(data stored in ACNUC7421 zone)

EMBL: CP001350

ID   CP001350; SV 1; circular; genomic DNA; STD; PRO; 487734 BP.
XX
AC   CP001350; ABIP01000000-ABIP01000162;
XX
PR   Project:PRJNA20477;
XX
DT   13-JAN-2009 (Rel. 99, Created)
DT   12-DEC-2013 (Rel. 119, Last updated, Version 2)
XX
DE   Methylobacterium nodulans ORS 2060 plasmid pMNOD01, complete sequence.
XX
KW   .
XX
OS   Methylobacterium nodulans ORS 2060
OC   Bacteria; Proteobacteria; Alphaproteobacteria; Rhizobiales;
OC   Methylobacteriaceae; Methylobacterium.
OG   Plasmid pMNOD01
XX
RN   [1]
RP   1-487734
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Marx C.J.,
RA   Richardson P.;
RT   "Complete sequence of plasmid1 of Methylobacterium nodulans ORS 2060";
RL   Unpublished.
XX
RN   [2]
RP   1-487734
RG   US DOE Joint Genome Institute
RA   Lucas S., Copeland A., Lapidus A., Glavina del Rio T., Dalin E., Tice H.,
RA   Bruce D., Goodwin L., Pitluck S., Sims D., Brettin T., Detter J.C., Han C.,
RA   Larimer F., Land M., Hauser L., Kyrpides N., Ivanova N., Marx C.J.,
RA   Richardson P.;
RT   ;
RL   Submitted (06-JAN-2009) to the INSDC.
RL   US DOE Joint Genome Institute, 2800 Mitchell Drive B100, Walnut Creek, CA
RL   94598-1698, USA
XX
DR   MD5; fdc6bb1a0d9c1fdd6794ffb4788578c7.
DR   BioSample; SAMN00000043.
DR   EnsemblGenomes-Gn; EBG00001172940.
DR   EnsemblGenomes-Gn; EBG00001172941.
DR   EnsemblGenomes-Gn; Mnod_R0095.
DR   EnsemblGenomes-Gn; Mnod_R0096.
DR   EnsemblGenomes-Tr; EBT00001739898.
DR   EnsemblGenomes-Tr; EBT00001739899.
DR   EnsemblGenomes-Tr; Mnod_R0095-1.
DR   EnsemblGenomes-Tr; Mnod_R0096-1.
DR   RFAM; RF00005; tRNA.
DR   RFAM; RF00029; Intron_gpII.
DR   RFAM; RF00519; suhB.
DR   StrainInfo; 72740; 1.
XX
CC   URL -- http://www.jgi.doe.gov
CC   JGI Project ID: 4003783
CC   Source DNA and bacteria available from Christopher J. Marx
CC   (cmarx@oeb.harvard.edu)
CC   Contacts: Christopher J. Marx (cmarx@oeb.harvard.edu)
CC             David Bruce (microbe@cuba.jgi-psf.org)
CC   Annotation done by JGI-ORNL and JGI-PGF
CC   Finishing done by JGI-LANL
CC   Finished microbial genomes have been curated to close all gaps with
CC   greater than 98% coverage of at least two independent clones. Each
CC   base pair has a minimum q (quality) value of 30 and the total error
CC   rate is less than one per 50000.
CC   The JGI and collaborators endorse the principles for the
CC   distribution and use of large scale sequencing data adopted by the
CC   larger genome sequencing community and urge users of this data to
CC   follow them. it is our intention to publish the work of this
CC   project in a timely fashion and we welcome collaborative
CC   interaction on the project and analysis.
CC   (http://www.genome.gov/page.cfm?pageID=10506376).
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..487734
FT                   /organism="Methylobacterium nodulans ORS 2060"
FT                   /plasmid="pMNOD01"
FT                   /strain="ORS 2060"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:460265"
FT   gene            211..657
FT                   /locus_tag="Mnod_8254"
FT   CDS_pept        211..657
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8254"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8254"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62409"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62409.1"
FT                   /translation="MSWEASAANSTYTKQQVLDVGDVPGHQLRIYELHRTFPSDKPNCE
FT                   GLKRVEQWSRGLTDYTDGNGSLSGYTVTILENGDKIFGKVSGTSQTTTNSDGSKTSTFT
FT                   GVVTYTGGTGKYQRVRGIQRDIIAFDLEKNFNQQRAEAEYWFEK"
FT   gene            complement(1228..2676)
FT                   /locus_tag="Mnod_8255"
FT   CDS_pept        complement(1228..2676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8255"
FT                   /product="sulfatase"
FT                   /note="PFAM: sulfatase; KEGG: bid:Bind_0555 sulfatase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8255"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62410"
FT                   /db_xref="GOA:B8IVH0"
FT                   /db_xref="InterPro:IPR000917"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="InterPro:IPR024607"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH0"
FT                   /inference="protein motif:PFAM:PF00884"
FT                   /protein_id="ACL62410.1"
FT                   /translation="MMERRGVTRRHVLGSAAAGAAASALTGPSEAWAAGPPNIVFIMAD
FT                   DLGYADVGCYGRPDLKTPHIDRIAARGVRFTQGYANSAVCSATRTALITGRYQYRLPVG
FT                   LEEPVTTRFTGGLPAEHPTLPGLLRRAGYRTALVGKWHLGSVAKFGPLQRGYDTFWGFR
FT                   GGTIDYFSHRGTDDKPDLWDGDVRVEEVGYATHLIGRRAVETIGTAVRAGRPFFLSLHF
FT                   NAPHWPWETPEDEAESRRIAGSNLRHFDGGTQATYHRIVAEMDAQIGRVLDALEQHGIA
FT                   QDTIVVFTSDNGGERFSDTWPFTGRKTELLEGGLRIPAIVSWPRRLPAGVVSAQPMITM
FT                   DWLPTLLAAAGASPDPVYPPDGIDLLPILTGEAAERPRSFYWRYRANAQAALREGDLKY
FT                   LKIRDNTFLFDVVADPLERANLKARRPEDFARMEASWRAWNATMLPEKPDSFTESYTGA
FT                   QLADHFGVQGPAPLRPVTAGEAHR"
FT   sig_peptide     complement(2575..2676)
FT                   /locus_tag="Mnod_8255"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.879 at
FT                   residue 34"
FT   gene            complement(2781..2960)
FT                   /locus_tag="Mnod_8256"
