKISINDFRKLRPVAKKSRCRVHISKKKGLPFLIYKYKNRKAFIIGSAACIITFF
FT                   IISSFIWDVSVTGNEKVSTEIILGKLYENGIKPGAFKFSINPDNVIDNIMLGINDLSRI
FT                   SVSVRGTRVFVDVSERVKPPDLIDKKIPCNLIAAKDGVIYSIVAKEGLETVKIGDTVTK
FT                   GQLLVTGTIENVKNPEAPPLMVHSMGAVKARTWYEASNQVEQTLVKTRRTGLEKERYSV
FT                   IFFTKKINLFHRKITYNNIEHIEYKKKLSIGKNFALPVEWVVDKYYEYELIQEKLDIDR
FT                   AKQLAAEKAFKQVQDLIPQGAEMAKKNVYFTEKDDGKITATVTVECIEDIGVTQMIGG"
FT   gene            665981..666949
FT                   /locus_tag="Ccel_0574"
FT   CDS_pept        665981..666949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0574"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: cth:Cthe_1071
FT                   PhoH-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74955"
FT                   /db_xref="GOA:B8I731"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I731"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACL74955.1"
FT                   /translation="MADITEKSVEFYTIEHAMNVFGNYDENIKIIEEAFNVKVLTRGTS
FT                   IRISGHSKNVSNAETIVNKLLDIAKQGQSITRQNVLYLVGLSNEQQIDKADEILTDYVC
FT                   LTAKGKQIKYKTHGQKVYVDAMKKNDIVFGIGPAGTGKTFLAVAMAVTAFRNKEVDRII
FT                   LTRPAVEAGEKLGFLPGDLQNKVDPYLRPLYDGLYEIMGADLYMKYLERGMIEIAPLAY
FT                   MRGRTLDNSFIILDEAQNTTPEQMKMFLTRIGFNSKAVITGDITQVDLPGDKKSGLREV
FT                   TNILNGIEGISFVNLTEKDVVRHELVQKIIVAYDKYDSNKK"
FT   gene            666972..669209
FT                   /locus_tag="Ccel_0575"
FT   CDS_pept        666972..669209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0575"
FT                   /product="metal dependent phosphohydrolase"
FT                   /note="KEGG: cth:Cthe_1070 metal dependent
FT                   phosphohydrolase; TIGRFAM: metal dependent phophohydrolase;
FT                   PFAM: metal-dependent phosphohydrolase HD sub domain;
FT                   metal-dependent phosphohydrolase 7TM intracellular region;
FT                   SMART: metal-dependent phosphohydrolase HD region"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74956"
FT                   /db_xref="GOA:B8I732"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR006674"
FT                   /db_xref="InterPro:IPR006675"
FT                   /db_xref="InterPro:IPR011621"
FT                   /db_xref="InterPro:IPR011624"
FT                   /db_xref="UniProtKB/TrEMBL:B8I732"
FT                   /inference="protein motif:TFAM:TIGR00277"
FT                   /protein_id="ACL74956.1"
FT                   /translation="MIKKKKSNGRLKKITKNFAFQRAFLAIITVLIAFFIIQTGAIPKK
FT                   YRLSVGDVSTYDITAPRDLVNEVLTEKNRISARDNVEPVNREDTKAFVEVIYKKDDFFR
FT                   AVSSARESIEKNLRQLGVNSNTKDYDVYLKQVREEAINSLTEQVAKLNIPLSADQINFL
FT                   VSKVSDSELDSFEEITRQLISDSMSEEVTESNLAIHIHRLQNSYQSEQGISQELKNIGN
FT                   QLVKAILKPNRVIDQEATEKKQQEAYNNDANIVKIKKESRIISFGDVVTEDKLQLLEEL
FT                   NLLETRSKYDYLFSIGILATILFLTGLVIVFLNKYHKKIYNDRNDLLLLSLIVSIILVL
FT                   ARCLYPYYEGLVIPIFVGTMLVSILLNMELAIVINCVLTVGISIMIKGDNKFLFMGLIC
FT                   GVISAFLVTKASQRSKLSMNGILLGLINVVLIVALNFIHKSDVQTIITDSVAVFLNGLI
FT                   SMVLTIGFLPFLESVFNIVTPLKLLEISDPNHPLLKRLLIEAPGTYHHSLMVGNLAEIA
FT                   TEDIGGNALLSRAGAYFHDVGKLKRPDFFKENQLNENPHDRMTPNLSTLVITSHAKDGV
FT                   DIAIKYKLPTAIRDIIKQHHGTTLVAYFFHRAMKAGGDDEIKQENFRYEGPKPQTKEAA
FT                   VVMLADSVEAAVRSMTDKTEGKIEGLIRKIIKDKLDDGQLDMCQLTLADLDTIAKSFMR
FT                   VLSGYFHAREQYPEIKDALKKDIFIEEKGEYNNEKETEEKRTGGGAKLDNN"
FT   sig_peptide     666972..667097
FT                   /locus_tag="Ccel_0575"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probabilty 0.998) with cleavage site probability 0.621 at
FT                   residue 42"
FT   gene            669196..669681
FT                   /locus_tag="Ccel_0576"
FT   CDS_pept        669196..669681
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0576"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   cth:Cthe_1069 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74957"
FT                   /db_xref="GOA:B8I733"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B8I733"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACL74957.1"
FT                   /translation="MIIIENEQNKVIVDKKIESLIEKTIKLCMKSEKLDKDYEVNVLIV
FT                   DDEEIRGINKEHRDTDKSTDVLSFPMVNFKDGKLISDEGDYDLEMGELILGDIIISAET
FT                   AQRQAEAYGHSFEREMAFLTAHSCFHLLGYDHMEKNEEEIMFKKQEDILIEIGLPRD"
FT   gene            669696..670070
FT                   /locus_tag="Ccel_0577"
FT   CDS_pept        669696..670070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Ccel_0577"
FT                   /product="diacylglycerol kinase"
FT                   /note="PFAM: diacylglycerol kinase; KEGG: cbt:CLH_0872
FT                   diacylglycerol kinase/PAP2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Ccel_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACL74958"
FT                   /db_xref="GOA:B8I734"
FT                   /db_xref="InterPro:IPR000829"
FT                   /db_xref="InterPro:IPR033717"
FT                   /db_xref="InterPro:IPR036945"
FT                   /db_xref="UniProtKB/TrEMBL:B8I734"
FT                   /inference="protein motif:PFAM:PF01219"
FT                   /protein_id="ACL74958.1"
FT                   /tra