(data stored in ACNUC7421 zone)

EMBL: CP001349

ID   CP001349; SV 1; circular; genomic DNA; STD; PRO; 7772460 BP.
AC   CP001349; ABIP01000000-ABIP01000162;
PR   Project:PRJNA20477;
DT   13-JAN-2009 (Rel. 99, Created)
DT   02-JAN-2014 (Rel. 119, Last updated, Version 3)
DE   Methylobacterium nodulans ORS 2060, complete genome.
KW   .
OS   Methylobacterium nodulans ORS 2060
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Methylobacteriaceae; Methylobacterium.
RN   [1]
RP   1-7772460
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Marx C.J.,
RA   Richardson P.;
RT   "Complete sequence of chromosome of Methylobacterium nodulans ORS 2060";
RL   Unpublished.
RN   [2]
RP   1-7772460
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Marx C.J.,
RA   Richardson P.;
RT   ;
RL   Submitted (06-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
DR   MD5; b91e41e01ab24f472bc47610621e1b79.
DR   BioSample; SAMN00000043.
DR   EnsemblGenomes-Gn; EBG00001172945.
DR   EnsemblGenomes-Gn; EBG00001172946.
DR   EnsemblGenomes-Gn; EBG00001172947.
DR   EnsemblGenomes-Gn; EBG00001172948.
DR   EnsemblGenomes-Gn; EBG00001172949.
DR   EnsemblGenomes-Gn; EBG00001172950.
DR   EnsemblGenomes-Gn; EBG00001172951.
DR   EnsemblGenomes-Gn; EBG00001172952.
DR   EnsemblGenomes-Gn; EBG00001172953.
DR   EnsemblGenomes-Gn; EBG00001172954.
DR   EnsemblGenomes-Gn; EBG00001172955.
DR   EnsemblGenomes-Gn; EBG00001172956.
DR   EnsemblGenomes-Gn; EBG00001172957.
DR   EnsemblGenomes-Gn; EBG00001172958.
DR   EnsemblGenomes-Gn; EBG00001172959.
DR   EnsemblGenomes-Gn; EBG00001172960.
DR   EnsemblGenomes-Gn; EBG00001172961.
DR   EnsemblGenomes-Gn; EBG00001172962.
DR   EnsemblGenomes-Gn; EBG00001172963.
DR   EnsemblGenomes-Gn; EBG00001172964.
DR   EnsemblGenomes-Gn; EBG00001172965.
DR   EnsemblGenomes-Gn; EBG00001172966.
DR   EnsemblGenomes-Gn; EBG00001172967.
DR   EnsemblGenomes-Gn; EBG00001172968.
DR   EnsemblGenomes-Gn; EBG00001172969.
DR   EnsemblGenomes-Gn; EBG00001172970.
DR   EnsemblGenomes-Gn; EBG00001172971.
DR   EnsemblGenomes-Gn; EBG00001172972.
DR   EnsemblGenomes-Gn; EBG00001172973.
DR   EnsemblGenomes-Gn; EBG00001172974.
DR   EnsemblGenomes-Gn; EBG00001172975.
DR   EnsemblGenomes-Gn; EBG00001172976.
DR   EnsemblGenomes-Gn; EBG00001172977.
DR   EnsemblGenomes-Gn; EBG00001172978.
DR   EnsemblGenomes-Gn; EBG00001172979.
DR   EnsemblGenomes-Gn; EBG00001172980.
DR   EnsemblGenomes-Gn; EBG00001172981.
DR   EnsemblGenomes-Gn; EBG00001172982.
DR   EnsemblGenomes-Gn; EBG00001172983.
DR   EnsemblGenomes-Gn; EBG00001172984.
DR   EnsemblGenomes-Gn; EBG00001172985.
DR   EnsemblGenomes-Gn; EBG00001172986.
DR   EnsemblGenomes-Gn; EBG00001172987.
DR   EnsemblGenomes-Gn; EBG00001172988.
DR   EnsemblGenomes-Gn; EBG00001172989.
DR   EnsemblGenomes-Gn; EBG00001172990.
DR   EnsemblGenomes-Gn; EBG00001172991.
DR   EnsemblGenomes-Gn; EBG00001172992.
DR   EnsemblGenomes-Gn; EBG00001172993.
DR   EnsemblGenomes-Gn; EBG00001172994.
DR   EnsemblGenomes-Gn; EBG00001172995.
DR   EnsemblGenomes-Gn; EBG00001172996.
DR   EnsemblGenomes-Gn; EBG00001172997.
DR   EnsemblGenomes-Gn; EBG00001172998.
DR   EnsemblGenomes-Gn; EBG00001172999.
DR   EnsemblGenomes-Gn; EBG00001173000.
DR   EnsemblGenomes-Gn; EBG00001173001.
DR   EnsemblGenomes-Gn; EBG00001173002.
DR   EnsemblGenomes-Gn; EBG00001173003.
DR   EnsemblGenomes-Gn; EBG00001173004.
DR   EnsemblGenomes-Gn; EBG00001173005.
DR   EnsemblGenomes-Gn; EBG00001173006.
DR   EnsemblGenomes-Gn; EBG00001173007.
DR   EnsemblGenomes-Gn; EBG00001173008.
DR   EnsemblGenomes-Gn; EBG00001173009.
DR   EnsemblGenomes-Gn; EBG00001173010.
DR   EnsemblGenomes-Gn; EBG00001173011.
DR   EnsemblGenomes-Gn; EBG00001173012.
DR   EnsemblGenomes-Gn; EBG00001173013.
DR   EnsemblGenomes-Gn; EBG00001173014.
DR   EnsemblGenomes-Gn; EBG00001173015.
DR   EnsemblGenomes-Gn; EBG00001173016.
DR   EnsemblGenomes-Gn; EBG00001173017.
DR   EnsemblGenomes-Gn; EBG00001173018.
DR   EnsemblGenomes-Gn; EBG00001173019.
DR   EnsemblGenomes-Gn; EBG00001173020.
DR   EnsemblGenomes-Gn; EBG00001173021.
DR   EnsemblGenomes-Gn; EBG00001173022.
DR   EnsemblGenomes-Gn; EBG00001173023.
DR   EnsemblGenomes-Gn; EBG00001173024.
DR   EnsemblGenomes-Gn; EBG00001173025.
DR   EnsemblGenomes-Gn; EBG00001173026.
DR   EnsemblGenomes-Gn; EBG00001173027.
DR   EnsemblGenomes-Gn; EBG00001173028.
DR   EnsemblGenomes-Gn; EBG00001173029.
DR   EnsemblGenomes-Gn; EBG00001173030.
DR   EnsemblGenomes-Gn; EBG00001173031.
DR   EnsemblGenomes-Gn; EBG00001173032.
DR   EnsemblGenomes-Gn; EBG00001173033.
DR   EnsemblGenomes-Gn; EBG00001173034.
DR   EnsemblGenomes-Gn; EBG00001173035.
DR   EnsemblGenomes-Gn; EBG00001173036.
DR   EnsemblGenomes-Gn; EBG00001173037.
DR   EnsemblGenomes-Gn; EBG00001173038.
DR   EnsemblGenomes-Gn; EBG00001173039.
DR   EnsemblGenomes-Gn; EBG00001173040.
DR   EnsemblGenomes-Gn; EBG00001173041.
DR   EnsemblGenomes-Gn; EBG00001173042.
DR   EnsemblGenomes-Gn; EBG00001173043.
DR   EnsemblGenomes-Gn; EBG00001173044.
DR   EnsemblGenomes-Gn; EBG00001173045.
DR   EnsemblGenomes-Gn; EBG00001173046.
DR   EnsemblGenomes-Gn; EBG00001173047.
DR   EnsemblGenomes-Gn; EBG00001173048.
DR   EnsemblGenomes-Gn; EBG00001173049.
DR   EnsemblGenomes-Gn; EBG00001173050.
DR   EnsemblGenomes-Gn; EBG00001173051.
DR   EnsemblGenomes-Gn; EBG00001173052.
DR   EnsemblGenomes-Gn; EBG00001173053.
DR   EnsemblGenomes-Gn; EBG00001173054.
DR   EnsemblGenomes-Gn; EBG00001173055.
DR   EnsemblGenomes-Gn; EBG00001173056.
DR   EnsemblGenomes-Gn; EBG00001173057.
DR   EnsemblGenomes-Gn; EBG00001173058.
DR   EnsemblGenomes-Gn; EBG00001173059.
DR   EnsemblGenomes-Gn; EBG00001173060.
DR   EnsemblGenomes-Gn; EBG00001173061.
DR   EnsemblGenomes-Gn; EBG00001173062.
DR   EnsemblGenomes-Gn; EBG00001173063.
DR   EnsemblGenomes-Gn; EBG00001173064.
DR   EnsemblGenomes-Gn; EBG00001173065.
DR   EnsemblGenomes-Gn; EBG00001173066.
DR   EnsemblGenomes-Gn; EBG00001173067.
DR   EnsemblGenomes-Gn; EBG00001173068.
DR   EnsemblGenomes-Gn; Mnod_R0001.
DR   EnsemblGenomes-Gn; Mnod_R0002.
DR   EnsemblGenomes-Gn; Mnod_R0003.
DR   EnsemblGenomes-Gn; Mnod_R0004.
DR   EnsemblGenomes-Gn; Mnod_R0005.
DR   EnsemblGenomes-Gn; Mnod_R0006.
DR   EnsemblGenomes-Gn; Mnod_R0007.
DR   EnsemblGenomes-Gn; Mnod_R0008.
DR   EnsemblGenomes-Gn; Mnod_R0009.
DR   EnsemblGenomes-Gn; Mnod_R0010.
DR   EnsemblGenomes-Gn; Mnod_R0011.
DR   EnsemblGenomes-Gn; Mnod_R0012.
DR   EnsemblGenomes-Gn; Mnod_R0013.
DR   EnsemblGenomes-Gn; Mnod_R0014.
DR   EnsemblGenomes-Gn; Mnod_R0015.
DR   EnsemblGenomes-Gn; Mnod_R0016.
DR   EnsemblGenomes-Gn; Mnod_R0017.
DR   EnsemblGenomes-Gn; Mnod_R0018.
DR   EnsemblGenomes-Gn; Mnod_R0019.
DR   EnsemblGenomes-Gn; Mnod_R0020.
DR   EnsemblGenomes-Gn; Mnod_R0021.
DR   EnsemblGenomes-Gn; Mnod_R0022.
DR   EnsemblGenomes-Gn; Mnod_R0023.
DR   EnsemblGenomes-Gn; Mnod_R0024.
DR   EnsemblGenomes-Gn; Mnod_R0025.
DR   EnsemblGenomes-Gn; Mnod_R0026.
DR   EnsemblGenomes-Gn; Mnod_R0027.
DR   EnsemblGenomes-Gn; Mnod_R0028.
DR   EnsemblGenomes-Gn; Mnod_R0029.
DR   EnsemblGenomes-Gn; Mnod_R0030.
DR   EnsemblGenomes-Gn; Mnod_R0031.
DR   EnsemblGenomes-Gn; Mnod_R0032.
DR   EnsemblGenomes-Gn; Mnod_R0033.
DR   EnsemblGenomes-Gn; Mnod_R0034.
DR   EnsemblGenomes-Gn; Mnod_R0035.
DR   EnsemblGenomes-Gn; Mnod_R0036.
DR   EnsemblGenomes-Gn; Mnod_R0037.
DR   EnsemblGenomes-Gn; Mnod_R0038.
DR   EnsemblGenomes-Gn; Mnod_R0039.
DR   EnsemblGenomes-Gn; Mnod_R0040.
DR   EnsemblGenomes-Gn; Mnod_R0041.
DR   EnsemblGenomes-Gn; Mnod_R0042.
DR   EnsemblGenomes-Gn; Mnod_R0043.
DR   EnsemblGenomes-Gn; Mnod_R0044.
DR   EnsemblGenomes-Gn; Mnod_R0045.
DR   EnsemblGenomes-Gn; Mnod_R0046.
DR   EnsemblGenomes-Gn; Mnod_R0047.
DR   EnsemblGenomes-Gn; Mnod_R0048.
DR   EnsemblGenomes-Gn; Mnod_R0049.
DR   EnsemblGenomes-Gn; Mnod_R0050.
DR   EnsemblGenomes-Gn; Mnod_R0051.
DR   EnsemblGenomes-Gn; Mnod_R0052.
DR   EnsemblGenomes-Gn; Mnod_R0053.
DR   EnsemblGenomes-Gn; Mnod_R0054.
DR   EnsemblGenomes-Gn; Mnod_R0055.
DR   EnsemblGenomes-Gn; Mnod_R0056.
DR   EnsemblGenomes-Gn; Mnod_R0057.
DR   EnsemblGenomes-Gn; Mnod_R0058.
DR   EnsemblGenomes-Gn; Mnod_R0059.
DR   EnsemblGenomes-Gn; Mnod_R0060.
DR   EnsemblGenomes-Gn; Mnod_R0061.
DR   EnsemblGenomes-Gn; Mnod_R0062.
DR   EnsemblGenomes-Gn; Mnod_R0063.
DR   EnsemblGenomes-Gn; Mnod_R0064.
DR   EnsemblGenomes-Gn; Mnod_R0065.
DR   EnsemblGenomes-Gn; Mnod_R0066.
DR   EnsemblGenomes-Gn; Mnod_R0067.
DR   EnsemblGenomes-Gn; Mnod_R0068.
DR   EnsemblGenomes-Gn; Mnod_R0069.
DR   EnsemblGenomes-Gn; Mnod_R0070.
DR   EnsemblGenomes-Gn; Mnod_R0071.
DR   EnsemblGenomes-Gn; Mnod_R0072.
DR   EnsemblGenomes-Gn; Mnod_R0073.
DR   EnsemblGenomes-Gn; Mnod_R0074.
DR   EnsemblGenomes-Gn; Mnod_R0075.
DR   EnsemblGenomes-Gn; Mnod_R0076.
DR   EnsemblGenomes-Gn; Mnod_R0077.
DR   EnsemblGenomes-Gn; Mnod_R0078.
DR   EnsemblGenomes-Gn; Mnod_R0079.
DR   EnsemblGenomes-Gn; Mnod_R0080.
DR   EnsemblGenomes-Gn; Mnod_R0081.
DR   EnsemblGenomes-Gn; Mnod_R0082.
DR   EnsemblGenomes-Gn; Mnod_R0083.
DR   EnsemblGenomes-Gn; Mnod_R0084.
DR   EnsemblGenomes-Gn; Mnod_R0085.
DR   EnsemblGenomes-Gn; Mnod_R0086.
DR   EnsemblGenomes-Gn; Mnod_R0087.
DR   EnsemblGenomes-Gn; Mnod_R0088.
DR   EnsemblGenomes-Gn; Mnod_R0089.
DR   EnsemblGenomes-Gn; Mnod_R0090.
DR   EnsemblGenomes-Gn; Mnod_R0091.
DR   EnsemblGenomes-Gn; Mnod_R0092.
DR   EnsemblGenomes-Gn; Mnod_R0093.
DR   EnsemblGenomes-Gn; Mnod_R0094.
DR   EnsemblGenomes-Tr; EBT00001739903.
DR   EnsemblGenomes-Tr; EBT00001739904.
DR   EnsemblGenomes-Tr; EBT00001739905.
DR   EnsemblGenomes-Tr; EBT00001739906.
DR   EnsemblGenomes-Tr; EBT00001739907.
DR   EnsemblGenomes-Tr; EBT00001739908.
DR   EnsemblGenomes-Tr; EBT00001739909.
DR   EnsemblGenomes-Tr; EBT00001739910.
DR   EnsemblGenomes-Tr; EBT00001739911.
DR   EnsemblGenomes-Tr; EBT00001739912.
DR   EnsemblGenomes-Tr; EBT00001739913.
DR   EnsemblGenomes-Tr; EBT00001739914.
DR   EnsemblGenomes-Tr; EBT00001739915.
DR   EnsemblGenomes-Tr; EBT00001739916.
DR   EnsemblGenomes-Tr; EBT00001739917.
DR   EnsemblGenomes-Tr; EBT00001739918.
DR   EnsemblGenomes-Tr; EBT00001739919.
DR   EnsemblGenomes-Tr; EBT00001739920.
DR   EnsemblGenomes-Tr; EBT00001739921.
DR   EnsemblGenomes-Tr; EBT00001739922.
DR   EnsemblGenomes-Tr; EBT00001739923.
DR   EnsemblGenomes-Tr; EBT00001739924.
DR   EnsemblGenomes-Tr; EBT00001739925.
DR   EnsemblGenomes-Tr; EBT00001739926.
DR   EnsemblGenomes-Tr; EBT00001739927.
DR   EnsemblGenomes-Tr; EBT00001739928.
DR   EnsemblGenomes-Tr; EBT00001739929.
DR   EnsemblGenomes-Tr; EBT00001739930.
DR   EnsemblGenomes-Tr; EBT00001739931.
DR   EnsemblGenomes-Tr; EBT00001739932.
DR   EnsemblGenomes-Tr; EBT00001739933.
DR   EnsemblGenomes-Tr; EBT00001739934.
DR   EnsemblGenomes-Tr; EBT00001739935.
DR   EnsemblGenomes-Tr; EBT00001739936.
DR   EnsemblGenomes-Tr; EBT00001739937.
DR   EnsemblGenomes-Tr; EBT00001739938.
DR   EnsemblGenomes-Tr; EBT00001739939.
DR   EnsemblGenomes-Tr; EBT00001739940.
DR   EnsemblGenomes-Tr; EBT00001739941.
DR   EnsemblGenomes-Tr; EBT00001739942.
DR   EnsemblGenomes-Tr; EBT00001739943.
DR   EnsemblGenomes-Tr; EBT00001739944.
DR   EnsemblGenomes-Tr; EBT00001739945.
DR   EnsemblGenomes-Tr; EBT00001739946.
DR   EnsemblGenomes-Tr; EBT00001739947.
DR   EnsemblGenomes-Tr; EBT00001739948.
DR   EnsemblGenomes-Tr; EBT00001739949.
DR   EnsemblGenomes-Tr; EBT00001739950.
DR   EnsemblGenomes-Tr; EBT00001739951.
DR   EnsemblGenomes-Tr; EBT00001739952.
DR   EnsemblGenomes-Tr; EBT00001739953.
DR   EnsemblGenomes-Tr; EBT00001739954.
DR   EnsemblGenomes-Tr; EBT00001739955.
DR   EnsemblGenomes-Tr; EBT00001739956.
DR   EnsemblGenomes-Tr; EBT00001739957.
DR   EnsemblGenomes-Tr; EBT00001739958.
DR   EnsemblGenomes-Tr; EBT00001739959.
DR   EnsemblGenomes-Tr; EBT00001739960.
DR   EnsemblGenomes-Tr; EBT00001739961.
DR   EnsemblGenomes-Tr; EBT00001739962.
DR   EnsemblGenomes-Tr; EBT00001739963.
DR   EnsemblGenomes-Tr; EBT00001739964.
DR   EnsemblGenomes-Tr; EBT00001739965.
DR   EnsemblGenomes-Tr; EBT00001739966.
DR   EnsemblGenomes-Tr; EBT00001739967.
DR   EnsemblGenomes-Tr; EBT00001739968.
DR   EnsemblGenomes-Tr; EBT00001739969.
DR   EnsemblGenomes-Tr; EBT00001739970.
DR   EnsemblGenomes-Tr; EBT00001739971.
DR   EnsemblGenomes-Tr; EBT00001739972.
DR   EnsemblGenomes-Tr; EBT00001739973.
DR   EnsemblGenomes-Tr; EBT00001739974.
DR   EnsemblGenomes-Tr; EBT00001739975.
DR   EnsemblGenomes-Tr; EBT00001739976.
DR   EnsemblGenomes-Tr; EBT00001739977.
DR   EnsemblGenomes-Tr; EBT00001739978.
DR   EnsemblGenomes-Tr; EBT00001739979.
DR   EnsemblGenomes-Tr; EBT00001739980.
DR   EnsemblGenomes-Tr; EBT00001739981.
DR   EnsemblGenomes-Tr; EBT00001739982.
DR   EnsemblGenomes-Tr; EBT00001739983.
DR   EnsemblGenomes-Tr; EBT00001739984.
DR   EnsemblGenomes-Tr; EBT00001739985.
DR   EnsemblGenomes-Tr; EBT00001739986.
DR   EnsemblGenomes-Tr; EBT00001739987.
DR   EnsemblGenomes-Tr; EBT00001739988.
DR   EnsemblGenomes-Tr; EBT00001739989.
DR   EnsemblGenomes-Tr; EBT00001739990.
DR   EnsemblGenomes-Tr; EBT00001739991.
DR   EnsemblGenomes-Tr; EBT00001739992.
DR   EnsemblGenomes-Tr; EBT00001739993.
DR   EnsemblGenomes-Tr; EBT00001739994.
DR   EnsemblGenomes-Tr; EBT00001739995.
DR   EnsemblGenomes-Tr; EBT00001739996.
DR   EnsemblGenomes-Tr; EBT00001739997.
DR   EnsemblGenomes-Tr; EBT00001739998.
DR   EnsemblGenomes-Tr; EBT00001739999.
DR   EnsemblGenomes-Tr; EBT00001740000.
DR   EnsemblGenomes-Tr; EBT00001740001.
DR   EnsemblGenomes-Tr; EBT00001740002.
DR   EnsemblGenomes-Tr; EBT00001740003.
DR   EnsemblGenomes-Tr; EBT00001740004.
DR   EnsemblGenomes-Tr; EBT00001740005.
DR   EnsemblGenomes-Tr; EBT00001740006.
DR   EnsemblGenomes-Tr; EBT00001740007.
DR   EnsemblGenomes-Tr; EBT00001740008.
DR   EnsemblGenomes-Tr; EBT00001740009.
DR   EnsemblGenomes-Tr; EBT00001740010.
DR   EnsemblGenomes-Tr; EBT00001740011.
DR   EnsemblGenomes-Tr; EBT00001740012.
DR   EnsemblGenomes-Tr; EBT00001740013.
DR   EnsemblGenomes-Tr; EBT00001740014.
DR   EnsemblGenomes-Tr; EBT00001740015.
DR   EnsemblGenomes-Tr; EBT00001740016.
DR   EnsemblGenomes-Tr; EBT00001740017.
DR   EnsemblGenomes-Tr; EBT00001740018.
DR   EnsemblGenomes-Tr; EBT00001740019.
DR   EnsemblGenomes-Tr; EBT00001740020.
DR   EnsemblGenomes-Tr; EBT00001740021.
DR   EnsemblGenomes-Tr; EBT00001740022.
DR   EnsemblGenomes-Tr; EBT00001740023.
DR   EnsemblGenomes-Tr; EBT00001740024.
DR   EnsemblGenomes-Tr; EBT00001740025.
DR   EnsemblGenomes-Tr; EBT00001740026.
DR   EnsemblGenomes-Tr; Mnod_R0001-1.
DR   EnsemblGenomes-Tr; Mnod_R0002-1.
DR   EnsemblGenomes-Tr; Mnod_R0003-1.
DR   EnsemblGenomes-Tr; Mnod_R0004-1.
DR   EnsemblGenomes-Tr; Mnod_R0005-1.
DR   EnsemblGenomes-Tr; Mnod_R0006-1.
DR   EnsemblGenomes-Tr; Mnod_R0007-1.
DR   EnsemblGenomes-Tr; Mnod_R0008-1.
DR   EnsemblGenomes-Tr; Mnod_R0009-1.
DR   EnsemblGenomes-Tr; Mnod_R0010-1.
DR   EnsemblGenomes-Tr; Mnod_R0011-1.
DR   EnsemblGenomes-Tr; Mnod_R0012-1.
DR   EnsemblGenomes-Tr; Mnod_R0013-1.
DR   EnsemblGenomes-Tr; Mnod_R0014-1.
DR   EnsemblGenomes-Tr; Mnod_R0015-1.
DR   EnsemblGenomes-Tr; Mnod_R0016-1.
DR   EnsemblGenomes-Tr; Mnod_R0017-1.
DR   EnsemblGenomes-Tr; Mnod_R0018-1.
DR   EnsemblGenomes-Tr; Mnod_R0019-1.
DR   EnsemblGenomes-Tr; Mnod_R0020-1.
DR   EnsemblGenomes-Tr; Mnod_R0021-1.
DR   EnsemblGenomes-Tr; Mnod_R0022-1.
DR   EnsemblGenomes-Tr; Mnod_R0023-1.
DR   EnsemblGenomes-Tr; Mnod_R0024-1.
DR   EnsemblGenomes-Tr; Mnod_R0025-1.
DR   EnsemblGenomes-Tr; Mnod_R0026-1.
DR   EnsemblGenomes-Tr; Mnod_R0027-1.
DR   EnsemblGenomes-Tr; Mnod_R0028-1.
DR   EnsemblGenomes-Tr; Mnod_R0029-1.
DR   EnsemblGenomes-Tr; Mnod_R0030-1.
DR   EnsemblGenomes-Tr; Mnod_R0031-1.
DR   EnsemblGenomes-Tr; Mnod_R0032-1.
DR   EnsemblGenomes-Tr; Mnod_R0033-1.
DR   EnsemblGenomes-Tr; Mnod_R0034-1.
DR   EnsemblGenomes-Tr; Mnod_R0035-1.
DR   EnsemblGenomes-Tr; Mnod_R0036-1.
DR   EnsemblGenomes-Tr; Mnod_R0037-1.
DR   EnsemblGenomes-Tr; Mnod_R0038-1.
DR   EnsemblGenomes-Tr; Mnod_R0039-1.
DR   EnsemblGenomes-Tr; Mnod_R0040-1.
DR   EnsemblGenomes-Tr; Mnod_R0041-1.
DR   EnsemblGenomes-Tr; Mnod_R0042-1.
DR   EnsemblGenomes-Tr; Mnod_R0043-1.
DR   EnsemblGenomes-Tr; Mnod_R0044-1.
DR   EnsemblGenomes-Tr; Mnod_R0045-1.
DR   EnsemblGenomes-Tr; Mnod_R0046-1.
DR   EnsemblGenomes-Tr; Mnod_R0047-1.
DR   EnsemblGenomes-Tr; Mnod_R0048-1.
DR   EnsemblGenomes-Tr; Mnod_R0049-1.
DR   EnsemblGenomes-Tr; Mnod_R0050-1.
DR   EnsemblGenomes-Tr; Mnod_R0051-1.
DR   EnsemblGenomes-Tr; Mnod_R0052-1.
DR   EnsemblGenomes-Tr; Mnod_R0053-1.
DR   EnsemblGenomes-Tr; Mnod_R0054-1.
DR   EnsemblGenomes-Tr; Mnod_R0055-1.
DR   EnsemblGenomes-Tr; Mnod_R0056-1.
DR   EnsemblGenomes-Tr; Mnod_R0057-1.
DR   EnsemblGenomes-Tr; Mnod_R0058-1.
DR   EnsemblGenomes-Tr; Mnod_R0059-1.
DR   EnsemblGenomes-Tr; Mnod_R0060-1.
DR   EnsemblGenomes-Tr; Mnod_R0061-1.
DR   EnsemblGenomes-Tr; Mnod_R0062-1.
DR   EnsemblGenomes-Tr; Mnod_R0063-1.
DR   EnsemblGenomes-Tr; Mnod_R0064-1.
DR   EnsemblGenomes-Tr; Mnod_R0065-1.
DR   EnsemblGenomes-Tr; Mnod_R0066-1.
DR   EnsemblGenomes-Tr; Mnod_R0067-1.
DR   EnsemblGenomes-Tr; Mnod_R0068-1.
DR   EnsemblGenomes-Tr; Mnod_R0069-1.
DR   EnsemblGenomes-Tr; Mnod_R0070-1.
DR   EnsemblGenomes-Tr; Mnod_R0071-1.
DR   EnsemblGenomes-Tr; Mnod_R0072-1.
DR   EnsemblGenomes-Tr; Mnod_R0073-1.
DR   EnsemblGenomes-Tr; Mnod_R0074-1.
DR   EnsemblGenomes-Tr; Mnod_R0075-1.
DR   EnsemblGenomes-Tr; Mnod_R0076-1.
DR   EnsemblGenomes-Tr; Mnod_R0077-1.
DR   EnsemblGenomes-Tr; Mnod_R0078-1.
DR   EnsemblGenomes-Tr; Mnod_R0079-1.
DR   EnsemblGenomes-Tr; Mnod_R0080-1.
DR   EnsemblGenomes-Tr; Mnod_R0081-1.
DR   EnsemblGenomes-Tr; Mnod_R0082-1.
DR   EnsemblGenomes-Tr; Mnod_R0083-1.
DR   EnsemblGenomes-Tr; Mnod_R0084-1.
DR   EnsemblGenomes-Tr; Mnod_R0085-1.
DR   EnsemblGenomes-Tr; Mnod_R0086-1.
DR   EnsemblGenomes-Tr; Mnod_R0087-1.
DR   EnsemblGenomes-Tr; Mnod_R0088-1.
DR   EnsemblGenomes-Tr; Mnod_R0089-1.
DR   EnsemblGenomes-Tr; Mnod_R0090-1.
DR   EnsemblGenomes-Tr; Mnod_R0091-1.
DR   EnsemblGenomes-Tr; Mnod_R0092-1.
DR   EnsemblGenomes-Tr; Mnod_R0093-1.
DR   EnsemblGenomes-Tr; Mnod_R0094-1.
DR   EuropePMC; PMC4161386; 25211235.
DR   RFAM; RF00001; 5S_rRNA.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00010; RNaseP_bact_a.
DR   RFAM; RF00013; 6S.
DR   RFAM; RF00059; TPP.
DR   RFAM; RF00169; Bacteria_small_SRP.
DR   RFAM; RF00174; Cobalamin.
DR   RFAM; RF00177; SSU_rRNA_bacteria.
DR   RFAM; RF00435; ROSE.
DR   RFAM; RF00504; Glycine.
DR   RFAM; RF00517; serC.
DR   RFAM; RF00518; speF.
DR   RFAM; RF00519; suhB.
DR   RFAM; RF01118; PK-G12rRNA.
DR   RFAM; RF01793; ffh.
DR   RFAM; RF01849; alpha_tmRNA.
DR   RFAM; RF01850; beta_tmRNA.
DR   RFAM; RF01867; CC2171.
DR   RFAM; RF01959; SSU_rRNA_archaea.
DR   SILVA-LSU; CP001349.
DR   SILVA-SSU; CP001349.
DR   StrainInfo; 72740; 1.