FT   CDS_pept        complement(2781..2960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8256"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6710 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8256"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62411"
FT                   /db_xref="GOA:B8IVH1"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH1"
FT                   /inference="similar to AA sequence:KEGG:M446_6710"
FT                   /protein_id="ACL62411.1"
FT                   /translation="MYVEGGWKPPWEPPREPRLTQRQERVFLWLIAVNALLVFIAPIGG
FT                   ATIIHAVLAVLRHG"
FT   gene            complement(3399..4706)
FT                   /locus_tag="Mnod_8257"
FT   CDS_pept        complement(3399..4706)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8257"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5531 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8257"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62412"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62412.1"
FT                   /translation="MGRRELERLSKAELIELVLRLQRPDKTSRTSSTPPSTDRKERREQ
FT                   AKPGGAKPGHEGHSRVSSQIPDEVVAHRPGHCSCGGGVLAPDLPAEIVSLSERIELPEV
FT                   APVVTQHQQLAVRCLACGARVLAPVPQAARGTPFGPRLHAVAVYLKTFQALSYERLQAL
FT                   LADLFGLTLSQGGLMNLLRRAQGRFRPGRAAAVSALRRAAVVASDETGVRIEGTNSYHW
FT                   GFHSADAVVHHAAPTRVACVIREMMDGHRPAVWLSDRSTAQQGHGVRHPTCLAHLVRDI
FT                   AYAVEASEDPVPLRLQLWLGSVFSLAERVTDLAASTLAAKRRTLERRLAEILAVPSRCD
FT                   LTRALQAKIGRARDQLLVFLAHPGQVAVTNNGCKRALRPAVVQRKVTNGYRAMWAAEGE
FT                   ADVRTVVDTARLSGAGTFSARSSRLSAPNPRCHGRG"
FT   gene            4929..5558
FT                   /pseudo
FT                   /locus_tag="Mnod_8258"
FT   gene            5953..6288
FT                   /locus_tag="Mnod_8259"
FT   CDS_pept        5953..6288
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8259"
FT                   /product="protein of unknown function DUF1452"
FT                   /note="PFAM: protein of unknown function DUF1452; KEGG:
FT                   pen:PSEEN3078 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8259"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62413"
FT                   /db_xref="GOA:B8IVH3"
FT                   /db_xref="InterPro:IPR007251"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH3"
FT                   /inference="protein motif:PFAM:PF07300"
FT                   /protein_id="ACL62413.1"
FT                   /translation="MTKFITNRFEALAAWISDNLGSPYAFMIASATVIVWALSGPYFGF
FT                   SDTWQLVINTSTTIITFLMVFLLQNTGNRTINEMEERLREMEQVNREILHELRRQQGFK
FT                   PDIREVA"
FT   gene            complement(6526..6630)
FT                   /locus_tag="Mnod_8260"
FT   CDS_pept        complement(6526..6630)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8260"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8260"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62414"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62414.1"
FT                   /translation="MRIAQQATLAFLFFQFATIRYAAWKMPRGEASGA"
FT   sig_peptide     complement(6562..6630)
FT                   /locus_tag="Mnod_8260"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.871) with cleavage site probability 0.869 at
FT                   residue 23"
FT   gene            complement(6627..7031)
FT                   /locus_tag="Mnod_8261"
FT   CDS_pept        complement(6627..7031)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8261"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8261"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62415"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62415.1"
FT                   /translation="MTAQMTLAERLEANAILDRLVADEPTFAISDAHRLIELIPIRAPR
FT                   RFTFNFTFSRPGTKTRGHAAGHGDVQVEEEGVEKTWSTDSGPVHKIGGYEVTHVPGLIT
FT                   IQLMWTETRLDQTGQSCELIYNKATASRRR"
FT   gene            7375..7815
FT                   /locus_tag="Mnod_8262"
FT   CDS_pept        7375..7815
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8262"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: syf:Synpcc7942_2103 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8262"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62416"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR021708"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH6"
FT                   /inference="similar to AA sequence:KEGG:Synpcc7942_2103"
FT                   /protein_id="ACL62416.1"
FT                   /translation="MSLISITRLRVRSIRFLPAFALHVLRSRNQVRHAPGFQGGSLLLD
FT                   WGWAFWTMTAWDTEENMRRYMTTGAHRIVMPYLLDWCDEASVVHWTQPETTLPSWAEAD
FT                   RRMRESGRPSKVRNPSPQHATLTYRGPRFTRGGPIRPAACSN"
FT   gene            complement(7850..8041)
FT                   /pseudo
FT                   /locus_tag="Mnod_8263"
FT   gene            complement(8488..8964)
FT                   /locus_tag="Mnod_8264"
FT   CDS_pept        complement(8488..8964)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8264"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: met:M446_3648 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8264"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62417"
FT                   /db_xref="GOA:B8IVH7"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH7"
FT                   /inference="protein motif:PFAM:PF06983"
FT                   /protein_id="ACL62417.1"
FT                   /translation="MVAKNTICLWYDKDAEAAARFYVETFPESAMGAVHRAPADYPSGK
FT                   AGDVLTVEFTVAGIPCIGLNGGPVFQHNEAFSFQIATDDQAETDRLWNAIVGNGGQESA
FT                   CGWCKDRWGISWQITPRVLTAAMAAGGEAAKRAFTAMMTMRKIDVAAIEAARRG"
FT   gene            9325..9681
FT                   /pseudo
FT                   /locus_tag="Mnod_8265"
FT   gene            complement(9630..10158)
FT                   /pseudo
FT                   /locus_tag="Mnod_8266"
FT   gene            complement(10155..10871)
FT                   /locus_tag="Mnod_8267"
FT   CDS_pept        complement(10155..10871)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8267"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: smd:Smed_1308 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8267"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62418"
FT                   /db_xref="GOA:B8IVH8"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62418.1"
FT                   /translation="MDWIGPAVVAAAVSGIVSTVGFVVNRATTLATHRERLTADRTLAE
FT                   RKSEFDKDLAERKFRYDRDLNDHKRGVELAETVLSDFYQMTAVLQEIRNSGALSNEWEE
FT                   RTPEPGETEWQAQNRNTYFVPLASIRRNSEFLSGMMSRRYRSKAMLGAEIDAAFQAVHE
FT                   ILVRVQVSAGTLMRLVDGSGEGRQRNQALRDRCEADIWMGAGDPNAPDQLAEQMEQAVA
FT                   AAERVCQRIITGEGAA"
FT   gene            complement(10930..11226)
FT                   /locus_tag="Mnod_8268"
FT   CDS_pept        complement(10930..11226)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8268"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_1886 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8268"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62419"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62419.1"
FT                   /translation="MILTALALTLKRQARGDFKGRHFEATLIVQAVSWSLRDALSDRDI
FT                   EEMLLERDLTVDHSTINRWVLAYRARLAVPAAGIRAVWCRYSFCIDSRYQKFI"
FT   gene            11369..11674
FT                   /locus_tag="Mnod_8269"
FT   CDS_pept        11369..11674
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8269"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: pap:PSPA7_4469
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8269"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62420"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI0"
FT                   /inference="protein motif:TFAM:TIGR02683"
FT                   /protein_id="ACL62420.1"
FT                   /translation="MIELKQTATFAKWESRLRDKRARTIIAARLMRLAEGLPGDVEPVG
FT                   EGVSELRIHYGPGYRVYFQQRGNLLIVLLCGGDKGSQARDIAAAKKLAKEWSSQDA"
FT   gene            11667..11960
FT                   /locus_tag="Mnod_8270"
FT   CDS_pept        11667..11960
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8270"
FT                   /product="putative transcriptional regulator"
FT                   /note="TIGRFAM: addiction module antidote protein; KEGG:
FT                   maq:Maqu_2670 putative transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8270"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62421"
FT                   /db_xref="GOA:B8IVI1"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR014057"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI1"
FT                   /inference="protein motif:TFAM:TIGR02684"
FT                   /protein_id="ACL62421.1"
FT                   /translation="MPEKLTTYDPAAALVDDEEIAAFMADAFETGDAAYVAKALGVVAR
FT                   AKGMTEISRKTGLSREQLYRSFSEHGNPTLKTTLAVMRALGVDITAKARAAQ"
FT   gene            12244..13524
FT                   /locus_tag="Mnod_8271"
FT   CDS_pept        12244..13524
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8271"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5531 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8271"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62422"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62422.1"
FT                   /translation="MGRSELERLSKQELIELVLRLQRPEKTSRTSSKPPSTDRKERREQ
FT                   AKPGGAKPGHEGHSRTLSPDPDEIVAHRPGHCPCCGGVLAPDLPAEIVSVCEQIDLPAV
FT                   APMVTQHQRLAVRCPACGTRVVAPVPQAARGTPFGPRLHAVAVYLKTFQALSYERLQAA
FT                   LSDLFGLTLSQGGLMNLLRRAQRQFRADREAAVSALRRAAVVASDETGVRIEGSNSYHW
FT                   VFRSDAAVVHHAASTRAAAVVHAMMDGHRPSVWLSDRYTAQQGHGEHHQTCLAHLARDV
FT                   AYAVEVSDDPVPLRLQLWLGSVFSLAERVTDLAASTLSAKRRALDRQLSAILAAPSRCD
FT                   LTRALQAKIGRARDQLLVFLDHPGRVAVTNNACERALRPAVVQRKVTNGYRAMWAAAGE
FT                   ADVRTVVDTARLSGAGTFATILNIIRA"
FT   gene            13656..14240
FT                   /locus_tag="Mnod_8272"
FT   CDS_pept        13656..14240
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8272"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase; Male
FT                   sterility domain; KEGG: xau:Xaut_3423 NAD-dependent
FT                   epimerase/dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8272"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62423"
FT                   /db_xref="GOA:B8IVI3"
FT                   /db_xref="InterPro:IPR003560"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI3"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL62423.1"