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003783
CC   Source DNA and bacteria available from Christopher J. Marx
CC   (cmarx@oeb.harvard.edu)
CC   Contacts: Christopher J. Marx (cmarx@oeb.harvard.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
FH   Key             Location/Qualifiers
FT   source          1..7772460
FT                   /organism="Methylobacterium nodulans ORS 2060"
FT                   /strain="ORS 2060"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:460265"
FT   gene            1..1500
FT                   /locus_tag="Mnod_0001"
FT   CDS_pept        1..1500
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0001"
FT                   /product="chromosomal replication initiator protein DnaA"
FT                   /note="KEGG: met:M446_0001 chromosomal replication
FT                   initiator protein DnaA; TIGRFAM: chromosomal replication
FT                   initiator protein DnaA; PFAM: Chromosomal replication
FT                   initiator DnaA domain; Chromosomal replication initiator
FT                   DnaA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0001"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55053"
FT                   /db_xref="GOA:B8ISZ1"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ1"
FT                   /inference="protein motif:TFAM:TIGR00362"
FT                   /protein_id="ACL55053.1"
FT   gene            1663..2784
FT                   /locus_tag="Mnod_0002"
FT   CDS_pept        1663..2784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0002"
FT                   /product="DNA polymerase III, beta subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: DNA polymerase III, beta subunit; PFAM: DNA
FT                   polymerase III beta chain; KEGG: met:M446_0002 DNA
FT                   polymerase III, beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0002"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55054"
FT                   /db_xref="GOA:B8ISZ2"
FT                   /db_xref="InterPro:IPR001001"
FT                   /db_xref="InterPro:IPR022634"
FT                   /db_xref="InterPro:IPR022635"
FT                   /db_xref="InterPro:IPR022637"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ2"
FT                   /inference="protein motif:TFAM:TIGR00663"
FT                   /protein_id="ACL55054.1"
FT   gene            2901..4049
FT                   /locus_tag="Mnod_0003"
FT   CDS_pept        2901..4049
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /note="TIGRFAM: DNA replication and repair protein RecF;
FT                   PFAM: SMC domain protein; KEGG: met:M446_0003 DNA
FT                   replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55055"
FT                   /db_xref="GOA:B8ISZ3"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ3"
FT                   /inference="protein motif:TFAM:TIGR00611"
FT                   /protein_id="ACL55055.1"
FT   gene            complement(4346..4590)
FT                   /pseudo
FT                   /locus_tag="Mnod_0004"
FT   gene            4708..6558
FT                   /locus_tag="Mnod_0005"
FT   CDS_pept        4708..6558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0005"
FT                   /product="ATP-dependent DNA helicase RecQ"
FT                   /note="KEGG: met:M446_0004 ATP-dependent DNA helicase RecQ;
FT                   TIGRFAM: ATP-dependent DNA helicase, RecQ family;
FT                   ATP-dependent DNA helicase RecQ; PFAM: helicase domain
FT                   protein; HRDC domain protein; DEAD/DEAH box helicase domain
FT                   protein; Helicase superfamily 1 and 2 ATP-binding; SMART:
FT                   DEAD-like helicases"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0005"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55056"
FT                   /db_xref="GOA:B8ISZ4"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR002121"
FT                   /db_xref="InterPro:IPR004589"
FT                   /db_xref="InterPro:IPR006293"
FT                   /db_xref="InterPro:IPR010997"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR018982"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ4"
FT                   /inference="protein motif:TFAM:TIGR01389"
FT                   /protein_id="ACL55056.1"
FT   gene            6770..8899
FT                   /locus_tag="Mnod_0006"
FT   CDS_pept        6770..8899
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0006"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: spe:Spro_1016 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0006"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55057"
FT                   /db_xref="GOA:B8ISZ5"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ5"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACL55057.1"
FT                   VGEPFQVLASARVSF"
FT   sig_peptide     6770..6841
FT                   /locus_tag="Mnod_0006"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.789 at
FT                   residue 24"
FT   gene            8901..10046
FT                   /locus_tag="Mnod_0007"
FT   CDS_pept        8901..10046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0007"
FT                   /product="PepSY-associated TM helix domain protein"
FT                   /note="PFAM: PepSY-associated TM helix domain protein;
FT                   KEGG: rpb:RPB_4238 PepSY-associated TM helix"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0007"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55058"
FT                   /db_xref="GOA:B8ISZ6"
FT                   /db_xref="InterPro:IPR005625"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ6"
FT                   /inference="protein motif:PFAM:PF03929"
FT                   /protein_id="ACL55058.1"
FT   sig_peptide     8901..9005
FT                   /locus_tag="Mnod_0007"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.303 at
FT                   residue 35"
FT   gene            10128..12341
FT                   /locus_tag="Mnod_0008"
FT   CDS_pept        10128..12341
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0008"
FT                   /product="phosphoribosylformylglycinamidine synthase II"
FT                   /EC_number=""
FT                   /note="TIGRFAM: phosphoribosylformylglycinamidine synthase
FT                   II; PFAM: AIR synthase related protein; AIR synthase
FT                   related protein domain protein; KEGG: met:M446_0005
FT                   phosphoribosylformylglycinamidine synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0008"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55059"
FT                   /db_xref="GOA:B8ISZ7"
FT                   /db_xref="InterPro:IPR010074"
FT                   /db_xref="InterPro:IPR010918"
FT                   /db_xref="InterPro:IPR016188"
FT                   /db_xref="InterPro:IPR036676"
FT                   /db_xref="InterPro:IPR036921"
FT                   /db_xref="InterPro:IPR041609"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ7"
FT                   /inference="protein motif:TFAM:TIGR01736"
FT                   /protein_id="ACL55059.1"
FT   gene            12368..12604
FT                   /locus_tag="Mnod_0009"
FT   CDS_pept        12368..12604
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0009"
FT                   /product="BolA family protein"
FT                   /note="PFAM: BolA family protein; KEGG: met:M446_0006 BolA
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0009"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55060"
FT                   /db_xref="InterPro:IPR002634"
FT                   /db_xref="InterPro:IPR036065"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ8"
FT                   /inference="protein motif:PFAM:PF01722"
FT                   /protein_id="ACL55060.1"
FT   gene            12622..13137
FT                   /locus_tag="Mnod_0010"
FT   CDS_pept        12622..13137
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0010"
FT                   /product="protein of unknown function DUF29"
FT                   /note="PFAM: protein of unknown function DUF29; KEGG:
FT                   mrd:Mrad2831_1125 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0010"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55061"
FT                   /db_xref="InterPro:IPR002636"
FT                   /db_xref="UniProtKB/TrEMBL:B8ISZ9"
FT                   /inference="protein motif:PFAM:PF01724"
FT                   /protein_id="ACL55061.1"
FT                   TGGRRRPT"
FT   gene            13151..13489
FT                   /locus_tag="Mnod_0011"
FT   CDS_pept        13151..13489
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0011"
FT                   /product="glutaredoxin-like protein"
FT                   /note="TIGRFAM: glutaredoxin-like protein; PFAM:
FT                   glutaredoxin; KEGG: met:M446_0007 glutaredoxin-like
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0011"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55062"
FT                   /db_xref="GOA:B8IT00"
FT                   /db_xref="InterPro:IPR002109"
FT                   /db_xref="InterPro:IPR004480"
FT                   /db_xref="InterPro:IPR014434"
FT                   /db_xref="InterPro:IPR033658"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT00"
FT                   /inference="protein motif:TFAM:TIGR00365"
FT                   /protein_id="ACL55062.1"
FT                   IAVKTAAA"
FT   gene            13608..14507
FT                   /locus_tag="Mnod_0012"
FT   CDS_pept        13608..14507
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0012"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD dependent oxidoreductase; FAD-dependent
FT                   pyridine nucleotide-disulphide oxidoreductase; KEGG:
FT                   met:M446_0008 FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0012"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55063"
FT                   /db_xref="GOA:B8IT01"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT01"
FT                   /inference="protein motif:PFAM:PF07992"
FT                   /protein_id="ACL55063.1"
FT                   GAMAAFAINTELLQEDTR"
FT   gene            14708..14893
FT                   /locus_tag="Mnod_0013"
FT   CDS_pept        14708..14893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0013"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0013"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55064"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT02"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55064.1"
FT                   ARELIRMAQSARIHRN"
FT   gene            15480..15659
FT                   /locus_tag="Mnod_0014"
FT   CDS_pept        15480..15659
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0014"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0014"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55065"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT03"
FT                   /inference="similar to AA sequence:KEGG:M446_0009"
FT                   /protein_id="ACL55065.1"
FT                   AAAKPADAKSDEAA"
FT   gene            complement(15663..16535)
FT                   /locus_tag="Mnod_0015"
FT   CDS_pept        complement(15663..16535)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0015"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0015"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55066"
FT                   /db_xref="GOA:B8IT04"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT04"
FT                   /inference="similar to AA sequence:KEGG:M446_0010"
FT                   /protein_id="ACL55066.1"
FT                   RGLITSQLW"
FT   gene            complement(16640..18697)
FT                   /locus_tag="Mnod_0016"
FT   CDS_pept        complement(16640..18697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0016"
FT                   /product="peptidase M3A and M3B thimet/oligopeptidase F"
FT                   /EC_number=""
FT                   /note="PFAM: peptidase M3A and M3B thimet/oligopeptidase F;
FT                   KEGG: met:M446_0011 peptidyl-dipeptidase DCP"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0016"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55067"
FT                   /db_xref="GOA:B8IT05"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR024077"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT05"
FT                   /inference="protein motif:PFAM:PF01432"
FT                   /protein_id="ACL55067.1"
FT   gene            18830..19576
FT                   /locus_tag="Mnod_0017"
FT   CDS_pept        18830..19576
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0017"
FT                   /product="Extensin family protein"
FT                   /note="PFAM: Extensin family protein; KEGG: met:M446_0012
FT                   extensin family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0017"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55068"
FT                   /db_xref="InterPro:IPR009683"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT06"
FT                   /inference="protein motif:PFAM:PF06904"
FT                   /protein_id="ACL55068.1"
FT   sig_peptide     18830..18892
FT                   /locus_tag="Mnod_0017"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            19635..20654
FT                   /locus_tag="Mnod_0018"
FT   CDS_pept        19635..20654
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0018"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: met:M446_0013
FT                   ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0018"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55069"
FT                   /db_xref="GOA:B8IT07"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT07"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55069.1"
FT   sig_peptide     19635..19697
FT                   /locus_tag="Mnod_0018"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.890 at
FT                   residue 21"
FT   gene            complement(20817..21560)
FT                   /locus_tag="Mnod_0019"
FT   CDS_pept        complement(20817..21560)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0019"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0016
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0019"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55070"
FT                   /db_xref="GOA:B8IT08"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT08"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55070.1"
FT   sig_peptide     complement(21477..21560)
FT                   /locus_tag="Mnod_0019"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.896 at
FT                   residue 28"
FT   gene            complement(21557..22696)
FT                   /locus_tag="Mnod_0020"
FT   CDS_pept        complement(21557..22696)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0020"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0017
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0020"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55071"
FT                   /db_xref="GOA:B8IT09"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT09"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55071.1"
FT   sig_peptide     complement(22622..22696)
FT                   /locus_tag="Mnod_0020"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.897 at
FT                   residue 25"
FT   gene            complement(22760..23692)
FT                   /locus_tag="Mnod_0021"
FT   CDS_pept        complement(22760..23692)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0021"
FT                   /product="Substrate-binding region of ABC-type glycine
FT                   betaine transport system"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; KEGG: met:M446_0018
FT                   substrate-binding region of ABC-type glycine betaine
FT                   transport system"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0021"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55072"
FT                   /db_xref="GOA:B8IT10"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT10"
FT                   /inference="protein motif:PFAM:PF04069"
FT                   /protein_id="ACL55072.1"
FT   sig_peptide     complement(23585..23692)
FT                   /locus_tag="Mnod_0021"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.986 at
FT                   residue 36"
FT   gene            23879..24307
FT                   /locus_tag="Mnod_0022"
FT   CDS_pept        23879..24307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0022"
FT                   /product="response regulator receiver and SARP domain
FT                   protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_0019 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0022"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55073"
FT                   /db_xref="GOA:B8IT11"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT11"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55073.1"
FT   gene            complement(24264..24503)
FT                   /locus_tag="Mnod_0023"
FT   CDS_pept        complement(24264..24503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0023"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0020 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0023"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55074"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT12"
FT                   /inference="similar to AA sequence:KEGG:M446_0020"
FT                   /protein_id="ACL55074.1"
FT   gene            complement(24591..24980)
FT                   /locus_tag="Mnod_0024"
FT   CDS_pept        complement(24591..24980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0024"
FT                   /product="protein of unknown function UPF0102"
FT                   /note="PFAM: protein of unknown function UPF0102; KEGG:
FT                   met:M446_0021 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0024"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55075"
FT                   /db_xref="GOA:B8IT13"
FT                   /db_xref="InterPro:IPR003509"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="InterPro:IPR011856"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT13"
FT                   /inference="protein motif:PFAM:PF02021"
FT                   /protein_id="ACL55075.1"
FT   gene            complement(24967..25920)
FT                   /locus_tag="Mnod_0025"
FT   CDS_pept        complement(24967..25920)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0025"
FT                   /product="Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase"
FT                   /note="PFAM: Uroporphyrin-III C/tetrapyrrole
FT                   (Corrin/Porphyrin) methyltransferase; KEGG: met:M446_0022
FT                   uroporphyrin-III C/tetrapyrrole methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0025"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55076"
FT                   /db_xref="GOA:B8IT14"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT14"
FT                   /inference="protein motif:PFAM:PF00590"
FT                   /protein_id="ACL55076.1"
FT   gene            26098..27294
FT                   /locus_tag="Mnod_0026"
FT   CDS_pept        26098..27294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0026"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_0023 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0026"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55077"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT15"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55077.1"
FT   sig_peptide     26098..26202
FT                   /locus_tag="Mnod_0026"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.771 at
FT                   residue 35"
FT   gene            complement(27573..28736)
FT                   /locus_tag="Mnod_0027"
FT   CDS_pept        complement(27573..28736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0027"
FT                   /product="oxygen-independent coproporphyrinogen III
FT                   oxidase"
FT                   /EC_number=""
FT                   /note="KEGG: met:M446_0024 oxygen-independent
FT                   coproporphyrinogen III oxidase; TIGRFAM: oxygen-independent
FT                   coproporphyrinogen III oxidase; PFAM: Radical SAM domain
FT                   protein; HemN domain protein; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0027"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55078"
FT                   /db_xref="GOA:B8IT16"
FT                   /db_xref="InterPro:IPR004559"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010723"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR034505"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT16"
FT                   /inference="protein motif:TFAM:TIGR00539"
FT                   /protein_id="ACL55078.1"
FT   gene            complement(29036..29338)
FT                   /locus_tag="Mnod_0028"
FT   CDS_pept        complement(29036..29338)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0028"
FT                   /product="protein of unknown function UPF0153"
FT                   /note="PFAM: protein of unknown function UPF0153; KEGG:
FT                   met:M446_0025 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0028"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55079"
FT                   /db_xref="InterPro:IPR005358"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT17"
FT                   /inference="protein motif:PFAM:PF03692"
FT                   /protein_id="ACL55079.1"
FT   sig_peptide     complement(29279..29338)
FT                   /locus_tag="Mnod_0028"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.716) with cleavage site probability 0.550 at
FT                   residue 20"
FT   gene            complement(29335..29595)
FT                   /locus_tag="Mnod_0029"
FT   CDS_pept        complement(29335..29595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0029"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: met:M446_0026 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0029"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55080"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT18"
FT                   /inference="similar to AA sequence:KEGG:M446_0026"
FT                   /protein_id="ACL55080.1"
FT   gene            complement(29671..30090)
FT                   /locus_tag="Mnod_0030"
FT   CDS_pept        complement(29671..30090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0030"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_0027 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0030"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55081"
FT                   /db_xref="GOA:B8IT19"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR033120"
FT                   /db_xref="InterPro:IPR040170"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT19"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55081.1"
FT   gene            30342..31670
FT                   /locus_tag="Mnod_0031"
FT   CDS_pept        30342..31670
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0031"
FT                   /product="peptidase C14 caspase catalytic subunit p20"
FT                   /note="PFAM: peptidase C14 caspase catalytic subunit p20;
FT                   SH3 type 3 domain protein; KEGG: met:M446_0029 peptidase
FT                   C14 caspase catalytic subunit P20"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0031"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55082"
FT                   /db_xref="GOA:B8IT20"
FT                   /db_xref="InterPro:IPR001309"
FT                   /db_xref="InterPro:IPR003646"
FT                   /db_xref="InterPro:IPR029030"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT20"
FT                   /inference="protein motif:PFAM:PF00656"
FT                   /protein_id="ACL55082.1"
FT   gene            31804..32214
FT                   /locus_tag="Mnod_0032"
FT   CDS_pept        31804..32214
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0032"
FT                   /product="DNA-directed RNA polymerase, omega subunit"
FT                   /note="TIGRFAM: DNA-directed RNA polymerase, omega subunit;
FT                   PFAM: RNA polymerase Rpb6; KEGG: met:M446_0030 DNA-directed
FT                   RNA polymerase, omega subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55083"
FT                   /db_xref="GOA:B8IT21"
FT                   /db_xref="InterPro:IPR003716"
FT                   /db_xref="InterPro:IPR006110"
FT                   /db_xref="InterPro:IPR012293"
FT                   /db_xref="InterPro:IPR036161"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT21"
FT                   /inference="protein motif:TFAM:TIGR00690"
FT                   /protein_id="ACL55083.1"
FT   gene            32653..34866
FT                   /locus_tag="Mnod_0033"
FT   CDS_pept        32653..34866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0033"
FT                   /product="(p)ppGpp synthetase I, SpoT/RelA"
FT                   /EC_number=""
FT                   /note="KEGG: met:M446_0031 (p)ppGpp synthetase I,
FT                   SpoT/RelA; TIGRFAM: RelA/SpoT family protein; PFAM: amino
FT                   acid-binding ACT domain protein; TGS domain protein;
FT                   metal-dependent phosphohydrolase HD sub domain; RelA/SpoT
FT                   domain protein; SMART: metal-dependent phosphohydrolase HD
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55084"
FT                   /db_xref="GOA:B8IT22"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR003607"
FT                   /db_xref="InterPro:IPR004095"
FT                   /db_xref="InterPro:IPR004811"
FT                   /db_xref="InterPro:IPR007685"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR012676"
FT                   /db_xref="InterPro:IPR033655"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT22"
FT                   /inference="protein motif:TFAM:TIGR00691"
FT                   /protein_id="ACL55084.1"
FT   gene            35063..35653
FT                   /locus_tag="Mnod_0034"
FT   CDS_pept        35063..35653
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0034"
FT                   /product="orotate phosphoribosyltransferase"
FT                   /note="TIGRFAM: orotate phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: met:M446_0032 orotate
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55085"
FT                   /db_xref="GOA:B8IT23"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR006273"
FT                   /db_xref="InterPro:IPR023031"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IT23"
FT                   /inference="protein motif:TFAM:TIGR01367"
FT                   /protein_id="ACL55085.1"
FT   gene            35854..36513
FT                   /locus_tag="Mnod_0035"
FT   CDS_pept        35854..36513
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0035"
FT                   /product="protein of unknown function DUF88"
FT                   /note="PFAM: protein of unknown function DUF88; KEGG:
FT                   met:M446_0033 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0035"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55086"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT24"
FT                   /inference="protein motif:PFAM:PF01936"
FT                   /protein_id="ACL55086.1"
FT   gene            complement(36708..37649)
FT                   /locus_tag="Mnod_0036"
FT   CDS_pept        complement(36708..37649)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0036"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: met:M446_0034 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0036"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55087"
FT                   /db_xref="GOA:B8IT25"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT25"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55087.1"
FT   gene            complement(37646..38647)
FT                   /locus_tag="Mnod_0037"
FT   CDS_pept        complement(37646..38647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0037"
FT                   /product="glycosyl transferase family 4"
FT                   /note="PFAM: glycosyl transferase family 4; KEGG:
FT                   met:M446_0035 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0037"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55088"
FT                   /db_xref="GOA:B8IT26"
FT                   /db_xref="InterPro:IPR000715"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT26"
FT                   /inference="protein motif:PFAM:PF00953"
FT                   /protein_id="ACL55088.1"
FT   sig_peptide     complement(38546..38647)
FT                   /locus_tag="Mnod_0037"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.714 at
FT                   residue 34"
FT   gene            complement(38939..41011)
FT                   /locus_tag="Mnod_0038"
FT   CDS_pept        complement(38939..41011)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0038"
FT                   /product="methylmalonyl-CoA mutase, large subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: methylmalonyl-CoA mutase, large subunit;
FT                   PFAM: methylmalonyl-CoA mutase; cobalamin B12-binding
FT                   domain protein; KEGG: met:M446_0036 methylmalonyl-CoA
FT                   mutase, large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55089"
FT                   /db_xref="GOA:B8IT27"
FT                   /db_xref="InterPro:IPR006098"
FT                   /db_xref="InterPro:IPR006099"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006159"
FT                   /db_xref="InterPro:IPR016176"
FT                   /db_xref="InterPro:IPR036724"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT27"
FT                   /inference="protein motif:TFAM:TIGR00641"
FT                   /protein_id="ACL55089.1"
FT   gene            41301..42596
FT                   /locus_tag="Mnod_0039"
FT   CDS_pept        41301..42596
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0039"
FT                   /product="crotonyl-CoA reductase"
FT                   /note="TIGRFAM: crotonyl-CoA reductase; PFAM: Alcohol
FT                   dehydrogenase zinc-binding domain protein; Alcohol
FT                   dehydrogenase GroES domain protein; KEGG: met:M446_0037
FT                   crotonyl-CoA reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0039"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55090"
FT                   /db_xref="GOA:B8IT28"
FT                   /db_xref="InterPro:IPR010085"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT28"
FT                   /inference="protein motif:TFAM:TIGR01751"
FT                   /protein_id="ACL55090.1"
FT   gene            complement(42670..43782)
FT                   /locus_tag="Mnod_0040"
FT   CDS_pept        complement(42670..43782)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0040"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="SMART: regulatory protein LuxR; KEGG: met:M446_0039
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0040"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55091"
FT                   /db_xref="GOA:B8IT29"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT29"
FT                   /inference="protein motif:SMART:SM00421"
FT                   /protein_id="ACL55091.1"
FT   gene            44173..44775
FT                   /locus_tag="Mnod_0041"
FT   CDS_pept        44173..44775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0041"
FT                   /product="3-isopropylmalate dehydratase, small subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 3-isopropylmalate dehydratase, small
FT                   subunit; PFAM: aconitate hydratase domain protein; KEGG:
FT                   met:M446_0040 3-isopropylmalate dehydratase, small subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0041"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55092"
FT                   /db_xref="GOA:B8IT30"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR004431"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR033940"
FT                   /db_xref="UniProtKB/TrEMBL:B8IT30"
FT                   /inference="protein motif:TFAM:TIGR00171"
FT                   /protein_id="ACL55092.1"
FT   gene            44871..46067
FT                   /locus_tag="Mnod_0042"
FT   CDS_pept        44871..46067
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0042"
FT                   /product="lytic murein transglycosylase"
FT                   /note="TIGRFAM: lytic murein transglycosylase; PFAM:
FT                   Peptidoglycan-binding domain 1 protein; KEGG: met:M446_0041
FT                   lytic murein transglycosylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0042"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55093"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR011970"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR036366"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU48"
FT                   /inference="protein motif:TFAM:TIGR02283"
FT                   /protein_id="ACL55093.1"
FT   sig_peptide     44871..44951
FT                   /locus_tag="Mnod_0042"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.961 at
FT                   residue 27"
FT   gene            complement(46344..47576)
FT                   /locus_tag="Mnod_0043"
FT   CDS_pept        complement(46344..47576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0043"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_0043 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55094"
FT                   /db_xref="GOA:B8IU49"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU49"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55094.1"
FT                   LAARNRHVLAR"
FT   gene            complement(47783..49618)
FT                   /locus_tag="Mnod_0044"
FT   CDS_pept        complement(47783..49618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0044"
FT                   /product="heat shock protein Hsp90"
FT                   /note="PFAM: heat shock protein Hsp90; ATP-binding region
FT                   ATPase domain protein; KEGG: met:M446_0044 heat shock
FT                   protein HSP90"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0044"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55095"
FT                   /db_xref="GOA:B8IU50"
FT                   /db_xref="InterPro:IPR001404"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020575"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR037196"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IU50"
FT                   /inference="protein motif:PFAM:PF00183"
FT                   /protein_id="ACL55095.1"
FT   gene            complement(49702..50373)
FT                   /locus_tag="Mnod_0045"
FT   CDS_pept        complement(49702..50373)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0045"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: met:M446_0045 exonuclease RNase T
FT                   and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0045"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55096"
FT                   /db_xref="GOA:B8IU51"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU51"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACL55096.1"
FT                   A"
FT   gene            complement(50375..52192)
FT                   /locus_tag="Mnod_0046"
FT   CDS_pept        complement(50375..52192)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0046"
FT                   /product="putative CBS domain and cyclic
FT                   nucleotide-regulated nucleotidyltransferase"
FT                   /note="PFAM: cyclic nucleotide-binding; CBS domain
FT                   containing protein; protein of unknown function DUF294
FT                   nucleotidyltransferase putative; KEGG: met:M446_0046 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0046"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55097"
FT                   /db_xref="GOA:B8IU52"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005105"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR018821"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU52"
FT                   /inference="protein motif:PFAM:PF03445"
FT                   /protein_id="ACL55097.1"
FT   gene            complement(52331..52789)
FT                   /locus_tag="Mnod_0047"
FT   CDS_pept        complement(52331..52789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0047"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   met:M446_0047 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0047"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55098"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU53"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55098.1"
FT   gene            complement(52794..54176)
FT                   /locus_tag="Mnod_0048"
FT   CDS_pept        complement(52794..54176)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0048"
FT                   /product="MATE efflux family protein"
FT                   /note="TIGRFAM: MATE efflux family protein; PFAM: multi
FT                   antimicrobial extrusion protein MatE; KEGG: met:M446_0048
FT                   MATE efflux family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55099"
FT                   /db_xref="GOA:B8IU54"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU54"
FT                   /inference="protein motif:TFAM:TIGR00797"
FT                   /protein_id="ACL55099.1"
FT                   GA"
FT   gene            complement(54826..56358)
FT                   /locus_tag="Mnod_0049"
FT   CDS_pept        complement(54826..56358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0049"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   mex:Mext_2140 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0049"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55100"
FT                   /db_xref="GOA:B8IU55"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU55"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55100.1"
FT   gene            complement(56404..57411)
FT                   /locus_tag="Mnod_0050"
FT   CDS_pept        complement(56404..57411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0050"
FT                   /product="2-dehydropantoate 2-reductase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 2-dehydropantoate 2-reductase; PFAM:
FT                   NAD-dependent glycerol-3-phosphate dehydrogenase domain
FT                   protein; Ketopantoate reductase ApbA/PanE domain protein;
FT                   KEGG: mpo:Mpop_2099 2-dehydropantoate 2-reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0050"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55101"
FT                   /db_xref="GOA:B8IU56"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR013332"
FT                   /db_xref="InterPro:IPR013752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU56"
FT                   /inference="protein motif:TFAM:TIGR00745"
FT                   /protein_id="ACL55101.1"
FT   sig_peptide     complement(57343..57411)
FT                   /locus_tag="Mnod_0050"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.760) with cleavage site probability 0.570 at
FT                   residue 23"
FT   gene            complement(57500..58363)
FT                   /locus_tag="Mnod_0051"
FT   CDS_pept        complement(57500..58363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0051"
FT                   /product="aminotransferase class IV"
FT                   /note="PFAM: aminotransferase class IV; KEGG: met:M446_0051
FT                   aminotransferase class IV"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0051"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55102"
FT                   /db_xref="GOA:B8IU57"
FT                   /db_xref="InterPro:IPR001544"
FT                   /db_xref="InterPro:IPR036038"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU57"
FT                   /inference="protein motif:PFAM:PF01063"
FT                   /protein_id="ACL55102.1"
FT                   LGRDLA"
FT   gene            complement(58350..58955)
FT                   /locus_tag="Mnod_0052"
FT   CDS_pept        complement(58350..58955)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0052"
FT                   /product="glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /note="TIGRFAM: glutamine amidotransferase of anthranilate
FT                   synthase; PFAM: glutamine amidotransferase class-I; KEGG:
FT                   met:M446_0052 glutamine amidotransferase of anthranilate
FT                   synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0052"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55103"
FT                   /db_xref="GOA:B8IU58"
FT                   /db_xref="InterPro:IPR006221"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU58"
FT                   /inference="protein motif:TFAM:TIGR00566"
FT                   /protein_id="ACL55103.1"
FT   gene            complement(59059..60453)
FT                   /locus_tag="Mnod_0053"
FT   CDS_pept        complement(59059..60453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0053"
FT                   /product="para-aminobenzoate synthase, subunit I"
FT                   /EC_number=""
FT                   /note="TIGRFAM: para-aminobenzoate synthase, subunit I;
FT                   PFAM: Anthranilate synthase component I domain protein;
FT                   Chorismate binding-like; KEGG: met:M446_0053
FT                   para-aminobenzoate synthase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0053"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55104"
FT                   /db_xref="GOA:B8IU59"
FT                   /db_xref="InterPro:IPR005801"
FT                   /db_xref="InterPro:IPR005802"
FT                   /db_xref="InterPro:IPR006805"
FT                   /db_xref="InterPro:IPR015890"
FT                   /db_xref="InterPro:IPR019999"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU59"
FT                   /inference="protein motif:TFAM:TIGR00553"
FT                   /protein_id="ACL55104.1"
FT                   AAGDPT"
FT   gene            complement(60575..61591)
FT                   /locus_tag="Mnod_0054"
FT   CDS_pept        complement(60575..61591)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0054"
FT                   /product="putative periplasmic substrate-binding
FT                   transmembrane protein"
FT                   /note="KEGG: met:M446_0054 putative periplasmic
FT                   substrate-binding transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0054"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55105"
FT                   /db_xref="GOA:B8IU60"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU60"
FT                   /inference="similar to AA sequence:KEGG:M446_0054"
FT                   /protein_id="ACL55105.1"
FT   sig_peptide     complement(61511..61591)
FT                   /locus_tag="Mnod_0054"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.984 at
FT                   residue 27"
FT   gene            complement(61654..62532)
FT                   /locus_tag="Mnod_0055"
FT   CDS_pept        complement(61654..62532)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0055"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_0055
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0055"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55106"
FT                   /db_xref="GOA:B8IU61"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU61"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55106.1"
FT                   KRTIRRWGMQH"
FT   gene            complement(62722..63492)
FT                   /locus_tag="Mnod_0056"
FT   CDS_pept        complement(62722..63492)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0056"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_0056 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0056"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55107"
FT                   /db_xref="GOA:B8IU62"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU62"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55107.1"
FT   gene            63612..64289
FT                   /locus_tag="Mnod_0057"
FT   CDS_pept        63612..64289
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0057"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: met:M446_0057 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0057"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55108"
FT                   /db_xref="GOA:B8IU63"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU63"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55108.1"
FT                   PEP"
FT   gene            64286..65671
FT                   /locus_tag="Mnod_0058"
FT   CDS_pept        64286..65671
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0058"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; Two-component sensor kinase domain
FT                   protein; KEGG: met:M446_0058 integral membrane sensor
FT                   signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0058"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55109"
FT                   /db_xref="GOA:B8IU64"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR013727"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU64"
FT                   /inference="protein motif:PFAM:PF08521"
FT                   /protein_id="ACL55109.1"
FT                   AAP"
FT   sig_peptide     64286..64402
FT                   /locus_tag="Mnod_0058"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.952 at
FT                   residue 39"
FT   gene            65668..66780
FT                   /locus_tag="Mnod_0059"
FT   CDS_pept        65668..66780
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0059"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: met:M446_0059 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0059"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55110"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU65"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL55110.1"
FT   sig_peptide     65668..65730
FT                   /locus_tag="Mnod_0059"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 21"
FT   gene            complement(66782..66934)
FT                   /pseudo
FT                   /locus_tag="Mnod_0060"
FT   gene            67135..67992
FT                   /locus_tag="Mnod_0061"
FT   CDS_pept        67135..67992
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0061"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2473 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0061"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55111"
FT                   /db_xref="InterPro:IPR018959"
FT                   /db_xref="InterPro:IPR028896"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU66"
FT                   /inference="similar to AA sequence:KEGG:M446_2473"
FT                   /protein_id="ACL55111.1"
FT                   APDA"
FT   gene            complement(68147..68353)
FT                   /locus_tag="Mnod_0062"
FT   CDS_pept        complement(68147..68353)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0062"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3871 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0062"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55112"
FT                   /db_xref="InterPro:IPR022037"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU67"
FT                   /inference="similar to AA sequence:KEGG:M446_3871"
FT                   /protein_id="ACL55112.1"
FT   gene            complement(68448..69587)
FT                   /locus_tag="Mnod_0063"
FT   CDS_pept        complement(68448..69587)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0063"
FT                   /product="iron-containing alcohol dehydrogenase"
FT                   /note="PFAM: iron-containing alcohol dehydrogenase; KEGG:
FT                   met:M446_3465 iron-containing alcohol dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0063"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55113"
FT                   /db_xref="GOA:B8IU68"
FT                   /db_xref="InterPro:IPR001670"
FT                   /db_xref="InterPro:IPR018211"
FT                   /db_xref="InterPro:IPR039697"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU68"
FT                   /inference="protein motif:PFAM:PF00465"
FT                   /protein_id="ACL55113.1"
FT   gene            69889..71154
FT                   /locus_tag="Mnod_0064"
FT   CDS_pept        69889..71154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0064"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_4762 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0064"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55114"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU69"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55114.1"
FT   sig_peptide     69889..69993
FT                   /locus_tag="Mnod_0064"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 35"
FT   gene            71240..72115
FT                   /locus_tag="Mnod_0065"
FT   CDS_pept        71240..72115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0065"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_4763 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0065"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55115"
FT                   /db_xref="GOA:B8IU70"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU70"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55115.1"
FT                   VRPQGLLGRR"
FT   gene            72137..73063
FT                   /locus_tag="Mnod_0066"
FT   CDS_pept        72137..73063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0066"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_4764 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0066"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55116"
FT                   /db_xref="GOA:B8IU71"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU71"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55116.1"
FT   sig_peptide     72137..72202
FT                   /locus_tag="Mnod_0066"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.975) with cleavage site probability 0.534 at
FT                   residue 22"
FT   gene            73089..74597
FT                   /locus_tag="Mnod_0067"
FT   CDS_pept        73089..74597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0067"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_4765 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0067"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55117"
FT                   /db_xref="GOA:B8IU72"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU72"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55117.1"
FT   gene            complement(75039..75563)
FT                   /locus_tag="Mnod_0068"
FT   CDS_pept        complement(75039..75563)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0068"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_5564 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0068"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55118"
FT                   /db_xref="GOA:B8IU73"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU73"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55118.1"
FT                   RGRSKEARSDR"
FT   gene            complement(75893..76396)
FT                   /locus_tag="Mnod_0069"
FT   CDS_pept        complement(75893..76396)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0069"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mpo:Mpop_3481 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0069"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55119"
FT                   /db_xref="GOA:B8IU74"
FT                   /db_xref="InterPro:IPR005134"
FT                   /db_xref="InterPro:IPR020761"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU74"
FT                   /inference="protein motif:PFAM:PF03350"
FT                   /protein_id="ACL55119.1"
FT                   HHDK"
FT   gene            76656..76862
FT                   /locus_tag="Mnod_0070"
FT   CDS_pept        76656..76862
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0070"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mex:Mext_2797 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0070"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55120"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU75"
FT                   /inference="similar to AA sequence:KEGG:Mext_2797"
FT                   /protein_id="ACL55120.1"
FT   gene            76846..77127
FT                   /locus_tag="Mnod_0071"
FT   CDS_pept        76846..77127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0071"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6447 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0071"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55121.1"
FT   gene            complement(77203..77832)
FT                   /locus_tag="Mnod_0072"
FT   CDS_pept        complement(77203..77832)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0072"
FT                   /product="phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family"
FT                   /note="TIGRFAM: phosphonate metabolim protein, transferase
FT                   hexapeptide repeat family; KEGG: atc:AGR_C_2119
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0072"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55122"
FT                   /db_xref="GOA:B8IU77"
FT                   /db_xref="InterPro:IPR001451"
FT                   /db_xref="InterPro:IPR011004"
FT                   /db_xref="InterPro:IPR017694"
FT                   /db_xref="InterPro:IPR018357"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU77"
FT                   /inference="protein motif:TFAM:TIGR03308"
FT                   /protein_id="ACL55122.1"
FT   gene            complement(78352..78738)
FT                   /locus_tag="Mnod_0073"
FT   CDS_pept        complement(78352..78738)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0073"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_6212 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0073"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55123"
FT                   /db_xref="GOA:B8IU78"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU78"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55123.1"
FT   gene            complement(79282..80016)
FT                   /locus_tag="Mnod_0074"
FT   CDS_pept        complement(79282..80016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0074"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6153 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0074"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55124"
FT                   /db_xref="GOA:B8IU79"
FT                   /db_xref="InterPro:IPR001375"
FT                   /db_xref="InterPro:IPR002471"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU79"
FT                   /inference="similar to AA sequence:KEGG:M446_6153"
FT                   /protein_id="ACL55124.1"
FT   gene            complement(80003..81148)
FT                   /locus_tag="Mnod_0075"
FT   CDS_pept        complement(80003..81148)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0075"
FT                   /product="biotin carboxylase"
FT                   /note="KEGG: met:M446_6154 biotin carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0075"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55125"
FT                   /db_xref="InterPro:IPR021519"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU80"
FT                   /inference="similar to AA sequence:KEGG:M446_6154"
FT                   /protein_id="ACL55125.1"
FT   gene            complement(81266..81772)
FT                   /locus_tag="Mnod_0076"
FT   CDS_pept        complement(81266..81772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01448 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0076"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55126"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU81"
FT                   /inference="similar to AA sequence:KEGG:SMc01448"
FT                   /protein_id="ACL55126.1"
FT                   GADRG"
FT   gene            complement(82001..82246)
FT                   /locus_tag="Mnod_0077"
FT   CDS_pept        complement(82001..82246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0077"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0077"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55127"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU82"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55127.1"
FT   gene            complement(83111..84526)
FT                   /locus_tag="Mnod_0078"
FT   CDS_pept        complement(83111..84526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0078"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: rle:pRL120502 putative guanylate/adenylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0078"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55128"
FT                   /db_xref="GOA:B8IU83"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU83"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55128.1"
FT                   RGIGSRMPVFELT"
FT   gene            85171..86010
FT                   /locus_tag="Mnod_0079"
FT   CDS_pept        85171..86010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0079"
FT                   /product="lipolytic protein G-D-S-L family"
FT                   /note="PFAM: lipolytic protein G-D-S-L family; KEGG:
FT                   met:M446_2090 GDSL family lipase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0079"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55129"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU84"
FT                   /inference="protein motif:PFAM:PF00657"
FT                   /protein_id="ACL55129.1"
FT   sig_peptide     85171..85305
FT                   /locus_tag="Mnod_0079"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.681 at
FT                   residue 45"
FT   gene            complement(86372..86647)
FT                   /locus_tag="Mnod_0080"
FT   CDS_pept        complement(86372..86647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0080"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0080"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55130"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU85"
FT                   /inference="similar to AA sequence:KEGG:M446_6371"
FT                   /protein_id="ACL55130.1"
FT   gene            87265..87861
FT                   /locus_tag="Mnod_0081"
FT   CDS_pept        87265..87861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0081"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: Hypothetical protein CBG04830"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0081"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55131"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU86"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55131.1"