FT                   /translation="MRILVLGGYGLIGTAVILRLLSAGHSVIALGRSAVAARRRFPEVS
FT                   WIETDIAGLSGAESWRPLIADCDAVVNCAGALQDGARDDLHAVQSTAMQALFLACEAAG
FT                   IRRVVQISAVGASPSATTAFMRTQAEADGTLSRLDLDWTILRPGLVLAPAAYGGTALLR
FT                   ALASIPVVLHRMWCDGSAFRFGQEPAVTAAA"
FT   gene            complement(14413..15165)
FT                   /pseudo
FT                   /locus_tag="Mnod_8273"
FT   gene            15451..17598
FT                   /locus_tag="Mnod_8274"
FT   CDS_pept        15451..17598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8274"
FT                   /product="TonB-dependent siderophore receptor"
FT                   /note="TIGRFAM: TonB-dependent siderophore receptor; PFAM:
FT                   TonB-dependent receptor; TonB-dependent receptor plug;
FT                   KEGG: mpo:Mpop_3808 TonB-dependent siderophore receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8274"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62424"
FT                   /db_xref="GOA:B8IVI4"
FT                   /db_xref="InterPro:IPR000531"
FT                   /db_xref="InterPro:IPR010105"
FT                   /db_xref="InterPro:IPR012910"
FT                   /db_xref="InterPro:IPR036942"
FT                   /db_xref="InterPro:IPR037066"
FT                   /db_xref="InterPro:IPR039423"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI4"
FT                   /inference="protein motif:TFAM:TIGR01783"
FT                   /protein_id="ACL62424.1"
FT                   /translation="MKTVNISIVVTAAWSIASVASWAVLGPQAVAAQAAADASPEIQLE
FT                   EISVAGSGGVPLKTEGYLARNSVSATRTDTPLREVPQAVVPVPRQVLEDAAATRIDTAL
FT                   DLAGVGRSNNFAGLGLTEFTIRGFATGEYYRNGFPINRGYPNSPDIVSIERIEVLKGPS
FT                   AFLYGRGDPGGTFNIVTRQPTAERSFALGTQYGSDNAKRSTFDATGALDEGGTVLARLT
FT                   GAVEDNGSFRDFVHSDRYYLAPVIAWKPSADTTMTLEGEFISAGQIFDRGIVPFRGDLR
FT                   AVPRTRYIGEPGLPPFRNDNALGQLRVEHRFNSDWVLSAGTQVLAGNIAGEAVQTVGFL
FT                   GDGRLLRRTLDRRELTWSDLDLQINLAGKFETGFLRHTLLVGLEHDRLRYREDITRSNF
FT                   NTNPFVLDLFAPRYGQALPALTVPSSNLLQNTTSYAGYVQDQIDLTPKLHALLGVRVED
FT                   IALDTTNYINGVSTKLQGTAATPRFGLVYDLSDIASVYGSYAQSFRPNTGADRSGRPFP
FT                   FQQAESYETGVKLSLLDGRLDATAAFFDIRRTNQLVTDPVDQNFSVATGAARSRGFDLT
FT                   VAGFLAPGWRVIGTYAFVDAAITRDSTLPVGTRLANIPQNSFALQSVYEFQSGPLRGLG
FT                   LGGGVTYVDSRVAGTALSTFTMPAYTLANLISYYWITPEVRVYLNVDNLFDERYFDRSF
FT                   QNRYATPGQPRTIMGGVAARF"
FT   sig_peptide     15451..15522
FT                   /locus_tag="Mnod_8274"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.361 at
FT                   residue 24"
FT   gene            17715..17834
FT                   /pseudo
FT                   /locus_tag="Mnod_8275"
FT   gene            17851..18309
FT                   /pseudo
FT                   /locus_tag="Mnod_8276"
FT   gene            complement(18462..19448)
FT                   /locus_tag="Mnod_8277"
FT   CDS_pept        complement(18462..19448)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8277"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: rpa:RPA2923 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8277"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62425"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62425.1"
FT                   /translation="MDRLCFIICSALGNCRGEPWGARGTRDSEAGIGGRSSPPIVAHRD
FT                   RTGRRNQRWERRAVPAGYIRDRPRFRAKLSIMIQKRQGRWLINMQPIPVMSFPTSTSAC
FT                   PRARRGSAAKPPSAHRAGQELGASLRDRALLAACGGSPNPVNGFRPPAGLRSLAQRATA
FT                   CSVPRRARASSGTVAGAVRPARPFRPPPRQVPPAPPLAPPAMRGPCPLRRRRTVPGTIS
FT                   DRKPASAPPASRRAAPPLRCGPFGVQAAPRPVLRSPSRPGRSRAHQGPHPMPRLASAPA
FT                   AARLALQAHVEELRAELASVLCPAERRQIERDLRTARAQLADLRSAC"
FT   gene            19874..21511
FT                   /locus_tag="Mnod_8278"
FT   CDS_pept        19874..21511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8278"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: mlo:mll5961 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8278"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62426"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI6"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACL62426.1"
FT                   /translation="MILSSSLPGCTIERVFRHTDHLVVIAHGRRCHGRCPTCGTPSSAV
FT                   HSRYDRRPADLPSMGQPVTLRLRIRRFYCHHPACRRRTFAEPLPRLIPPRARRTRRLAQ
FT                   AQTRIGLAVGGEAGARLTGHLGMQTSPDTILRLVHRLPLPRANAPRAVGIDDWAIRKGR
FT                   SYGTLLVDLERRCPIDLLPDRSGATVAAWLRRHPSIQIVARDRSTEYARAATAGAPAAL
FT                   QVADRWHLLLNLRQVLERWLGRVHGRLRQLPPLASGDGRQPGERPRAYRRSAAEIAVSL
FT                   DSRARRLAAYEDVRRRHLAGETLLAIGRATGLARATVRKYAQAESFPERAIRRPNPSRL
FT                   DPYLAHLEQRMAEGCENAMALWREIRRQGFAGTHRQVHRFVAERRTARKWLSQPASTST
FT                   EAIRPSPIASPKQLAWILVQPLATLQPRAAADLARIRQDPEAARIADLARRFTMLVRAC
FT                   GLGGDRPADPASELDRWLLETRNCGVAALETFAAGLAQDGAAVRAALTTSWSNAQAEGQ
FT                   ISRLKMLKRTMYGRASFALLRSRILIAA"
FT   gene            21951..23480
FT                   /locus_tag="Mnod_8279"
FT   CDS_pept        21951..23480
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8279"
FT                   /product="Hemolysin-type calcium-binding region"
FT                   /note="PFAM: Hemolysin-type calcium-binding region; KEGG:
FT                   dde:Dde_1416 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8279"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62427"
FT                   /db_xref="GOA:B8IVI7"
FT                   /db_xref="InterPro:IPR001343"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="InterPro:IPR018511"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI7"
FT                   /inference="protein motif:PFAM:PF00353"
FT                   /protein_id="ACL62427.1"
FT                   /translation="MPTSWRLRAREGVYVEPWQWAAIGDALMHRDLAARRASAQIDADG
FT                   SIYYPDLGYGVIRDYHEFAFRNLGGTVPDGQGVTIEAWTAYAPIEVLGTSTWERMLADS
FT                   LVEQLGVGAGVAAQMVVATWTPLMSGMSFEKQPLAERWLDTLWQARSAPFAEGSPLAFP
FT                   TEVENAYIVMGTRGDDTLRANEEAAQGRDIMLLGLNGNDTITAAQSGGYVDAGAGDDLI
FT                   IGQGSNAKVDGGSGFDSLQLNAPDATSKAYIFIDDAYYDKFSGGSYYFTTRPHSTTSGI
FT                   EGERFARIETLAGTSGDDRFLVYTLSTQVLPNITLDAGPGIDEISLEFLGDLPVVVDLL
FT                   QTRNSAEILGVTDPGSITFNLSNFENVTTGKGNDIVFGSNSDNAISVGDGRNEAHGRDG
FT                   NDRLSGGKGIDRLYGDRGKDEILGHDGNDLLDGGDNDDKLYGMEGDDILQGGSGNDFLT
FT                   GGSGKDLLDGGAGDNELFAYEAEGGDTLRGALETTGFMHQAATIFLKVEMV"
FT   gene            23540..23821
FT                   /pseudo
FT                   /locus_tag="Mnod_8280"
FT   gene            23952..24089
FT                   /locus_tag="Mnod_8281"
FT   CDS_pept        23952..24089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8281"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8281"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62428"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62428.1"
FT                   /translation="MGQGRGIGGARVTCLAQYFSTADLIGDVERPFALIAEKVLAVDAY
FT                   "
FT   gene            complement(24202..25137)
FT                   /locus_tag="Mnod_8282"
FT   CDS_pept        complement(24202..25137)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8282"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_6059 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8282"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62429"
FT                   /db_xref="InterPro:IPR019627"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI9"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6059"
FT                   /protein_id="ACL62429.1"
FT                   /translation="MLDSPVSSFTDHHGAGQGGHLLEELLTHHYRPFEQDADPRPLPEP
FT                   EAVESAMLGAMNALADVFAGTRLEDDASDLLWGFVNLFHRRAEQLDRKLDDNELAQRQS
FT                   QGEQDGSEVRSVELERLIALGLSLTERRNAFEFARDAAAEVYRVHTGSLWRPRSGSQVN
FT                   HRTMTAAMIDSRDFLAAKRKAETEILVPPGPRIAFTGGQDYQDVERIWVVLDRVKAKHP
FT                   GMVLLHGGSPKGAELIAAKWADSRQVPQVAFRPDWTKHGKAAPFRRNDALLEAMPIGVV
FT                   HFPGGGISDNLADKARAKGIPVQRGVRAGA"
FT   gene            complement(25374..26447)
FT                   /locus_tag="Mnod_8283"
FT   CDS_pept        complement(25374..26447)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8283"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_6058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8283"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62430"
FT                   /db_xref="InterPro:IPR006171"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ0"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6058"
FT                   /protein_id="ACL62430.1"
FT                   /translation="MPSHPAAELARRLGEIAEVVCRHYLSNGRRQGRYWLVGDVNNSAG
FT                   SSLYVRLTGPSSGKGARGRWVDAASGEYGDLLDLIRLNRGHDDWRETLEEAREFLRLPR
FT                   PARPEASGQGGPALATRDTVEAARRLFRSGRSVAGTPAATYLAGRGLARAIGLPALRYH
FT                   PRCYHRVSDDEPSQQHPALLAAVTDLHGTVTGVARTWLAPDGRGKAALADPRRSLGHQL
FT                   GHGVRFPGAVPDTLVAGEGLETTLSVHAVMPAISAAAALSANHLAALVLPPGLRRLYVA
FT                   RDGDPEGVRAYTTLRARAEAAGVPEVWELVPAADDFNTDLMARGPGGLALHLAPQLAEQ
FT                   DAMHFLRLEAIEPDAVV"
FT   gene            26773..27204
FT                   /locus_tag="Mnod_8284"
FT   CDS_pept        26773..27204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8284"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   mex:Mext_4474 ROSMUCR transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8284"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62431"
FT                   /db_xref="GOA:B8IVJ1"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ1"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL62431.1"
FT                   /translation="MVNQVAQQPDEAIVRTATIVMAYVSNNSLRPAELPDLIASVHAAI
FT                   GRGRAPEPAEPQTPRATPAQIRRSISHEALISFEDSKPYKSLRRHLTTRGLTPEQYRAK
FT                   WGLPPDYPMVAAAYSEERSALARAAGLGRKRAAVRPPAR"
FT   gene            complement(27238..27624)
FT                   /locus_tag="Mnod_8285"
FT   CDS_pept        complement(27238..27624)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8285"
FT                   /product="PilT protein domain protein"
FT                   /note="PFAM: PilT protein domain protein; KEGG:
FT                   nha:Nham_4577 PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8285"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62432"