FT   gene            complement(88195..88269)
FT                   /locus_tag="Mnod_R0001"
FT                   /note="tRNA-Thr4"
FT   tRNA            complement(88195..88269)
FT                   /locus_tag="Mnod_R0001"
FT                   /product="tRNA-Thr"
FT   gene            88499..88762
FT                   /pseudo
FT                   /locus_tag="Mnod_0082"
FT   gene            89014..89613
FT                   /locus_tag="Mnod_0083"
FT   CDS_pept        89014..89613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0083"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3764 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0083"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55132"
FT                   /db_xref="InterPro:IPR012347"
FT                   /db_xref="InterPro:IPR025419"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU87"
FT                   /inference="similar to AA sequence:KEGG:M446_3764"
FT                   /protein_id="ACL55132.1"
FT   sig_peptide     89014..89091
FT                   /locus_tag="Mnod_0083"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 26"
FT   gene            90204..90302
FT                   /locus_tag="Mnod_0084"
FT   CDS_pept        90204..90302
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0084"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0084"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55133"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU88"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55133.1"
FT                   /translation="MCSFGVDGNIAPDVALTGASPYHLLHNGFTVS"
FT   gene            90479..90703
FT                   /locus_tag="Mnod_0085"
FT   CDS_pept        90479..90703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0085"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0085"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55134"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU89"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55134.1"
FT   gene            complement(91649..91822)
FT                   /locus_tag="Mnod_0086"
FT   CDS_pept        complement(91649..91822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0086"
FT                   /product="CsbD family protein"
FT                   /note="PFAM: CsbD family protein; KEGG: met:M446_0717 CsbD
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0086"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55135"
FT                   /db_xref="InterPro:IPR008462"
FT                   /db_xref="InterPro:IPR036629"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU90"
FT                   /inference="protein motif:PFAM:PF05532"
FT                   /protein_id="ACL55135.1"
FT                   VVGGIKDALKGK"
FT   gene            91955..92227
FT                   /locus_tag="Mnod_0087"
FT   CDS_pept        91955..92227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0087"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0718 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0087"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55136"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU91"
FT                   /inference="similar to AA sequence:KEGG:M446_0718"
FT                   /protein_id="ACL55136.1"
FT   sig_peptide     91955..92017
FT                   /locus_tag="Mnod_0087"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 21"
FT   gene            92845..93063
FT                   /locus_tag="Mnod_0088"
FT   CDS_pept        92845..93063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0088"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6754 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0088"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55137"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU92"
FT                   /inference="similar to AA sequence:KEGG:M446_6754"
FT                   /protein_id="ACL55137.1"
FT   gene            complement(93415..95358)
FT                   /locus_tag="Mnod_0089"
FT   CDS_pept        complement(93415..95358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0089"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   TPR repeat-containing protein; SMART: Tetratricopeptide
FT                   domain protein; KEGG: met:M446_0534 adenylate/guanylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0089"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55138"
FT                   /db_xref="GOA:B8IU93"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU93"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55138.1"
FT                   VEGLRKAGLQEE"
FT   gene            95644..95769
FT                   /locus_tag="Mnod_0090"
FT   CDS_pept        95644..95769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0090"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0090"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55139"
FT                   /db_xref="GOA:B8IU94"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU94"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55139.1"
FT   gene            96128..96322
FT                   /locus_tag="Mnod_0091"
FT   CDS_pept        96128..96322
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0091"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0091"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55140"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU95"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55140.1"
FT   gene            97100..97657
FT                   /locus_tag="Mnod_0092"
FT   CDS_pept        97100..97657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0092"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: kra:Krad_3536 helix-turn-helix
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0092"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55141"
FT                   /db_xref="GOA:B8IU96"
FT                   /db_xref="InterPro:IPR036444"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU96"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55141.1"
FT   gene            98091..98345
FT                   /pseudo
FT                   /locus_tag="Mnod_0093"
FT   gene            complement(99254..99505)
FT                   /locus_tag="Mnod_0094"
FT   CDS_pept        complement(99254..99505)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0094"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0094"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55142"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU97"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55142.1"
FT   gene            99795..100073
FT                   /locus_tag="Mnod_0095"
FT   CDS_pept        99795..100073
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0095"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0095"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55143"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU98"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55143.1"
FT   gene            complement(100201..102144)
FT                   /locus_tag="Mnod_0096"
FT   CDS_pept        complement(100201..102144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0096"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: met:M446_0534 adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0096"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55144"
FT                   /db_xref="GOA:B8IU99"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IU99"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55144.1"
FT                   VDGLRKAGLQEE"
FT   gene            complement(102203..104788)
FT                   /pseudo
FT                   /locus_tag="Mnod_0097"
FT   gene            complement(102570..102830)
FT                   /locus_tag="Mnod_0098"
FT   CDS_pept        complement(102570..102830)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0098"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0098"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55145"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55145.1"
FT   gene            103128..103847
FT                   /locus_tag="Mnod_0099"
FT   CDS_pept        103128..103847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0099"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0099"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55146"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55146.1"
FT                   GLPVGGGTLLGGQLGNS"
FT   gene            complement(104891..104965)
FT                   /locus_tag="Mnod_R0002"
FT                   /note="tRNA-Thr3"
FT   tRNA            complement(104891..104965)
FT                   /locus_tag="Mnod_R0002"
FT                   /product="tRNA-Thr"
FT   gene            105255..106244
FT                   /locus_tag="Mnod_0100"
FT   CDS_pept        105255..106244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0100"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; Transport-associated
FT                   OB domain protein; SMART: AAA ATPase; KEGG: met:M446_4738
FT                   ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0100"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55147"
FT                   /db_xref="GOA:B8IUA2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55147.1"
FT   gene            106269..107552
FT                   /locus_tag="Mnod_0101"
FT   CDS_pept        106269..107552
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0101"
FT                   /product="ABC transporter substrate-binding protein"
FT                   /note="KEGG: met:M446_4739 ABC transporter
FT                   substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0101"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55148"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA3"
FT                   /inference="similar to AA sequence:KEGG:M446_4739"
FT                   /protein_id="ACL55148.1"
FT   sig_peptide     106269..106388
FT                   /locus_tag="Mnod_0101"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 40"
FT   gene            107549..108502
FT                   /locus_tag="Mnod_0102"
FT   CDS_pept        107549..108502
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0102"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_4740
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0102"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55149"
FT                   /db_xref="GOA:B8IUA4"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA4"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55149.1"
FT   gene            108505..109398
FT                   /locus_tag="Mnod_0103"
FT   CDS_pept        108505..109398
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0103"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_4741
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0103"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55150"
FT                   /db_xref="GOA:B8IUA5"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA5"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55150.1"
FT                   YLWLQRRRARRALPGG"
FT   gene            109724..110560
FT                   /locus_tag="Mnod_0104"
FT   CDS_pept        109724..110560
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0104"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KEGG:
FT                   met:M446_1731 short-chain dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0104"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55151"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA6"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55151.1"
FT   gene            110557..111354
FT                   /locus_tag="Mnod_0105"
FT   CDS_pept        110557..111354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0105"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   bbt:BBta_0175 putative hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0105"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55152"
FT                   /db_xref="GOA:B8IUA7"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA7"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL55152.1"
FT   gene            complement(111374..111646)
FT                   /locus_tag="Mnod_0106"
FT   CDS_pept        complement(111374..111646)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0106"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4742 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0106"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55153"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA8"
FT                   /inference="similar to AA sequence:KEGG:M446_4742"
FT                   /protein_id="ACL55153.1"
FT   sig_peptide     complement(111575..111646)
FT                   /locus_tag="Mnod_0106"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 24"
FT   gene            complement(111795..113156)
FT                   /locus_tag="Mnod_0107"
FT   CDS_pept        complement(111795..113156)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0107"
FT                   /product="TRAP-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: met:M446_4743 TRAP-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0107"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55154"
FT                   /db_xref="GOA:B8IUA9"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUA9"
FT                   /inference="similar to AA sequence:KEGG:M446_4743"
FT                   /protein_id="ACL55154.1"
FT   sig_peptide     complement(113085..113156)
FT                   /locus_tag="Mnod_0107"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.970) with cleavage site probability 0.319 at
FT                   residue 24"
FT   gene            complement(113187..113936)
FT                   /locus_tag="Mnod_0108"
FT   CDS_pept        complement(113187..113936)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0108"
FT                   /product="ubiquinone biosynthesis O-methyltransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: ubiquinone biosynthesis
FT                   O-methyltransferase; PFAM: Methyltransferase type 11;
FT                   Methyltransferase type 12; KEGG: met:M446_4744 ubiquinone
FT                   biosynthesis O-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0108"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55155"
FT                   /db_xref="GOA:B8IUB0"
FT                   /db_xref="InterPro:IPR010233"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUB0"
FT                   /inference="protein motif:TFAM:TIGR01983"
FT                   /protein_id="ACL55155.1"
FT   gene            complement(113933..114106)
FT                   /locus_tag="Mnod_0109"
FT   CDS_pept        complement(113933..114106)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0109"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0109"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55156"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55156.1"
FT                   LTQGDSMRRARG"
FT   gene            114128..115363
FT                   /locus_tag="Mnod_0110"
FT   CDS_pept        114128..115363
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0110"
FT                   /product="aspartate kinase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: aspartate kinase; aspartate kinase,
FT                   monofunctional class; PFAM: aspartate/glutamate/uridylate
FT                   kinase; amino acid-binding ACT domain protein; KEGG:
FT                   met:M446_4746 aspartate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0110"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55157"
FT                   /db_xref="GOA:B8IUB2"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR001341"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR005260"
FT                   /db_xref="InterPro:IPR018042"
FT                   /db_xref="InterPro:IPR027795"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="InterPro:IPR041740"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB2"
FT                   /inference="protein motif:TFAM:TIGR00657"
FT                   /protein_id="ACL55157.1"
FT                   RTLHSLYGLDRA"
FT   gene            115536..117797
FT                   /locus_tag="Mnod_0111"
FT   CDS_pept        115536..117797
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0111"
FT                   /product="PTSINtr with GAF domain, PtsP"
FT                   /note="TIGRFAM: phosphoenolpyruvate-protein
FT                   phosphotransferase; PFAM: PEP-utilizing protein; GAF domain
FT                   protein; PEP-utilising protein mobile region; PEP-utilising
FT                   protein domain protein; KEGG: met:M446_4747
FT                   phosphoenolpyruvate-protein phosphotransferase PtsP"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0111"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55158"
FT                   /db_xref="GOA:B8IUB3"
FT                   /db_xref="InterPro:IPR000121"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR006318"
FT                   /db_xref="InterPro:IPR008279"
FT                   /db_xref="InterPro:IPR008731"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR023151"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036618"
FT                   /db_xref="InterPro:IPR036637"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB3"
FT                   /inference="protein motif:TFAM:TIGR01417"
FT                   /protein_id="ACL55158.1"
FT                   "
FT   gene            117995..119074
FT                   /locus_tag="Mnod_0112"
FT   CDS_pept        117995..119074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0112"
FT                   /product="peptide chain release factor 1"
FT                   /note="TIGRFAM: peptide chain release factor 1; PFAM: Class
FT                   I peptide chain release factor; PCRF domain protein; KEGG:
FT                   met:M446_4748 peptide chain release factor 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0112"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55159"
FT                   /db_xref="GOA:B8IUB4"
FT                   /db_xref="InterPro:IPR000352"
FT                   /db_xref="InterPro:IPR004373"
FT                   /db_xref="InterPro:IPR005139"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUB4"
FT                   /inference="protein motif:TFAM:TIGR00019"
FT                   /protein_id="ACL55159.1"
FT   gene            119071..119970
FT                   /locus_tag="Mnod_0113"
FT   CDS_pept        119071..119970
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0113"
FT                   /product="modification methylase, HemK family"
FT                   /note="TIGRFAM: modification methylase, HemK family; PFAM:
FT                   putative RNA methylase; methyltransferase small; KEGG:
FT                   met:M446_4749 protein-(glutamine-N5) methyltransferase,
FT                   release factor-specific"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0113"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55160"
FT                   /db_xref="GOA:B8IUB5"
FT                   /db_xref="InterPro:IPR002052"
FT                   /db_xref="InterPro:IPR004556"
FT                   /db_xref="InterPro:IPR019874"
FT                   /db_xref="InterPro:IPR025714"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR040758"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB5"
FT                   /inference="protein motif:TFAM:TIGR00536"
FT                   /protein_id="ACL55160.1"
FT                   RAVVMAREPGRNPDSSGF"
FT   gene            120329..121264
FT                   /locus_tag="Mnod_0114"
FT   CDS_pept        120329..121264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0114"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4750 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0114"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55161"
FT                   /db_xref="InterPro:IPR025430"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB6"
FT                   /inference="similar to AA sequence:KEGG:M446_4750"
FT                   /protein_id="ACL55161.1"
FT   gene            121317..122450
FT                   /locus_tag="Mnod_0115"
FT   CDS_pept        121317..122450
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0115"
FT                   /product="FAD dependent oxidoreductase"
FT                   /EC_number=""
FT                   /note="PFAM: FAD dependent oxidoreductase; KEGG:
FT                   met:M446_4751 sarcosine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0115"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55162"
FT                   /db_xref="GOA:B8IUB7"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB7"
FT                   /inference="protein motif:PFAM:PF01266"
FT                   /protein_id="ACL55162.1"
FT   gene            122557..123213
FT                   /locus_tag="Mnod_0116"
FT   CDS_pept        122557..123213
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0116"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sme:SMb20033
FT                   hypothetical transcriptional regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0116"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55163"
FT                   /db_xref="GOA:B8IUB8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041474"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB8"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55163.1"
FT   gene            complement(123605..124939)
FT                   /locus_tag="Mnod_0117"
FT   CDS_pept        complement(123605..124939)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0117"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: sma:SAV1779
FT                   3-(2-hydroxyphenyl) propionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0117"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55164"
FT                   /db_xref="GOA:B8IUB9"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUB9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55164.1"
FT   gene            complement(124972..125847)
FT                   /locus_tag="Mnod_0118"
FT   CDS_pept        complement(124972..125847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0118"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: Shikimate/quinate 5-dehydrogenase; Shikimate
FT                   dehydrogenase substrate binding domain protein; KEGG:
FT                   rso:RSp1398 shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0118"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55165"
FT                   /db_xref="GOA:B8IUC0"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC0"
FT                   /inference="protein motif:PFAM:PF08501"
FT                   /protein_id="ACL55165.1"
FT                   LGDKAAKTAA"
FT   gene            126251..127201
FT                   /locus_tag="Mnod_0119"
FT   CDS_pept        126251..127201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0119"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_4752 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0119"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55166"
FT                   /db_xref="GOA:B8IUC1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="InterPro:IPR037424"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55166.1"
FT   gene            127329..128219
FT                   /locus_tag="Mnod_0120"
FT   CDS_pept        127329..128219
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0120"
FT                   /product="shikimate 5-dehydrogenase"
FT                   /note="TIGRFAM: shikimate 5-dehydrogenase; PFAM:
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: met:M446_4753
FT                   shikimate 5-dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0120"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55167"
FT                   /db_xref="GOA:B8IUC2"
FT                   /db_xref="InterPro:IPR011342"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR022893"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR041121"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC2"
FT                   /inference="protein motif:TFAM:TIGR00507"
FT                   /protein_id="ACL55167.1"
FT                   AHAEEGSPPPPRSDG"
FT   gene            128363..129769
FT                   /locus_tag="Mnod_0121"
FT   CDS_pept        128363..129769
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0121"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: met:M446_4754 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0121"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55168"
FT                   /db_xref="GOA:B8IUC3"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC3"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55168.1"
FT                   LASGGRLAGA"
FT   gene            129870..131753
FT                   /locus_tag="Mnod_0122"
FT   CDS_pept        129870..131753
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0122"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /EC_number=""
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: met:M446_4755 4-hydroxyphenylpyruvate dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0122"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55169"
FT                   /db_xref="GOA:B8IUC4"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="InterPro:IPR041736"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL55169.1"
FT   gene            131777..132202
FT                   /locus_tag="Mnod_0123"
FT   CDS_pept        131777..132202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0123"
FT                   /product="3-dehydroquinate dehydratase, type II"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 3-dehydroquinate dehydratase, type II;
FT                   PFAM: dehydroquinase class II; KEGG: met:M446_4756
FT                   3-dehydroquinate dehydratase, type II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0123"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55170"
FT                   /db_xref="GOA:B8IUC5"
FT                   /db_xref="InterPro:IPR001874"
FT                   /db_xref="InterPro:IPR018509"
FT                   /db_xref="InterPro:IPR036441"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC5"
FT                   /inference="protein motif:TFAM:TIGR01088"
FT                   /protein_id="ACL55170.1"
FT   gene            complement(132491..132904)
FT                   /locus_tag="Mnod_0124"
FT   CDS_pept        complement(132491..132904)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0124"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_6298 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0124"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55171"
FT                   /db_xref="GOA:B8IUC6"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC6"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55171.1"
FT   gene            complement(133456..134328)
FT                   /locus_tag="Mnod_0125"
FT   CDS_pept        complement(133456..134328)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0125"
FT                   /product="2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /note="TIGRFAM: 2-dehydro-3-deoxyphosphooctonate aldolase;
FT                   PFAM: DAHP synthetase I/KDSA; KEGG: met:M446_4766
FT                   2-dehydro-3-deoxyphosphooctonate aldolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0125"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55172"
FT                   /db_xref="GOA:B8IUC7"
FT                   /db_xref="InterPro:IPR006218"
FT                   /db_xref="InterPro:IPR006269"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC7"
FT                   /inference="protein motif:TFAM:TIGR01362"
FT                   /protein_id="ACL55172.1"
FT                   AFDRLAKAL"
FT   gene            complement(134383..134919)
FT                   /locus_tag="Mnod_0126"
FT   CDS_pept        complement(134383..134919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0126"
FT                   /product="GCN5-related N-acetyltransferase"
FT                   /note="PFAM: GCN5-related N-acetyltransferase; KEGG:
FT                   met:M446_4767 GCN5-related N-acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0126"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55173"
FT                   /db_xref="GOA:B8IUC8"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC8"
FT                   /inference="protein motif:PFAM:PF00583"
FT                   /protein_id="ACL55173.1"
FT                   DGRPCDTVYFFKALA"
FT   gene            complement(134923..135504)
FT                   /locus_tag="Mnod_0127"
FT   CDS_pept        complement(134923..135504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0127"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: met:M446_4768 XRE
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0127"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55174"
FT                   /db_xref="GOA:B8IUC9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUC9"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL55174.1"
FT   gene            135625..136527
FT                   /locus_tag="Mnod_0128"
FT   CDS_pept        135625..136527
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0128"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4769 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0128"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55175"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD0"
FT                   /inference="similar to AA sequence:KEGG:M446_4769"
FT                   /protein_id="ACL55175.1"
FT   sig_peptide     135625..135717
FT                   /locus_tag="Mnod_0128"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.948 at
FT                   residue 31"
FT   gene            136917..138092
FT                   /locus_tag="Mnod_0129"
FT   CDS_pept        136917..138092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0129"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bra:BRADO5530 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0129"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55176"
FT                   /db_xref="GOA:B8ILL4"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8ILL4"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL55176.1"
FT   gene            complement(138219..139560)
FT                   /pseudo
FT                   /locus_tag="Mnod_0130"
FT   gene            complement(139557..141449)
FT                   /locus_tag="Mnod_0131"
FT   CDS_pept        complement(139557..141449)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0131"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; KEGG: met:M446_4771
FT                   histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0131"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55177"
FT                   /db_xref="GOA:B8IUD2"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR017055"
FT                   /db_xref="InterPro:IPR029151"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD2"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL55177.1"
FT   gene            141666..143015
FT                   /locus_tag="Mnod_0132"
FT   CDS_pept        141666..143015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0132"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   met:M446_4772 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0132"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55178"
FT                   /db_xref="GOA:B8IUD3"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR023954"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD3"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL55178.1"
FT   gene            complement(143121..143663)
FT                   /locus_tag="Mnod_0133"
FT   CDS_pept        complement(143121..143663)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0133"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: met:M446_2672
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0133"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55179"
FT                   /db_xref="GOA:B8IUD4"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD4"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACL55179.1"
FT                   NGAWIRLERDERITLGE"
FT   gene            complement(143660..145426)
FT                   /locus_tag="Mnod_0134"
FT   CDS_pept        complement(143660..145426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0134"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2673 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0134"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55180"
FT                   /db_xref="GOA:B8IUD5"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD5"
FT                   /inference="similar to AA sequence:KEGG:M446_2673"
FT                   /protein_id="ACL55180.1"
FT                   GARLGRLLRDGG"
FT   gene            145840..147588
FT                   /locus_tag="Mnod_0135"
FT   CDS_pept        145840..147588
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0135"
FT                   /product="ankyrin"
FT                   /note="KEGG: met:M446_2674 ankyrin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0135"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55181"
FT                   /db_xref="GOA:B8IUD6"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="InterPro:IPR019020"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD6"
FT                   /inference="similar to AA sequence:KEGG:M446_2674"
FT                   /protein_id="ACL55181.1"
FT                   VRIDLR"
FT   gene            147609..148652
FT                   /locus_tag="Mnod_0136"
FT   CDS_pept        147609..148652
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0136"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: met:M446_2675 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0136"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55182"
FT                   /db_xref="GOA:B8IUD7"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD7"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACL55182.1"
FT                   AAPRSAA"
FT   gene            148894..149103
FT                   /locus_tag="Mnod_0137"
FT   CDS_pept        148894..149103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0137"
FT                   /product="YcfA family protein"
FT                   /note="PFAM: YcfA family protein; KEGG: sme:SMc04441
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0137"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55183"
FT                   /db_xref="GOA:B8IUD8"
FT                   /db_xref="InterPro:IPR012933"
FT                   /db_xref="InterPro:IPR038570"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD8"
FT                   /inference="protein motif:PFAM:PF07927"
FT                   /protein_id="ACL55183.1"
FT   gene            149158..149574
FT                   /locus_tag="Mnod_0138"
FT   CDS_pept        149158..149574
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0138"
FT                   /product="protein of unknown function UPF0150"
FT                   /note="PFAM: CopG domain protein DNA-binding domain
FT                   protein; protein of unknown function UPF0150; KEGG:
FT                   nha:Nham_0567 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0138"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55184"
FT                   /db_xref="InterPro:IPR031807"
FT                   /db_xref="InterPro:IPR035069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUD9"
FT                   /inference="protein motif:PFAM:PF03681"
FT                   /protein_id="ACL55184.1"
FT   gene            complement(149680..150477)
FT                   /locus_tag="Mnod_0139"
FT   CDS_pept        complement(149680..150477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0139"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2676 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0139"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55185"
FT                   /db_xref="InterPro:IPR024370"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE0"
FT                   /inference="similar to AA sequence:KEGG:M446_2676"
FT                   /protein_id="ACL55185.1"
FT   sig_peptide     complement(150409..150477)
FT                   /locus_tag="Mnod_0139"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(150626..151825)
FT                   /locus_tag="Mnod_0140"
FT   CDS_pept        complement(150626..151825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0140"
FT                   /product="hydrolase, peptidase M42 family"
FT                   /note="TIGRFAM: hydrolase, peptidase M42 family; PFAM:
FT                   peptidase M20; peptidase M42 family protein; KEGG:
FT                   met:M446_2678 peptidase M42 family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0140"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55186"
FT                   /db_xref="GOA:B8IUE1"
FT                   /db_xref="InterPro:IPR008007"
FT                   /db_xref="InterPro:IPR017537"
FT                   /db_xref="InterPro:IPR023367"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE1"
FT                   /inference="protein motif:TFAM:TIGR03106"
FT                   /protein_id="ACL55186.1"
FT                   "
FT   gene            complement(151828..153537)
FT                   /locus_tag="Mnod_0141"
FT   CDS_pept        complement(151828..153537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0141"
FT                   /product="GNAT-family acetyltransferase TIGR03103"
FT                   /EC_number=""
FT                   /note="TIGRFAM: GNAT-family acetyltransferase TIGR03103;
FT                   PFAM: phosphoribosylglycinamide synthetase; GCN5-related
FT                   N-acetyltransferase; RimK domain protein ATP-grasp; KEGG:
FT                   met:M446_2679 GNAT family acetyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0141"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55187"
FT                   /db_xref="GOA:B8IUE2"
FT                   /db_xref="InterPro:IPR000182"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013651"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR017534"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE2"
FT                   /inference="protein motif:TFAM:TIGR03103"
FT                   /protein_id="ACL55187.1"
FT   gene            complement(153541..155313)
FT                   /locus_tag="Mnod_0142"
FT   CDS_pept        complement(153541..155313)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0142"
FT                   /product="asparagine synthase family amidotransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: asparagine synthase
FT                   (glutamine-hydrolyzing); asparagine synthase family
FT                   amidotransferase; PFAM: glutamine amidotransferase
FT                   class-II; asparagine synthase; KEGG: met:M446_2680
FT                   asparagine synthase amidotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0142"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55188"
FT                   /db_xref="GOA:B8IUE3"
FT                   /db_xref="InterPro:IPR001962"
FT                   /db_xref="InterPro:IPR006426"
FT                   /db_xref="InterPro:IPR017535"
FT                   /db_xref="InterPro:IPR017932"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="InterPro:IPR033738"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE3"
FT                   /inference="protein motif:TFAM:TIGR03104"
FT                   /protein_id="ACL55188.1"
FT                   QVALLEFWLQTHAI"
FT   gene            155543..155935
FT                   /locus_tag="Mnod_0143"
FT   CDS_pept        155543..155935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0143"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_2682 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0143"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55189"
FT                   /db_xref="GOA:B8IUE4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE4"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55189.1"
FT   gene            156242..159271
FT                   /locus_tag="Mnod_0144"
FT   CDS_pept        156242..159271
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0144"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /EC_number=""
FT                   /note="KEGG: met:M446_2683 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; ATP-binding region ATPase domain
FT                   protein; histidine kinase A domain protein; Hpt domain
FT                   protein; PAS fold-3 domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein; PAC repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0144"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55190"
FT                   /db_xref="GOA:B8IUE5"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR008207"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036641"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE5"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL55190.1"
FT   sig_peptide     156242..156403
FT                   /locus_tag="Mnod_0144"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.934) with cleavage site probability 0.910 at
FT                   residue 54"
FT   gene            complement(159593..160138)
FT                   /locus_tag="Mnod_0145"
FT   CDS_pept        complement(159593..160138)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0145"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   met:M446_4615 CoA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0145"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55191"
FT                   /db_xref="GOA:B8IUE6"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE6"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACL55191.1"
FT                   KRPKLAARGFQKLTIEKR"
FT   gene            complement(160252..161034)
FT                   /locus_tag="Mnod_0146"
FT   CDS_pept        complement(160252..161034)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0146"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   met:M446_4614 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0146"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55192"
FT                   /db_xref="GOA:B8IUE7"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE7"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACL55192.1"
FT   gene            161145..161582
FT                   /locus_tag="Mnod_0147"
FT   CDS_pept        161145..161582
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0147"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_4613 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0147"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55193"
FT                   /db_xref="GOA:B8IUE8"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUE8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55193.1"
FT   gene            161760..162221
FT                   /locus_tag="Mnod_0148"
FT   CDS_pept        161760..162221
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0148"
FT                   /product="ribosomal protein L13"
FT                   /note="PFAM: ribosomal protein L13; KEGG: met:M446_4612
FT                   ribosomal protein L13"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0148"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55194"
FT                   /db_xref="GOA:B8IUE9"
FT                   /db_xref="InterPro:IPR005822"
FT                   /db_xref="InterPro:IPR005823"
FT                   /db_xref="InterPro:IPR036899"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUE9"
FT                   /inference="protein motif:PFAM:PF00572"
FT                   /protein_id="ACL55194.1"
FT   gene            162223..162711
FT                   /locus_tag="Mnod_0149"
FT   CDS_pept        162223..162711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0149"
FT                   /product="ribosomal protein S9"
FT                   /note="PFAM: ribosomal protein S9; KEGG: met:M446_4611
FT                   ribosomal protein S9"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0149"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55195"
FT                   /db_xref="GOA:B8IUF0"
FT                   /db_xref="InterPro:IPR000754"
FT                   /db_xref="InterPro:IPR014721"
FT                   /db_xref="InterPro:IPR020568"
FT                   /db_xref="InterPro:IPR020574"
FT                   /db_xref="InterPro:IPR023035"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IUF0"
FT                   /inference="protein motif:PFAM:PF00380"
FT                   /protein_id="ACL55195.1"
FT   gene            162897..163703
FT                   /locus_tag="Mnod_0150"
FT   CDS_pept        162897..163703
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0150"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap; KEGG:
FT                   met:M446_4609 peptidase S1 and S6 chymotrypsin/Hap"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0150"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55196"
FT                   /db_xref="GOA:B8IUF1"
FT                   /db_xref="InterPro:IPR001254"
FT                   /db_xref="InterPro:IPR001314"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR018114"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF1"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL55196.1"
FT   sig_peptide     162897..163004
FT                   /locus_tag="Mnod_0150"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.898) with cleavage site probability 0.788 at
FT                   residue 36"
FT   gene            complement(163794..164342)
FT                   /locus_tag="Mnod_0151"
FT   CDS_pept        complement(163794..164342)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0151"
FT                   /product="YbaK/prolyl-tRNA synthetase associated region"
FT                   /note="PFAM: YbaK/prolyl-tRNA synthetase associated region;
FT                   KEGG: met:M446_4608 YbaK/prolyl-tRNA synthetase associated
FT                   region"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0151"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55197"
FT                   /db_xref="GOA:B8IUF2"
FT                   /db_xref="InterPro:IPR007214"
FT                   /db_xref="InterPro:IPR036754"
FT                   /db_xref="InterPro:IPR040285"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF2"
FT                   /inference="protein motif:PFAM:PF04073"
FT                   /protein_id="ACL55197.1"
FT   gene            complement(164339..165295)
FT                   /locus_tag="Mnod_0152"
FT   CDS_pept        complement(164339..165295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0152"
FT                   /product="Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit"
FT                   /note="PFAM: Pyridoxal-5'-phosphate-dependent protein beta
FT                   subunit; KEGG: met:M446_4607
FT                   pyridoxal-5'-phosphate-dependent protein beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0152"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55198"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF3"
FT                   /inference="protein motif:PFAM:PF00291"
FT                   /protein_id="ACL55198.1"
FT   gene            complement(165295..166068)
FT                   /locus_tag="Mnod_0153"
FT   CDS_pept        complement(165295..166068)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0153"
FT                   /product="Enoyl-CoA hydratase/isomerase"
FT                   /note="PFAM: Enoyl-CoA hydratase/isomerase; KEGG:
FT                   met:M446_4606 enoyl-CoA hydratase/isomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0153"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55199"
FT                   /db_xref="GOA:B8IUF4"
FT                   /db_xref="InterPro:IPR001753"
FT                   /db_xref="InterPro:IPR014748"
FT                   /db_xref="InterPro:IPR018376"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF4"
FT                   /inference="protein motif:PFAM:PF00378"
FT                   /protein_id="ACL55199.1"
FT   gene            complement(166481..167230)
FT                   /locus_tag="Mnod_0154"
FT   CDS_pept        complement(166481..167230)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0154"
FT                   /product="phosphoesterase PA-phosphatase related"
FT                   /note="PFAM: phosphoesterase PA-phosphatase related; KEGG:
FT                   met:M446_4605 phosphoesterase PA-phosphatase related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0154"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55200"
FT                   /db_xref="GOA:B8IUF5"
FT                   /db_xref="InterPro:IPR000326"
FT                   /db_xref="InterPro:IPR036938"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF5"
FT                   /inference="protein motif:PFAM:PF01569"
FT                   /protein_id="ACL55200.1"
FT   sig_peptide     complement(167090..167230)
FT                   /locus_tag="Mnod_0154"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.706) with cleavage site probability 0.667 at
FT                   residue 47"
FT   gene            complement(167227..167352)
FT                   /locus_tag="Mnod_0155"
FT   CDS_pept        complement(167227..167352)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0155"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4604 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0155"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55201"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55201.1"
FT   gene            167428..168354
FT                   /locus_tag="Mnod_0156"
FT   CDS_pept        167428..168354
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0156"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0156"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55202"
FT                   /db_xref="InterPro:IPR031811"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF7"
FT                   /inference="similar to AA sequence:KEGG:M446_4603"
FT                   /protein_id="ACL55202.1"
FT   gene            168410..169396
FT                   /locus_tag="Mnod_0157"
FT   CDS_pept        168410..169396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0157"
FT                   /product="glutathione S-transferase domain-containing
FT                   protein"
FT                   /note="KEGG: met:M446_4602 glutathione S-transferase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0157"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55203"
FT                   /db_xref="GOA:B8IUF8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR016639"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF8"
FT                   /inference="similar to AA sequence:KEGG:M446_4602"
FT                   /protein_id="ACL55203.1"
FT   gene            169590..169802
FT                   /locus_tag="Mnod_0158"
FT   CDS_pept        169590..169802
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0158"
FT                   /product="ferredoxin protein"
FT                   /note="KEGG: met:M446_4601 ferredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0158"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55204"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUF9"
FT                   /inference="similar to AA sequence:KEGG:M446_4601"
FT                   /protein_id="ACL55204.1"
FT   gene            169795..171093
FT                   /locus_tag="Mnod_0159"
FT   CDS_pept        169795..171093
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0159"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: met:M446_4600 cyclic
FT                   nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0159"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55205"
FT                   /db_xref="GOA:B8IUG0"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG0"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACL55205.1"
FT   gene            171099..172340
FT                   /locus_tag="Mnod_0160"
FT   CDS_pept        171099..172340
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0160"
FT                   /product="cytochrome P450"
FT                   /note="PFAM: cytochrome P450; KEGG: met:M446_4599
FT                   cytochrome P450"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0160"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55206"
FT                   /db_xref="GOA:B8IUG1"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR002397"
FT                   /db_xref="InterPro:IPR036396"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG1"
FT                   /inference="protein motif:PFAM:PF00067"
FT                   /protein_id="ACL55206.1"
FT                   RGPQHLRLAIEGVA"
FT   gene            complement(172544..174295)
FT                   /locus_tag="Mnod_0161"
FT   CDS_pept        complement(172544..174295)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0161"
FT                   /product="cyclic nucleotide-binding protein"
FT                   /note="PFAM: cyclic nucleotide-binding; Patatin; KEGG:
FT                   met:M446_4598 cyclic nucleotide-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0161"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55207"
FT                   /db_xref="GOA:B8IUG2"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR018488"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG2"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACL55207.1"
FT                   AGMAAVR"
FT   gene            complement(174342..175523)
FT                   /locus_tag="Mnod_0162"
FT   CDS_pept        complement(174342..175523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0162"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4597 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0162"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55208"
FT                   /db_xref="InterPro:IPR021445"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG3"
FT                   /inference="similar to AA sequence:KEGG:M446_4597"
FT                   /protein_id="ACL55208.1"
FT   gene            complement(175600..177009)
FT                   /locus_tag="Mnod_0163"
FT   CDS_pept        complement(175600..177009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0163"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: adenylyl cyclase class-3/4/guanylyl cyclase;
FT                   KEGG: rle:pRL110185 putative transmembrane adenylate
FT                   cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0163"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55209"
FT                   /db_xref="GOA:B8IUG4"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG4"
FT                   /inference="protein motif:PFAM:PF00211"
FT                   /protein_id="ACL55209.1"
FT                   TGHPPTVPRPA"
FT   gene            complement(177163..177399)
FT                   /locus_tag="Mnod_0164"
FT   CDS_pept        complement(177163..177399)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0164"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55210"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG5"
FT                   /inference="similar to AA sequence:KEGG:M446_4595"
FT                   /protein_id="ACL55210.1"
FT   gene            complement(177547..177852)
FT                   /locus_tag="Mnod_0165"
FT   CDS_pept        complement(177547..177852)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0165"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4594 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0165"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55211"
FT                   /db_xref="GOA:B8IUG6"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG6"
FT                   /inference="similar to AA sequence:KEGG:M446_4594"
FT                   /protein_id="ACL55211.1"
FT   gene            177952..179169
FT                   /locus_tag="Mnod_0166"
FT   CDS_pept        177952..179169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0166"
FT                   /product="protein of unknown function DUF482"
FT                   /note="PFAM: protein of unknown function DUF482; KEGG:
FT                   met:M446_4593 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0166"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55212"
FT                   /db_xref="InterPro:IPR007434"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG7"
FT                   /inference="protein motif:PFAM:PF04339"
FT                   /protein_id="ACL55212.1"
FT                   YRQGEE"
FT   gene            179441..180400
FT                   /locus_tag="Mnod_0167"
FT   CDS_pept        179441..180400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0167"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4592 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0167"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55213"
FT                   /db_xref="GOA:B8IUG8"
FT                   /db_xref="InterPro:IPR011213"
FT                   /db_xref="InterPro:IPR015797"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG8"
FT                   /inference="similar to AA sequence:KEGG:M446_4592"
FT                   /protein_id="ACL55213.1"
FT   gene            181196..182197
FT                   /locus_tag="Mnod_0168"
FT   CDS_pept        181196..182197
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0168"
FT                   /product="quinolinate synthetase complex, A subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: quinolinate synthetase complex, A subunit;
FT                   PFAM: Quinolinate synthetase A; KEGG: met:M446_4591
FT                   quinolinate synthetase complex, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0168"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55214"
FT                   /db_xref="GOA:B8IUG9"
FT                   /db_xref="InterPro:IPR003473"
FT                   /db_xref="InterPro:IPR023066"
FT                   /db_xref="InterPro:IPR036094"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUG9"
FT                   /inference="protein motif:TFAM:TIGR00550"
FT                   /protein_id="ACL55214.1"
FT   gene            182194..183693
FT                   /locus_tag="Mnod_0169"
FT   CDS_pept        182194..183693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0169"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /EC_number=""
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: met:M446_4590
FT                   L-aspartate oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0169"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55215"
FT                   /db_xref="GOA:B8IUH0"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR005288"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IUH0"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACL55215.1"