FT                   /db_xref="GOA:B8IVJ2"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ2"
FT                   /inference="protein motif:PFAM:PF01850"
FT                   /protein_id="ACL62432.1"
FT                   /translation="MVIDTSAIVAIALDEPEAAGFERKIADDPVRLISAATVLEAAMVL
FT                   ETRLGEAGGSELDLWLHKAEVEIVAVEPEHADRARRAWRRYGKGRHSAGLNFGDCFSYA
FT                   LAALTGEPLLFKGNDFSQTDVRAA"
FT   gene            complement(27624..27878)
FT                   /locus_tag="Mnod_8286"
FT   CDS_pept        complement(27624..27878)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8286"
FT                   /product="Rv0623 family protein transcription factor"
FT                   /note="PFAM: Rv0623 family protein transcription factor;
FT                   KEGG: nha:Nham_4578 Rv0623-like transcription factor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8286"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62433"
FT                   /db_xref="InterPro:IPR011660"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ3"
FT                   /inference="protein motif:PFAM:PF07704"
FT                   /protein_id="ACL62433.1"
FT                   /translation="MALSIKDPETERLARTLAERTGETITVATRKALEERLRRVGSDAR
FT                   KAALLEDLAACRRRWSTLPVLDPRSADEILGYDENGLPG"
FT   gene            complement(27999..30128)
FT                   /locus_tag="Mnod_8287"
FT   CDS_pept        complement(27999..30128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8287"
FT                   /product="ParB domain protein nuclease"
FT                   /note="SMART: ParB domain protein nuclease; KEGG:
FT                   pla:Plav_3513 nuclease"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8287"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62434"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ4"
FT                   /inference="protein motif:SMART:SM00470"
FT                   /protein_id="ACL62434.1"
FT                   /translation="MAASKKITLASARTIPFDKLVLSQANVRRISHGQTIEQLAEDIAH
FT                   RGLLQSLCVRPVLDADGAETSLFEVPAGGRRFRALERLVKTRRMTKTAPVPCIVREPGS
FT                   AISAEEDSLAENAMREQLHPLDQFRAFKALIEAGLSEEDVAARFFVTVTIVKQRLKLAS
FT                   VSETLLAAYAAEEMTLQQLMAFTVSPDHAQQEQVWDAIRQQRYPAPAYTIRQMLTREQV
FT                   PSSDPRAQFVGTEAYEAAGGSVIRDLFSEEGEGWFKDPALLDRLATEKLQLLAAEVRAE
FT                   GWKWVEVALHFPYGHKNGLSRVFPEPVLTDEETAARDALRAEYDDLEQQHAGDGDLPEE
FT                   VDARLAELERAIEAFDARAFRYAPADIAIAGAFVSLDHDGELRIERGYVRLGDLPIESP
FT                   AAPEGDAAGVPEGETPAVQCVVFTIGGAPQGTEPAPEPDEAETDRPLTERHMMELTTYR
FT                   TLALREALADDPDAAFLAVLHAMVLRVFHLSGDSCLEITTRSTSPDRSVEGLATFGPAT
FT                   ALQSRRDLWAGQLPRQSAALWDFLLGLDADSRASLFALCAGLSVNAMQLPHDSRPAAIA
FT                   HGHRVAELVGLAMARHWEPTAANFFGKVTKSRILSAVREARGEQAAQLIDHLKKADMAR
FT                   EAERLLAGSGWLPQPLRTPGLDRGALPAADMDHERGTAASEPEARPEALPAFLAAEDGT
FT                   DPEVGDRGSYAVAAE"
FT   gene            30276..30485
FT                   /pseudo
FT                   /locus_tag="Mnod_8288"
FT   gene            30613..30828
FT                   /locus_tag="Mnod_8289"
FT   CDS_pept        30613..30828
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8289"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8289"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62435"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62435.1"
FT                   /translation="MWLRRRARRWACVRARARIMQGRYGAEAYYVARDRARRPHGQRVW
FT                   FWTRVAIELARWQGREIGVSASDRWR"
FT   gene            30911..31483
FT                   /locus_tag="Mnod_8290"
FT   CDS_pept        30911..31483
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8290"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8290"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62436"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62436.1"
FT                   /translation="MASSIEFLLKQLWVLNEQDGIQQSMRRCSHTMDGIATFDPSKKIK
FT                   LSPMLRERFRCAYEWENAAIGQTWLGLDKVAIASDDTQIRKHYDLRVQNWTHAPPAMTT
FT                   PSRTAIYGINTERREATYLAWPAEDEEPIICALYGGQFDIFKNLKRYLEFLAGDRCHDD
FT                   SEEILPHVPLSVDEVVTKAREDGGLER"
FT   gene            31593..31784
FT                   /locus_tag="Mnod_8291"
FT   CDS_pept        31593..31784
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8291"
FT                   /product="transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: rpt:Rpal_1044 transposase and inactivated
FT                   derivatives-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8291"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62437"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ7"
FT                   /inference="similar to AA sequence:KEGG:Rpal_1044"
FT                   /protein_id="ACL62437.1"
FT                   /translation="MKTGLNSPEFNPIERAFAKLKALLSKAAEHSFNGLRQAILRIFDA
FT                   FTPAECSNYYAGAGYYAK"
FT   gene            31936..32577
FT                   /locus_tag="Mnod_8292"
FT   CDS_pept        31936..32577
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8292"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   rle:RL2993 putative glutathione S-transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8292"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62438"
FT                   /db_xref="GOA:B8IVJ8"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ8"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACL62438.1"
FT                   /translation="MADLVLHTFDWVPEMPRGYVRDLRVRWALEEAGLPYRVESVPFGK
FT                   RGAEHFAHQPFGQVPWLTDGDLSTFESGAILVHLGERSEALMPADPRGRSEVLEWVFAA
FT                   LNSVEMASLPWSIVQFSGDTGDTPGWTPLNQFLNARLQHMEPVLAGREWVARGVFSVAD
FT                   ILMADVLRLVDRFEGLAGFPSCRAYVARATARPAFLKAHADQMAHFAAAD"
FT   gene            32785..33117
FT                   /locus_tag="Mnod_8293"
FT   CDS_pept        32785..33117
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8293"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bra:BRADO7105 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8293"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62439"
FT                   /db_xref="InterPro:IPR007351"
FT                   /db_xref="InterPro:IPR038056"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVJ9"
FT                   /inference="similar to AA sequence:KEGG:BRADO7105"
FT                   /protein_id="ACL62439.1"
FT                   /translation="MTTGDDLRRAALALEGTVESPHFDRAAFKVARIYVTLAADGRTAN
FT                   FKFSPDEQEFKCLLAPDAFSPVPNAWGKQGWTTGRLSALSEEELVSALKTAWAHALPKK
FT                   PNRRRR"
FT   gene            complement(33126..33833)
FT                   /locus_tag="Mnod_8294"
FT   CDS_pept        complement(33126..33833)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8294"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mes:Meso_3816 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8294"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62440"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62440.1"
FT                   /translation="MRFRRVPRPEPYRETSCKRAAFLRKQRLELEALPLFADAIAASQH
FT                   DVAAEMACRAVWWAEAERERRRQRTAGWRQARARLFALDTALRRTIRALWRTCRYPGDP
FT                   PYLAGLLHQIAVGRFDPHRPPWLFHPATFDAAFRRIGRRTVGGGPKTAPANELVFRGNL
FT                   GAGILFLTSRVRLIDRRRQIAPIHASQRLPAPAEDPDPGAGRRPGFLRLASGEGPGSRK
FT                   DLHRRPRTDVANY"
FT   gene            complement(33833..34780)
FT                   /locus_tag="Mnod_8295"
FT   CDS_pept        complement(33833..34780)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8295"
FT                   /product="domain of unknown function DUF1738"
FT                   /note="PFAM: domain of unknown function DUF1738; KEGG:
FT                   mrd:Mrad2831_6049 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8295"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62441"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK1"
FT                   /inference="protein motif:PFAM:PF08401"
FT                   /protein_id="ACL62441.1"
FT                   /translation="MARASSPARSTRTERASLYREITDKIIAQLEAGCVPWVQPWSTGP
FT                   GTAAVTMPRNAASTRAYSGINVMLLWAAAIENGYATQRWLTFRQALSLGGCVRRGEHGT
FT                   TVVYADRFTPEDERQRADRDGDQARQIAFLKRFTVFNVAQCDGLPTEMLVPAPPREDLI
FT                   LPRFRALMEASGVTIRIGGHMSFYRPADDVIVLPPPEAFHEPINFHRTAAHELSHATGH
FT                   ASRLNREMKGPRGGACYAREELVAEISAAFVCASLGIVPTVRHADYIGAWLEVLREDDR
FT                   AIVRAASHASKAADWLLGRLLDAESPASAEAEAA"
FT   gene            34980..35315
FT                   /pseudo
FT                   /locus_tag="Mnod_8296"
FT   gene            35348..35503
FT                   /pseudo
FT                   /locus_tag="Mnod_8297"
FT   gene            36064..36243
FT                   /pseudo
FT                   /locus_tag="Mnod_8298"
FT   gene            complement(36529..37506)
FT                   /locus_tag="Mnod_8299"
FT   CDS_pept        complement(36529..37506)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8299"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Lytic transglycosylase catalytic; KEGG:
FT                   bid:Bind_1465 lytic transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8299"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62442"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK2"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACL62442.1"
FT                   /translation="MGGALVTARRISVAAAVGLACVCVATSAQAESANDGFPNLPLPPT
FT                   IVGLVGLPTIYNKGRSAYLDMLTQEAIRQGLPPAVADAVAQVETAYNPNAIGGVGEVGL
FT                   MQVRPQTAAMLGYRGTDADLAEPTTNVRYGVAYLARAWRLAGGDLCRALMKYRAGHGEE
FT                   RMTPLSVEYCRRARAHLALIGSPLAGEIAPPTEPGPTSASAAAAQPRKPSPSSLPQAAS
FT                   VEPHRPRETTKATRSIADAGAGNSSRPAERRSAQARIVLPPSRPPTVKLASVSIGADVL
FT                   TAAQTALQLKKQEQTRRIWAERDARLKAIDAKLKRSGLIIATGI"
FT   sig_peptide     complement(37414..37506)
FT                   /locus_tag="Mnod_8299"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.990 at
FT                   residue 31"
FT   gene            38446..39054
FT                   /locus_tag="Mnod_8300"
FT   CDS_pept        38446..39054
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8300"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0121 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8300"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62443"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK3"
FT                   /inference="similar to AA sequence:KEGG:M446_0121"