FT   gene            183690..184553
FT                   /locus_tag="Mnod_0170"
FT   CDS_pept        183690..184553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0170"
FT                   /product="nicotinate-nucleotide pyrophosphorylase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: nicotinate-nucleotide pyrophosphorylase;
FT                   PFAM: Quinolinate phosphoribosyl transferase; KEGG:
FT                   met:M446_4589 nicotinate-nucleotide pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0170"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55216"
FT                   /db_xref="GOA:B8I9G3"
FT                   /db_xref="InterPro:IPR002638"
FT                   /db_xref="InterPro:IPR004393"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR022412"
FT                   /db_xref="InterPro:IPR027277"
FT                   /db_xref="InterPro:IPR036068"
FT                   /db_xref="InterPro:IPR037128"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G3"
FT                   /inference="protein motif:TFAM:TIGR00078"
FT                   /protein_id="ACL55216.1"
FT                   LGLDVA"
FT   gene            complement(184629..185363)
FT                   /locus_tag="Mnod_0171"
FT   CDS_pept        complement(184629..185363)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0171"
FT                   /product="protein of unknown function DUF1236"
FT                   /note="PFAM: protein of unknown function DUF1236; KEGG:
FT                   met:M446_4588 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0171"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55217"
FT                   /db_xref="InterPro:IPR009642"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G4"
FT                   /inference="protein motif:PFAM:PF06823"
FT                   /protein_id="ACL55217.1"
FT   sig_peptide     complement(185292..185363)
FT                   /locus_tag="Mnod_0171"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.988 at
FT                   residue 24"
FT   gene            complement(185765..186592)
FT                   /locus_tag="Mnod_0172"
FT   CDS_pept        complement(185765..186592)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0172"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4587 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0172"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55218"
FT                   /db_xref="InterPro:IPR021457"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G5"
FT                   /inference="similar to AA sequence:KEGG:M446_4587"
FT                   /protein_id="ACL55218.1"
FT   sig_peptide     complement(186500..186592)
FT                   /locus_tag="Mnod_0172"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 31"
FT   gene            complement(186819..187124)
FT                   /locus_tag="Mnod_0173"
FT   CDS_pept        complement(186819..187124)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0173"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3665 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0173"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55219"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G6"
FT                   /inference="similar to AA sequence:KEGG:M446_3665"
FT                   /protein_id="ACL55219.1"
FT   gene            complement(187247..189949)
FT                   /locus_tag="Mnod_0174"
FT   CDS_pept        complement(187247..189949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0174"
FT                   /product="aconitate hydratase 1"
FT                   /note="TIGRFAM: aconitate hydratase 1; PFAM: aconitate
FT                   hydratase domain protein; KEGG: met:M446_3664 aconitate
FT                   hydratase 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0174"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55220"
FT                   /db_xref="GOA:B8I9G7"
FT                   /db_xref="InterPro:IPR000573"
FT                   /db_xref="InterPro:IPR001030"
FT                   /db_xref="InterPro:IPR006249"
FT                   /db_xref="InterPro:IPR015928"
FT                   /db_xref="InterPro:IPR015931"
FT                   /db_xref="InterPro:IPR018136"
FT                   /db_xref="InterPro:IPR036008"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G7"
FT                   /inference="protein motif:TFAM:TIGR01341"
FT                   /protein_id="ACL55220.1"
FT   gene            190529..191176
FT                   /locus_tag="Mnod_0175"
FT   CDS_pept        190529..191176
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0175"
FT                   /product="heme exporter protein CcmA"
FT                   /note="KEGG: met:M446_3663 heme exporter protein CcmA;
FT                   TIGRFAM: heme exporter protein CcmA; PFAM: ABC transporter
FT                   related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0175"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55221"
FT                   /db_xref="GOA:B8I9G8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005895"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G8"
FT                   /inference="protein motif:TFAM:TIGR01189"
FT                   /protein_id="ACL55221.1"
FT   gene            191173..191841
FT                   /locus_tag="Mnod_0176"
FT   CDS_pept        191173..191841
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0176"
FT                   /product="heme exporter protein CcmB"
FT                   /note="TIGRFAM: heme exporter protein CcmB; PFAM:
FT                   cytochrome c-type biogenesis protein CcmB; KEGG:
FT                   met:M446_3662 heme exporter protein CcmB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0176"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55222"
FT                   /db_xref="GOA:B8I9G9"
FT                   /db_xref="InterPro:IPR003544"
FT                   /db_xref="InterPro:IPR026031"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9G9"
FT                   /inference="protein motif:TFAM:TIGR01190"
FT                   /protein_id="ACL55222.1"
FT                   "
FT   gene            complement(191851..192024)
FT                   /locus_tag="Mnod_0177"
FT   CDS_pept        complement(191851..192024)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0177"
FT                   /product="protein of unknown function DUF1328"
FT                   /note="PFAM: protein of unknown function DUF1328; KEGG:
FT                   met:M446_3661 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0177"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55223"
FT                   /db_xref="GOA:B8I9H0"
FT                   /db_xref="InterPro:IPR009760"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H0"
FT                   /inference="protein motif:PFAM:PF07043"
FT                   /protein_id="ACL55223.1"
FT                   VIFAFAVGQAVF"
FT   sig_peptide     complement(191947..192024)
FT                   /locus_tag="Mnod_0177"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.474 at
FT                   residue 26"
FT   gene            192140..192904
FT                   /locus_tag="Mnod_0178"
FT   CDS_pept        192140..192904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0178"
FT                   /product="heme exporter protein CcmC"
FT                   /note="TIGRFAM: heme exporter protein CcmC; PFAM:
FT                   cytochrome c assembly protein; KEGG: met:M446_3660 heme
FT                   exporter protein CcmC"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0178"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55224"
FT                   /db_xref="GOA:B8I9H1"
FT                   /db_xref="InterPro:IPR002541"
FT                   /db_xref="InterPro:IPR003557"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H1"
FT                   /inference="protein motif:TFAM:TIGR01191"
FT                   /protein_id="ACL55224.1"
FT   sig_peptide     192140..192274
FT                   /locus_tag="Mnod_0178"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.804) with cleavage site probability 0.506 at
FT                   residue 45"
FT   gene            192932..193078
FT                   /locus_tag="Mnod_0179"
FT   CDS_pept        192932..193078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0179"
FT                   /product="heme exporter protein CcmD"
FT                   /note="TIGRFAM: heme exporter protein CcmD; PFAM: Heme
FT                   exporter protein D (CcmD); KEGG: met:M446_3659 heme
FT                   exporter protein CcmD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0179"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55225"
FT                   /db_xref="GOA:B8I9H2"
FT                   /db_xref="InterPro:IPR007078"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H2"
FT                   /inference="protein motif:TFAM:TIGR03141"
FT                   /protein_id="ACL55225.1"
FT                   RGA"
FT   gene            193075..193662
FT                   /locus_tag="Mnod_0180"
FT   CDS_pept        193075..193662
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0180"
FT                   /product="periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE"
FT                   /note="TIGRFAM: periplasmic protein thiol/disulphide
FT                   oxidoreductase DsbE; PFAM: alkyl hydroperoxide reductase/
FT                   Thiol specific antioxidant/ Mal allergen; Redoxin domain
FT                   protein; Thioredoxin domain; KEGG: met:M446_3658
FT                   periplasmic protein thiol--disulphide oxidoreductase DsbE"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0180"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55226"
FT                   /db_xref="GOA:B8I9H3"
FT                   /db_xref="InterPro:IPR000866"
FT                   /db_xref="InterPro:IPR004799"
FT                   /db_xref="InterPro:IPR013766"
FT                   /db_xref="InterPro:IPR017937"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H3"
FT                   /inference="protein motif:TFAM:TIGR00385"
FT                   /protein_id="ACL55226.1"
FT   gene            193897..194949
FT                   /locus_tag="Mnod_0181"
FT   CDS_pept        193897..194949
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0181"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: rpe:RPE_4214 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0181"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55227"
FT                   /db_xref="GOA:B8I9H4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55227.1"
FT                   PMGGAEPARA"
FT   gene            complement(195284..195994)
FT                   /locus_tag="Mnod_0182"
FT   CDS_pept        complement(195284..195994)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0182"
FT                   /product="transcription activator effector binding"
FT                   /note="PFAM: transcription activator effector binding;
FT                   KEGG: met:M446_3657 transcription activator effector
FT                   binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0182"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55228"
FT                   /db_xref="InterPro:IPR010499"
FT                   /db_xref="InterPro:IPR011256"
FT                   /db_xref="InterPro:IPR029442"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H5"
FT                   /inference="protein motif:PFAM:PF06445"
FT                   /protein_id="ACL55228.1"
FT                   SDTGLEVNIYALPK"
FT   sig_peptide     complement(195914..195994)
FT                   /locus_tag="Mnod_0182"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 27"
FT   gene            196165..197046
FT                   /locus_tag="Mnod_0183"
FT   CDS_pept        196165..197046
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0183"
FT                   /product="diaminopimelate epimerase"
FT                   /EC_number=""
FT                   /note="PFAM: diaminopimelate epimerase; KEGG: met:M446_3656
FT                   diaminopimelate epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0183"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55229"
FT                   /db_xref="GOA:B8I9H6"
FT                   /db_xref="InterPro:IPR001653"
FT                   /db_xref="InterPro:IPR018510"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9H6"
FT                   /inference="protein motif:PFAM:PF01678"
FT                   /protein_id="ACL55229.1"
FT                   GTLAPSLFAGAA"
FT   gene            197046..198284
FT                   /locus_tag="Mnod_0184"
FT   CDS_pept        197046..198284
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0184"
FT                   /product="MiaB-like tRNA modifying enzyme"
FT                   /note="KEGG: met:M446_3655 MiaB-like tRNA modifying enzyme;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; MiaB-like
FT                   tRNA modifying enzyme; PFAM: Radical SAM domain protein;
FT                   Protein of unknown function UPF0004; SMART: Elongator
FT                   protein 3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0184"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55230"
FT                   /db_xref="GOA:B8I9H7"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006467"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H7"
FT                   /inference="protein motif:TFAM:TIGR01579"
FT                   /protein_id="ACL55230.1"
FT                   AITGHDGRVLAAA"
FT   gene            complement(198408..199387)
FT                   /pseudo
FT                   /locus_tag="Mnod_0185"
FT   gene            complement(199716..200144)
FT                   /locus_tag="Mnod_0186"
FT   CDS_pept        complement(199716..200144)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0186"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   met:M446_3654 thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0186"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55231"
FT                   /db_xref="InterPro:IPR003736"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H8"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL55231.1"
FT   gene            200219..200908
FT                   /locus_tag="Mnod_0187"
FT   CDS_pept        200219..200908
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0187"
FT                   /product="Phosphoglycerate mutase"
FT                   /note="PFAM: Phosphoglycerate mutase; KEGG: met:M446_3653
FT                   phosphoglycerate mutase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0187"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55232"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H9"
FT                   /inference="protein motif:PFAM:PF00300"
FT                   /protein_id="ACL55232.1"
FT                   EGGGPAA"
FT   gene            complement(200928..203126)
FT                   /locus_tag="Mnod_0188"
FT   CDS_pept        complement(200928..203126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0188"
FT                   /product="malate synthase G"
FT                   /EC_number=""
FT                   /note="TIGRFAM: malate synthase G; PFAM: malate synthase;
FT                   KEGG: met:M446_3652 malate synthase G"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0188"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55233"
FT                   /db_xref="GOA:B8I9I0"
FT                   /db_xref="InterPro:IPR001465"
FT                   /db_xref="InterPro:IPR006253"
FT                   /db_xref="InterPro:IPR011076"
FT                   /db_xref="InterPro:IPR023310"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I0"
FT                   /inference="protein motif:TFAM:TIGR01345"
FT                   /protein_id="ACL55233.1"
FT   gene            203447..204169
FT                   /locus_tag="Mnod_0189"
FT   CDS_pept        203447..204169
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0189"
FT                   /product="putative periplasmic ligand-binding sensor
FT                   protein"
FT                   /note="KEGG: met:M446_3651 putative periplasmic
FT                   ligand-binding sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0189"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55234"
FT                   /db_xref="InterPro:IPR018648"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I1"
FT                   /inference="similar to AA sequence:KEGG:M446_3651"
FT                   /protein_id="ACL55234.1"
FT                   DASFDDGDGDSGGGDDWV"
FT   gene            complement(204335..205126)
FT                   /locus_tag="Mnod_0190"
FT   CDS_pept        complement(204335..205126)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0190"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: ErfK/YbiS/YcfS/YnhG family protein; KEGG:
FT                   met:M446_3650 ErfK/YbiS/YcfS/YnhG family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0190"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55235"
FT                   /db_xref="GOA:B8I9I2"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I2"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55235.1"
FT   sig_peptide     complement(205058..205126)
FT                   /locus_tag="Mnod_0190"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.681 at
FT                   residue 23"
FT   gene            205381..206091
FT                   /locus_tag="Mnod_0191"
FT   CDS_pept        205381..206091
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0191"
FT                   /product="putative chemotaxis phosphatase, CheZ"
FT                   /note="KEGG: met:M446_3649 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0191"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55236"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I3"
FT                   /inference="similar to AA sequence:KEGG:M446_3649"
FT                   /protein_id="ACL55236.1"
FT                   PGHVDQADIDALFN"
FT   gene            complement(206205..206281)
FT                   /locus_tag="Mnod_R0003"
FT                   /note="tRNA-Met9"
FT   tRNA            complement(206205..206281)
FT                   /locus_tag="Mnod_R0003"
FT                   /product="tRNA-Met"
FT   gene            complement(206360..206474)
FT                   /locus_tag="Mnod_R0004"
FT   rRNA            complement(206360..206474)
FT                   /locus_tag="Mnod_R0004"
FT                   /product="5S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(206573..209380)
FT                   /locus_tag="Mnod_R0005"
FT   rRNA            complement(206573..209380)
FT                   /locus_tag="Mnod_R0005"
FT                   /product="23S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(209639..209714)
FT                   /locus_tag="Mnod_R0006"
FT                   /note="tRNA-Ala10"
FT   tRNA            complement(209639..209714)
FT                   /locus_tag="Mnod_R0006"
FT                   /product="tRNA-Ala"
FT   gene            complement(209741..209817)
FT                   /locus_tag="Mnod_R0007"
FT                   /note="tRNA-Ile7"
FT   tRNA            complement(209741..209817)
FT                   /locus_tag="Mnod_R0007"
FT                   /product="tRNA-Ile"
FT   gene            complement(209967..211438)
FT                   /locus_tag="Mnod_R0008"
FT   rRNA            complement(209967..211438)
FT                   /locus_tag="Mnod_R0008"
FT                   /product="16S ribosomal RNA"
FT                   /note="RNAmmer 1.2, Lagesen et al., Nucleic Acids Res. Apr2
FT                   2, 2007"
FT   gene            complement(212089..212763)
FT                   /locus_tag="Mnod_0192"
FT   CDS_pept        complement(212089..212763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0192"
FT                   /product="Isoprenylcysteine carboxyl methyltransferase"
FT                   /note="PFAM: Isoprenylcysteine carboxyl methyltransferase;
FT                   KEGG: mlo:mll0909 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0192"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55237"
FT                   /db_xref="GOA:B8I9I4"
FT                   /db_xref="InterPro:IPR007318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I4"
FT                   /inference="protein motif:PFAM:PF04140"
FT                   /protein_id="ACL55237.1"
FT                   IW"
FT   sig_peptide     complement(212680..212763)
FT                   /locus_tag="Mnod_0192"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.995) with cleavage site probability 0.975 at
FT                   residue 28"
FT   gene            213151..214866
FT                   /locus_tag="Mnod_0193"
FT   CDS_pept        213151..214866
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0193"
FT                   /product="potassium-transporting ATPase, A subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: potassium-transporting ATPase, A subunit;
FT                   PFAM: K transporting ATPase A subunit; KEGG:
FT                   mrd:Mrad2831_0209 potassium-transporting ATPase, A subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0193"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55238"
FT                   /db_xref="GOA:B8I9I5"
FT                   /db_xref="InterPro:IPR004623"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9I5"
FT                   /inference="protein motif:TFAM:TIGR00680"
FT                   /protein_id="ACL55238.1"
FT   gene            214868..215110
FT                   /locus_tag="Mnod_0194"
FT   CDS_pept        214868..215110
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0194"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0194"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55239"
FT                   /db_xref="GOA:B8I9I6"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55239.1"
FT   gene            215171..217276
FT                   /locus_tag="Mnod_0195"
FT   CDS_pept        215171..217276
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0195"
FT                   /product="K+-transporting ATPase, B subunit"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; K+-transporting ATPase, B
FT                   subunit; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   mrd:Mrad2831_0207 K+-transporting ATPase, B subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0195"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55240"
FT                   /db_xref="GOA:B8I9I7"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR006391"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I7"
FT                   /inference="protein motif:TFAM:TIGR01497"
FT                   /protein_id="ACL55240.1"
FT                   LAVSALL"
FT   sig_peptide     215171..215233
FT                   /locus_tag="Mnod_0195"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.733) with cleavage site probability 0.443 at
FT                   residue 21"
FT   gene            217354..217959
FT                   /locus_tag="Mnod_0196"
FT   CDS_pept        217354..217959
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0196"
FT                   /product="potassium-transporting ATPase, C subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: potassium-transporting ATPase, C subunit;
FT                   PFAM: K transporting ATPase KdpC subunit; KEGG:
FT                   mrd:Mrad2831_0206 potassium-transporting ATPase, C subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0196"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55241"
FT                   /db_xref="GOA:B8I9I8"
FT                   /db_xref="InterPro:IPR003820"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9I8"
FT                   /inference="protein motif:TFAM:TIGR00681"
FT                   /protein_id="ACL55241.1"
FT   sig_peptide     217354..217434
FT                   /locus_tag="Mnod_0196"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.978) with cleavage site probability 0.442 at
FT                   residue 27"
FT   gene            217982..220705
FT                   /locus_tag="Mnod_0197"
FT   CDS_pept        217982..220705
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0197"
FT                   /product="osmosensitive K+ channel signal transduction
FT                   histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase A domain protein; Osmosensitive K channel
FT                   His kinase sensor; UspA domain protein; KEGG:
FT                   mrd:Mrad2831_0205 osmosensitive K+ channel signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0197"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55242"
FT                   /db_xref="GOA:B8I9I9"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR003852"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR025201"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="InterPro:IPR038318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9I9"
FT                   /inference="protein motif:PFAM:PF02702"
FT                   /protein_id="ACL55242.1"
FT   gene            220702..220893
FT                   /locus_tag="Mnod_0198"
FT   CDS_pept        220702..220893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0198"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0198"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55243"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55243.1"
FT                   SWMPFGGERSSPSRGPLP"
FT   gene            220890..221360
FT                   /locus_tag="Mnod_0199"
FT   CDS_pept        220890..221360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0199"
FT                   /product="putative PTS IIA-like nitrogen-regulatory protein
FT                   PtsN"
FT                   /note="PFAM: phosphoenolpyruvate-dependent sugar
FT                   phosphotransferase system EIIA 2; KEGG: mrd:Mrad2831_0203
FT                   putative PTS IIA-like nitrogen-regulatory protein PtsN"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0199"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55244"
FT                   /db_xref="GOA:B8I9J1"
FT                   /db_xref="InterPro:IPR002178"
FT                   /db_xref="InterPro:IPR016152"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J1"
FT                   /inference="protein motif:PFAM:PF00359"
FT                   /protein_id="ACL55244.1"
FT   gene            complement(221341..222123)
FT                   /locus_tag="Mnod_0200"
FT   CDS_pept        complement(221341..222123)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0200"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   rle:pRL120704 putative hydratase/decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0200"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55245"
FT                   /db_xref="GOA:B8I9J2"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J2"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL55245.1"
FT   gene            complement(222484..224025)
FT                   /locus_tag="Mnod_0201"
FT   CDS_pept        complement(222484..224025)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0201"
FT                   /product="alpha amylase catalytic region"
FT                   /note="PFAM: alpha amylase catalytic region; SMART: alpha
FT                   amylase catalytic sub domain; KEGG: alpha amylase 3 (IC)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0201"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55246"
FT                   /db_xref="GOA:B8I9J3"
FT                   /db_xref="InterPro:IPR006047"
FT                   /db_xref="InterPro:IPR012850"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J3"
FT                   /inference="protein motif:PFAM:PF00128"
FT                   /protein_id="ACL55246.1"
FT   sig_peptide     complement(223945..224025)
FT                   /locus_tag="Mnod_0201"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.747 at
FT                   residue 27"
FT   gene            complement(224145..224357)
FT                   /locus_tag="Mnod_0202"
FT   CDS_pept        complement(224145..224357)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0202"
FT                   /product="protein of unknown function DUF1458"
FT                   /note="PFAM: protein of unknown function DUF1458; KEGG:
FT                   met:M446_1265 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0202"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55247"
FT                   /db_xref="InterPro:IPR009923"
FT                   /db_xref="InterPro:IPR025543"
FT                   /db_xref="InterPro:IPR036694"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J4"
FT                   /inference="protein motif:PFAM:PF07311"
FT                   /protein_id="ACL55247.1"
FT   gene            224742..226736
FT                   /locus_tag="Mnod_0203"
FT   CDS_pept        224742..226736
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0203"
FT                   /product="glycosyl transferase family 51"
FT                   /note="PFAM: glycosyl transferase family 51;
FT                   penicillin-binding protein transpeptidase; KEGG:
FT                   met:M446_3785 glycosyl transferase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0203"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55248"
FT                   /db_xref="GOA:B8I9J5"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J5"
FT                   /inference="protein motif:PFAM:PF00912"
FT                   /protein_id="ACL55248.1"
FT   sig_peptide     224742..224807
FT                   /locus_tag="Mnod_0203"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 22"
FT   gene            227066..227308
FT                   /locus_tag="Mnod_0204"
FT   CDS_pept        227066..227308
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0204"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_1408 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0204"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55249"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J6"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_1408"
FT                   /protein_id="ACL55249.1"
FT   gene            227335..228603
FT                   /locus_tag="Mnod_0205"
FT   CDS_pept        227335..228603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0205"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3789 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0205"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55250"
FT                   /db_xref="InterPro:IPR019236"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J7"
FT                   /inference="similar to AA sequence:KEGG:M446_3789"
FT                   /protein_id="ACL55250.1"
FT   sig_peptide     227335..227418
FT                   /locus_tag="Mnod_0205"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.984) with cleavage site probability 0.977 at
FT                   residue 28"
FT   gene            complement(228937..229019)
FT                   /locus_tag="Mnod_R0009"
FT                   /note="tRNA-Tyr1"
FT   tRNA            complement(228937..229019)
FT                   /locus_tag="Mnod_R0009"
FT                   /product="tRNA-Tyr"
FT   gene            complement(229118..230911)
FT                   /locus_tag="Mnod_0206"
FT   CDS_pept        complement(229118..230911)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0206"
FT                   /product="single-stranded-DNA-specific exonuclease RecJ"
FT                   /note="TIGRFAM: single-stranded-DNA-specific exonuclease
FT                   RecJ; PFAM: phosphoesterase RecJ domain protein;
FT                   phosphoesterase DHHA1; KEGG: met:M446_3141
FT                   single-stranded-DNA-specific exonuclease RecJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0206"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55251"
FT                   /db_xref="GOA:B8I9J8"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR004610"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="InterPro:IPR041122"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J8"
FT                   /inference="protein motif:TFAM:TIGR00644"
FT                   /protein_id="ACL55251.1"
FT   gene            complement(231185..232582)
FT                   /locus_tag="Mnod_0207"
FT   CDS_pept        complement(231185..232582)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0207"
FT                   /product="NAD(P) transhydrogenase beta subunit"
FT                   /EC_number=""
FT                   /note="PFAM: NAD(P) transhydrogenase beta subunit; KEGG:
FT                   met:M446_3142 NAD(P)(+) transhydrogenase (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0207"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55252"
FT                   /db_xref="GOA:B8I9J9"
FT                   /db_xref="InterPro:IPR012136"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR034300"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9J9"
FT                   /inference="protein motif:PFAM:PF02233"
FT                   /protein_id="ACL55252.1"
FT                   DEIVKSF"
FT   gene            complement(232587..233036)
FT                   /locus_tag="Mnod_0208"
FT   CDS_pept        complement(232587..233036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0208"
FT                   /product="PntAB, NAD(P) transhydrogenase, alpha2 subunit"
FT                   /note="KEGG: met:M446_3143 PntAB, NAD(P) transhydrogenase,
FT                   alpha2 subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0208"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55253"
FT                   /db_xref="GOA:B8I9K0"
FT                   /db_xref="InterPro:IPR024605"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K0"
FT                   /inference="similar to AA sequence:KEGG:M446_3143"
FT                   /protein_id="ACL55253.1"
FT   gene            complement(233054..234193)
FT                   /locus_tag="Mnod_0209"
FT   CDS_pept        complement(233054..234193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0209"
FT                   /product="alanine dehydrogenase/PNT domain protein"
FT                   /EC_number=""
FT                   /note="PFAM: alanine dehydrogenase/PNT domain protein;
FT                   KEGG: met:M446_3144 NAD(P)(+) transhydrogenase
FT                   (AB-specific)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0209"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55254"
FT                   /db_xref="GOA:B8I9K1"
FT                   /db_xref="InterPro:IPR007698"
FT                   /db_xref="InterPro:IPR007886"
FT                   /db_xref="InterPro:IPR008143"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K1"
FT                   /inference="protein motif:PFAM:PF01262"
FT                   /protein_id="ACL55254.1"
FT   gene            complement(234413..234706)
FT                   /locus_tag="Mnod_0210"
FT   CDS_pept        complement(234413..234706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0210"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0210"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55255"
FT                   /db_xref="GOA:B8I9K2"
FT                   /db_xref="InterPro:IPR012422"
FT                   /db_xref="InterPro:IPR036596"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K2"
FT                   /inference="similar to AA sequence:KEGG:M446_3145"
FT                   /protein_id="ACL55255.1"
FT   gene            complement(234853..236214)
FT                   /locus_tag="Mnod_0211"
FT   CDS_pept        complement(234853..236214)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0211"
FT                   /product="ABC-1 domain protein"
FT                   /note="PFAM: ABC-1 domain protein; KEGG: met:M446_3146
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0211"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55256"
FT                   /db_xref="InterPro:IPR004147"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR034646"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K3"
FT                   /inference="protein motif:PFAM:PF03109"
FT                   /protein_id="ACL55256.1"
FT   gene            complement(236430..236741)
FT                   /locus_tag="Mnod_0212"
FT   CDS_pept        complement(236430..236741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0212"
FT                   /product="protein of unknown function DUF156"
FT                   /note="PFAM: protein of unknown function DUF156; KEGG:
FT                   met:M446_3147 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0212"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55257"
FT                   /db_xref="GOA:B8I9K4"
FT                   /db_xref="InterPro:IPR003735"
FT                   /db_xref="InterPro:IPR038390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K4"
FT                   /inference="protein motif:PFAM:PF02583"
FT                   /protein_id="ACL55257.1"
FT   gene            complement(237159..239009)
FT                   /locus_tag="Mnod_0213"
FT   CDS_pept        complement(237159..239009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0213"
FT                   /product="oligoendopeptidase, pepF/M3 family"
FT                   /note="TIGRFAM: oligoendopeptidase, pepF/M3 family; PFAM:
FT                   peptidase M3A and M3B thimet/oligopeptidase F;
FT                   Oligopeptidase F; KEGG: met:M446_3148 PepF/M3 family
FT                   oligoendopeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0213"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55258"
FT                   /db_xref="GOA:B8I9K5"
FT                   /db_xref="InterPro:IPR001567"
FT                   /db_xref="InterPro:IPR011977"
FT                   /db_xref="InterPro:IPR013647"
FT                   /db_xref="InterPro:IPR042088"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K5"
FT                   /inference="protein motif:TFAM:TIGR02290"
FT                   /protein_id="ACL55258.1"
FT   gene            239290..240777
FT                   /locus_tag="Mnod_0214"
FT   CDS_pept        239290..240777
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0214"
FT                   /product="two component, sigma54 specific, transcriptional
FT                   regulator, Fis family"
FT                   /note="PFAM: response regulator receiver; sigma-54 factor
FT                   interaction domain-containing protein; helix-turn-helix
FT                   Fis-type; ATPase associated with various cellular
FT                   activities AAA_5; SMART: AAA ATPase; KEGG: met:M446_3149
FT                   two component, sigma54 specific, fis family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0214"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55259"
FT                   /db_xref="GOA:B8I9K6"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR002078"
FT                   /db_xref="InterPro:IPR002197"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR025662"
FT                   /db_xref="InterPro:IPR025943"
FT                   /db_xref="InterPro:IPR025944"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K6"
FT                   /inference="protein motif:PFAM:PF00158"
FT                   /protein_id="ACL55259.1"
FT   gene            240971..242983
FT                   /locus_tag="Mnod_0215"
FT   CDS_pept        240971..242983
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0215"
FT                   /product="ErfK/YbiS/YcfS/YnhG family protein"
FT                   /note="PFAM: Peptidoglycan-binding domain 1 protein;
FT                   ErfK/YbiS/YcfS/YnhG family protein; KEGG: met:M446_3150
FT                   peptidoglycan binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0215"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55260"
FT                   /db_xref="GOA:B8I9K7"
FT                   /db_xref="InterPro:IPR002477"
FT                   /db_xref="InterPro:IPR005490"
FT                   /db_xref="InterPro:IPR036365"
FT                   /db_xref="InterPro:IPR038063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K7"
FT                   /inference="protein motif:PFAM:PF03734"
FT                   /protein_id="ACL55260.1"
FT   sig_peptide     240971..241051
FT                   /locus_tag="Mnod_0215"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.729 at
FT                   residue 27"
FT   gene            243210..244742
FT                   /locus_tag="Mnod_0216"
FT   CDS_pept        243210..244742
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0216"
FT                   /product="protein of unknown function DUF882"
FT                   /note="PFAM: peptidase M15B and M15C DD-carboxypeptidase
FT                   VanY/endolysin; protein of unknown function DUF882;
FT                   Peptidase M15A; KEGG: met:M446_3151 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0216"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55261"
FT                   /db_xref="InterPro:IPR009045"
FT                   /db_xref="InterPro:IPR010275"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K8"
FT                   /inference="protein motif:PFAM:PF05951"
FT                   /protein_id="ACL55261.1"
FT   gene            244924..245100
FT                   /pseudo
FT                   /locus_tag="Mnod_0217"
FT   gene            245210..246619
FT                   /locus_tag="Mnod_0218"
FT   CDS_pept        245210..246619
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0218"
FT                   /product="Amidase"
FT                   /EC_number=""
FT                   /note="PFAM: Amidase; KEGG: met:M446_3159 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0218"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55262"
FT                   /db_xref="GOA:B8I9K9"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9K9"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL55262.1"
FT                   WPVLDAPRQPT"
FT   gene            246627..247130
FT                   /locus_tag="Mnod_0219"
FT   CDS_pept        246627..247130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0219"
FT                   /product="protein of unknown function DUF82"
FT                   /note="PFAM: protein of unknown function DUF82; KEGG:
FT                   met:M446_3160 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0219"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55263"
FT                   /db_xref="InterPro:IPR002782"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L0"
FT                   /inference="protein motif:PFAM:PF01927"
FT                   /protein_id="ACL55263.1"
FT                   GGRS"
FT   gene            247258..248010
FT                   /locus_tag="Mnod_0220"
FT   CDS_pept        247258..248010
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0220"
FT                   /product="HAD-superfamily hydrolase, subfamily IIB"
FT                   /EC_number=""
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IIB;
FT                   PFAM: trehalose-phosphatase; KEGG: met:M446_3162 HAD family
FT                   hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0220"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55264"
FT                   /db_xref="GOA:B8I9L1"
FT                   /db_xref="InterPro:IPR003337"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L1"
FT                   /inference="protein motif:TFAM:TIGR01484"
FT                   /protein_id="ACL55264.1"
FT   gene            248088..248510
FT                   /locus_tag="Mnod_0221"
FT   CDS_pept        248088..248510
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0221"
FT                   /product="peptidylprolyl isomerase FKBP-type"
FT                   /note="PFAM: peptidylprolyl isomerase FKBP-type; KEGG:
FT                   met:M446_3163 peptidylprolyl isomerase FKBP-type"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0221"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55265"
FT                   /db_xref="GOA:B8I9L2"
FT                   /db_xref="InterPro:IPR001179"
FT                   /db_xref="InterPro:IPR023566"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L2"
FT                   /inference="protein motif:PFAM:PF00254"
FT                   /protein_id="ACL55265.1"
FT   sig_peptide     248088..248156
FT                   /locus_tag="Mnod_0221"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.601 at
FT                   residue 23"
FT   gene            complement(248673..249404)
FT                   /locus_tag="Mnod_0222"
FT   CDS_pept        complement(248673..249404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0222"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_3165 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0222"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55266"
FT                   /db_xref="GOA:B8I9L3"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L3"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55266.1"
FT   gene            complement(249401..250153)
FT                   /locus_tag="Mnod_0223"
FT   CDS_pept        complement(249401..250153)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0223"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_3166 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0223"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55267"
FT                   /db_xref="GOA:B8I9L4"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L4"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55267.1"
FT   gene            complement(250158..251483)
FT                   /locus_tag="Mnod_0224"
FT   CDS_pept        complement(250158..251483)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0224"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_3167 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0224"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55268"
FT                   /db_xref="GOA:B8I9L5"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L5"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55268.1"
FT   gene            complement(251480..252433)
FT                   /locus_tag="Mnod_0225"
FT   CDS_pept        complement(251480..252433)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0225"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_3168 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0225"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55269"
FT                   /db_xref="GOA:B8I9L6"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L6"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55269.1"
FT   sig_peptide     complement(252308..252433)
FT                   /locus_tag="Mnod_0225"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.608) with cleavage site probability 0.388 at
FT                   residue 42"
FT   gene            complement(252543..253781)
FT                   /locus_tag="Mnod_0226"
FT   CDS_pept        complement(252543..253781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0226"
FT                   /product="ABC transporter, periplasmic branched chain amino
FT                   acid binding protein"
FT                   /note="KEGG: met:M446_3169 ABC transporter, periplasmic
FT                   branched chain amino acid binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0226"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55270"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L7"
FT                   /inference="similar to AA sequence:KEGG:M446_3169"
FT                   /protein_id="ACL55270.1"
FT                   TLLPTTCKMDRPS"
FT   sig_peptide     complement(253710..253781)
FT                   /locus_tag="Mnod_0226"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 24"
FT   gene            254049..254924
FT                   /locus_tag="Mnod_0227"
FT   CDS_pept        254049..254924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0227"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: met:M446_3170 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0227"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55271"
FT                   /db_xref="GOA:B8I9L8"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L8"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL55271.1"
FT                   VDEIPRRGGG"
FT   gene            255057..255815
FT                   /locus_tag="Mnod_0228"
FT   CDS_pept        255057..255815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0228"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_3175 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0228"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55272"
FT                   /db_xref="GOA:B8I9L9"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9L9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55272.1"
FT   sig_peptide     255057..255146
FT                   /locus_tag="Mnod_0228"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.615) with cleavage site probability 0.291 at
FT                   residue 30"
FT   gene            255827..256708
FT                   /locus_tag="Mnod_0229"
FT   CDS_pept        255827..256708
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0229"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   met:M446_3176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0229"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55273"
FT                   /db_xref="GOA:B8I9M0"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M0"
FT                   /inference="protein motif:PFAM:PF05853"
FT                   /protein_id="ACL55273.1"
FT                   AEARALFGLAPR"
FT   gene            complement(256727..257140)
FT                   /locus_tag="Mnod_0230"
FT   CDS_pept        complement(256727..257140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0230"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   met:M446_3177 XRE family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0230"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55274"
FT                   /db_xref="GOA:B8I9M1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M1"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL55274.1"
FT   gene            complement(257161..258831)
FT                   /locus_tag="Mnod_0231"
FT   CDS_pept        complement(257161..258831)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0231"
FT                   /product="apolipoprotein N-acyltransferase"
FT                   /note="TIGRFAM: apolipoprotein N-acyltransferase; PFAM:
FT                   Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: met:M446_3178 apolipoprotein
FT                   N-acyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0231"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55275"
FT                   /db_xref="GOA:B8I9M2"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR004563"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M2"
FT                   /inference="protein motif:TFAM:TIGR00546"
FT                   /protein_id="ACL55275.1"
FT   gene            complement(259265..260386)
FT                   /locus_tag="Mnod_0232"
FT   CDS_pept        complement(259265..260386)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0232"
FT                   /product="CBS domain containing protein"
FT                   /note="PFAM: CBS domain containing protein;
FT                   transporter-associated region; KEGG: met:M446_3179 CBS
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0232"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55276"
FT                   /db_xref="GOA:B8I9M3"
FT                   /db_xref="InterPro:IPR000644"
FT                   /db_xref="InterPro:IPR005170"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M3"
FT                   /inference="protein motif:PFAM:PF00571"
FT                   /protein_id="ACL55276.1"
FT   gene            complement(260421..260900)
FT                   /locus_tag="Mnod_0233"
FT   CDS_pept        complement(260421..260900)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0233"
FT                   /product="protein of unknown function UPF0054"
FT                   /note="PFAM: protein of unknown function UPF0054; KEGG:
FT                   met:M446_3180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0233"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55277"
FT                   /db_xref="GOA:B8I9M4"
FT                   /db_xref="InterPro:IPR002036"
FT                   /db_xref="InterPro:IPR023091"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M4"
FT                   /inference="protein motif:PFAM:PF02130"
FT                   /protein_id="ACL55277.1"
FT   gene            complement(260926..262035)
FT                   /locus_tag="Mnod_0234"
FT   CDS_pept        complement(260926..262035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0234"
FT                   /product="PhoH family protein"
FT                   /note="PFAM: PhoH family protein; KEGG: met:M446_3181 PhoH
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0234"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55278"
FT                   /db_xref="GOA:B8I9M5"
FT                   /db_xref="InterPro:IPR003714"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M5"
FT                   /inference="protein motif:PFAM:PF02562"
FT                   /protein_id="ACL55278.1"
FT   gene            complement(262047..263390)
FT                   /locus_tag="Mnod_0235"
FT   CDS_pept        complement(262047..263390)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0235"
FT                   /product="RNA modification enzyme, MiaB family"
FT                   /EC_number=""
FT                   /note="KEGG: met:M446_3182 RNA modification protein;
FT                   TIGRFAM: RNA modification enzyme, MiaB family; tRNA-i(6)A37
FT                   thiotransferase enzyme MiaB; PFAM: deoxyribonuclease/rho
FT                   motif-related TRAM; Radical SAM domain protein; Protein of
FT                   unknown function UPF0004; SMART: Elongator protein
FT                   3/MiaB/NifB"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0235"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55279"
FT                   /db_xref="GOA:B8I9M6"
FT                   /db_xref="InterPro:IPR002792"
FT                   /db_xref="InterPro:IPR005839"
FT                   /db_xref="InterPro:IPR006463"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013848"
FT                   /db_xref="InterPro:IPR020612"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR038135"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M6"
FT                   /inference="protein motif:TFAM:TIGR00089"
FT                   /protein_id="ACL55279.1"
FT   gene            complement(263569..263973)
FT                   /locus_tag="Mnod_0236"
FT   CDS_pept        complement(263569..263973)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0236"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3183 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0236"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55280"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M7"
FT                   /inference="similar to AA sequence:KEGG:M446_3183"
FT                   /protein_id="ACL55280.1"
FT   sig_peptide     complement(263899..263973)
FT                   /locus_tag="Mnod_0236"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.617 at
FT                   residue 25"
FT   gene            complement(264029..265036)
FT                   /locus_tag="Mnod_0237"
FT   CDS_pept        complement(264029..265036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0237"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3184 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0237"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55281"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M8"
FT                   /inference="similar to AA sequence:KEGG:M446_3184"
FT                   /protein_id="ACL55281.1"
FT   gene            265366..266400
FT                   /locus_tag="Mnod_0238"
FT   CDS_pept        265366..266400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0238"
FT                   /product="aspartate-semialdehyde dehydrogenase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: aspartate-semialdehyde dehydrogenase; PFAM:
FT                   Semialdehyde dehydrogenase NAD - binding; Semialdehyde
FT                   dehydrogenase dimerisation region; KEGG: met:M446_3185
FT                   aspartate-semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0238"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55282"
FT                   /db_xref="GOA:B8I9M9"
FT                   /db_xref="InterPro:IPR000534"
FT                   /db_xref="InterPro:IPR005986"
FT                   /db_xref="InterPro:IPR012080"
FT                   /db_xref="InterPro:IPR012280"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9M9"
FT                   /inference="protein motif:TFAM:TIGR01296"
FT                   /protein_id="ACL55282.1"
FT                   QKAA"
FT   gene            266492..268021
FT                   /locus_tag="Mnod_0239"
FT   CDS_pept        266492..268021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0239"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: met:M446_3186
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0239"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55283"
FT                   /db_xref="GOA:B8I9N0"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N0"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL55283.1"
FT   gene            complement(268333..269355)
FT                   /locus_tag="Mnod_0240"
FT   CDS_pept        complement(268333..269355)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0240"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: mlo:mlr6069 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0240"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55284"
FT                   /db_xref="GOA:B8I9N1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55284.1"
FT                   "
FT   gene            269915..270835
FT                   /locus_tag="Mnod_0241"
FT   CDS_pept        269915..270835
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0241"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2168 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0241"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55285"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N2"
FT                   /inference="similar to AA sequence:KEGG:Bind_2168"
FT                   /protein_id="ACL55285.1"
FT   gene            270825..271313
FT                   /locus_tag="Mnod_0242"
FT   CDS_pept        270825..271313
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0242"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2169 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0242"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55286"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N3"
FT                   /inference="similar to AA sequence:KEGG:Bind_2169"
FT                   /protein_id="ACL55286.1"
FT   gene            271310..273355
FT                   /locus_tag="Mnod_0243"
FT   CDS_pept        271310..273355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0243"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2170 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0243"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55287"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2170"
FT                   /protein_id="ACL55287.1"
FT   gene            complement(273321..273434)
FT                   /locus_tag="Mnod_0244"
FT   CDS_pept        complement(273321..273434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0244"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0244"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55288"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55288.1"
FT   gene            complement(273510..274676)
FT                   /locus_tag="Mnod_0245"
FT   CDS_pept        complement(273510..274676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0245"
FT                   /product="amidohydrolase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: amidohydrolase; PFAM: peptidase M20;
FT                   peptidase dimerisation domain protein; KEGG: met:M446_3187
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0245"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55289"
FT                   /db_xref="GOA:B8I9N6"
FT                   /db_xref="InterPro:IPR002933"
FT                   /db_xref="InterPro:IPR011650"
FT                   /db_xref="InterPro:IPR017439"
FT                   /db_xref="InterPro:IPR036264"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N6"
FT                   /inference="protein motif:TFAM:TIGR01891"
FT                   /protein_id="ACL55289.1"
FT   gene            275040..275918
FT                   /locus_tag="Mnod_0246"
FT   CDS_pept        275040..275918
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0246"
FT                   /product="Aldose 1-epimerase"
FT                   /note="PFAM: Aldose 1-epimerase; KEGG: met:M446_3188 aldose
FT                   1-epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0246"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55290"
FT                   /db_xref="GOA:B8I9N7"
FT                   /db_xref="InterPro:IPR008183"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR014718"
FT                   /db_xref="InterPro:IPR037481"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N7"
FT                   /inference="protein motif:PFAM:PF01263"
FT                   /protein_id="ACL55290.1"
FT                   RHGVVLAFEAA"
FT   gene            276057..277025
FT                   /locus_tag="Mnod_0247"
FT   CDS_pept        276057..277025
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0247"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: met:M446_3189 integrase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0247"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55291"
FT                   /db_xref="GOA:B8I9N8"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9N8"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL55291.1"
FT   gene            complement(277345..278172)
FT                   /locus_tag="Mnod_0248"
FT   CDS_pept        complement(277345..278172)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0248"
FT                   /product="helix-turn-helix domain protein"
FT                   /note="SMART: helix-turn-helix domain protein; KEGG:
FT                   met:M446_2362 helix-turn-helix domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0248"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55292"
FT                   /db_xref="GOA:B8I9N9"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N9"
FT                   /inference="protein motif:SMART:SM00530"
FT                   /protein_id="ACL55292.1"
FT   gene            278254..279036
FT                   /locus_tag="Mnod_0249"
FT   CDS_pept        278254..279036
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0249"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; Methyltransferase
FT                   type 11; Methyltransferase type 12; KEGG: met:M446_2361
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0249"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55293"
FT                   /db_xref="GOA:B8I9P0"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P0"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55293.1"
FT   gene            complement(279197..280309)
FT                   /locus_tag="Mnod_0250"
FT   CDS_pept        complement(279197..280309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0250"
FT                   /product="GTP cyclohydrolase II"
FT                   /EC_number=""
FT                   /note="PFAM: GTP cyclohydrolase II; KEGG: met:M446_2360 GTP
FT                   cyclohydrolase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0250"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55294"
FT                   /db_xref="GOA:B8I9P1"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P1"
FT                   /inference="protein motif:PFAM:PF00925"
FT                   /protein_id="ACL55294.1"
FT   gene            280361..281128
FT                   /locus_tag="Mnod_0251"
FT   CDS_pept        280361..281128
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0251"
FT                   /product="bifunctional deaminase-reductase domain protein"
FT                   /note="PFAM: bifunctional deaminase-reductase domain
FT                   protein; KEGG: met:M446_2359 deaminase-reductase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0251"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55295"
FT                   /db_xref="GOA:B8I9P2"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P2"
FT                   /inference="protein motif:PFAM:PF01872"
FT                   /protein_id="ACL55295.1"
FT   gene            281148..281690
FT                   /locus_tag="Mnod_0252"
FT   CDS_pept        281148..281690
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0252"
FT                   /product="cytochrome B561"
FT                   /note="PFAM: cytochrome B561; KEGG: met:M446_2358
FT                   cytochrome b561"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0252"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55296"
FT                   /db_xref="GOA:B8I9P3"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P3"
FT                   /inference="protein motif:PFAM:PF01292"
FT                   /protein_id="ACL55296.1"
FT                   IRRDATLRRMLPGRSEV"
FT   gene            complement(282155..282397)
FT                   /locus_tag="Mnod_0253"
FT   CDS_pept        complement(282155..282397)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0253"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2356 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0253"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55297"
FT                   /db_xref="InterPro:IPR021074"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P4"
FT                   /inference="similar to AA sequence:KEGG:M446_2356"
FT                   /protein_id="ACL55297.1"
FT   gene            complement(282394..283293)
FT                   /locus_tag="Mnod_0254"
FT   CDS_pept        complement(282394..283293)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0254"
FT                   /product="formate dehydrogenase family accessory protein
FT                   FdhD"
FT                   /note="TIGRFAM: formate dehydrogenase family accessory
FT                   protein FdhD; PFAM: formate dehydrogenase subunit FdhD;
FT                   KEGG: met:M446_2355 formate dehydrogenase family accessory
FT                   protein FdhD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55298"
FT                   /db_xref="GOA:B8I9P5"
FT                   /db_xref="InterPro:IPR003786"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P5"
FT                   /inference="protein motif:TFAM:TIGR00129"
FT                   /protein_id="ACL55298.1"
FT                   FTGAERLLLAPDHPEETP"
FT   gene            complement(283238..286096)
FT                   /locus_tag="Mnod_0255"
FT   CDS_pept        complement(283238..286096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0255"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; 4Fe-4S ferredoxin, iron-sulphur binding,
FT                   conserved site; KEGG: mrd:Mrad2831_4998 formate
FT                   dehydrogenase, alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55299"
FT                   /db_xref="GOA:B8I9P6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR019574"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P6"
FT                   /inference="protein motif:TFAM:TIGR01591"
FT                   /protein_id="ACL55299.1"
FT   gene            complement(286107..287666)
FT                   /locus_tag="Mnod_0256"
FT   CDS_pept        complement(286107..287666)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0256"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /EC_number=""
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; KEGG: met:M446_2353 NADH dehydrogenase
FT                   (quinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55300"
FT                   /db_xref="GOA:B8I9P7"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P7"
FT                   /inference="protein motif:PFAM:PF01512"
FT                   /protein_id="ACL55300.1"
FT                   AE"
FT   gene            complement(287663..288136)
FT                   /locus_tag="Mnod_0257"
FT   CDS_pept        complement(287663..288136)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0257"
FT                   /product="NADH dehydrogenase (ubiquinone) 24 kDa subunit"
FT                   /note="PFAM: NADH dehydrogenase (ubiquinone) 24 kDa
FT                   subunit; KEGG: met:M446_2352 NADH dehydrogenase
FT                   (ubiquinone) 24 kDa subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55301"
FT                   /db_xref="GOA:B8I9P8"
FT                   /db_xref="InterPro:IPR002023"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P8"
FT                   /inference="protein motif:PFAM:PF01257"
FT                   /protein_id="ACL55301.1"
FT   gene            288426..288824
FT                   /locus_tag="Mnod_0258"
FT   CDS_pept        288426..288824
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0258"
FT                   /product="glutathione-dependent formaldehyde-activating
FT                   GFA"
FT                   /note="PFAM: glutathione-dependent formaldehyde-activating
FT                   GFA; KEGG: met:M446_2351 glutathione-dependent
FT                   formaldehyde-activating GFA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0258"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55302"
FT                   /db_xref="GOA:B8I9P9"
FT                   /db_xref="InterPro:IPR006913"
FT                   /db_xref="InterPro:IPR011057"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9P9"
FT                   /inference="protein motif:PFAM:PF04828"
FT                   /protein_id="ACL55302.1"
FT   gene            complement(288959..289867)
FT                   /locus_tag="Mnod_0259"
FT   CDS_pept        complement(288959..289867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0259"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2350 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55303"
FT                   /db_xref="GOA:B8I9Q0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55303.1"
FT   gene            290210..291076
FT                   /locus_tag="Mnod_0260"
FT   CDS_pept        290210..291076
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0260"
FT                   /product="cytochrome c oxidase, subunit II"
FT                   /EC_number=""
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit II; PFAM:
FT                   cytochrome c oxidase subunit II; cytochrome C oxidase
FT                   subunit II transmembrane region; KEGG: met:M446_2349
FT                   cytochrome c oxidase, subunit II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55304"
FT                   /db_xref="GOA:B8I9Q1"
FT                   /db_xref="InterPro:IPR001505"
FT                   /db_xref="InterPro:IPR002429"
FT                   /db_xref="InterPro:IPR008972"
FT                   /db_xref="InterPro:IPR011759"
FT                   /db_xref="InterPro:IPR014222"
FT                   /db_xref="InterPro:IPR034210"
FT                   /db_xref="InterPro:IPR036257"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q1"
FT                   /inference="protein motif:TFAM:TIGR02866"
FT                   /protein_id="ACL55304.1"
FT                   AKFASAR"
FT   sig_peptide     290210..290311
FT                   /locus_tag="Mnod_0260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 34"
FT   gene            291147..292775
FT                   /locus_tag="Mnod_0261"
FT   CDS_pept        291147..292775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0261"
FT                   /product="cytochrome c oxidase, subunit I"
FT                   /EC_number=""
FT                   /note="TIGRFAM: cytochrome c oxidase, subunit I; PFAM:
FT                   cytochrome c oxidase subunit I; KEGG: met:M446_2348
FT                   cytochrome c oxidase, subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55305"
FT                   /db_xref="GOA:B8I9Q2"
FT                   /db_xref="InterPro:IPR000883"
FT                   /db_xref="InterPro:IPR014241"
FT                   /db_xref="InterPro:IPR023615"
FT                   /db_xref="InterPro:IPR023616"
FT                   /db_xref="InterPro:IPR033944"
FT                   /db_xref="InterPro:IPR036927"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q2"
FT                   /inference="protein motif:TFAM:TIGR02891"
FT                   /protein_id="ACL55305.1"
FT   gene            292907..293860
FT                   /locus_tag="Mnod_0262"
FT   CDS_pept        292907..293860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0262"
FT                   /product="protoheme IX farnesyltransferase"
FT                   /note="TIGRFAM: protoheme IX farnesyltransferase; PFAM:
FT                   UbiA prenyltransferase; KEGG: met:M446_2347 protoheme IX
FT                   farnesyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55306"
FT                   /db_xref="GOA:B8I9Q3"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006369"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8I9Q3"
FT                   /inference="protein motif:TFAM:TIGR01473"
FT                   /protein_id="ACL55306.1"
FT   gene            293857..294009
FT                   /locus_tag="Mnod_0263"
FT   CDS_pept        293857..294009
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0263"
FT                   /product="protein CoxF"
FT                   /note="KEGG: met:M446_2346 protein CoxF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0263"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55307"
FT                   /db_xref="GOA:B8I9Q4"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q4"
FT                   /inference="similar to AA sequence:KEGG:M446_2346"
FT                   /protein_id="ACL55307.1"
FT                   LNRPL"
FT   gene            294026..294637
FT                   /locus_tag="Mnod_0264"
FT   CDS_pept        294026..294637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0264"
FT                   /product="cytochrome c oxidase assembly protein CtaG/Cox11"
FT                   /note="PFAM: cytochrome c oxidase assembly protein
FT                   CtaG/Cox11; KEGG: met:M446_2345 cytochrome c oxidase
FT                   assembly protein CtaG/Cox11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55308"
FT                   /db_xref="GOA:B8I9Q5"
FT                   /db_xref="InterPro:IPR007533"
FT                   /db_xref="InterPro:IPR023471"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q5"
FT                   /inference="protein motif:PFAM:PF04442"
FT                   /protein_id="ACL55308.1"
FT   sig_peptide     294026..294136
FT                   /locus_tag="Mnod_0264"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.982) with cleavage site probability 0.879 at
FT                   residue 37"
FT   gene            294798..295664
FT                   /locus_tag="Mnod_0265"
FT   CDS_pept        294798..295664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0265"
FT                   /product="cytochrome c oxidase subunit III"
FT                   /note="PFAM: cytochrome c oxidase subunit III; KEGG:
FT                   met:M446_2344 cytochrome c oxidase subunit III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0265"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55309"
FT                   /db_xref="GOA:B8I9Q6"
FT                   /db_xref="InterPro:IPR000298"
FT                   /db_xref="InterPro:IPR013833"
FT                   /db_xref="InterPro:IPR024791"
FT                   /db_xref="InterPro:IPR033945"
FT                   /db_xref="InterPro:IPR035973"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q6"
FT                   /inference="protein motif:PFAM:PF00510"
FT                   /protein_id="ACL55309.1"
FT                   HAAAAGS"
FT   gene            295949..296317
FT                   /locus_tag="Mnod_0266"
FT   CDS_pept        295949..296317
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0266"
FT                   /product="protein of unknown function DUF983"
FT                   /note="PFAM: protein of unknown function DUF983; KEGG:
FT                   met:M446_2343 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0266"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55310"
FT                   /db_xref="GOA:B8I9Q7"
FT                   /db_xref="InterPro:IPR009325"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q7"
FT                   /inference="protein motif:PFAM:PF06170"
FT                   /protein_id="ACL55310.1"
FT                   GLMAALQFSNRAEQGRFR"
FT   gene            296317..297078
FT                   /locus_tag="Mnod_0267"
FT   CDS_pept        296317..297078
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0267"
FT                   /product="Surfeit locus 1 family protein"
FT                   /note="PFAM: Surfeit locus 1 family protein; KEGG:
FT                   met:M446_2342 surfeit locus 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55311"
FT                   /db_xref="GOA:B8I9Q8"
FT                   /db_xref="InterPro:IPR002994"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q8"
FT                   /inference="protein motif:PFAM:PF02104"
FT                   /protein_id="ACL55311.1"
FT   gene            297415..298830
FT                   /locus_tag="Mnod_0268"
FT   CDS_pept        297415..298830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0268"
FT                   /product="threonine synthase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: threonine synthase; PFAM:
FT                   Pyridoxal-5'-phosphate-dependent protein beta subunit;
FT                   KEGG: met:M446_2341 threonine synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55312"
FT                   /db_xref="GOA:B8I9Q9"
FT                   /db_xref="InterPro:IPR000634"
FT                   /db_xref="InterPro:IPR001926"
FT                   /db_xref="InterPro:IPR004450"
FT                   /db_xref="InterPro:IPR029144"
FT                   /db_xref="InterPro:IPR036052"
FT                   /db_xref="InterPro:IPR037158"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Q9"
FT                   /inference="protein motif:TFAM:TIGR00260"
FT                   /protein_id="ACL55312.1"
FT                   IRERARILRGAAA"
FT   gene            298827..300122
FT                   /locus_tag="Mnod_0269"
FT   CDS_pept        298827..300122
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0269"
FT                   /product="peptidase M16 domain protein"
FT                   /EC_number=""
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2340 processing peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55313"
FT                   /db_xref="GOA:B8I9R0"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R0"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55313.1"
FT   gene            300357..303236
FT                   /locus_tag="Mnod_0270"
FT   CDS_pept        300357..303236
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0270"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC-like protein"
FT                   /note="KEGG: met:M446_2339 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; Diverse 7TM
FT                   receptor extracellular region 2; Diverse 7TM receptor
FT                   transmembrane region; PAS fold-3 domain protein; PAS fold-4
FT                   domain protein; PAS fold domain protein; SMART: PAC
FT                   repeat-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55314"
FT                   /db_xref="GOA:B8I9R1"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001610"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR011622"
FT                   /db_xref="InterPro:IPR013655"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R1"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL55314.1"
FT   sig_peptide     300357..300434
FT                   /locus_tag="Mnod_0270"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.979 at
FT                   residue 26"
FT   gene            complement(303441..304421)
FT                   /locus_tag="Mnod_0271"
FT   CDS_pept        complement(303441..304421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0271"
FT                   /product="transposase IS111A/IS1328/IS1533"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: gdi:GDI1409
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55315"
FT                   /db_xref="GOA:B8I9R2"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R2"
FT                   /inference="protein motif:PFAM:PF01548"
FT                   /protein_id="ACL55315.1"
FT   gene            complement(304972..305358)
FT                   /locus_tag="Mnod_0272"
FT   CDS_pept        complement(304972..305358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0272"
FT                   /product="response regulator receiver protein"
FT                   /note="KEGG: met:M446_2338 response regulator receiver
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55316"
FT                   /db_xref="GOA:B8I9R3"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R3"
FT                   /inference="similar to AA sequence:KEGG:M446_2338"
FT                   /protein_id="ACL55316.1"
FT   gene            305613..305954
FT                   /locus_tag="Mnod_0273"
FT   CDS_pept        305613..305954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0273"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2337 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0273"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55317"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R4"
FT                   /inference="similar to AA sequence:KEGG:M446_2337"
FT                   /protein_id="ACL55317.1"
FT                   VERLLFAGR"
FT   gene            305998..306963
FT                   /locus_tag="Mnod_0274"
FT   CDS_pept        305998..306963
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0274"
FT                   /product="oxidoreductase FAD/NAD(P)-binding domain protein"
FT                   /note="PFAM: oxidoreductase FAD/NAD(P)-binding domain
FT                   protein; KEGG: met:M446_2336 oxidoreductase
FT                   FAD/NAD(P)-binding subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55318"
FT                   /db_xref="GOA:B8I9R5"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R5"
FT                   /inference="protein motif:PFAM:PF00175"
FT                   /protein_id="ACL55318.1"
FT   gene            307042..309747
FT                   /locus_tag="Mnod_0275"
FT   CDS_pept        307042..309747
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0275"
FT                   /product="ABC-type multidrug transport system ATPase and
FT                   permease components-like protein"
FT                   /note="KEGG: met:M446_2335 ABC-type multidrug transport
FT                   system ATPase and permease components-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0275"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55319"
FT                   /db_xref="GOA:B8I9R6"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R6"
FT                   /inference="similar to AA sequence:KEGG:M446_2335"
FT                   /protein_id="ACL55319.1"
FT   gene            309848..310774
FT                   /locus_tag="Mnod_0276"
FT   CDS_pept        309848..310774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0276"
FT                   /product="beta-lactamase domain-containing protein"
FT                   /note="KEGG: met:M446_2334 beta-lactamase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0276"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55320"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R7"
FT                   /inference="similar to AA sequence:KEGG:M446_2334"
FT                   /protein_id="ACL55320.1"
FT   gene            complement(310905..311918)
FT                   /locus_tag="Mnod_0277"
FT   CDS_pept        complement(310905..311918)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0277"
FT                   /product="high-affinity nickel-transporter"
FT                   /note="PFAM: high-affinity nickel-transporter; KEGG:
FT                   met:M446_2333 high-affinity nickel-transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55321"
FT                   /db_xref="GOA:B8I9R8"
FT                   /db_xref="InterPro:IPR011541"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R8"
FT                   /inference="protein motif:PFAM:PF03824"
FT                   /protein_id="ACL55321.1"
FT   sig_peptide     complement(311811..311918)
FT                   /locus_tag="Mnod_0277"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.964) with cleavage site probability 0.319 at
FT                   residue 36"
FT   gene            complement(311909..312553)
FT                   /locus_tag="Mnod_0278"
FT   CDS_pept        complement(311909..312553)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0278"
FT                   /product="protein of unknown function DUF1007"
FT                   /note="PFAM: protein of unknown function DUF1007; KEGG:
FT                   met:M446_2332 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55322"
FT                   /db_xref="InterPro:IPR010412"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9R9"
FT                   /inference="protein motif:PFAM:PF06226"
FT                   /protein_id="ACL55322.1"
FT   sig_peptide     complement(312464..312553)
FT                   /locus_tag="Mnod_0278"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 30"
FT   gene            complement(312607..313533)
FT                   /locus_tag="Mnod_0279"
FT   CDS_pept        complement(312607..313533)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0279"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2331 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55323"
FT                   /db_xref="GOA:B8I9S0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55323.1"
FT   gene            313642..313872
FT                   /locus_tag="Mnod_0280"
FT   CDS_pept        313642..313872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0280"
FT                   /product="protein of unknown function DUF1127"
FT                   /note="PFAM: protein of unknown function DUF1127; KEGG:
FT                   met:M446_2330 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0280"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55324"
FT                   /db_xref="InterPro:IPR009506"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S1"
FT                   /inference="protein motif:PFAM:PF06568"
FT                   /protein_id="ACL55324.1"
FT   gene            complement(313981..316041)
FT                   /locus_tag="Mnod_0281"
FT   CDS_pept        complement(313981..316041)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0281"
FT                   /product="protein of unknown function DUF839"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; protein
FT                   of unknown function DUF839; KEGG: chu:CHU_3119 phytase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55325"
FT                   /db_xref="GOA:B8I9S2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR008557"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S2"
FT                   /inference="protein motif:PFAM:PF05787"
FT                   /protein_id="ACL55325.1"
FT   gene            316282..317022
FT                   /locus_tag="Mnod_0282"
FT   CDS_pept        316282..317022
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0282"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; Autoinducer-binding
FT                   domain protein; KEGG: bra:BRADO0942 putative N-acyl
FT                   homoserine lactone transcriptional regulator, LuxR-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55326"
FT                   /db_xref="GOA:B8I9S3"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S3"
FT                   /inference="protein motif:PFAM:PF03472"
FT                   /protein_id="ACL55326.1"
FT   gene            317298..317948
FT                   /locus_tag="Mnod_0283"
FT   CDS_pept        317298..317948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0283"
FT                   /product="autoinducer synthesis protein"
FT                   /note="KEGG: rpb:RPB_0417 autoinducer synthesis protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55327"
FT                   /db_xref="GOA:B8I9S4"
FT                   /db_xref="InterPro:IPR001690"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S4"
FT                   /inference="similar to AA sequence:KEGG:RPB_0417"
FT                   /protein_id="ACL55327.1"
FT   gene            318025..318345
FT                   /locus_tag="Mnod_0284"
FT   CDS_pept        318025..318345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0284"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5460 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55328"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55328.1"
FT                   HH"
FT   gene            complement(318648..319217)
FT                   /locus_tag="Mnod_0285"
FT   CDS_pept        complement(318648..319217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0285"
FT                   /product="crossover junction endodeoxyribonuclease RuvC"
FT                   /EC_number=""
FT                   /note="TIGRFAM: crossover junction endodeoxyribonuclease
FT                   RuvC; PFAM: Crossover junction endodeoxyribonuclease RuvC;
FT                   KEGG: met:M446_2328 crossover junction
FT                   endodeoxyribonuclease RuvC"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55329"
FT                   /db_xref="GOA:B8I9S6"
FT                   /db_xref="InterPro:IPR002176"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR020563"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S6"
FT                   /inference="protein motif:TFAM:TIGR00228"
FT                   /protein_id="ACL55329.1"
FT   gene            complement(319388..321748)
FT                   /locus_tag="Mnod_0286"
FT   CDS_pept        complement(319388..321748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0286"
FT                   /product="Orn/Lys/Arg decarboxylase major region"
FT                   /EC_number=""
FT                   /note="PFAM: Orn/Lys/Arg decarboxylase major region;
FT                   aromatic amino acid beta-eliminating lyase/threonine
FT                   aldolase; Orn/Lys/Arg decarboxylase domain protein; KEGG:
FT                   mrd:Mrad2831_4404 ornithine decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55330"
FT                   /db_xref="GOA:B8I9S7"
FT                   /db_xref="InterPro:IPR000310"
FT                   /db_xref="InterPro:IPR005308"
FT                   /db_xref="InterPro:IPR008286"
FT                   /db_xref="InterPro:IPR011193"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR036633"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S7"
FT                   /inference="protein motif:PFAM:PF01276"
FT                   /protein_id="ACL55330.1"
FT   gene            complement(322083..325568)
FT                   /locus_tag="Mnod_0287"
FT   CDS_pept        complement(322083..325568)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0287"
FT                   /product="pyruvate ferredoxin/flavodoxin oxidoreductase"
FT                   /note="PFAM: pyruvate ferredoxin/flavodoxin oxidoreductase;
FT                   KEGG: met:M446_2324 pyruvate ferredoxin/flavodoxin
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55331"
FT                   /db_xref="GOA:B8I9S8"
FT                   /db_xref="InterPro:IPR002869"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR019752"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S8"
FT                   /inference="protein motif:PFAM:PF01558"
FT                   /protein_id="ACL55331.1"
FT   gene            complement(325792..327486)
FT                   /locus_tag="Mnod_0288"
FT   CDS_pept        complement(325792..327486)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0288"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_2319 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0288"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55332"
FT                   /db_xref="GOA:B8I9S9"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9S9"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55332.1"
FT   gene            327664..328839
FT                   /locus_tag="Mnod_0289"
FT   CDS_pept        327664..328839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0289"
FT                   /product="acyl-CoA dehydrogenase domain protein"
FT                   /note="PFAM: acyl-CoA dehydrogenase domain protein;
FT                   Acyl-CoA dehydrogenase type 2 domain; KEGG: met:M446_2318
FT                   acyl-CoA dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55333"
FT                   /db_xref="GOA:B8IAU0"
FT                   /db_xref="InterPro:IPR006089"
FT                   /db_xref="InterPro:IPR006091"
FT                   /db_xref="InterPro:IPR009075"
FT                   /db_xref="InterPro:IPR009100"
FT                   /db_xref="InterPro:IPR013786"
FT                   /db_xref="InterPro:IPR034183"
FT                   /db_xref="InterPro:IPR036250"
FT                   /db_xref="InterPro:IPR037069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU0"
FT                   /inference="protein motif:PFAM:PF00441"
FT                   /protein_id="ACL55333.1"
FT   gene            328849..330456
FT                   /locus_tag="Mnod_0290"
FT   CDS_pept        328849..330456
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0290"
FT                   /product="carboxyl transferase"
FT                   /EC_number=""
FT                   /note="PFAM: carboxyl transferase; KEGG: met:M446_2317
FT                   propionyl-CoA carboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55334"
FT                   /db_xref="GOA:B8IAU1"
FT                   /db_xref="InterPro:IPR011762"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR034733"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU1"
FT                   /inference="protein motif:PFAM:PF01039"
FT                   /protein_id="ACL55334.1"
FT                   SACLNAPVPETRFGLFRM"
FT   gene            330749..332698
FT                   /locus_tag="Mnod_0291"
FT   CDS_pept        330749..332698
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0291"
FT                   /product="Carbamoyl-phosphate synthase L chain ATP-binding"
FT                   /note="PFAM: Carbamoyl-phosphate synthase L chain
FT                   ATP-binding; Carbamoyl-phosphate synthetase large chain
FT                   domain protein; biotin carboxylase domain protein; KEGG:
FT                   met:M446_2316 carbamoyl-phosphate synthase L chain
FT                   ATP-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55335"
FT                   /db_xref="GOA:B8IAU2"
FT                   /db_xref="InterPro:IPR005479"
FT                   /db_xref="InterPro:IPR005481"
FT                   /db_xref="InterPro:IPR005482"
FT                   /db_xref="InterPro:IPR011054"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR011764"
FT                   /db_xref="InterPro:IPR016185"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU2"
FT                   /inference="protein motif:PFAM:PF02786"
FT                   /protein_id="ACL55335.1"
FT                   GCRGRAPDHHPHGG"
FT   gene            332702..333202
FT                   /locus_tag="Mnod_0292"
FT   CDS_pept        332702..333202
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0292"
FT                   /product="MaoC domain protein dehydratase"
FT                   /note="PFAM: MaoC domain protein dehydratase; KEGG:
FT                   met:M446_2315 dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55336"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU3"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55336.1"
FT                   ETA"
FT   gene            333202..334077
FT                   /locus_tag="Mnod_0293"
FT   CDS_pept        333202..334077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0293"
FT                   /product="HpcH/HpaI aldolase"
FT                   /note="PFAM: HpcH/HpaI aldolase; KEGG: met:M446_2314
FT                   citrate (pro-3S)-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55337"
FT                   /db_xref="GOA:B8IAU4"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR011206"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU4"
FT                   /inference="protein motif:PFAM:PF03328"
FT                   /protein_id="ACL55337.1"
FT                   RLLARVGGGV"
FT   gene            334144..335376
FT                   /locus_tag="Mnod_0294"
FT   CDS_pept        334144..335376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0294"
FT                   /product="putative phenylacetate-CoA ligase"
FT                   /note="KEGG: met:M446_2311 putative phenylacetate-CoA
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55338"
FT                   /db_xref="GOA:B8IAU5"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR028154"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU5"
FT                   /inference="similar to AA sequence:KEGG:M446_2311"
FT                   /protein_id="ACL55338.1"
FT                   GKVIADERPTG"
FT   gene            complement(335348..336010)
FT                   /locus_tag="Mnod_0295"
FT   CDS_pept        complement(335348..336010)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0295"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: met:M446_2310
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55339"
FT                   /db_xref="GOA:B8IAU6"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU6"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55339.1"
FT   gene            336206..337015
FT                   /locus_tag="Mnod_0296"
FT   CDS_pept        336206..337015
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0296"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2309 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55340"
FT                   /db_xref="GOA:B8IAU7"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU7"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55340.1"
FT   gene            337015..338946
FT                   /locus_tag="Mnod_0297"
FT   CDS_pept        337015..338946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0297"
FT                   /product="AMP-dependent synthetase and ligase"
FT                   /note="PFAM: AMP-dependent synthetase and ligase; KEGG:
FT                   met:M446_2308 AMP-dependent synthetase and ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55341"
FT                   /db_xref="GOA:B8IAU8"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU8"
FT                   /inference="protein motif:PFAM:PF00501"
FT                   /protein_id="ACL55341.1"
FT                   VPVLAAAE"
FT   gene            338959..339852
FT                   /locus_tag="Mnod_0298"
FT   CDS_pept        338959..339852
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0298"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2307 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0298"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55342"
FT                   /db_xref="GOA:B8IAU9"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAU9"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55342.1"
FT                   MIKPYGLFGTRDIERV"
FT   gene            339860..340933
FT                   /locus_tag="Mnod_0299"
FT   CDS_pept        339860..340933
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0299"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2306 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55343"
FT                   /db_xref="GOA:B8IAV0"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV0"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55343.1"
FT                   HRWRQIKAYWKLYPFSH"
FT   gene            340992..342272
FT                   /locus_tag="Mnod_0300"
FT   CDS_pept        340992..342272
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0300"
FT                   /product="putative branched-chain amino acid ABC transport
FT                   system substrate-binding protein"
FT                   /note="KEGG: met:M446_2305 putative branched-chain amino
FT                   acid ABC transport system substrate-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55344"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV1"
FT                   /inference="similar to AA sequence:KEGG:M446_2305"
FT                   /protein_id="ACL55344.1"
FT   sig_peptide     340992..341063
FT                   /locus_tag="Mnod_0300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            342397..343233
FT                   /locus_tag="Mnod_0301"
FT   CDS_pept        342397..343233
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0301"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2304 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55345"
FT                   /db_xref="GOA:B8IAV2"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV2"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55345.1"
FT   gene            343308..343553
FT                   /locus_tag="Mnod_0302"
FT   CDS_pept        343308..343553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0302"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2303 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV3"
FT                   /inference="similar to AA sequence:KEGG:M446_2303"
FT                   /protein_id="ACL55346.1"
FT   gene            343838..344839
FT                   /locus_tag="Mnod_0303"
FT   CDS_pept        343838..344839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0303"
FT                   /product="Asparaginase/glutaminase"
FT                   /EC_number=""
FT                   /note="PFAM: Asparaginase/glutaminase; KEGG: met:M446_2302
FT                   asparaginase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55347"
FT                   /db_xref="GOA:B8IAV4"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV4"
FT                   /inference="protein motif:PFAM:PF00710"
FT                   /protein_id="ACL55347.1"
FT   gene            345092..345352
FT                   /locus_tag="Mnod_0304"
FT   CDS_pept        345092..345352
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0304"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2301 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55348"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV5"
FT                   /inference="similar to AA sequence:KEGG:M446_2301"
FT                   /protein_id="ACL55348.1"
FT   gene            complement(345479..346777)
FT                   /locus_tag="Mnod_0305"
FT   CDS_pept        complement(345479..346777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0305"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_2300 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55349"
FT                   /db_xref="GOA:B8IAV6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL55349.1"
FT   gene            346902..347462
FT                   /locus_tag="Mnod_0306"
FT   CDS_pept        346902..347462
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0306"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: met:M446_2299
FT                   TetR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55350"
FT                   /db_xref="GOA:B8IAV7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL55350.1"
FT   gene            347665..348471
FT                   /locus_tag="Mnod_0307"
FT   CDS_pept        347665..348471
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0307"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55351"
FT                   /db_xref="InterPro:IPR033469"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV8"
FT                   /inference="similar to AA sequence:KEGG:M446_2298"
FT                   /protein_id="ACL55351.1"
FT   gene            complement(349017..350351)
FT                   /locus_tag="Mnod_0308"
FT   CDS_pept        complement(349017..350351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0308"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   xau:Xaut_4843 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55352"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAV9"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL55352.1"
FT   gene            350731..352092
FT                   /locus_tag="Mnod_0309"
FT   CDS_pept        350731..352092
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0309"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   met:M446_2297 sodium:dicarboxylate symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55353"
FT                   /db_xref="GOA:B8IAW0"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW0"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL55353.1"
FT   gene            352089..353012
FT                   /locus_tag="Mnod_0310"
FT   CDS_pept        352089..353012
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0310"
FT                   /product="ROK family protein"
FT                   /note="PFAM: ROK family protein; KEGG: met:M446_2296 ROK
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55354"
FT                   /db_xref="InterPro:IPR000600"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW1"
FT                   /inference="protein motif:PFAM:PF00480"
FT                   /protein_id="ACL55354.1"
FT   gene            complement(353037..353660)
FT                   /locus_tag="Mnod_0311"
FT   CDS_pept        complement(353037..353660)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0311"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2295 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55355"
FT                   /db_xref="GOA:B8IAW2"
FT                   /db_xref="InterPro:IPR005325"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW2"
FT                   /inference="similar to AA sequence:KEGG:M446_2295"
FT                   /protein_id="ACL55355.1"
FT   gene            353875..355077
FT                   /locus_tag="Mnod_0312"
FT   CDS_pept        353875..355077
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0312"
FT                   /product="secretion protein HlyD family protein"
FT                   /note="PFAM: secretion protein HlyD family protein; KEGG:
FT                   mrd:Mrad2831_3613 secretion protein HlyD family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55356"
FT                   /db_xref="GOA:B8IAW3"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW3"
FT                   /inference="protein motif:PFAM:PF00529"
FT                   /protein_id="ACL55356.1"
FT                   R"
FT   gene            355074..356669
FT                   /locus_tag="Mnod_0313"
FT   CDS_pept        355074..356669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0313"
FT                   /product="drug resistance transporter, EmrB/QacA subfamily"
FT                   /note="TIGRFAM: drug resistance transporter, EmrB/QacA
FT                   subfamily; PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mrd:Mrad2831_3614
FT                   EmrB/QacA family drug resistance transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55357"
FT                   /db_xref="GOA:B8IAW4"
FT                   /db_xref="InterPro:IPR001411"
FT                   /db_xref="InterPro:IPR004638"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW4"
FT                   /inference="protein motif:TFAM:TIGR00711"
FT                   /protein_id="ACL55357.1"
FT                   TSVKRRGGAPATGH"
FT   gene            356747..357694
FT                   /locus_tag="Mnod_0314"
FT   CDS_pept        356747..357694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0314"
FT                   /product="cation diffusion facilitator family transporter"
FT                   /note="TIGRFAM: cation diffusion facilitator family
FT                   transporter; PFAM: cation efflux protein; KEGG:
FT                   met:M446_2294 cation diffusion facilitator family
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55358"
FT                   /db_xref="GOA:B8IAW5"
FT                   /db_xref="InterPro:IPR002524"
FT                   /db_xref="InterPro:IPR027469"
FT                   /db_xref="InterPro:IPR036837"
FT                   /db_xref="InterPro:IPR040177"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW5"
FT                   /inference="protein motif:TFAM:TIGR01297"
FT                   /protein_id="ACL55358.1"
FT   sig_peptide     356747..356830
FT                   /locus_tag="Mnod_0314"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.972) with cleavage site probability 0.925 at
FT                   residue 28"
FT   gene            357805..359547
FT                   /locus_tag="Mnod_0315"
FT   CDS_pept        357805..359547
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0315"
FT                   /product="adenylate/guanylate cyclase"
FT                   /note="PFAM: ferredoxin; adenylyl cyclase
FT                   class-3/4/guanylyl cyclase; KEGG: met:M446_2293
FT                   adenylate/guanylate cyclase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55359"
FT                   /db_xref="GOA:B8IAW6"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001054"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW6"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACL55359.1"
FT                   LPAA"
FT   gene            complement(359663..360781)
FT                   /locus_tag="Mnod_0316"
FT   CDS_pept        complement(359663..360781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0316"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   met:M446_2292 lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0316"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55360"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW7"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACL55360.1"
FT   gene            361188..362360
FT                   /locus_tag="Mnod_0317"
FT   CDS_pept        361188..362360
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0317"
FT                   /product="methyltransferase type 11"
FT                   /note="KEGG: met:M446_2289 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55361"
FT                   /db_xref="GOA:B8IAW8"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW8"
FT                   /inference="similar to AA sequence:KEGG:M446_2289"
FT                   /protein_id="ACL55361.1"
FT   gene            complement(362424..363380)
FT                   /locus_tag="Mnod_0318"
FT   CDS_pept        complement(362424..363380)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0318"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_2283 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55362"
FT                   /db_xref="GOA:B8IAW9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAW9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55362.1"
FT   sig_peptide     complement(363303..363380)
FT                   /locus_tag="Mnod_0318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.908) with cleavage site probability 0.749 at
FT                   residue 26"
FT   gene            363581..364573
FT                   /locus_tag="Mnod_0319"
FT   CDS_pept        363581..364573
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0319"
FT                   /product="Inositol phosphatase/fructose-16-bisphosphatase"
FT                   /EC_number=""
FT                   /note="PFAM: Inositol
FT                   phosphatase/fructose-16-bisphosphatase; KEGG: met:M446_2282
FT                   inositol phosphatase/fructose-16-bisphosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55363"
FT                   /db_xref="GOA:B8IAX0"
FT                   /db_xref="InterPro:IPR000146"
FT                   /db_xref="InterPro:IPR028343"
FT                   /db_xref="InterPro:IPR033391"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX0"
FT                   /inference="protein motif:PFAM:PF00316"
FT                   /protein_id="ACL55363.1"
FT   gene            364666..365526
FT                   /locus_tag="Mnod_0320"
FT   CDS_pept        364666..365526
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0320"
FT                   /product="phosphoribulokinase/uridine kinase"
FT                   /EC_number=""
FT                   /note="PFAM: phosphoribulokinase/uridine kinase; KEGG:
FT                   met:M446_2281 phosphoribulokinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55364"
FT                   /db_xref="GOA:B8IAX1"
FT                   /db_xref="InterPro:IPR006082"
FT                   /db_xref="InterPro:IPR006083"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX1"
FT                   /inference="protein motif:PFAM:PF00485"
FT                   /protein_id="ACL55364.1"
FT                   RRRLL"
FT   gene            365602..366396
FT                   /locus_tag="Mnod_0321"
FT   CDS_pept        365602..366396
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0321"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; AraC protein arabinose-binding/dimerisation;
FT                   KEGG: bcj:BCAM2003 AraC family regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55365"
FT                   /db_xref="GOA:B8IAX2"
FT                   /db_xref="InterPro:IPR003313"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR037923"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX2"
FT                   /inference="protein motif:PFAM:PF02311"
FT                   /protein_id="ACL55365.1"
FT   gene            366476..367282
FT                   /locus_tag="Mnod_0322"
FT   CDS_pept        366476..367282
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0322"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: UbiE/COQ5 methyltransferase; methyltransferase
FT                   small; Methyltransferase type 11; Methyltransferase type
FT                   12; KEGG: gur:Gura_0628 methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55366"
FT                   /db_xref="GOA:B8IAX3"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX3"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55366.1"
FT   gene            367377..368153
FT                   /locus_tag="Mnod_0323"
FT   CDS_pept        367377..368153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0323"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: met:M446_2280 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55367"
FT                   /db_xref="GOA:B8IAX4"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="InterPro:IPR041492"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX4"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACL55367.1"
FT   gene            368195..369391
FT                   /locus_tag="Mnod_0324"
FT   CDS_pept        368195..369391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0324"
FT                   /product="signal transduction histidine kinase"
FT                   /note="PFAM: GAF domain protein; ATP-binding region ATPase
FT                   domain protein; histidine kinase
FT                   dimerisation/phosphoacceptor; KEGG: met:M446_2279 signal
FT                   transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55368"
FT                   /db_xref="GOA:B8IAX5"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011102"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX5"
FT                   /inference="protein motif:PFAM:PF07568"
FT                   /protein_id="ACL55368.1"
FT   gene            369574..370515
FT                   /locus_tag="Mnod_0325"
FT   CDS_pept        369574..370515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0325"
FT                   /product="NMT1/THI5 like domain protein"
FT                   /note="PFAM: Substrate-binding region of ABC-type glycine
FT                   betaine transport system; NMT1/THI5 like domain protein;
FT                   KEGG: met:M446_2277 NMT1/THI5-like domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55369"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="InterPro:IPR015168"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX6"
FT                   /inference="protein motif:PFAM:PF09084"
FT                   /protein_id="ACL55369.1"
FT   sig_peptide     369574..369636
FT                   /locus_tag="Mnod_0325"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            370521..371294
FT                   /locus_tag="Mnod_0326"
FT   CDS_pept        370521..371294
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0326"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2276
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55370"
FT                   /db_xref="GOA:B8IAX7"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX7"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55370.1"
FT   sig_peptide     370521..370607
FT                   /locus_tag="Mnod_0326"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.788) with cleavage site probability 0.733 at
FT                   residue 29"
FT   gene            371306..372100
FT                   /locus_tag="Mnod_0327"
FT   CDS_pept        371306..372100
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0327"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2275 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55371"
FT                   /db_xref="GOA:B8IAX8"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX8"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55371.1"
FT   gene            372241..373464
FT                   /locus_tag="Mnod_0328"
FT   CDS_pept        372241..373464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0328"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: met:M446_2274 FAD-dependent pyridine
FT                   nucleotide-disulphide oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55372"
FT                   /db_xref="GOA:B8IAX9"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAX9"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACL55372.1"
FT                   KAFALTSA"
FT   gene            complement(373472..373774)
FT                   /locus_tag="Mnod_0329"
FT   CDS_pept        complement(373472..373774)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0329"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2273 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55373"
FT                   /db_xref="GOA:B8IAY0"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY0"
FT                   /inference="similar to AA sequence:KEGG:M446_2273"
FT                   /protein_id="ACL55373.1"
FT   gene            374046..374534
FT                   /locus_tag="Mnod_0330"
FT   CDS_pept        374046..374534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0330"
FT                   /product="protein of unknown function DUF306 Meta and HslJ"
FT                   /note="PFAM: protein of unknown function DUF306 Meta and
FT                   HslJ; KEGG: met:M446_2272 protein of unknown function
FT                   DUF306 MetA and HslJ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55374"
FT                   /db_xref="InterPro:IPR005184"
FT                   /db_xref="InterPro:IPR038670"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY1"
FT                   /inference="protein motif:PFAM:PF03724"
FT                   /protein_id="ACL55374.1"
FT   sig_peptide     374046..374120
FT                   /locus_tag="Mnod_0330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.956 at
FT                   residue 25"
FT   gene            374787..375920
FT                   /locus_tag="Mnod_0331"
FT   CDS_pept        374787..375920
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0331"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   met:M446_2271 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55375"
FT                   /db_xref="GOA:B8IAY2"
FT                   /db_xref="InterPro:IPR000709"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY2"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL55375.1"
FT   sig_peptide     374787..374858
FT                   /locus_tag="Mnod_0331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.942 at
FT                   residue 24"
FT   gene            376143..377024
FT                   /locus_tag="Mnod_0332"
FT   CDS_pept        376143..377024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0332"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2270 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0332"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55376"
FT                   /db_xref="GOA:B8IAY3"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY3"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55376.1"
FT                   MGLFGRAAAKRA"
FT   gene            377030..377875
FT                   /locus_tag="Mnod_0333"
FT   CDS_pept        377030..377875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0333"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   met:M446_2269 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55377"
FT                   /db_xref="GOA:B8IAY4"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY4"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL55377.1"
FT                   "
FT   gene            377872..378672
FT                   /locus_tag="Mnod_0334"
FT   CDS_pept        377872..378672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0334"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2268 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55378"
FT                   /db_xref="GOA:B8IAY5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY5"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55378.1"
FT   gene            378669..379418
FT                   /locus_tag="Mnod_0335"
FT   CDS_pept        378669..379418
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0335"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_2267 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55379"
FT                   /db_xref="GOA:B8IAY6"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY6"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55379.1"
FT   gene            379557..380714
FT                   /locus_tag="Mnod_0336"
FT   CDS_pept        379557..380714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0336"
FT                   /product="Integrase catalytic region"
FT                   /note="PFAM: Integrase catalytic region; KEGG:
FT                   bra:BRADO5530 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55380"
FT                   /db_xref="GOA:B8IAY7"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR024967"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="InterPro:IPR038965"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY7"
FT                   /inference="protein motif:PFAM:PF00665"
FT                   /protein_id="ACL55380.1"
FT   gene            380730..381425
FT                   /locus_tag="Mnod_0337"
FT   CDS_pept        380730..381425
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0337"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55381"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY8"
FT                   /inference="similar to AA sequence:KEGG:PFDG_03179"
FT                   /protein_id="ACL55381.1"
FT                   PKAMQFGSP"
FT   sig_peptide     380730..380840
FT                   /locus_tag="Mnod_0337"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.879) with cleavage site probability 0.380 at
FT                   residue 37"
FT   gene            complement(381330..382487)
FT                   /locus_tag="Mnod_0338"
FT   CDS_pept        complement(381330..382487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0338"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; Recombinase; KEGG:
FT                   acr:Acry_3392 resolvase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55382"
FT                   /db_xref="GOA:B8IAY9"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAY9"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL55382.1"
FT   gene            382893..382994
FT                   /locus_tag="Mnod_0339"
FT   CDS_pept        382893..382994
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0339"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55383"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55383.1"
FT   gene            383047..383382
FT                   /pseudo
FT                   /locus_tag="Mnod_0340"
FT   gene            383831..384028
FT                   /locus_tag="Mnod_0341"
FT   CDS_pept        383831..384028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0341"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2266 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55384"
FT                   /db_xref="GOA:B8IAZ1"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ1"
FT                   /inference="similar to AA sequence:KEGG:M446_2266"
FT                   /protein_id="ACL55384.1"
FT   gene            384075..385346
FT                   /locus_tag="Mnod_0342"
FT   CDS_pept        384075..385346
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0342"
FT                   /product="TRAP transporter solute receptor, TAXI family"
FT                   /note="TIGRFAM: TRAP transporter solute receptor, TAXI
FT                   family; KEGG: met:M446_2265 TRAP transporter solute
FT                   receptor TAXI family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55385"
FT                   /db_xref="GOA:B8IAZ2"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ2"
FT                   /inference="protein motif:TFAM:TIGR02122"
FT                   /protein_id="ACL55385.1"
FT   sig_peptide     384075..384158
FT                   /locus_tag="Mnod_0342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.996) with cleavage site probability 0.884 at
FT                   residue 28"
FT   gene            385532..387355
FT                   /locus_tag="Mnod_0343"
FT   CDS_pept        385532..387355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0343"
FT                   /product="GTP-binding protein TypA"
FT                   /note="TIGRFAM: small GTP-binding protein; GTP-binding
FT                   protein TypA; PFAM: elongation factor G domain protein;
FT                   protein synthesis factor GTP-binding; elongation factor Tu
FT                   domain 2 protein; KEGG: met:M446_2264 GTP-binding protein
FT                   TypA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55386"
FT                   /db_xref="GOA:B8IAZ3"
FT                   /db_xref="InterPro:IPR000640"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006298"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR031157"
FT                   /db_xref="InterPro:IPR035647"
FT                   /db_xref="InterPro:IPR035651"
FT                   /db_xref="InterPro:IPR042116"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ3"
FT                   /inference="protein motif:TFAM:TIGR01394"
FT                   /protein_id="ACL55386.1"
FT   gene            complement(387652..389091)
FT                   /locus_tag="Mnod_0344"
FT   CDS_pept        complement(387652..389091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0344"
FT                   /product="protein of unknown function UPF0061"
FT                   /note="PFAM: protein of unknown function UPF0061; KEGG:
FT                   mex:Mext_4180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55387"
FT                   /db_xref="InterPro:IPR003846"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ4"
FT                   /inference="protein motif:PFAM:PF02696"
FT                   /protein_id="ACL55387.1"
FT   gene            complement(389161..389847)
FT                   /locus_tag="Mnod_0345"
FT   CDS_pept        complement(389161..389847)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0345"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: met:M446_2263
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55388"
FT                   /db_xref="GOA:B8IAZ5"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ5"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACL55388.1"
FT                   ATLLGF"
FT   gene            390146..390874
FT                   /locus_tag="Mnod_0346"
FT   CDS_pept        390146..390874
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0346"
FT                   /product="cold-shock DNA-binding domain protein"
FT                   /note="PFAM: Cold-shock protein DNA-binding; Ribonuclease B
FT                   OB region domain; SMART: Cold shock protein; KEGG:
FT                   met:M446_2262 cold-shock DNA-binding domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55389"
FT                   /db_xref="GOA:B8IAZ6"
FT                   /db_xref="InterPro:IPR002059"
FT                   /db_xref="InterPro:IPR011129"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ6"
FT                   /inference="protein motif:PFAM:PF00313"
FT                   /protein_id="ACL55389.1"
FT   gene            390883..391185
FT                   /locus_tag="Mnod_0347"
FT   CDS_pept        390883..391185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0347"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_0145 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55390"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55390.1"
FT   sig_peptide     390883..390969
FT                   /locus_tag="Mnod_0347"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(391151..391420)
FT                   /locus_tag="Mnod_0348"
FT   CDS_pept        complement(391151..391420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0348"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2261 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55391"
FT                   /db_xref="GOA:B8IAZ8"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ8"
FT                   /inference="similar to AA sequence:KEGG:M446_2261"
FT                   /protein_id="ACL55391.1"
FT   gene            complement(391587..394040)
FT                   /locus_tag="Mnod_0349"
FT   CDS_pept        complement(391587..394040)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0349"
FT                   /product="ATP-dependent Clp protease, ATP-binding subunit
FT                   clpA"
FT                   /note="KEGG: met:M446_2260 ATP-dependent Clp protease,
FT                   ATP-binding subunit ClpA; TIGRFAM: ATP-dependent Clp
FT                   protease, ATP-binding subunit clpA; PFAM: AAA ATPase
FT                   central domain protein; Clp domain protein; ATPase
FT                   associated with various cellular activities AAA_5; ATPase
FT                   AAA-2 domain protein; ATP-dependent Clp protease
FT                   ATP-binding subunit clpA; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0349"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55392"
FT                   /db_xref="GOA:B8IAZ9"
FT                   /db_xref="InterPro:IPR001270"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR003959"
FT                   /db_xref="InterPro:IPR004176"
FT                   /db_xref="InterPro:IPR013461"
FT                   /db_xref="InterPro:IPR018368"
FT                   /db_xref="InterPro:IPR019489"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR028299"
FT                   /db_xref="InterPro:IPR036628"
FT                   /db_xref="InterPro:IPR041546"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAZ9"
FT                   /inference="protein motif:TFAM:TIGR02639"
FT                   /protein_id="ACL55392.1"
FT                   PLVRA"
FT   gene            complement(394062..394469)
FT                   /locus_tag="Mnod_0350"
FT   CDS_pept        complement(394062..394469)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0350"
FT                   /product="ATP-dependent Clp protease adaptor protein ClpS"
FT                   /note="PFAM: ATP-dependent Clp protease adaptor protein
FT                   ClpS; KEGG: met:M446_2259 ATP-dependent Clp protease
FT                   adaptor protein ClpS"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55393"
FT                   /db_xref="GOA:B8IB00"
FT                   /db_xref="InterPro:IPR003769"
FT                   /db_xref="InterPro:IPR014719"
FT                   /db_xref="InterPro:IPR022935"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB00"
FT                   /inference="protein motif:PFAM:PF02617"
FT                   /protein_id="ACL55393.1"
FT   gene            complement(394791..395129)
FT                   /locus_tag="Mnod_0351"
FT   CDS_pept        complement(394791..395129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0351"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2258 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55394"
FT                   /db_xref="InterPro:IPR010127"
FT                   /db_xref="InterPro:IPR018968"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB01"
FT                   /inference="similar to AA sequence:KEGG:M446_2258"
FT                   /protein_id="ACL55394.1"
FT                   AAKVPAAA"
FT   gene            395421..396917
FT                   /locus_tag="Mnod_0352"
FT   CDS_pept        395421..396917
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0352"
FT                   /product="peptidase S11 D-alanyl-D-alanine carboxypeptidase
FT                   1"
FT                   /EC_number=""
FT                   /note="PFAM: beta-lactamase; peptidase S11
FT                   D-alanyl-D-alanine carboxypeptidase 1; Sporulation domain
FT                   protein; KEGG: met:M446_2257 serine-type D-Ala-D-Ala
FT                   carboxypeptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55395"
FT                   /db_xref="GOA:B8IB02"
FT                   /db_xref="InterPro:IPR001967"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR018044"
FT                   /db_xref="InterPro:IPR036680"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB02"
FT                   /inference="protein motif:PFAM:PF00768"
FT                   /protein_id="ACL55395.1"
FT   sig_peptide     395421..395501
FT                   /locus_tag="Mnod_0352"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.683 at
FT                   residue 27"
FT   gene            complement(397099..397824)
FT                   /locus_tag="Mnod_0353"
FT   CDS_pept        complement(397099..397824)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0353"
FT                   /product="heat shock protein DnaJ domain protein"
FT                   /note="PFAM: heat shock protein DnaJ domain protein; KEGG:
FT                   met:M446_2256 heat shock protein DnaJ domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55396"
FT                   /db_xref="GOA:B8IB03"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR036869"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB03"
FT                   /inference="protein motif:PFAM:PF00226"
FT                   /protein_id="ACL55396.1"
FT   sig_peptide     complement(397750..397824)
FT                   /locus_tag="Mnod_0353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.732) with cleavage site probability 0.393 at
FT                   residue 25"
FT   gene            complement(397870..398571)
FT                   /locus_tag="Mnod_0354"
FT   CDS_pept        complement(397870..398571)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0354"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2255 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0354"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55397"
FT                   /db_xref="InterPro:IPR036465"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB04"
FT                   /inference="similar to AA sequence:KEGG:M446_2255"
FT                   /protein_id="ACL55397.1"
FT                   ARRLLGAMTPR"
FT   gene            complement(398587..399579)
FT                   /locus_tag="Mnod_0355"
FT   CDS_pept        complement(398587..399579)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0355"
FT                   /product="methyltransferase"
FT                   /note="TIGRFAM: methyltransferase; KEGG: met:M446_2254
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0355"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55398"
FT                   /db_xref="GOA:B8IB05"
FT                   /db_xref="InterPro:IPR017804"
FT                   /db_xref="InterPro:IPR019257"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="InterPro:IPR035094"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB05"
FT                   /inference="protein motif:TFAM:TIGR03438"
FT                   /protein_id="ACL55398.1"
FT   gene            complement(399621..400877)
FT                   /locus_tag="Mnod_0356"
FT   CDS_pept        complement(399621..400877)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0356"
FT                   /product="protein of unknown function DUF323"
FT                   /note="PFAM: protein of unknown function DUF323; KEGG:
FT                   met:M446_2253 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55399"
FT                   /db_xref="GOA:B8IB06"
FT                   /db_xref="InterPro:IPR005532"
FT                   /db_xref="InterPro:IPR016187"
FT                   /db_xref="InterPro:IPR017806"
FT                   /db_xref="InterPro:IPR024775"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="InterPro:IPR042095"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB06"
FT                   /inference="protein motif:PFAM:PF03781"
FT                   /protein_id="ACL55399.1"
FT   gene            401055..401993
FT                   /locus_tag="Mnod_0357"
FT   CDS_pept        401055..401993
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0357"
FT                   /product="glutamate racemase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: glutamate racemase; PFAM: Asp/Glu/hydantoin
FT                   racemase; KEGG: met:M446_2251 glutamate racemase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55400"
FT                   /db_xref="GOA:B8IB07"
FT                   /db_xref="InterPro:IPR001920"
FT                   /db_xref="InterPro:IPR004391"
FT                   /db_xref="InterPro:IPR015942"
FT                   /db_xref="InterPro:IPR018187"
FT                   /db_xref="InterPro:IPR033134"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB07"
FT                   /inference="protein motif:TFAM:TIGR00067"
FT                   /protein_id="ACL55400.1"
FT   gene            402005..402817
FT                   /locus_tag="Mnod_0358"
FT   CDS_pept        402005..402817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0358"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2250 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55401"
FT                   /db_xref="InterPro:IPR022742"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB08"
FT                   /inference="similar to AA sequence:KEGG:M446_2250"
FT                   /protein_id="ACL55401.1"
FT   sig_peptide     402005..402061
FT                   /locus_tag="Mnod_0358"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.888) with cleavage site probability 0.417 at
FT                   residue 19"
FT   gene            402995..403612
FT                   /locus_tag="Mnod_0359"
FT   CDS_pept        402995..403612
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0359"
FT                   /product="RNA-binding S4 domain protein"
FT                   /note="PFAM: ribosomal protein S4; RNA-binding S4 domain
FT                   protein; KEGG: met:M446_2249 RNA-binding S4
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55402"
FT                   /db_xref="GOA:B8IB09"
FT                   /db_xref="InterPro:IPR001912"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR005709"
FT                   /db_xref="InterPro:IPR018079"
FT                   /db_xref="InterPro:IPR022801"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB09"
FT                   /inference="protein motif:PFAM:PF01479"
FT                   /protein_id="ACL55402.1"
FT   gene            complement(403728..404474)
FT                   /locus_tag="Mnod_0360"
FT   CDS_pept        complement(403728..404474)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0360"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sen:SACE_5323 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55403"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB10"
FT                   /inference="similar to AA sequence:KEGG:SACE_5323"
FT                   /protein_id="ACL55403.1"
FT   sig_peptide     complement(404391..404474)
FT                   /locus_tag="Mnod_0360"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.623 at
FT                   residue 28"
FT   gene            complement(404677..405489)
FT                   /locus_tag="Mnod_0361"
FT   CDS_pept        complement(404677..405489)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0361"
FT                   /product="inositol monophosphatase"
FT                   /note="PFAM: inositol monophosphatase; KEGG: met:M446_2248
FT                   inositol monophosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55404"
FT                   /db_xref="GOA:B8IB11"
FT                   /db_xref="InterPro:IPR000760"
FT                   /db_xref="InterPro:IPR020550"
FT                   /db_xref="InterPro:IPR020583"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB11"
FT                   /inference="protein motif:PFAM:PF00459"
FT                   /protein_id="ACL55404.1"
FT   gene            405848..406369
FT                   /locus_tag="Mnod_0362"
FT   CDS_pept        405848..406369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0362"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2247 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55405"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB12"
FT                   /inference="similar to AA sequence:KEGG:M446_2247"
FT                   /protein_id="ACL55405.1"
FT                   DEDPLTDHGL"
FT   gene            complement(406375..407349)
FT                   /locus_tag="Mnod_0363"
FT   CDS_pept        complement(406375..407349)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0363"
FT                   /product="4-hydroxybenzoate polyprenyl transferase"
FT                   /note="TIGRFAM: 4-hydroxybenzoate polyprenyl transferase;
FT                   PFAM: UbiA prenyltransferase; KEGG: met:M446_2246
FT                   4-hydroxybenzoate polyprenyl transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55406"
FT                   /db_xref="GOA:B8IB13"
FT                   /db_xref="InterPro:IPR000537"
FT                   /db_xref="InterPro:IPR006370"
FT                   /db_xref="InterPro:IPR030470"
FT                   /db_xref="InterPro:IPR039653"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB13"
FT                   /inference="protein motif:TFAM:TIGR01474"
FT                   /protein_id="ACL55406.1"
FT   gene            complement(407346..407825)
FT                   /locus_tag="Mnod_0364"
FT   CDS_pept        complement(407346..407825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0364"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: mrd:Mrad2831_5383 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55407"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB14"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5383"
FT                   /protein_id="ACL55407.1"
FT   sig_peptide     complement(407739..407825)
FT                   /locus_tag="Mnod_0364"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.989 at
FT                   residue 29"
FT   gene            408044..408847
FT                   /locus_tag="Mnod_0365"
FT   CDS_pept        408044..408847
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0365"
FT                   /product="protein of unknown function DUF558"
FT                   /note="PFAM: protein of unknown function DUF558; KEGG:
FT                   met:M446_2244 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55408"
FT                   /db_xref="GOA:B8IB15"
FT                   /db_xref="InterPro:IPR006700"
FT                   /db_xref="InterPro:IPR015947"
FT                   /db_xref="InterPro:IPR029026"
FT                   /db_xref="InterPro:IPR029028"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB15"
FT                   /inference="protein motif:PFAM:PF04452"
FT                   /protein_id="ACL55408.1"
FT   gene            408930..410063
FT                   /locus_tag="Mnod_0366"
FT   CDS_pept        408930..410063
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0366"
FT                   /product="glutamate--cysteine ligase GCS2"
FT                   /note="PFAM: glutamate--cysteine ligase GCS2; KEGG:
FT                   met:M446_2243 glutamate--cysteine ligase GCS2"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55409"
FT                   /db_xref="GOA:B8IB16"
FT                   /db_xref="InterPro:IPR006336"
FT                   /db_xref="InterPro:IPR011793"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB16"
FT                   /inference="protein motif:PFAM:PF04107"
FT                   /protein_id="ACL55409.1"
FT   gene            complement(410361..410750)
FT                   /locus_tag="Mnod_0367"
FT   CDS_pept        complement(410361..410750)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0367"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55410"
FT                   /db_xref="InterPro:IPR022254"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB17"
FT                   /inference="similar to AA sequence:KEGG:M446_2242"
FT                   /protein_id="ACL55410.1"
FT   gene            410874..411590
FT                   /locus_tag="Mnod_0368"
FT   CDS_pept        410874..411590
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0368"
FT                   /product="protein of unknown function DUF540"
FT                   /note="PFAM: protein of unknown function DUF540; KEGG:
FT                   met:M446_2241 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55411"
FT                   /db_xref="GOA:B8IB18"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB18"
FT                   /inference="protein motif:PFAM:PF04401"
FT                   /protein_id="ACL55411.1"
FT                   SRERLLAAPQARPPIR"
FT   gene            complement(411606..412751)
FT                   /locus_tag="Mnod_0369"
FT   CDS_pept        complement(411606..412751)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0369"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /EC_number=""
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; NmrA family protein; Male
FT                   sterility domain; KEGG: met:M446_2240 NADH dehydrogenase
FT                   (ubiquinone)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55412"
FT                   /db_xref="GOA:B8IB19"
FT                   /db_xref="InterPro:IPR029903"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB19"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55412.1"
FT   gene            complement(412943..413578)
FT                   /locus_tag="Mnod_0370"
FT   CDS_pept        complement(412943..413578)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0370"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2239 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55413"
FT                   /db_xref="InterPro:IPR025833"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB20"
FT                   /inference="similar to AA sequence:KEGG:M446_2239"
FT                   /protein_id="ACL55413.1"
FT   sig_peptide     complement(413498..413578)
FT                   /locus_tag="Mnod_0370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 27"
FT   gene            complement(413575..414885)
FT                   /locus_tag="Mnod_0371"
FT   CDS_pept        complement(413575..414885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0371"
FT                   /product="membrane protein-like protein"
FT                   /note="KEGG: met:M446_2238 membrane protein-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0371"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55414"
FT                   /db_xref="GOA:B8IB21"
FT                   /db_xref="InterPro:IPR018677"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB21"
FT                   /inference="similar to AA sequence:KEGG:M446_2238"
FT                   /protein_id="ACL55414.1"
FT   gene            414981..415115
FT                   /pseudo
FT                   /locus_tag="Mnod_0372"
FT   gene            415221..416303
FT                   /locus_tag="Mnod_0373"
FT   CDS_pept        415221..416303
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0373"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: nha:Nham_4120 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55415"
FT                   /db_xref="GOA:B8IB22"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB22"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55415.1"
FT   gene            complement(416795..418297)
FT                   /locus_tag="Mnod_0374"
FT   CDS_pept        complement(416795..418297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0374"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; FAD dependent oxidoreductase;
FT                   KEGG: met:M446_2236 amine oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55416"
FT                   /db_xref="GOA:B8IB23"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB23"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACL55416.1"
FT   sig_peptide     complement(418223..418297)
FT                   /locus_tag="Mnod_0374"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.730) with cleavage site probability 0.700 at
FT                   residue 25"
FT   gene            418446..420260
FT                   /locus_tag="Mnod_0375"
FT   CDS_pept        418446..420260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0375"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2235 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55417"
FT                   /db_xref="GOA:B8IB24"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB24"
FT                   /inference="similar to AA sequence:KEGG:M446_2235"
FT                   /protein_id="ACL55417.1"
FT   gene            420257..420790
FT                   /locus_tag="Mnod_0376"
FT   CDS_pept        420257..420790
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0376"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2234 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55418"
FT                   /db_xref="InterPro:IPR010865"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB25"
FT                   /inference="similar to AA sequence:KEGG:M446_2234"
FT                   /protein_id="ACL55418.1"
FT                   RLARWLDGVKDAAR"
FT   sig_peptide     420257..420346
FT                   /locus_tag="Mnod_0376"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.609 at
FT                   residue 30"
FT   gene            420787..422160
FT                   /locus_tag="Mnod_0377"
FT   CDS_pept        420787..422160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0377"
FT                   /product="amine oxidase"
FT                   /note="PFAM: amine oxidase; KEGG: met:M446_2233 amine
FT                   oxidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0377"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55419"
FT                   /db_xref="GOA:B8IB26"
FT                   /db_xref="InterPro:IPR001613"
FT                   /db_xref="InterPro:IPR002937"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB26"
FT                   /inference="protein motif:PFAM:PF01593"
FT                   /protein_id="ACL55419.1"
FT   gene            complement(422329..423333)
FT                   /locus_tag="Mnod_0378"
FT   CDS_pept        complement(422329..423333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0378"
FT                   /product="D-isomer specific 2-hydroxyacid dehydrogenase
FT                   NAD-binding"
FT                   /EC_number=""
FT                   /note="PFAM: D-isomer specific 2-hydroxyacid dehydrogenase
FT                   catalytic region; D-isomer specific 2-hydroxyacid
FT                   dehydrogenase NAD-binding; KEGG: met:M446_2232 glyoxylate
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55420"
FT                   /db_xref="GOA:B8IB27"
FT                   /db_xref="InterPro:IPR006139"
FT                   /db_xref="InterPro:IPR006140"
FT                   /db_xref="InterPro:IPR029752"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB27"
FT                   /inference="protein motif:PFAM:PF02826"
FT                   /protein_id="ACL55420.1"
FT   gene            423623..424186
FT                   /locus_tag="Mnod_0379"
FT   CDS_pept        423623..424186
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0379"
FT                   /product="protein of unknown function DUF1058"
FT                   /note="PFAM: protein of unknown function DUF1058; KEGG:
FT                   met:M446_2231 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55421"
FT                   /db_xref="InterPro:IPR010466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB28"
FT                   /inference="protein motif:PFAM:PF06347"
FT                   /protein_id="ACL55421.1"
FT   sig_peptide     423623..423706
FT                   /locus_tag="Mnod_0379"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 28"
FT   gene            424204..424629
FT                   /locus_tag="Mnod_0380"
FT   CDS_pept        424204..424629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0380"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: sme:SMc01008 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55422"
FT                   /db_xref="InterPro:IPR018727"
FT                   /db_xref="InterPro:IPR038282"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB29"
FT                   /inference="similar to AA sequence:KEGG:SMc01008"
FT                   /protein_id="ACL55422.1"
FT   gene            complement(424721..425215)
FT                   /locus_tag="Mnod_0381"
FT   CDS_pept        complement(424721..425215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0381"
FT                   /product="ferric uptake regulator, Fur family"
FT                   /note="PFAM: ferric-uptake regulator; KEGG: met:M446_2230
FT                   ferric uptake regulator family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55423"
FT                   /db_xref="GOA:B8IB30"
FT                   /db_xref="InterPro:IPR002481"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB30"
FT                   /inference="protein motif:PFAM:PF01475"
FT                   /protein_id="ACL55423.1"
FT                   T"
FT   gene            425454..426005
FT                   /locus_tag="Mnod_0382"
FT   CDS_pept        425454..426005
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0382"
FT                   /product="beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA"
FT                   /EC_number=""
FT                   /note="TIGRFAM: beta-hydroxyacyl-(acyl-carrier-protein)
FT                   dehydratase FabA; PFAM:
FT                   Beta-hydroxyacyl-(acyl-carrier-protein) dehydratase
FT                   FabA/FabZ; KEGG: met:M446_2229
FT                   beta-hydroxyacyl-(acyl-carrier-protein) dehydratase FabA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55424"
FT                   /db_xref="GOA:B8IB31"
FT                   /db_xref="InterPro:IPR010083"
FT                   /db_xref="InterPro:IPR013114"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB31"
FT                   /inference="protein motif:TFAM:TIGR01749"
FT                   /protein_id="ACL55424.1"
FT   gene            426078..427304
FT                   /locus_tag="Mnod_0383"
FT   CDS_pept        426078..427304
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0383"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: met:M446_2228
FT                   beta-ketoacyl synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0383"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55425"
FT                   /db_xref="GOA:B8IB32"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB32"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACL55425.1"
FT                   TLILKHVDA"
FT   gene            427344..428171
FT                   /locus_tag="Mnod_0384"
FT   CDS_pept        427344..428171
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0384"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="KEGG: met:M446_2227 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55426"
FT                   /db_xref="GOA:B8IB33"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR014358"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB33"
FT                   /inference="similar to AA sequence:KEGG:M446_2227"
FT                   /protein_id="ACL55426.1"
FT   gene            428546..430243
FT                   /locus_tag="Mnod_0385"
FT   CDS_pept        428546..430243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0385"
FT                   /product="adenine deaminase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: adenine deaminase; PFAM: amidohydrolase;
FT                   KEGG: met:M446_2226 adenine deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0385"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55427"
FT                   /db_xref="GOA:B8IB34"
FT                   /db_xref="InterPro:IPR006679"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR026912"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB34"
FT                   /inference="protein motif:TFAM:TIGR01178"
FT                   /protein_id="ACL55427.1"
FT   gene            430347..431252
FT                   /locus_tag="Mnod_0386"
FT   CDS_pept        430347..431252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0386"
FT                   /product="HAD-superfamily hydrolase, subfamily IIA"
FT                   /note="TIGRFAM: HAD-superfamily subfamily IIA hydrolase
FT                   like protein; HAD-superfamily hydrolase, subfamily IIA;
FT                   PFAM: Haloacid dehalogenase domain protein hydrolase; KEGG:
FT                   met:M446_2225 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55428"
FT                   /db_xref="GOA:B8IB35"
FT                   /db_xref="InterPro:IPR006356"
FT                   /db_xref="InterPro:IPR006357"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB35"
FT                   /inference="protein motif:TFAM:TIGR01460"
FT                   /protein_id="ACL55428.1"
FT   gene            complement(431253..431843)
FT                   /locus_tag="Mnod_0387"
FT   CDS_pept        complement(431253..431843)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0387"
FT                   /product="putative chemotaxis phosphatase, CheZ"
FT                   /note="KEGG: met:M446_2224 putative chemotaxis phosphatase,
FT                   CheZ"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0387"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55429"
FT                   /db_xref="GOA:B8IB36"
FT                   /db_xref="InterPro:IPR007439"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB36"
FT                   /inference="similar to AA sequence:KEGG:M446_2224"
FT                   /protein_id="ACL55429.1"
FT   gene            complement(431985..432368)
FT                   /locus_tag="Mnod_0388"
FT   CDS_pept        complement(431985..432368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0388"
FT                   /product="response regulator receiver protein"
FT                   /note="PFAM: response regulator receiver; KEGG:
FT                   met:M446_2223 response regulator receiver protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0388"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55430"
FT                   /db_xref="GOA:B8IB37"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB37"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL55430.1"
FT   gene            432812..433828
FT                   /locus_tag="Mnod_0389"
FT   CDS_pept        432812..433828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0389"
FT                   /product="riboflavin biosynthesis protein RibF"
FT                   /note="TIGRFAM: riboflavin biosynthesis protein RibF; PFAM:
FT                   FAD synthetase; Riboflavin kinase; KEGG: met:M446_2222
FT                   riboflavin biosynthesis protein RibF"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55431"
FT                   /db_xref="GOA:B8IB38"
FT                   /db_xref="InterPro:IPR002606"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR015864"
FT                   /db_xref="InterPro:IPR015865"
FT                   /db_xref="InterPro:IPR023465"
FT                   /db_xref="InterPro:IPR023468"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB38"
FT                   /inference="protein motif:TFAM:TIGR00083"
FT                   /protein_id="ACL55431.1"
FT   gene            complement(433981..434256)
FT                   /locus_tag="Mnod_0390"
FT   CDS_pept        complement(433981..434256)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0390"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2221 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55432"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB39"
FT                   /inference="similar to AA sequence:KEGG:M446_2221"
FT                   /protein_id="ACL55432.1"
FT   sig_peptide     complement(434194..434256)
FT                   /locus_tag="Mnod_0390"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.997 at
FT                   residue 21"
FT   gene            434589..437558
FT                   /locus_tag="Mnod_0391"
FT   CDS_pept        434589..437558
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0391"
FT                   /product="isoleucyl-tRNA synthetase"
FT                   /note="TIGRFAM: isoleucyl-tRNA synthetase; KEGG:
FT                   met:M446_2220 isoleucyl-tRNA synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55433"
FT                   /db_xref="GOA:B8IB40"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002300"
FT                   /db_xref="InterPro:IPR002301"
FT                   /db_xref="InterPro:IPR009008"
FT                   /db_xref="InterPro:IPR009080"
FT                   /db_xref="InterPro:IPR013155"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR023585"
FT                   /db_xref="InterPro:IPR033708"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB40"
FT                   /inference="protein motif:TFAM:TIGR00392"
FT                   /protein_id="ACL55433.1"
FT                   "
FT   gene            437630..438127
FT                   /locus_tag="Mnod_0392"
FT   CDS_pept        437630..438127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0392"
FT                   /product="lipoprotein signal peptidase"
FT                   /note="TIGRFAM: lipoprotein signal peptidase; PFAM:
FT                   peptidase A8 signal peptidase II; KEGG: met:M446_2219
FT                   lipoprotein signal peptidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0392"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55434"
FT                   /db_xref="GOA:B8IB41"
FT                   /db_xref="InterPro:IPR001872"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8IB41"
FT                   /inference="protein motif:TFAM:TIGR00077"
FT                   /protein_id="ACL55434.1"
FT                   DA"
FT   gene            438269..438931
FT                   /locus_tag="Mnod_0393"
FT   CDS_pept        438269..438931
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0393"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2218 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55435"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB42"
FT                   /inference="similar to AA sequence:KEGG:M446_2218"
FT                   /protein_id="ACL55435.1"
FT   sig_peptide     438269..438340
FT                   /locus_tag="Mnod_0393"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 24"
FT   gene            439218..440597
FT                   /locus_tag="Mnod_0394"
FT   CDS_pept        439218..440597
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0394"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2217 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0394"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55436"
FT                   /db_xref="GOA:B8IB43"
FT                   /db_xref="InterPro:IPR001431"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="InterPro:IPR011765"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB43"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55436.1"
FT                   A"
FT   gene            440641..441954
FT                   /locus_tag="Mnod_0395"
FT   CDS_pept        440641..441954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0395"
FT                   /product="peptidase M16 domain protein"
FT                   /note="PFAM: peptidase M16 domain protein; KEGG:
FT                   met:M446_2216 peptidase M16 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55437"
FT                   /db_xref="GOA:B8IB44"
FT                   /db_xref="InterPro:IPR007863"
FT                   /db_xref="InterPro:IPR011249"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB44"
FT                   /inference="protein motif:PFAM:PF05193"
FT                   /protein_id="ACL55437.1"
FT   sig_peptide     440641..440709
FT                   /locus_tag="Mnod_0395"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.746) with cleavage site probability 0.728 at
FT                   residue 23"
FT   gene            complement(442080..442517)
FT                   /locus_tag="Mnod_0396"
FT   CDS_pept        complement(442080..442517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0396"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   met:M446_2215 cupin 2 domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0396"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55438"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR017102"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB45"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL55438.1"
FT   gene            442613..443455
FT                   /locus_tag="Mnod_0397"
FT   CDS_pept        442613..443455
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0397"
FT                   /product="Urease accessory protein UreD"
FT                   /note="PFAM: Urease accessory protein UreD; KEGG:
FT                   met:M446_2214 urease accessory protein UreD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55439"
FT                   /db_xref="GOA:B8IB46"
FT                   /db_xref="InterPro:IPR002669"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB46"
FT                   /inference="protein motif:PFAM:PF01774"
FT                   /protein_id="ACL55439.1"
FT   gene            443534..444154
FT                   /locus_tag="Mnod_0398"
FT   CDS_pept        443534..444154
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0398"
FT                   /product="urease, gamma subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: urease, beta subunit; urease, gamma
FT                   subunit; PFAM: Urease beta subunit; Urease gamma subunit
FT                   region; KEGG: met:M446_2213 urease, gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55440"
FT                   /db_xref="GOA:B8IB47"
FT                   /db_xref="InterPro:IPR002019"
FT                   /db_xref="InterPro:IPR002026"
FT                   /db_xref="InterPro:IPR008223"
FT                   /db_xref="InterPro:IPR012010"
FT                   /db_xref="InterPro:IPR036461"
FT                   /db_xref="InterPro:IPR036463"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB47"
FT                   /inference="protein motif:TFAM:TIGR00193"
FT                   /protein_id="ACL55440.1"
FT   gene            444188..445915
FT                   /locus_tag="Mnod_0399"
FT   CDS_pept        444188..445915
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0399"
FT                   /product="urease, alpha subunit"
FT                   /EC_number=""
FT                   /note="TIGRFAM: urease, alpha subunit; PFAM:
FT                   amidohydrolase; Urease alpha-subunit domain protein;
FT                   Amidohydrolase 3; KEGG: met:M446_2211 urease, alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55441"
FT                   /db_xref="GOA:B8IB48"
FT                   /db_xref="InterPro:IPR005848"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR011059"
FT                   /db_xref="InterPro:IPR011612"
FT                   /db_xref="InterPro:IPR017950"
FT                   /db_xref="InterPro:IPR017951"
FT                   /db_xref="InterPro:IPR029754"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB48"
FT                   /inference="protein motif:TFAM:TIGR01792"
FT                   /protein_id="ACL55441.1"
FT   gene            446092..447669
FT                   /locus_tag="Mnod_0400"
FT   CDS_pept        446092..447669
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0400"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_2210 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55442"
FT                   /db_xref="GOA:B8IB49"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB49"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55442.1"
FT                   VFWNIEKQ"
FT   sig_peptide     446092..446172
FT                   /locus_tag="Mnod_0400"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 27"
FT   gene            447677..448618
FT                   /locus_tag="Mnod_0401"
FT   CDS_pept        447677..448618
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0401"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2209
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55443"
FT                   /db_xref="GOA:B8IB50"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB50"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55443.1"
FT   gene            448615..449487
FT                   /locus_tag="Mnod_0402"
FT   CDS_pept        448615..449487
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0402"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_2208
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55444"
FT                   /db_xref="GOA:B8IB51"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB51"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55444.1"
FT                   LARRLGGVR"
FT   sig_peptide     448615..448734
FT                   /locus_tag="Mnod_0402"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.985 at
FT                   residue 40"
FT   gene            449484..451136
FT                   /locus_tag="Mnod_0403"
FT   CDS_pept        449484..451136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0403"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related;
FT                   Oligopeptide/dipeptide ABC transporter domain protein;
FT                   SMART: AAA ATPase; KEGG: met:M446_2207 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55445"
FT                   /db_xref="GOA:B8IB52"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB52"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55445.1"
FT   gene            complement(451314..451883)
FT                   /locus_tag="Mnod_0404"
FT   CDS_pept        complement(451314..451883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0404"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0094 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55446"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB53"
FT                   /inference="similar to AA sequence:KEGG:M446_0094"
FT                   /protein_id="ACL55446.1"
FT   gene            452077..453345
FT                   /locus_tag="Mnod_0405"
FT   CDS_pept        452077..453345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0405"
FT                   /product="membrane-fusion protein"
FT                   /note="KEGG: met:M446_0093 membrane-fusion protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0405"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55447"
FT                   /db_xref="GOA:B8IB54"
FT                   /db_xref="InterPro:IPR022275"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB54"
FT                   /inference="similar to AA sequence:KEGG:M446_0093"
FT                   /protein_id="ACL55447.1"
FT   gene            453352..455529
FT                   /locus_tag="Mnod_0406"
FT   CDS_pept        453352..455529
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0406"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter transmembrane region; ABC
FT                   transporter related; peptidase C39 bacteriocin processing;
FT                   SMART: AAA ATPase; KEGG: met:M446_0092 ABC transporter
FT                   related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0406"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55448"
FT                   /db_xref="GOA:B8IB55"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005074"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022514"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB55"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55448.1"
FT   gene            455526..458420
FT                   /locus_tag="Mnod_0407"
FT   CDS_pept        455526..458420
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0407"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_0091 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55449"
FT                   /db_xref="GOA:B8IB56"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022515"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB56"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55449.1"
FT   gene            complement(458853..460022)
FT                   /locus_tag="Mnod_0408"
FT   CDS_pept        complement(458853..460022)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0408"
FT                   /product="acetate kinase"
FT                   /note="TIGRFAM: acetate kinase; PFAM: acetate and butyrate
FT                   kinase; KEGG: met:M446_6098 acetate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0408"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55450"
FT                   /db_xref="GOA:B8IB57"
FT                   /db_xref="InterPro:IPR000890"
FT                   /db_xref="InterPro:IPR004372"
FT                   /db_xref="InterPro:IPR023865"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB57"
FT                   /inference="protein motif:TFAM:TIGR00016"
FT                   /protein_id="ACL55450.1"
FT   gene            complement(460019..461461)
FT                   /locus_tag="Mnod_0409"
FT   CDS_pept        complement(460019..461461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0409"
FT                   /product="MaoC domain protein dehydratase"
FT                   /EC_number=""
FT                   /note="PFAM: phosphate acetyl/butaryl transferase; MaoC
FT                   domain protein dehydratase; KEGG: met:M446_6099 phosphate
FT                   butyryltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55451"
FT                   /db_xref="GOA:B8IB58"
FT                   /db_xref="InterPro:IPR002505"
FT                   /db_xref="InterPro:IPR002539"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB58"
FT                   /inference="protein motif:PFAM:PF01575"
FT                   /protein_id="ACL55451.1"
FT   gene            complement(461462..461557)
FT                   /locus_tag="Mnod_0410"
FT   CDS_pept        complement(461462..461557)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0410"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0410"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55452"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB59"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55452.1"
FT                   /translation="MASPIAERGGPAARLGARIVPILESGLHAVA"
FT   gene            complement(461561..463441)
FT                   /locus_tag="Mnod_0411"
FT   CDS_pept        complement(461561..463441)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0411"
FT                   /product="Poly-beta-hydroxybutyrate polymerase domain
FT                   protein"
FT                   /note="PFAM: alpha/beta hydrolase fold;
FT                   Poly-beta-hydroxybutyrate polymerase domain protein; KEGG:
FT                   met:M446_6101 poly-beta-hydroxybutyrate polymerase
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55453"
FT                   /db_xref="GOA:B8IB60"
FT                   /db_xref="InterPro:IPR010941"
FT                   /db_xref="InterPro:IPR022211"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB60"
FT                   /inference="protein motif:PFAM:PF07167"
FT                   /protein_id="ACL55453.1"
FT   gene            463630..463839
FT                   /locus_tag="Mnod_0412"
FT   CDS_pept        463630..463839
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0412"
FT                   /product="TOBE domain protein"
FT                   /note="PFAM: TOBE domain protein; KEGG: met:M446_3573 TOBE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55454"
FT                   /db_xref="GOA:B8IB61"
FT                   /db_xref="InterPro:IPR004606"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB61"
FT                   /inference="protein motif:PFAM:PF03459"
FT                   /protein_id="ACL55454.1"
FT   gene            complement(464290..465012)
FT                   /locus_tag="Mnod_0413"
FT   CDS_pept        complement(464290..465012)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0413"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; SMART: regulatory
FT                   protein Crp; KEGG: met:M446_5720 Crp/FNR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55455"
FT                   /db_xref="GOA:B8IB62"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IB62"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACL55455.1"
FT                   CECHALISAEYRRLFTRR"
FT   gene            465273..467066
FT                   /locus_tag="Mnod_0414"
FT   CDS_pept        465273..467066
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0414"
FT                   /product="thiamine pyrophosphate protein TPP binding domain
FT                   protein"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: met:M446_2089 thiamine pyrophosphate binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55456"
FT                   /db_xref="GOA:B8IC68"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC68"
FT                   /inference="protein motif:PFAM:PF02776"
FT                   /protein_id="ACL55456.1"
FT   gene            467070..468164
FT                   /locus_tag="Mnod_0415"
FT   CDS_pept        467070..468164
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0415"
FT                   /product="Mandelate racemase/muconate lactonizing protein"
FT                   /note="PFAM: Mandelate racemase/muconate lactonizing
FT                   protein; KEGG: met:M446_2088 mandelate racemase/muconate
FT                   lactonizing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55457"
FT                   /db_xref="GOA:B8IC69"
FT                   /db_xref="InterPro:IPR013341"
FT                   /db_xref="InterPro:IPR013342"
FT                   /db_xref="InterPro:IPR018110"
FT                   /db_xref="InterPro:IPR029017"
FT                   /db_xref="InterPro:IPR029065"
FT                   /db_xref="InterPro:IPR034593"
FT                   /db_xref="InterPro:IPR036849"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC69"
FT                   /inference="protein motif:PFAM:PF02746"
FT                   /protein_id="ACL55457.1"
FT   gene            468154..469215
FT                   /locus_tag="Mnod_0416"
FT   CDS_pept        468154..469215
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0416"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2087 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0416"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55458"
FT                   /db_xref="GOA:B8IC70"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC70"
FT                   /inference="similar to AA sequence:KEGG:M446_2087"
FT                   /protein_id="ACL55458.1"
FT                   LAALDLMERHDHG"
FT   gene            469208..469882
FT                   /locus_tag="Mnod_0417"
FT   CDS_pept        469208..469882
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0417"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2086 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0417"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55459"
FT                   /db_xref="InterPro:IPR027056"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC71"
FT                   /inference="similar to AA sequence:KEGG:M446_2086"
FT                   /protein_id="ACL55459.1"
FT                   RM"
FT   gene            469890..471611
FT                   /locus_tag="Mnod_0418"
FT   CDS_pept        469890..471611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0418"
FT                   /product="glucose-methanol-choline oxidoreductase"
FT                   /note="PFAM: glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: met:M446_2085
FT                   glucose-methanol-choline oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55460"
FT                   /db_xref="GOA:B8IC72"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC72"
FT                   /inference="protein motif:PFAM:PF00732"
FT                   /protein_id="ACL55460.1"
FT   gene            471627..472517
FT                   /locus_tag="Mnod_0419"
FT   CDS_pept        471627..472517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0419"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: met:M446_2084 SMP-30/gluconolaconase/LRE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55461"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="InterPro:IPR039096"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC73"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACL55461.1"
FT                   GVRGEPRPLFGETRP"
FT   gene            472514..473509
FT                   /locus_tag="Mnod_0420"
FT   CDS_pept        472514..473509
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0420"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_2083 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55462"
FT                   /db_xref="GOA:B8IC74"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC74"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55462.1"
FT   sig_peptide     472514..472582
FT                   /locus_tag="Mnod_0420"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.950) with cleavage site probability 0.947 at
FT                   residue 23"
FT   gene            complement(473856..475628)
FT                   /locus_tag="Mnod_0421"
FT   CDS_pept        complement(473856..475628)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0421"
FT                   /product="PQQ-dependent dehydrogenase, methanol/ethanol
FT                   family"
FT                   /note="TIGRFAM: PQQ-dependent dehydrogenase,
FT                   methanol/ethanol family; PFAM: Pyrrolo-quinoline quinone;
FT                   KEGG: met:M446_2082 methanol/ethanol family PQQ-dependent
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55463"
FT                   /db_xref="GOA:B8IC75"
FT                   /db_xref="InterPro:IPR001479"
FT                   /db_xref="InterPro:IPR002372"
FT                   /db_xref="InterPro:IPR011047"
FT                   /db_xref="InterPro:IPR017512"
FT                   /db_xref="InterPro:IPR018391"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC75"
FT                   /inference="protein motif:TFAM:TIGR03075"
FT                   /protein_id="ACL55463.1"
FT                   TAPGGVLTVFALPE"
FT   sig_peptide     complement(475569..475628)
FT                   /locus_tag="Mnod_0421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 20"
FT   gene            475849..476589
FT                   /locus_tag="Mnod_0422"
FT   CDS_pept        475849..476589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0422"
FT                   /product="transcriptional regulator, Crp/Fnr family"
FT                   /note="PFAM: cyclic nucleotide-binding; regulatory protein
FT                   Crp; KEGG: met:M446_6132 Crp/FNR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55464"
FT                   /db_xref="GOA:B8IC76"
FT                   /db_xref="InterPro:IPR000595"
FT                   /db_xref="InterPro:IPR012318"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR018335"
FT                   /db_xref="InterPro:IPR018490"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC76"
FT                   /inference="protein motif:PFAM:PF00027"
FT                   /protein_id="ACL55464.1"
FT   gene            complement(476605..477420)
FT                   /locus_tag="Mnod_0423"
FT   CDS_pept        complement(476605..477420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0423"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: met:M446_6131 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55465"
FT                   /db_xref="InterPro:IPR006015"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC77"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACL55465.1"
FT   gene            complement(477560..477823)
FT                   /locus_tag="Mnod_0424"
FT   CDS_pept        complement(477560..477823)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0424"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC78"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55466.1"
FT   gene            complement(477820..478215)
FT                   /locus_tag="Mnod_0425"
FT   CDS_pept        complement(477820..478215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0425"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3595 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55467"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC79"
FT                   /inference="similar to AA sequence:KEGG:M446_3595"
FT                   /protein_id="ACL55467.1"
FT   gene            complement(478231..478479)
FT                   /locus_tag="Mnod_0426"
FT   CDS_pept        complement(478231..478479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6133 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55468"
FT                   /db_xref="InterPro:IPR007420"
FT                   /db_xref="InterPro:IPR038444"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC80"
FT                   /inference="similar to AA sequence:KEGG:M446_6133"
FT                   /protein_id="ACL55468.1"
FT   gene            complement(478676..478822)
FT                   /locus_tag="Mnod_0427"
FT   CDS_pept        complement(478676..478822)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0427"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_0580 OmpW family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0427"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55469"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC81"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55469.1"
FT                   CKF"
FT   gene            complement(478936..481767)
FT                   /locus_tag="Mnod_0428"
FT   CDS_pept        complement(478936..481767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0428"
FT                   /product="multi-sensor hybrid histidine kinase"
FT                   /note="KEGG: met:M446_2081 multi-sensor hybrid histidine
FT                   kinase; TIGRFAM: PAS sensor protein; PFAM: response
FT                   regulator receiver; GAF domain protein; ATP-binding region
FT                   ATPase domain protein; histidine kinase A domain protein;
FT                   PAS fold-3 domain protein; PAS fold-4 domain protein; PAS
FT                   fold domain protein; SMART: PAS domain containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0428"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55470"
FT                   /db_xref="GOA:B8IC82"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000700"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR013656"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC82"
FT                   /inference="protein motif:TFAM:TIGR00229"
FT                   /protein_id="ACL55470.1"
FT                   RVTARAPAAPHGG"
FT   sig_peptide     complement(481711..481767)
FT                   /locus_tag="Mnod_0428"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.770) with cleavage site probability 0.712 at
FT                   residue 19"
FT   gene            482216..484447
FT                   /locus_tag="Mnod_0429"
FT   CDS_pept        482216..484447
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0429"
FT                   /product="diguanylate cyclase/phosphodiesterase with
FT                   PAS/PAC sensor(s)"
FT                   /note="KEGG: mpo:Mpop_0141 diguanylate
FT                   cyclase/phosphodiesterase with PAS/PAC sensor(s); TIGRFAM:
FT                   PAS sensor protein; diguanylate cyclase; PFAM: GGDEF domain
FT                   containing protein; EAL domain protein; PAS fold-4 domain
FT                   protein; PAS fold domain protein; SMART: PAS domain
FT                   containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55471"
FT                   /db_xref="GOA:B8IC83"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR005330"
FT                   /db_xref="InterPro:IPR013767"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC83"
FT                   /inference="protein motif:TFAM:TIGR00254"
FT                   /protein_id="ACL55471.1"
FT   sig_peptide     482216..482308
FT                   /locus_tag="Mnod_0429"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.899) with cleavage site probability 0.308 at
FT                   residue 31"
FT   gene            485121..486401
FT                   /locus_tag="Mnod_0430"
FT   CDS_pept        485121..486401
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0430"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2080 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0430"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55472"
FT                   /db_xref="InterPro:IPR021225"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC84"
FT                   /inference="similar to AA sequence:KEGG:M446_2080"
FT                   /protein_id="ACL55472.1"
FT   gene            complement(486561..487358)
FT                   /locus_tag="Mnod_0431"
FT   CDS_pept        complement(486561..487358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2079 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55473"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR031304"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC85"
FT                   /inference="similar to AA sequence:KEGG:M446_2079"
FT                   /protein_id="ACL55473.1"
FT   sig_peptide     complement(487284..487358)
FT                   /locus_tag="Mnod_0431"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.762 at
FT                   residue 25"
FT   gene            487696..488814
FT                   /locus_tag="Mnod_0432"
FT   CDS_pept        487696..488814
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0432"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; Male sterility domain; KR domain
FT                   protein; KEGG: met:M446_2078 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0432"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55474"
FT                   /db_xref="GOA:B8IC86"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC86"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55474.1"
FT   sig_peptide     487696..487755
FT                   /locus_tag="Mnod_0432"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.677) with cleavage site probability 0.504 at
FT                   residue 20"
FT   gene            488811..489905
FT                   /locus_tag="Mnod_0433"
FT   CDS_pept        488811..489905
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0433"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: met:M446_2077 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55475"
FT                   /db_xref="GOA:B8IC87"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC87"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55475.1"
FT   gene            490003..491301
FT                   /locus_tag="Mnod_0434"
FT   CDS_pept        490003..491301
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0434"
FT                   /product="Radical SAM domain protein"
FT                   /note="PFAM: Radical SAM domain protein; SMART: Elongator
FT                   protein 3/MiaB/NifB; KEGG: met:M446_2076 radical SAM
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55476"
FT                   /db_xref="GOA:B8IC88"
FT                   /db_xref="InterPro:IPR006158"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR023404"
FT                   /db_xref="InterPro:IPR027559"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC88"
FT                   /inference="protein motif:PFAM:PF04055"
FT                   /protein_id="ACL55476.1"
FT   gene            491286..492446
FT                   /locus_tag="Mnod_0435"
FT   CDS_pept        491286..492446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0435"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_2075 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55477"
FT                   /db_xref="GOA:B8IC89"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC89"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55477.1"
FT   gene            492443..493555
FT                   /locus_tag="Mnod_0436"
FT   CDS_pept        492443..493555
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0436"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2074 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55478"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC90"
FT                   /inference="similar to AA sequence:KEGG:M446_2074"
FT                   /protein_id="ACL55478.1"
FT   gene            493641..494738
FT                   /locus_tag="Mnod_0437"
FT   CDS_pept        493641..494738
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0437"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2073 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC91"
FT                   /inference="similar to AA sequence:KEGG:M446_2073"
FT                   /protein_id="ACL55479.1"
FT   gene            494735..495883
FT                   /locus_tag="Mnod_0438"
FT   CDS_pept        494735..495883
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0438"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55480"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC92"
FT                   /inference="similar to AA sequence:KEGG:M446_2072"
FT                   /protein_id="ACL55480.1"
FT   sig_peptide     494735..494806
FT                   /locus_tag="Mnod_0438"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.800) with cleavage site probability 0.765 at
FT                   residue 24"
FT   gene            495942..496964
FT                   /locus_tag="Mnod_0439"
FT   CDS_pept        495942..496964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0439"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   dTDP-4-dehydrorhamnose reductase; Male sterility domain;
FT                   KEGG: met:M446_2071 NAD-dependent epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55481"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC93"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL55481.1"
FT                   "
FT   sig_peptide     495942..496019
FT                   /locus_tag="Mnod_0439"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.941) with cleavage site probability 0.497 at
FT                   residue 26"
FT   gene            complement(497106..497282)
FT                   /locus_tag="Mnod_0440"
FT   CDS_pept        complement(497106..497282)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0440"
FT                   /product="metallothionein family 14"
FT                   /note="PFAM: metallothionein family 14; KEGG: met:M446_2070
FT                   metallothionein family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55482"
FT                   /db_xref="GOA:B8IC94"
FT                   /db_xref="InterPro:IPR000518"
FT                   /db_xref="InterPro:IPR017854"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC94"
FT                   /inference="protein motif:PFAM:PF02069"
FT                   /protein_id="ACL55482.1"
FT                   HAGCDHAGCTCHG"
FT   gene            complement(497728..498585)
FT                   /locus_tag="Mnod_0441"
FT   CDS_pept        complement(497728..498585)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0441"
FT                   /product="LmbE family protein"
FT                   /note="PFAM: LmbE family protein; KEGG: met:M446_2069 LmbE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55483"
FT                   /db_xref="InterPro:IPR003737"
FT                   /db_xref="InterPro:IPR024078"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC95"
FT                   /inference="protein motif:PFAM:PF02585"
FT                   /protein_id="ACL55483.1"
FT                   GLCP"
FT   gene            complement(498582..499517)
FT                   /locus_tag="Mnod_0442"
FT   CDS_pept        complement(498582..499517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0442"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2068 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55484"
FT                   /db_xref="InterPro:IPR017853"
FT                   /db_xref="InterPro:IPR024655"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC96"
FT                   /inference="similar to AA sequence:KEGG:M446_2068"
FT                   /protein_id="ACL55484.1"
FT   gene            499683..500642
FT                   /locus_tag="Mnod_0443"
FT   CDS_pept        499683..500642
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0443"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: mpo:Mpop_2285
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55485"
FT                   /db_xref="GOA:B8IC97"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC97"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL55485.1"
FT   gene            complement(500753..501379)
FT                   /locus_tag="Mnod_0444"
FT   CDS_pept        complement(500753..501379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0444"
FT                   /product="phosphoglycerate mutase 1 family"
FT                   /note="TIGRFAM: phosphoglycerate mutase 1 family; PFAM:
FT                   Phosphoglycerate mutase; KEGG: met:M446_2067
FT                   phosphoglycerate mutase 1 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55486"
FT                   /db_xref="GOA:B8IC98"
FT                   /db_xref="InterPro:IPR001345"
FT                   /db_xref="InterPro:IPR005952"
FT                   /db_xref="InterPro:IPR013078"
FT                   /db_xref="InterPro:IPR029033"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC98"
FT                   /inference="protein motif:TFAM:TIGR01258"
FT                   /protein_id="ACL55486.1"
FT   gene            complement(501411..502208)
FT                   /locus_tag="Mnod_0445"
FT   CDS_pept        complement(501411..502208)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0445"
FT                   /product="dihydrodipicolinate reductase"
FT                   /EC_number=""
FT                   /note="PFAM: dihydrodipicolinate reductase; KEGG:
FT                   met:M446_2066 dihydrodipicolinate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55487"
FT                   /db_xref="GOA:B8IC99"
FT                   /db_xref="InterPro:IPR000846"
FT                   /db_xref="InterPro:IPR022663"
FT                   /db_xref="InterPro:IPR022664"
FT                   /db_xref="InterPro:IPR023940"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC99"
FT                   /inference="protein motif:PFAM:PF01113"
FT                   /protein_id="ACL55487.1"
FT   gene            complement(502345..503052)
FT                   /locus_tag="Mnod_0446"
FT   CDS_pept        complement(502345..503052)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0446"
FT                   /product="multiple antibiotic resistance (MarC)-related
FT                   protein"
FT                   /note="PFAM: multiple antibiotic resistance (MarC)-related
FT                   protein; KEGG: met:M446_2065 multiple antibiotic resistance
FT                   (MarC)-related protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55488"
FT                   /db_xref="GOA:B8ICA0"
FT                   /db_xref="InterPro:IPR002771"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA0"
FT                   /inference="protein motif:PFAM:PF01914"
FT                   /protein_id="ACL55488.1"
FT                   SDVLEPLLAARGR"
FT   gene            complement(503060..503800)
FT                   /locus_tag="Mnod_0447"
FT   CDS_pept        complement(503060..503800)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0447"
FT                   /product="Methyltransferase type 11"
FT                   /note="PFAM: Methyltransferase type 11; KEGG: met:M446_2064
FT                   methyltransferase type 11"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55489"
FT                   /db_xref="GOA:B8ICA1"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA1"
FT                   /inference="protein motif:PFAM:PF08241"
FT                   /protein_id="ACL55489.1"
FT   gene            504007..504774
FT                   /locus_tag="Mnod_0448"
FT   CDS_pept        504007..504774
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0448"
FT                   /product="hydroxyacylglutathione hydrolase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: hydroxyacylglutathione hydrolase; PFAM:
FT                   beta-lactamase domain protein; KEGG: met:M446_2063
FT                   hydroxyacylglutathione hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55490"
FT                   /db_xref="GOA:B8ICA2"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR017782"
FT                   /db_xref="InterPro:IPR032282"
FT                   /db_xref="InterPro:IPR035680"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICA2"
FT                   /inference="protein motif:TFAM:TIGR03413"
FT                   /protein_id="ACL55490.1"
FT   gene            504934..505380
FT                   /locus_tag="Mnod_0449"
FT   CDS_pept        504934..505380
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0449"
FT                   /product="protein of unknown function DUF985"
FT                   /note="PFAM: protein of unknown function DUF985; KEGG:
FT                   met:M446_2062 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55491"
FT                   /db_xref="InterPro:IPR009327"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="InterPro:IPR039935"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA3"
FT                   /inference="protein motif:PFAM:PF06172"
FT                   /protein_id="ACL55491.1"
FT   gene            complement(505587..506471)
FT                   /locus_tag="Mnod_0450"
FT   CDS_pept        complement(505587..506471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0450"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: met:M446_2060 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55492"
FT                   /db_xref="GOA:B8ICA4"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA4"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL55492.1"
FT                   ATRAGAEKRERVA"
FT   sig_peptide     complement(506385..506471)
FT                   /locus_tag="Mnod_0450"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.634 at
FT                   residue 29"
FT   gene            506554..507201
FT                   /locus_tag="Mnod_0451"
FT   CDS_pept        506554..507201
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0451"
FT                   /product="2OG-Fe(II) oxygenase"
FT                   /note="PFAM: 2OG-Fe(II) oxygenase; KEGG: met:M446_2016
FT                   2OG-Fe(II) oxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55493"
FT                   /db_xref="GOA:B8ICA5"
FT                   /db_xref="InterPro:IPR004574"
FT                   /db_xref="InterPro:IPR005123"
FT                   /db_xref="InterPro:IPR027450"
FT                   /db_xref="InterPro:IPR037151"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA5"
FT                   /inference="protein motif:PFAM:PF03171"
FT                   /protein_id="ACL55493.1"
FT   gene            507279..508223
FT                   /locus_tag="Mnod_0452"
FT   CDS_pept        507279..508223
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0452"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2015 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55494"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA6"
FT                   /inference="similar to AA sequence:KEGG:M446_2015"
FT                   /protein_id="ACL55494.1"
FT   sig_peptide     507279..507344
FT                   /locus_tag="Mnod_0452"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(508211..509926)
FT                   /locus_tag="Mnod_0453"
FT   CDS_pept        complement(508211..509926)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0453"
FT                   /product="dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /EC_number=""
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: met:M446_1318 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55495"
FT                   /db_xref="GOA:B8ICA7"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR020558"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="InterPro:IPR042096"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA7"
FT                   /inference="protein motif:PFAM:PF00920"
FT                   /protein_id="ACL55495.1"
FT   gene            510181..510411
FT                   /locus_tag="Mnod_0454"
FT   CDS_pept        510181..510411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0454"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2014 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55496"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA8"
FT                   /inference="similar to AA sequence:KEGG:M446_2014"
FT                   /protein_id="ACL55496.1"
FT   gene            511130..511813
FT                   /locus_tag="Mnod_0455"
FT   CDS_pept        511130..511813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0455"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2012 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55497"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICA9"
FT                   /inference="similar to AA sequence:KEGG:M446_2012"
FT                   /protein_id="ACL55497.1"
FT                   MNMME"
FT   sig_peptide     511130..511195
FT                   /locus_tag="Mnod_0455"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            512032..512241
FT                   /locus_tag="Mnod_0456"
FT   CDS_pept        512032..512241
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0456"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_2011 low-affinity inorganic phosphate
FT                   transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0456"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55498"
FT                   /db_xref="GOA:B8ICB0"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55498.1"
FT   gene            512244..513281
FT                   /locus_tag="Mnod_0457"
FT   CDS_pept        512244..513281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0457"
FT                   /product="Mg2 transporter protein CorA family protein"
FT                   /note="PFAM: Mg2 transporter protein CorA family protein;
FT                   KEGG: met:M446_2010 Mg2 transporter protein CorA family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0457"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55499"
FT                   /db_xref="GOA:B8ICB1"
FT                   /db_xref="InterPro:IPR002523"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB1"
FT                   /inference="protein motif:PFAM:PF01544"
FT                   /protein_id="ACL55499.1"
FT                   RTPRR"
FT   gene            513469..514146
FT                   /locus_tag="Mnod_0458"
FT   CDS_pept        513469..514146
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0458"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2009 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55500"
FT                   /db_xref="InterPro:IPR018550"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB2"
FT                   /inference="similar to AA sequence:KEGG:M446_2009"
FT                   /protein_id="ACL55500.1"
FT                   YTF"
FT   gene            514258..514833
FT                   /locus_tag="Mnod_0459"
FT   CDS_pept        514258..514833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0459"
FT                   /product="ATP/cobalamin adenosyltransferase"
FT                   /note="TIGRFAM: ATP/cobalamin adenosyltransferase; PFAM:
FT                   cobalamin adenosyltransferase; KEGG: met:M446_2008
FT                   ATP--cobalamin adenosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55501"
FT                   /db_xref="GOA:B8ICB3"
FT                   /db_xref="InterPro:IPR016030"
FT                   /db_xref="InterPro:IPR029499"
FT                   /db_xref="InterPro:IPR036451"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB3"
FT                   /inference="protein motif:TFAM:TIGR00636"
FT                   /protein_id="ACL55501.1"
FT   gene            515064..515813
FT                   /locus_tag="Mnod_0460"
FT   CDS_pept        515064..515813
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0460"
FT                   /product="Electron transfer flavoprotein
FT                   alpha/beta-subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit; KEGG: met:M446_2007 electron transfer
FT                   flavoprotein alpha/beta-subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55502"
FT                   /db_xref="GOA:B8ICB4"
FT                   /db_xref="InterPro:IPR000049"
FT                   /db_xref="InterPro:IPR012255"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR033948"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB4"
FT                   /inference="protein motif:PFAM:PF01012"
FT                   /protein_id="ACL55502.1"
FT   gene            515845..516795
FT                   /locus_tag="Mnod_0461"
FT   CDS_pept        515845..516795
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0461"
FT                   /product="Electron transfer flavoprotein alpha subunit"
FT                   /note="PFAM: Electron transfer flavoprotein
FT                   alpha/beta-subunit ; Electron transfer flavoprotein alpha
FT                   subunit; KEGG: met:M446_2006 electron transfer flavoprotein
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55503"
FT                   /db_xref="GOA:B8ICB5"
FT                   /db_xref="InterPro:IPR001308"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR014730"
FT                   /db_xref="InterPro:IPR014731"
FT                   /db_xref="InterPro:IPR018206"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR033947"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB5"
FT                   /inference="protein motif:PFAM:PF00766"
FT                   /protein_id="ACL55503.1"
FT   gene            516965..517846
FT                   /locus_tag="Mnod_0462"
FT   CDS_pept        516965..517846
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0462"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /EC_number=""
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   met:M446_2005 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55504"
FT                   /db_xref="GOA:B8ICB6"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR006180"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR022694"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB6"
FT                   /inference="protein motif:PFAM:PF02737"
FT                   /protein_id="ACL55504.1"
FT                   YDYRGPEPVPTR"
FT   gene            complement(517911..518225)
FT                   /locus_tag="Mnod_0463"
FT   CDS_pept        complement(517911..518225)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0463"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2004 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55505"
FT                   /db_xref="GOA:B8ICB7"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB7"
FT                   /inference="similar to AA sequence:KEGG:M446_2004"
FT                   /protein_id="ACL55505.1"
FT                   "
FT   gene            complement(518323..519330)
FT                   /locus_tag="Mnod_0464"
FT   CDS_pept        complement(518323..519330)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0464"
FT                   /product="NAD(P)H quinone oxidoreductase, PIG3 family"
FT                   /note="TIGRFAM: NAD(P)H quinone oxidoreductase, PIG3
FT                   family; PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   met:M446_2003 PIG3 family NAD(P)H quinone oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0464"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55506"
FT                   /db_xref="GOA:B8ICB8"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR014189"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB8"
FT                   /inference="protein motif:TFAM:TIGR02824"
FT                   /protein_id="ACL55506.1"
FT   gene            complement(519442..520104)
FT                   /locus_tag="Mnod_0465"
FT   CDS_pept        complement(519442..520104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0465"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /note="TIGRFAM: uracil phosphoribosyltransferase; PFAM:
FT                   phosphoribosyltransferase; KEGG: met:M446_2002 uracil
FT                   phosphoribosyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0465"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55507"
FT                   /db_xref="GOA:B8ICB9"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICB9"
FT                   /inference="protein motif:TFAM:TIGR01091"
FT                   /protein_id="ACL55507.1"
FT   gene            complement(520156..521412)
FT                   /locus_tag="Mnod_0466"
FT   CDS_pept        complement(520156..521412)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0466"
FT                   /product="protein of unknown function DUF1688"
FT                   /note="PFAM: protein of unknown function DUF1688; KEGG:
FT                   bra:BRADO1787 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0466"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55508"
FT                   /db_xref="InterPro:IPR012469"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC0"
FT                   /inference="protein motif:PFAM:PF07958"
FT                   /protein_id="ACL55508.1"
FT   gene            complement(521693..522949)
FT                   /locus_tag="Mnod_0467"
FT   CDS_pept        complement(521693..522949)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0467"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2000 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0467"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55509"
FT                   /db_xref="GOA:B8ICC1"
FT                   /db_xref="InterPro:IPR000926"
FT                   /db_xref="InterPro:IPR022163"
FT                   /db_xref="InterPro:IPR032677"
FT                   /db_xref="InterPro:IPR036144"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC1"
FT                   /inference="similar to AA sequence:KEGG:M446_2000"
FT                   /protein_id="ACL55509.1"
FT   gene            complement(523080..523499)
FT                   /locus_tag="Mnod_0468"
FT   CDS_pept        complement(523080..523499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1999 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55510"
FT                   /db_xref="GOA:B8ICC2"
FT                   /db_xref="InterPro:IPR021273"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC2"
FT                   /inference="similar to AA sequence:KEGG:M446_1999"
FT                   /protein_id="ACL55510.1"
FT   gene            523768..523977
FT                   /locus_tag="Mnod_0469"
FT   CDS_pept        523768..523977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0469"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1721 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55511"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC3"
FT                   /inference="similar to AA sequence:KEGG:M446_1721"
FT                   /protein_id="ACL55511.1"
FT   gene            complement(523967..525382)
FT                   /locus_tag="Mnod_0470"
FT   CDS_pept        complement(523967..525382)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0470"
FT                   /product="protease Do"
FT                   /EC_number=""
FT                   /note="TIGRFAM: protease Do; PFAM: peptidase S1 and S6
FT                   chymotrypsin/Hap; PDZ/DHR/GLGF domain protein; KEGG:
FT                   met:M446_1718 protease Do"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55512"
FT                   /db_xref="GOA:B8ICC4"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR011782"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="InterPro:IPR041489"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC4"
FT                   /inference="protein motif:TFAM:TIGR02037"
FT                   /protein_id="ACL55512.1"
FT                   NRGGQQLTSVFSG"
FT   sig_peptide     complement(525314..525382)
FT                   /locus_tag="Mnod_0470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.993 at
FT                   residue 23"
FT   gene            complement(525456..526724)
FT                   /locus_tag="Mnod_0471"
FT   CDS_pept        complement(525456..526724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0471"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_1719 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55513"
FT                   /db_xref="GOA:B8ICC5"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC5"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55513.1"
FT   gene            526824..528098
FT                   /locus_tag="Mnod_0472"
FT   CDS_pept        526824..528098
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0472"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_1720 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55514"
FT                   /db_xref="GOA:B8ICC6"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="InterPro:IPR028098"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC6"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL55514.1"
FT   gene            528345..529397
FT                   /locus_tag="Mnod_0473"
FT   CDS_pept        528345..529397
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0473"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: rpe:RPE_4214 transposase IS116/IS110/IS902 family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55515"
FT                   /db_xref="GOA:B8I9H4"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9H4"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL55515.1"
FT                   PMGGAEPARA"
FT   gene            529834..530706
FT                   /locus_tag="Mnod_0474"
FT   CDS_pept        529834..530706
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0474"
FT                   /product="PDZ/DHR/GLGF domain protein"
FT                   /note="PFAM: PDZ/DHR/GLGF domain protein; KEGG:
FT                   met:M446_1717 PDZ/DHR/GLGF domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0474"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55516"
FT                   /db_xref="GOA:B8ICC8"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC8"
FT                   /inference="protein motif:PFAM:PF00595"
FT                   /protein_id="ACL55516.1"
FT                   VALTIGERP"
FT   gene            530703..531074
FT                   /locus_tag="Mnod_0475"
FT   CDS_pept        530703..531074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0475"
FT                   /product="transcriptional regulator, LuxR family"
FT                   /note="PFAM: regulatory protein LuxR; KEGG: met:M446_1716
FT                   LuxR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55517"
FT                   /db_xref="GOA:B8ICC9"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICC9"
FT                   /inference="protein motif:PFAM:PF00196"
FT                   /protein_id="ACL55517.1"
FT   gene            531185..532135
FT                   /locus_tag="Mnod_0476"
FT   CDS_pept        531185..532135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0476"
FT                   /product="peptidase S1 and S6 chymotrypsin/Hap"
FT                   /note="PFAM: peptidase S1 and S6 chymotrypsin/Hap;
FT                   PDZ/DHR/GLGF domain protein; KEGG: bra:BRADO2400 serine
FT                   protease DO-like precursor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55518"
FT                   /db_xref="GOA:B8ICD0"
FT                   /db_xref="InterPro:IPR001478"
FT                   /db_xref="InterPro:IPR001940"
FT                   /db_xref="InterPro:IPR009003"
FT                   /db_xref="InterPro:IPR036034"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD0"
FT                   /inference="protein motif:PFAM:PF00089"
FT                   /protein_id="ACL55518.1"
FT   gene            532201..533127
FT                   /locus_tag="Mnod_0477"
FT   CDS_pept        532201..533127
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0477"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: met:M446_1715 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55519"
FT                   /db_xref="GOA:B8ICD1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD1"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL55519.1"
FT   gene            533124..533885
FT                   /locus_tag="Mnod_0478"
FT   CDS_pept        533124..533885
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0478"
FT                   /product="ABC-2 type transporter"
FT                   /note="PFAM: ABC-2 type transporter; KEGG: met:M446_1714
FT                   ABC-2 type transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0478"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55520"
FT                   /db_xref="GOA:B8ICD2"
FT                   /db_xref="InterPro:IPR000412"
FT                   /db_xref="InterPro:IPR013525"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD2"
FT                   /inference="protein motif:PFAM:PF01061"
FT                   /protein_id="ACL55520.1"
FT   gene            534002..534799
FT                   /locus_tag="Mnod_0479"
FT   CDS_pept        534002..534799
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0479"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: met:M446_1711 GntR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55521"
FT                   /db_xref="GOA:B8ICD3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL55521.1"
FT   gene            535856..536548
FT                   /locus_tag="Mnod_0480"
FT   CDS_pept        535856..536548
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0480"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bid:Bind_2269 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55522"
FT                   /db_xref="InterPro:IPR025638"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD4"
FT                   /inference="similar to AA sequence:KEGG:Bind_2269"
FT                   /protein_id="ACL55522.1"
FT                   RAFRWLVA"
FT   gene            536733..537719
FT                   /locus_tag="Mnod_0481"
FT   CDS_pept        536733..537719
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0481"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: met:M446_1704 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55523"
FT                   /db_xref="GOA:B8ICD5"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD5"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL55523.1"
FT   sig_peptide     536733..536798
FT                   /locus_tag="Mnod_0481"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.885) with cleavage site probability 0.851 at
FT                   residue 22"
FT   gene            complement(537737..538459)
FT                   /locus_tag="Mnod_0482"
FT   CDS_pept        complement(537737..538459)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0482"
FT                   /product="metallophosphoesterase"
FT                   /note="PFAM: metallophosphoesterase; KEGG: met:M446_1703
FT                   metallophosphoesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55524"
FT                   /db_xref="GOA:B8ICD6"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR016538"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD6"
FT                   /inference="protein motif:PFAM:PF00149"
FT                   /protein_id="ACL55524.1"
FT                   VAIQIPKPNGRPYALLEL"
FT   gene            complement(538452..539270)
FT                   /locus_tag="Mnod_0483"
FT   CDS_pept        complement(538452..539270)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0483"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1702 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55525"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD7"
FT                   /inference="similar to AA sequence:KEGG:M446_1702"
FT                   /protein_id="ACL55525.1"
FT   gene            complement(539597..547603)
FT                   /locus_tag="Mnod_0484"
FT   CDS_pept        complement(539597..547603)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0484"
FT                   /product="glycerophosphoryl diester phosphodiesterase"
FT                   /note="PFAM: Hemolysin-type calcium-binding region;
FT                   glycerophosphoryl diester phosphodiesterase;
FT                   metallophosphoesterase; KEGG: atc:AGR_L_909 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55526"
FT                   /db_xref="GOA:B8ICD8"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR017946"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="InterPro:IPR030395"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD8"
FT                   /inference="protein motif:PFAM:PF03009"
FT                   /protein_id="ACL55526.1"
FT   gene            548032..548916
FT                   /locus_tag="Mnod_0485"
FT   CDS_pept        548032..548916
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0485"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: met:M446_1695 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55527"
FT                   /db_xref="GOA:B8ICD9"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICD9"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL55527.1"
FT                   GARSWRSEPPEMA"
FT   sig_peptide     548032..548109
FT                   /locus_tag="Mnod_0485"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.897) with cleavage site probability 0.371 at
FT                   residue 26"
FT   gene            complement(549204..550193)
FT                   /locus_tag="Mnod_0486"
FT   CDS_pept        complement(549204..550193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0486"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: met:M446_1694 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55528"
FT                   /db_xref="GOA:B8ICE0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE0"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL55528.1"
FT   gene            complement(550190..551212)
FT                   /locus_tag="Mnod_0487"
FT   CDS_pept        complement(550190..551212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0487"
FT                   /product="oligopeptide/dipeptide ABC transporter, ATPase
FT                   subunit"
FT                   /note="KEGG: met:M446_1693 oligopeptide/dipeptide ABC
FT                   transporter, ATPase subunit; TIGRFAM:
FT                   oligopeptide/dipeptide ABC transporter, ATPase subunit;
FT                   PFAM: ABC transporter related; Oligopeptide/dipeptide ABC
FT                   transporter domain protein; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55529"
FT                   /db_xref="GOA:B8ICE1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR013563"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE1"
FT                   /inference="protein motif:TFAM:TIGR01727"
FT                   /protein_id="ACL55529.1"
FT                   "
FT   gene            complement(551217..552128)
FT                   /locus_tag="Mnod_0488"
FT   CDS_pept        complement(551217..552128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0488"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1692
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55530"
FT                   /db_xref="GOA:B8ICE2"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR025966"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE2"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55530.1"
FT   gene            complement(552169..553179)
FT                   /locus_tag="Mnod_0489"
FT   CDS_pept        complement(552169..553179)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0489"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /EC_number=""
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1691 alkaline
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55531"
FT                   /db_xref="GOA:B8ICE3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE3"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55531.1"
FT   gene            complement(553225..554820)
FT                   /locus_tag="Mnod_0490"
FT   CDS_pept        complement(553225..554820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0490"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1690 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55532"
FT                   /db_xref="GOA:B8ICE4"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR023765"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE4"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55532.1"
FT                   PFSRHVFYGVDIKG"
FT   sig_peptide     complement(554752..554820)
FT                   /locus_tag="Mnod_0490"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.987 at
FT                   residue 23"
FT   gene            555014..557503
FT                   /locus_tag="Mnod_0491"
FT   CDS_pept        555014..557503
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0491"
FT                   /product="DNA ligase, NAD-dependent"
FT                   /EC_number=""
FT                   /note="KEGG: met:M446_1689 DNA ligase, NAD-dependent;
FT                   TIGRFAM: DNA ligase, NAD-dependent; PFAM: BRCT domain
FT                   protein; NAD-dependent DNA ligase OB-fold; NAD-dependent
FT                   DNA ligase adenylation; SMART: Helix-hairpin-helix
FT                   DNA-binding class 1; NAD-dependent DNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55533"
FT                   /db_xref="GOA:B8ICE5"
FT                   /db_xref="InterPro:IPR001357"
FT                   /db_xref="InterPro:IPR001679"
FT                   /db_xref="InterPro:IPR003583"
FT                   /db_xref="InterPro:IPR004149"
FT                   /db_xref="InterPro:IPR004150"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR013839"
FT                   /db_xref="InterPro:IPR013840"
FT                   /db_xref="InterPro:IPR018239"
FT                   /db_xref="InterPro:IPR033136"
FT                   /db_xref="InterPro:IPR036420"
FT                   /db_xref="InterPro:IPR041663"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICE5"
FT                   /inference="protein motif:TFAM:TIGR00575"
FT                   /protein_id="ACL55533.1"
FT                   GVRVISEAEWLAMVEAA"
FT   gene            557536..558105
FT                   /locus_tag="Mnod_0492"
FT   CDS_pept        557536..558105
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0492"
FT                   /product="Exonuclease RNase T and DNA polymerase III"
FT                   /note="PFAM: Exonuclease RNase T and DNA polymerase III;
FT                   SMART: Exonuclease; KEGG: met:M446_1688 exonuclease RNase T
FT                   and DNA polymerase III"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55534"
FT                   /db_xref="GOA:B8ICE6"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE6"
FT                   /inference="protein motif:PFAM:PF00929"
FT                   /protein_id="ACL55534.1"
FT   gene            558449..559831
FT                   /locus_tag="Mnod_0493"
FT   CDS_pept        558449..559831
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0493"
FT                   /product="UDP-N-acetylmuramoylalanine/D-glutamate ligase"
FT                   /note="TIGRFAM: UDP-N-acetylmuramoylalanine/D-glutamate
FT                   ligase; PFAM: cytoplasmic peptidoglycan synthetase domain
FT                   protein; Mur ligase middle domain protein; KEGG:
FT                   met:M446_1685 UDP-N-acetylmuramoylalanine--D-glutamate
FT                   ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55535"
FT                   /db_xref="GOA:B8ICE7"
FT                   /db_xref="InterPro:IPR004101"
FT                   /db_xref="InterPro:IPR005762"
FT                   /db_xref="InterPro:IPR013221"
FT                   /db_xref="InterPro:IPR018109"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="InterPro:IPR036565"
FT                   /db_xref="InterPro:IPR036615"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE7"
FT                   /inference="protein motif:TFAM:TIGR01087"
FT                   /protein_id="ACL55535.1"
FT                   GG"
FT   sig_peptide     558449..558541
FT                   /locus_tag="Mnod_0493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.761 at
FT                   residue 31"
FT   gene            559951..560730
FT                   /locus_tag="Mnod_0494"
FT   CDS_pept        559951..560730
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0494"
FT                   /product="Endonuclease/exonuclease/phosphatase"
FT                   /note="PFAM: Endonuclease/exonuclease/phosphatase; KEGG:
FT                   met:M446_1684 endonuclease/exonuclease/phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55536"
FT                   /db_xref="GOA:B8ICE8"
FT                   /db_xref="InterPro:IPR005135"
FT                   /db_xref="InterPro:IPR036691"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE8"
FT                   /inference="protein motif:PFAM:PF03372"
FT                   /protein_id="ACL55536.1"
FT   gene            complement(560663..562099)
FT                   /locus_tag="Mnod_0495"
FT   CDS_pept        complement(560663..562099)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0495"
FT                   /product="phospholipase D/Transphosphatidylase"
FT                   /note="PFAM: phospholipase D/Transphosphatidylase; KEGG:
FT                   met:M446_1683 phospholipase D/transphosphatidylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0495"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55537"
FT                   /db_xref="GOA:B8ICE9"
FT                   /db_xref="InterPro:IPR001736"
FT                   /db_xref="InterPro:IPR025202"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICE9"
FT                   /inference="protein motif:PFAM:PF00614"
FT                   /protein_id="ACL55537.1"
FT   gene            complement(562242..563528)
FT                   /locus_tag="Mnod_0496"
FT   CDS_pept        complement(562242..563528)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0496"
FT                   /product="putative glucose/sorbosone dehydrogenase"
FT                   /note="KEGG: met:M446_1682 putative glucose/sorbosone
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55538"
FT                   /db_xref="GOA:B8ICF0"
FT                   /db_xref="InterPro:IPR011041"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR012938"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF0"
FT                   /inference="similar to AA sequence:KEGG:M446_1682"
FT                   /protein_id="ACL55538.1"
FT   sig_peptide     complement(563451..563528)
FT                   /locus_tag="Mnod_0496"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.576 at
FT                   residue 26"
FT   gene            complement(563629..565074)
FT                   /locus_tag="Mnod_0497"
FT   CDS_pept        complement(563629..565074)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0497"
FT                   /product="Amidase"
FT                   /note="PFAM: Amidase; KEGG: met:M446_1681 amidase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0497"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55539"
FT                   /db_xref="GOA:B8ICF1"
FT                   /db_xref="InterPro:IPR000120"
FT                   /db_xref="InterPro:IPR020556"
FT                   /db_xref="InterPro:IPR023631"
FT                   /db_xref="InterPro:IPR036928"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF1"
FT                   /inference="protein motif:PFAM:PF01425"
FT                   /protein_id="ACL55539.1"
FT   gene            565252..565395
FT                   /locus_tag="Mnod_0498"
FT   CDS_pept        565252..565395
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0498"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1680 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55540"
FT                   /db_xref="GOA:B8ICF2"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF2"
FT                   /inference="similar to AA sequence:KEGG:M446_1680"
FT                   /protein_id="ACL55540.1"
FT                   MP"
FT   gene            565506..565664
FT                   /locus_tag="Mnod_0499"
FT   CDS_pept        565506..565664
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0499"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1679 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55541"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF3"
FT                   /inference="similar to AA sequence:KEGG:M446_1679"
FT                   /protein_id="ACL55541.1"
FT                   RERHRKD"
FT   gene            complement(565785..566216)
FT                   /locus_tag="Mnod_0500"
FT   CDS_pept        complement(565785..566216)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0500"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55542"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF4"
FT                   /inference="similar to AA sequence:KEGG:M446_1940"
FT                   /protein_id="ACL55542.1"
FT   gene            566399..567523
FT                   /locus_tag="Mnod_0501"
FT   CDS_pept        566399..567523
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0501"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="TIGRFAM: methylated-DNA/protein-cysteine
FT                   methyltransferase; PFAM: helix-turn-helix- domain
FT                   containing protein AraC type; Ada metal-binding domain
FT                   protein; Methylated-DNA-[protein]-cysteine
FT                   S-methyltransferase DNA binding; KEGG: met:M446_1042 AraC
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55543"
FT                   /db_xref="GOA:B8ICF5"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF5"
FT                   /inference="protein motif:TFAM:TIGR00589"
FT                   /protein_id="ACL55543.1"
FT   gene            567523..568227
FT                   /pseudo
FT                   /locus_tag="Mnod_0502"
FT   gene            complement(568306..568767)
FT                   /locus_tag="Mnod_0503"
FT   CDS_pept        complement(568306..568767)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1044 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55544"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF6"
FT                   /inference="similar to AA sequence:KEGG:M446_1044"
FT                   /protein_id="ACL55544.1"
FT   sig_peptide     complement(568702..568767)
FT                   /locus_tag="Mnod_0503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            complement(568944..569966)
FT                   /locus_tag="Mnod_0504"
FT   CDS_pept        complement(568944..569966)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0504"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpd:RPD_1710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0504"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55545"
FT                   /db_xref="InterPro:IPR022060"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF7"
FT                   /inference="similar to AA sequence:KEGG:RPD_1710"
FT                   /protein_id="ACL55545.1"
FT                   "
FT   sig_peptide     complement(569892..569966)
FT                   /locus_tag="Mnod_0504"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 25"
FT   gene            complement(570325..570462)
FT                   /locus_tag="Mnod_0505"
FT   CDS_pept        complement(570325..570462)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55546"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55546.1"
FT                   "
FT   gene            571031..573421
FT                   /locus_tag="Mnod_0506"
FT   CDS_pept        571031..573421
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0506"
FT                   /product="penicillin-binding protein, 1A family"
FT                   /EC_number=""
FT                   /note="TIGRFAM: penicillin-binding protein, 1A family;
FT                   PFAM: glycosyl transferase family 51; penicillin-binding
FT                   protein transpeptidase; KEGG: met:M446_1046 1A family
FT                   penicillin-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0506"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55547"
FT                   /db_xref="GOA:B8ICF9"
FT                   /db_xref="InterPro:IPR001264"
FT                   /db_xref="InterPro:IPR001460"
FT                   /db_xref="InterPro:IPR012338"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR036950"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICF9"
FT                   /inference="protein motif:TFAM:TIGR02074"
FT                   /protein_id="ACL55547.1"
FT   gene            complement(573459..574118)
FT                   /locus_tag="Mnod_0507"
FT   CDS_pept        complement(573459..574118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0507"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpb:RPB_4480 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0507"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55548"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG0"
FT                   /inference="similar to AA sequence:KEGG:RPB_4480"
FT                   /protein_id="ACL55548.1"
FT   gene            574427..575314
FT                   /locus_tag="Mnod_0508"
FT   CDS_pept        574427..575314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0508"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   met:M446_1047 beta-lactamase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0508"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55549"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG1"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL55549.1"
FT                   TPARAEDGSAYRRA"
FT   gene            complement(575716..576576)
FT                   /locus_tag="Mnod_0509"
FT   CDS_pept        complement(575716..576576)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0509"
FT                   /product="purine nucleotide phosphorylase"
FT                   /note="TIGRFAM: inosine guanosine and xanthosine
FT                   phosphorylase family; purine nucleotide phosphorylase;
FT                   PFAM: purine or other phosphorylase family 1; KEGG:
FT                   met:M446_1622 purine nucleotide phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0509"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55550"
FT                   /db_xref="GOA:B8ICG2"
FT                   /db_xref="InterPro:IPR000845"
FT                   /db_xref="InterPro:IPR011268"
FT                   /db_xref="InterPro:IPR011269"
FT                   /db_xref="InterPro:IPR035994"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG2"
FT                   /inference="protein motif:TFAM:TIGR01698"
FT                   /protein_id="ACL55550.1"
FT                   GPGEG"
FT   gene            complement(576573..577001)
FT                   /locus_tag="Mnod_0510"
FT   CDS_pept        complement(576573..577001)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0510"
FT                   /product="cytidine deaminase"
FT                   /note="TIGRFAM: cytidine deaminase; PFAM: CMP/dCMP
FT                   deaminase zinc-binding; KEGG: met:M446_1621 cytidine
FT                   deaminase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0510"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55551"
FT                   /db_xref="GOA:B8ICG3"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR006262"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG3"
FT                   /inference="protein motif:TFAM:TIGR01354"
FT                   /protein_id="ACL55551.1"
FT   gene            complement(577100..577954)
FT                   /locus_tag="Mnod_0511"
FT   CDS_pept        complement(577100..577954)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0511"
FT                   /product="prephenate dehydratase"
FT                   /EC_number=""
FT                   /note="PFAM: prephenate dehydratase; KEGG: met:M446_1620
FT                   prephenate dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55552"
FT                   /db_xref="GOA:B8ICG4"
FT                   /db_xref="InterPro:IPR001086"
FT                   /db_xref="InterPro:IPR002912"
FT                   /db_xref="InterPro:IPR008242"
FT                   /db_xref="InterPro:IPR018528"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG4"
FT                   /inference="protein motif:PFAM:PF00800"
FT                   /protein_id="ACL55552.1"
FT                   VAE"
FT   gene            complement(578082..578825)
FT                   /locus_tag="Mnod_0512"
FT   CDS_pept        complement(578082..578825)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0512"
FT                   /product="3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase"
FT                   /EC_number=""
FT                   /note="TIGRFAM: 3-deoxy-D-manno-octulosonate
FT                   cytidylyltransferase; PFAM: acylneuraminate
FT                   cytidylyltransferase; KEGG: met:M446_1619
FT                   3-deoxy-D-manno-octulosonate cytidylyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55553"
FT                   /db_xref="GOA:B8ICG5"
FT                   /db_xref="InterPro:IPR003329"
FT                   /db_xref="InterPro:IPR004528"
FT                   /db_xref="InterPro:IPR029044"
FT                   /db_xref="UniProtKB/Swiss-Prot:B8ICG5"
FT                   /inference="protein motif:TFAM:TIGR00466"
FT                   /protein_id="ACL55553.1"
FT   gene            579133..579675
FT                   /locus_tag="Mnod_0513"
FT   CDS_pept        579133..579675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0513"
FT                   /product="cytochrome c class I"
FT                   /note="PFAM: cytochrome c class I; KEGG: met:M446_1618
FT                   cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55554"
FT                   /db_xref="GOA:B8ICG6"
FT                   /db_xref="InterPro:IPR002327"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG6"
FT                   /inference="protein motif:PFAM:PF00034"
FT                   /protein_id="ACL55554.1"
FT                   LAYLKTLSDKPVDFPKP"
FT   sig_peptide     579133..579213
FT                   /locus_tag="Mnod_0513"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.692) with cleavage site probability 0.666 at
FT                   residue 27"
FT   gene            579903..581756
FT                   /locus_tag="Mnod_0514"
FT   CDS_pept        579903..581756
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0514"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1616 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55555"
FT                   /db_xref="GOA:B8ICG7"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG7"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55555.1"
FT   sig_peptide     579903..579968
FT                   /locus_tag="Mnod_0514"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 22"
FT   gene            581753..583633
FT                   /locus_tag="Mnod_0515"
FT   CDS_pept        581753..583633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0515"
FT                   /product="extracellular solute-binding protein family 5"
FT                   /note="PFAM: extracellular solute-binding protein family 5;
FT                   KEGG: met:M446_1615 extracellular solute-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55556"
FT                   /db_xref="GOA:B8ICG8"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG8"
FT                   /inference="protein motif:PFAM:PF00496"
FT                   /protein_id="ACL55556.1"
FT   sig_peptide     581753..581836
FT                   /locus_tag="Mnod_0515"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.903 at
FT                   residue 28"
FT   gene            583638..584741
FT                   /locus_tag="Mnod_0516"
FT   CDS_pept        583638..584741
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0516"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: met:M446_1614
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55557"
FT                   /db_xref="GOA:B8ICG9"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICG9"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL55557.1"
FT   gene            complement(584824..585378)
FT                   /locus_tag="Mnod_0517"
FT   CDS_pept        complement(584824..585378)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0517"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55558"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH0"
FT                   /inference="similar to AA sequence:KEGG:M446_2034"
FT                   /protein_id="ACL55558.1"
FT   sig_peptide     complement(585313..585378)
FT                   /locus_tag="Mnod_0517"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.992) with cleavage site probability 0.992 at
FT                   residue 22"
FT   gene            585637..587055
FT                   /locus_tag="Mnod_0518"
FT   CDS_pept        585637..587055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0518"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   met:M446_2035 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55559"
FT                   /db_xref="GOA:B8ICH1"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH1"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACL55559.1"
FT                   DPDNIMNPGKVLAV"
FT   gene            complement(587088..588479)
FT                   /locus_tag="Mnod_0519"
FT   CDS_pept        complement(587088..588479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0519"
FT                   /product="TRAP-type uncharacterized transport system
FT                   periplasmic component-like protein"
FT                   /note="KEGG: met:M446_2036 TRAP-type uncharacterized
FT                   transport system periplasmic component-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55560"
FT                   /db_xref="GOA:B8ICH2"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH2"
FT                   /inference="similar to AA sequence:KEGG:M446_2036"
FT                   /protein_id="ACL55560.1"
FT                   HAPGA"
FT   sig_peptide     complement(588399..588479)
FT                   /locus_tag="Mnod_0519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.284 at
FT                   residue 27"
FT   gene            588495..589115
FT                   /locus_tag="Mnod_0520"
FT   CDS_pept        588495..589115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0520"
FT                   /product="regulatory protein RecX"
FT                   /note="PFAM: regulatory protein RecX; KEGG: met:M446_2037
FT                   regulatory protein RecX"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55561"
FT                   /db_xref="GOA:B8ICH3"
FT                   /db_xref="InterPro:IPR003783"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH3"
FT                   /inference="protein motif:PFAM:PF02631"
FT                   /protein_id="ACL55561.1"
FT   gene            complement(589181..589444)
FT                   /locus_tag="Mnod_0521"
FT   CDS_pept        complement(589181..589444)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0521"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2038 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55562"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH4"
FT                   /inference="similar to AA sequence:KEGG:M446_2038"
FT                   /protein_id="ACL55562.1"
FT   gene            complement(589592..589876)
FT                   /locus_tag="Mnod_0522"
FT   CDS_pept        complement(589592..589876)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0522"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2040 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55563"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH5"
FT                   /inference="similar to AA sequence:KEGG:M446_2040"
FT                   /protein_id="ACL55563.1"
FT   gene            complement(590209..590736)
FT                   /locus_tag="Mnod_0523"
FT   CDS_pept        complement(590209..590736)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0523"
FT                   /product="protein of unknown function DUF421"
FT                   /note="PFAM: protein of unknown function DUF421; KEGG:
FT                   mex:Mext_1108 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55564"
FT                   /db_xref="GOA:B8ICH6"
FT                   /db_xref="InterPro:IPR007353"
FT                   /db_xref="InterPro:IPR023090"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH6"
FT                   /inference="protein motif:PFAM:PF04239"
FT                   /protein_id="ACL55564.1"
FT                   TGRDGDKRREVA"
FT   gene            complement(591063..591482)
FT                   /locus_tag="Mnod_0524"
FT   CDS_pept        complement(591063..591482)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0524"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0524"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55565"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH7"
FT                   /inference="similar to AA sequence:KEGG:M446_1067"
FT                   /protein_id="ACL55565.1"
FT   gene            591811..591945
FT                   /locus_tag="Mnod_0525"
FT   CDS_pept        591811..591945
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0525"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0525"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55566"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55566.1"
FT   gene            complement(591959..592090)
FT                   /locus_tag="Mnod_0526"
FT   CDS_pept        complement(591959..592090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0526"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6412 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55567"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICH9"
FT                   /inference="similar to AA sequence:KEGG:M446_6412"
FT                   /protein_id="ACL55567.1"
FT   sig_peptide     complement(592013..592090)
FT                   /locus_tag="Mnod_0526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.747 at
FT                   residue 26"
FT   gene            592994..594106
FT                   /locus_tag="Mnod_0527"
FT   CDS_pept        592994..594106
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0527"
FT                   /product="Sel1 domain protein repeat-containing protein"
FT                   /note="PFAM: Sel1 domain protein repeat-containing protein;
FT                   KEGG: met:M446_3557 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55568"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI0"
FT                   /inference="protein motif:PFAM:PF08238"
FT                   /protein_id="ACL55568.1"
FT   sig_peptide     592994..593086
FT                   /locus_tag="Mnod_0527"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.750) with cleavage site probability 0.461 at
FT                   residue 31"
FT   gene            594136..595299
FT                   /locus_tag="Mnod_0528"
FT   CDS_pept        594136..595299
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0528"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3556 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55569"
FT                   /db_xref="InterPro:IPR011852"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI1"
FT                   /inference="similar to AA sequence:KEGG:M446_3556"
FT                   /protein_id="ACL55569.1"
FT   sig_peptide     594136..594225
FT                   /locus_tag="Mnod_0528"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.937 at
FT                   residue 30"
FT   gene            complement(595426..595656)
FT                   /pseudo
FT                   /locus_tag="Mnod_0529"
FT   gene            complement(595715..596212)
FT                   /locus_tag="Mnod_0530"
FT   CDS_pept        complement(595715..596212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0530"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0955 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55570"
FT                   /db_xref="GOA:B8ICI2"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI2"
FT                   /inference="similar to AA sequence:KEGG:M446_0955"
FT                   /protein_id="ACL55570.1"
FT                   GL"
FT   gene            complement(596261..597574)
FT                   /locus_tag="Mnod_0531"
FT   CDS_pept        complement(596261..597574)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0531"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mrd:Mrad2831_2892 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55571"
FT                   /db_xref="InterPro:IPR006059"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI3"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL55571.1"
FT   sig_peptide     complement(597473..597574)
FT                   /locus_tag="Mnod_0531"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.747) with cleavage site probability 0.303 at
FT                   residue 34"
FT   gene            complement(597763..600867)
FT                   /locus_tag="Mnod_0532"
FT   CDS_pept        complement(597763..600867)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0532"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   bja:blr0277 AcrB/AcrD/AcrF family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55572"
FT                   /db_xref="GOA:B8ICI4"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI4"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACL55572.1"
FT   sig_peptide     complement(600760..600867)
FT                   /locus_tag="Mnod_0532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.954) with cleavage site probability 0.339 at
FT                   residue 36"
FT   gene            complement(600864..602009)
FT                   /locus_tag="Mnod_0533"
FT   CDS_pept        complement(600864..602009)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0533"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bja:blr0276 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55573"
FT                   /db_xref="GOA:B8ICI5"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR039562"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI5"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACL55573.1"
FT   gene            602629..603297
FT                   /locus_tag="Mnod_0534"
FT   CDS_pept        602629..603297
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0534"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55574"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55574.1"
FT                   "
FT   gene            complement(603301..603588)
FT                   /pseudo
FT                   /locus_tag="Mnod_0535"
FT   gene            604133..605008
FT                   /locus_tag="Mnod_0536"
FT   CDS_pept        604133..605008
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0536"
FT                   /product="aldo/keto reductase"
FT                   /note="PFAM: aldo/keto reductase; KEGG: mex:Mext_4689
FT                   aldo/keto reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55575"
FT                   /db_xref="InterPro:IPR023210"
FT                   /db_xref="InterPro:IPR036812"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICI7"
FT                   /inference="protein motif:PFAM:PF00248"
FT                   /protein_id="ACL55575.1"
FT                   EGRAAWQAAR"
FT   gene            605211..605384
FT                   /pseudo
FT                   /locus_tag="Mnod_0537"
FT   gene            605472..605627
FT                   /locus_tag="Mnod_0538"
FT   CDS_pept        605472..605627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0538"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55576"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55576.1"
FT                   TDKAKS"
FT   gene            complement(605633..606073)
FT                   /locus_tag="Mnod_0539"
FT   CDS_pept        complement(605633..606073)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0539"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55577"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55577.1"
FT   gene            complement(606241..606471)
FT                   /locus_tag="Mnod_0540"
FT   CDS_pept        complement(606241..606471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55578"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55578.1"
FT   gene            608755..608904
FT                   /locus_tag="Mnod_0541"
FT   CDS_pept        608755..608904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0541"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0541"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55579"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55579.1"
FT                   EWIP"
FT   gene            complement(609625..611337)
FT                   /locus_tag="Mnod_0542"
FT   CDS_pept        complement(609625..611337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0542"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   rpt:Rpal_3326 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55580"
FT                   /db_xref="GOA:B8IDK8"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR015517"
FT                   /db_xref="InterPro:IPR016192"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK8"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACL55580.1"
FT   sig_peptide     complement(611275..611337)
FT                   /locus_tag="Mnod_0542"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.605) with cleavage site probability 0.603 at
FT                   residue 21"
FT   gene            611750..611902
FT                   /locus_tag="Mnod_0543"
FT   CDS_pept        611750..611902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0543"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_2886 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55581"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDK9"
FT                   /inference="similar to AA sequence:KEGG:M446_2886"
FT                   /protein_id="ACL55581.1"
FT                   LARAA"
FT   gene            611993..612391
FT                   /locus_tag="Mnod_0544"
FT   CDS_pept        611993..612391
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0544"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mlr0242 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0544"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55582"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL0"
FT                   /inference="similar to AA sequence:KEGG:mlr0242"
FT                   /protein_id="ACL55582.1"
FT   gene            complement(613011..613421)
FT                   /locus_tag="Mnod_0545"
FT   CDS_pept        complement(613011..613421)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0545"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: met:M446_6972 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55583"
FT                   /db_xref="GOA:B8IDL1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL1"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL55583.1"
FT   gene            613427..613627
FT                   /locus_tag="Mnod_0546"
FT   CDS_pept        613427..613627
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0546"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0546"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55584"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55584.1"
FT   gene            613566..614345
FT                   /locus_tag="Mnod_0547"
FT   CDS_pept        613566..614345
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0547"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0547"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55585"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55585.1"
FT   gene            complement(614934..615140)
FT                   /locus_tag="Mnod_0548"
FT   CDS_pept        complement(614934..615140)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0548"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55586"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL4"
FT                   /inference="similar to AA sequence:KEGG:M446_6420"
FT                   /protein_id="ACL55586.1"
FT   gene            615499..615942
FT                   /locus_tag="Mnod_0549"
FT   CDS_pept        615499..615942
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0549"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_6603 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55587"
FT                   /db_xref="GOA:B8IDL5"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL5"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL55587.1"
FT   gene            616089..616337
FT                   /locus_tag="Mnod_0550"
FT   CDS_pept        616089..616337
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55588"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL6"
FT                   /inference="similar to AA sequence:KEGG:M446_1863"
FT                   /protein_id="ACL55588.1"
FT   gene            616337..616603
FT                   /locus_tag="Mnod_0551"
FT   CDS_pept        616337..616603
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0551"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6746 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0551"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55589"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55589.1"
FT   gene            complement(616600..616833)
FT                   /locus_tag="Mnod_0552"
FT   CDS_pept        complement(616600..616833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0552"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_3603 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55590"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL8"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_3603"
FT                   /protein_id="ACL55590.1"
FT   sig_peptide     complement(616765..616833)
FT                   /locus_tag="Mnod_0552"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            617017..617244
FT                   /locus_tag="Mnod_0553"
FT   CDS_pept        617017..617244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0553"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_7034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55591"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55591.1"
FT   gene            617701..617904
FT                   /locus_tag="Mnod_0554"
FT   CDS_pept        617701..617904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0554"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0554"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55592"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55592.1"
FT   gene            complement(617963..618247)
FT                   /locus_tag="Mnod_0555"
FT   CDS_pept        complement(617963..618247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0555"
FT                   /product="DNA-directed DNA polymerase"
FT                   /note="KEGG: mrd:Mrad2831_6255 DNA-directed DNA polymerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55593"
FT                   /db_xref="GOA:B8IDM1"
FT                   /db_xref="InterPro:IPR025188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM1"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6255"
FT                   /protein_id="ACL55593.1"
FT   gene            complement(618410..620704)
FT                   /locus_tag="Mnod_0556"
FT   CDS_pept        complement(618410..620704)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0556"
FT                   /product="proprotein convertase P"
FT                   /note="KEGG: bid:Bind_3695 proprotein convertase P"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55594"
FT                   /db_xref="GOA:B8IDM2"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM2"
FT                   /inference="similar to AA sequence:KEGG:Bind_3695"
FT                   /protein_id="ACL55594.1"
FT                   AVINSSDYTFV"
FT   gene            complement(620838..622118)
FT                   /locus_tag="Mnod_0557"
FT   CDS_pept        complement(620838..622118)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0557"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: met:M446_5531
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55595"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM3"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACL55595.1"
FT   gene            complement(622131..622415)
FT                   /pseudo
FT                   /locus_tag="Mnod_0558"
FT   gene            complement(622354..622869)
FT                   /locus_tag="Mnod_0559"
FT   CDS_pept        complement(622354..622869)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0559"
FT                   /product="peptidase S24 and S26 domain protein"
FT                   /note="PFAM: peptidase S24 and S26 domain protein; KEGG:
FT                   mpo:Mpop_0340 peptidase S24 and S26 domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55596"
FT                   /db_xref="GOA:B8IDM4"
FT                   /db_xref="InterPro:IPR015927"
FT                   /db_xref="InterPro:IPR036286"
FT                   /db_xref="InterPro:IPR039418"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM4"
FT                   /inference="protein motif:PFAM:PF00717"
FT                   /protein_id="ACL55596.1"
FT                   LLLLREGV"
FT   repeat_region   complement(623501..623960)
FT                   /rpt_unit_range=623502..623538
FT                   /note="CRISPRs"
FT   gene            complement(624239..626215)
FT                   /locus_tag="Mnod_0560"
FT   CDS_pept        complement(624239..626215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0560"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sec:SC3393 putative ABC transporter
FT                   ATP-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55597"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55597.1"
FT   gene            complement(626253..627647)
FT                   /locus_tag="Mnod_0561"
FT   CDS_pept        complement(626253..627647)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0561"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55598"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55598.1"
FT                   CIDTPL"
FT   gene            complement(627980..628339)
FT                   /locus_tag="Mnod_0562"
FT   CDS_pept        complement(627980..628339)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0562"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55599"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55599.1"
FT                   GDAEPDGDEHDDGSS"
FT   gene            complement(628949..629218)
FT                   /locus_tag="Mnod_0563"
FT   CDS_pept        complement(628949..629218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0563"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55600"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55600.1"
FT   gene            complement(629215..629622)
FT                   /locus_tag="Mnod_0564"
FT   CDS_pept        complement(629215..629622)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0564"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55601"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDM9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55601.1"
FT   gene            complement(629794..629988)
FT                   /locus_tag="Mnod_0565"
FT   CDS_pept        complement(629794..629988)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0565"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_5980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0565"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55602"
FT                   /db_xref="GOA:B8IDN0"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN0"
FT                   /inference="similar to AA sequence:KEGG:M446_5980"
FT                   /protein_id="ACL55602.1"
FT   sig_peptide     complement(629917..629988)
FT                   /locus_tag="Mnod_0565"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.964 at
FT                   residue 24"
FT   gene            complement(630039..630797)
FT                   /locus_tag="Mnod_0566"
FT   CDS_pept        complement(630039..630797)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0566"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4117 putative transmembrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0566"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55603"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="InterPro:IPR034691"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55603.1"
FT   gene            complement(630962..631186)
FT                   /locus_tag="Mnod_0567"
FT   CDS_pept        complement(630962..631186)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0567"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4118 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0567"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55604"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55604.1"
FT   gene            complement(631281..633635)
FT                   /locus_tag="Mnod_0568"
FT   CDS_pept        complement(631281..633635)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0568"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: predicted protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55605"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55605.1"
FT   sig_peptide     complement(633564..633635)
FT                   /locus_tag="Mnod_0568"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.536 at
FT                   residue 24"
FT   gene            complement(633645..634376)
FT                   /locus_tag="Mnod_0569"
FT   CDS_pept        complement(633645..634376)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0569"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4123 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55606"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55606.1"
FT   gene            complement(634406..635434)
FT                   /locus_tag="Mnod_0570"
FT   CDS_pept        complement(634406..635434)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0570"
FT                   /product="late control D family protein"
FT                   /note="PFAM: late control D family protein; KEGG:
FT                   met:M446_4124 late control D family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55607"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN5"
FT                   /inference="protein motif:PFAM:PF05954"
FT                   /protein_id="ACL55607.1"
FT                   AE"
FT   gene            complement(635447..635674)
FT                   /locus_tag="Mnod_0571"
FT   CDS_pept        complement(635447..635674)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0571"
FT                   /product="tail X family protein"
FT                   /note="PFAM: tail X family protein; KEGG: met:M446_4125
FT                   tail X family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0571"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55608"
FT                   /db_xref="InterPro:IPR008861"
FT                   /db_xref="InterPro:IPR036779"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN6"
FT                   /inference="protein motif:PFAM:PF05489"
FT                   /protein_id="ACL55608.1"
FT   gene            complement(635679..636116)
FT                   /locus_tag="Mnod_0572"
FT   CDS_pept        complement(635679..636116)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0572"
FT                   /product="P2 GpU family protein"
FT                   /note="KEGG: met:M446_4126 P2 GpU family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55609"
FT                   /db_xref="InterPro:IPR009734"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN7"
FT                   /inference="similar to AA sequence:KEGG:M446_4126"
FT                   /protein_id="ACL55609.1"
FT   gene            complement(636135..640766)
FT                   /locus_tag="Mnod_0573"
FT   CDS_pept        complement(636135..640766)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0573"
FT                   /product="TP901 family phage tail tape measure protein"
FT                   /note="KEGG: met:M446_4127 TP901 family phage tail tape
FT                   measure protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55610"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN8"
FT                   /inference="similar to AA sequence:KEGG:M446_4127"
FT                   /protein_id="ACL55610.1"
FT   gene            640878..641309
FT                   /locus_tag="Mnod_0574"
FT   CDS_pept        640878..641309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0574"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_5180 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55611"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDN9"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5180"
FT                   /protein_id="ACL55611.1"
FT   gene            complement(641317..642204)
FT                   /locus_tag="Mnod_0575"
FT   CDS_pept        complement(641317..642204)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0575"
FT                   /product="prophage antirepressor"
FT                   /note="PFAM: BRO domain protein; KEGG: ecv:APECO1_4056
FT                   putative anti-repressor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0575"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55612"
FT                   /db_xref="InterPro:IPR003497"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP0"
FT                   /inference="protein motif:PFAM:PF02498"
FT                   /protein_id="ACL55612.1"
FT                   VRAVLIPKLQVQLG"
FT   gene            complement(642375..642725)
FT                   /locus_tag="Mnod_0576"
FT   CDS_pept        complement(642375..642725)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0576"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_1869 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55613"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55613.1"
FT                   GDEFDDDGLDER"
FT   gene            complement(643257..643793)
FT                   /locus_tag="Mnod_0577"
FT   CDS_pept        complement(643257..643793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0577"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4128 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0577"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55614"
FT                   /db_xref="InterPro:IPR019289"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP2"
FT                   /inference="similar to AA sequence:KEGG:M446_4128"
FT                   /protein_id="ACL55614.1"
FT                   SVSTPASGETTAPTS"
FT   gene            complement(643852..644379)
FT                   /locus_tag="Mnod_0578"
FT   CDS_pept        complement(643852..644379)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0578"
FT                   /product="major tail tube protein"
FT                   /note="PFAM: major tail tube protein; KEGG: met:M446_4129
FT                   major tail tube protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0578"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55615"
FT                   /db_xref="InterPro:IPR006498"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP3"
FT                   /inference="protein motif:PFAM:PF04985"
FT                   /protein_id="ACL55615.1"
FT                   DVFAEYRATLGA"
FT   gene            complement(644462..645748)
FT                   /locus_tag="Mnod_0579"
FT   CDS_pept        complement(644462..645748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4130 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0579"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55616"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP4"
FT                   /inference="similar to AA sequence:KEGG:M446_4130"
FT                   /protein_id="ACL55616.1"
FT   gene            complement(645824..646333)
FT                   /locus_tag="Mnod_0580"
FT   CDS_pept        complement(645824..646333)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0580"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4131 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55617"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP5"
FT                   /inference="similar to AA sequence:KEGG:M446_4131"
FT                   /protein_id="ACL55617.1"
FT                   IIWPTF"
FT   gene            complement(646364..647128)
FT                   /locus_tag="Mnod_0581"
FT   CDS_pept        complement(646364..647128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0581"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4132 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0581"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55618"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP6"
FT                   /inference="similar to AA sequence:KEGG:M446_4132"
FT                   /protein_id="ACL55618.1"
FT   gene            complement(647141..647710)
FT                   /locus_tag="Mnod_0582"
FT   CDS_pept        complement(647141..647710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0582"
FT                   /product="pyocin R2_PP, tail fiber protein, putative"
FT                   /note="KEGG: met:M446_4133 pyocin R2_PP, tail fiber
FT                   protein, putative"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0582"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55619"
FT                   /db_xref="InterPro:IPR022225"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP7"
FT                   /inference="similar to AA sequence:KEGG:M446_4133"
FT                   /protein_id="ACL55619.1"
FT   gene            complement(647703..648389)
FT                   /locus_tag="Mnod_0583"
FT   CDS_pept        complement(647703..648389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0583"
FT                   /product="phage tail protein I"
FT                   /note="TIGRFAM: phage tail protein I; PFAM: tail protein I;
FT                   KEGG: met:M446_4134 phage tail protein I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0583"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55620"
FT                   /db_xref="InterPro:IPR006521"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP8"
FT                   /inference="protein motif:TFAM:TIGR01634"
FT                   /protein_id="ACL55620.1"
FT                   VSPPDV"
FT   gene            complement(648382..648564)
FT                   /locus_tag="Mnod_0584"
FT   CDS_pept        complement(648382..648564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0584"
FT                   /product="baseplate J family protein"
FT                   /note="KEGG: met:M446_4135 baseplate J family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0584"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55621"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDP9"
FT                   /inference="similar to AA sequence:KEGG:M446_4135"
FT                   /protein_id="ACL55621.1"
FT                   PYCTEIVVTVEVGDG"
FT   gene            complement(648611..649132)
FT                   /locus_tag="Mnod_0585"
FT   CDS_pept        complement(648611..649132)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0585"
FT                   /product="putative transposase of insertion sequence"
FT                   /note="KEGG: mrd:Mrad2831_5181 putative transposase of
FT                   insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0585"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55622"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAL5"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5181"
FT                   /protein_id="ACL55622.1"
FT                   GYEDDAYAST"
FT   gene            complement(649189..649572)
FT                   /locus_tag="Mnod_0586"
FT   CDS_pept        complement(649189..649572)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0586"
FT                   /product="transposase"
FT                   /note="KEGG: mrd:Mrad2831_5182 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0586"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55623"
FT                   /db_xref="GOA:B8IC28"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC28"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5182"
FT                   /protein_id="ACL55623.1"
FT   gene            complement(649655..650446)
FT                   /locus_tag="Mnod_0587"
FT   CDS_pept        complement(649655..650446)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0587"
FT                   /product="Baseplate J family protein"
FT                   /note="PFAM: Baseplate J family protein; KEGG:
FT                   met:M446_4135 baseplate J family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0587"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55624"
FT                   /db_xref="InterPro:IPR006949"
FT                   /db_xref="InterPro:IPR014507"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ2"
FT                   /inference="protein motif:PFAM:PF04865"
FT                   /protein_id="ACL55624.1"
FT   gene            complement(650477..650899)
FT                   /locus_tag="Mnod_0588"
FT   CDS_pept        complement(650477..650899)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0588"
FT                   /product="GPW/gp25 family protein"
FT                   /note="PFAM: GPW/gp25 family protein; KEGG: met:M446_4136
FT                   gpW/GP25 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0588"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55625"
FT                   /db_xref="InterPro:IPR007048"
FT                   /db_xref="InterPro:IPR040471"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ3"
FT                   /inference="protein motif:PFAM:PF04965"
FT                   /protein_id="ACL55625.1"
FT   gene            complement(650903..651268)
FT                   /locus_tag="Mnod_0589"
FT   CDS_pept        complement(650903..651268)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0589"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4137 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0589"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55626"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL55626.1"
FT                   EREVTLASTAIPAEPDA"
FT   gene            complement(651285..651854)
FT                   /locus_tag="Mnod_0590"
FT   CDS_pept        complement(651285..651854)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0590"
FT                   /product="phage baseplate assembly protein V"
FT                   /note="TIGRFAM: phage baseplate assembly protein V; KEGG:
FT                   met:M446_4138 phage baseplate assembly protein V"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0590"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55627"
FT                   /db_xref="InterPro:IPR006531"
FT                   /db_xref="InterPro:IPR013046"
FT                   /db_xref="InterPro:IPR037026"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ5"
FT                   /inference="protein motif:TFAM:TIGR01644"
FT                   /protein_id="ACL55627.1"
FT   gene            complement(651851..652627)
FT                   /locus_tag="Mnod_0591"
FT   CDS_pept        complement(651851..652627)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_4139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0591"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55628"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ6"
FT                   /inference="similar to AA sequence:KEGG:M446_4139"
FT                   /protein_id="ACL55628.1"
FT   gene            complement(652627..653037)
FT                   /locus_tag="Mnod_0592"
FT   CDS_pept        complement(652627..653037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0592"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: oan:Oant_1502 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0592"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55629"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ7"
FT                   /inference="similar to AA sequence:KEGG:Oant_1502"
FT                   /protein_id="ACL55629.1"
FT   gene            complement(653424..654461)
FT                   /locus_tag="Mnod_0593"
FT   CDS_pept        complement(653424..654461)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0593"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mgm:Mmc1_1263 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0593"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55630"
FT                   /db_xref="InterPro:IPR005564"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ8"
FT                   /inference="similar to AA sequence:KEGG:Mmc1_1263"
FT                   /protein_id="ACL55630.1"
FT                   KGTSN"
FT   gene            complement(654468..654857)
FT                   /locus_tag="Mnod_0594"
FT   CDS_pept        complement(654468..654857)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0594"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mms:mma_2770 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0594"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55631"
FT                   /db_xref="InterPro:IPR004195"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDQ9"
FT                   /inference="similar to AA sequence:KEGG:mma_2770"
FT                   /protein_id="ACL55631.1"
FT   gene            complement(654887..656149)
FT                   /locus_tag="Mnod_0595"
FT   CDS_pept        complement(654887..656149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0595"
FT                   /product="peptidase S49"
FT                   /note="PFAM: peptidase S49; KEGG: rsq:Rsph17025_0104
FT                   peptidase S49"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0595"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55632"
FT                   /db_xref="GOA:B8IDR0"
FT                   /db_xref="InterPro:IPR002142"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="InterPro:IPR033855"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR0"
FT                   /inference="protein motif:PFAM:PF01343"
FT                   /protein_id="ACL55632.1"
FT   gene            complement(656179..657777)
FT                   /locus_tag="Mnod_0596"
FT   CDS_pept        complement(656179..657777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0596"
FT                   /product="phage portal protein, lambda family"
FT                   /note="TIGRFAM: phage portal protein, lambda family; PFAM:
FT                   portal protein lambda; KEGG: smd:Smed_1658 phage portal
FT                   protein, lambda family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0596"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55633"
FT                   /db_xref="GOA:B8IDR1"
FT                   /db_xref="InterPro:IPR006429"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR1"
FT                   /inference="protein motif:TFAM:TIGR01539"
FT                   /protein_id="ACL55633.1"
FT                   GEGDQRPRKTADARD"
FT   gene            complement(657777..658004)
FT                   /locus_tag="Mnod_0597"
FT   CDS_pept        complement(657777..658004)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_0597"
FT                   /product="Head-to-tail joining protein W gpW family
FT                   protein"
FT                   /note="PFAM: Head-to-tail joining protein W gpW family
FT                   protein; KEGG: ecd:ECDH10B_1348 head-to-tail joining
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_0597"
FT                   /db_xref="EnsemblGenomes-Tr:ACL55634"
FT                   /db_xref="GOA:B8IDR2"
FT                   /db_xref="InterPro:IPR004174"
FT                   /db_xref="InterPro:IPR036626"
FT                   /db_xref="UniProtKB/TrEMBL:B8IDR2"
FT                   /inference="protein motif:PFAM:PF02831"
FT                   /protein_id="ACL55634.1"
FT   gene            complement(658009..660171)
FT                   /locus_tag="Mnod_0598"