FT                   /protein_id="ACL62443.1"
FT                   /translation="MRAIMFALLVIFVAENGTVAAAANQSSTYSKKFIAFFFEIRRYND
FT                   ISSEITEEVIKDSDDAHVSQKTNRAASAFDVCDMDDFNNFKRHISSRDNRYIREFNLAG
FT                   NPDDTSYIGASVVYVKQLLININKLARKRSYKIGAAIAYLQLDTEGVVLEARVIDFLGD
FT                   TTIIREVYGVVTPGRKLGEPPYFVDKDNLKFIVPVVFER"
FT   sig_peptide     38446..38511
FT                   /locus_tag="Mnod_8300"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.969) with cleavage site probability 0.829 at
FT                   residue 22"
FT   gene            complement(39542..40420)
FT                   /locus_tag="Mnod_8301"
FT   CDS_pept        complement(39542..40420)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8301"
FT                   /product="beta-lactamase domain protein"
FT                   /note="PFAM: beta-lactamase domain protein; KEGG:
FT                   bpy:Bphyt_5423 beta-lactamase domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8301"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62444"
FT                   /db_xref="InterPro:IPR001279"
FT                   /db_xref="InterPro:IPR036866"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK4"
FT                   /inference="protein motif:PFAM:PF00753"
FT                   /protein_id="ACL62444.1"
FT                   /translation="MTTNEVPVVYRIGHATVTRISEITAEFPAGKLLPDYDPALERPDP
FT                   VGSSPVDAAGGQLTVSVHSWLVRIGGLTVLVDAGIGNGKTRASKLFDHLDTPWLDRLAT
FT                   AGARPEDVTHVLLTHLHTDHVGWNTVPGDGGWVPTFPNARTLMPHRGYELFMSPEGRAR
FT                   PNHDMFADSVLPVVAAGRTEFVPPEGGESLADFTYVPTPGHSPDHMSILLRSDGREALF
FT                   AGDVLHHPVQVARPDWCSMFCEAPEEARRSRLRMLDLAAERRLIWFSSHCAGTSAGTVA
FT                   RNGERFTWTFL"
FT   gene            complement(40458..41240)
FT                   /locus_tag="Mnod_8302"
FT   CDS_pept        complement(40458..41240)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8302"
FT                   /product="Creatininase"
FT                   /note="PFAM: Creatininase; KEGG: hma:pNG7317 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8302"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62445"
FT                   /db_xref="InterPro:IPR003785"
FT                   /db_xref="InterPro:IPR024087"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK5"
FT                   /inference="protein motif:PFAM:PF02633"
FT                   /protein_id="ACL62445.1"
FT                   /translation="MTVSTEMAPPEVAWNRLSAEALNDLARRDAIVLLPVASTEQHGPH
FT                   LPTGVDDFLGTAVCRRTAELVAPDRPIVVAPTVWCGLADHHVAFGGTFTLSLATYHALL
FT                   RDLCRSILAAGFRKVVLVNSHGGNITALSSLAVELTRELDAPIATATYFMEAADAVSGI
FT                   LEDQGNVMHACEAETSMMMALDSDLVDATRLAEAHGPGFDIADSLMPTLKRVRGWQEVS
FT                   RGGVAGDARRASAAKGEAVLDACALALAARLRAGDPWA"
FT   gene            complement(41254..42690)
FT                   /locus_tag="Mnod_8303"
FT   CDS_pept        complement(41254..42690)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8303"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pla:Plav_2687 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8303"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62446"
FT                   /db_xref="GOA:B8IVK6"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62446.1"
FT                   /translation="MLTQRPDPLPAAVDVSPAMPRPSVAWYGVAVLFVVQIFSFVDRQA
FT                   LSLLIAPIKADLGMSDTEVSLVIGLGFALAYAVAGLPIGRLVDRVSRPALLSAGLALWC
FT                   GCTFLCGFVRSFPQLALARSGVGIGEATGTPVVVSLLGDWFPPHRRGLAFAVFAVSAYV
FT                   GTGLALVAGSGIVHAFEGLTVVDVPLIGSVRTWQFVFLLIGPPGLLVIPFVLSLYEPRR
FT                   SGVAKGQGKPTSDAPDLPQVVAHYRRHWRAFATQHAASTLLAMLFYGTGAWVPEFLRRT
FT                   YGLPIAQGGLWFGCVTVAAGALGVLAGGVTSDRMLRAGRTDARLRVTGIAALCALPFAA
FT                   AFPQAATPALALLLAGGMIFFTAVISTTGSTGVQELAPARMRGTASAVYLFVFNGIGLS
FT                   LGPTVFALLTDRAFGDEALLWRAMAVGAPSLAILAALAAFSGLHPYRACVAANAGTSGA
FT                   HEAAPSTSPASPASTRIATA"
FT   gene            42804..43475
FT                   /locus_tag="Mnod_8304"
FT   CDS_pept        42804..43475
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8304"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sco:SCO6778
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8304"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62447"
FT                   /db_xref="GOA:B8IVK7"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039536"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK7"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL62447.1"
FT                   /translation="MARRGATVRDDEHAGSGGEGAGTSIAILDAARRLFLDAGYEGVSL
FT                   EQVGRAAGVSRQTVYNQFGSKDAVFRSVVDRHWETVRTEVAVMLPSPSAEPAEPAEILH
FT                   GFARALLRFVQGTDQIAFTRLVIAESRHQPWIAEAFYRAGKAPLVAAFAGVLSELTNRR
FT                   LLCCPHPELAARQFMGLVQEFVIWPHVMRVGGLAEIPDDDTVVEEAVRTFLARYAAHPP
FT                   G"
FT   gene            complement(43623..44972)
FT                   /pseudo
FT                   /locus_tag="Mnod_8305"
FT   gene            complement(45584..47065)
FT                   /locus_tag="Mnod_8306"
FT   CDS_pept        complement(45584..47065)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8306"
FT                   /product="succinic semialdehyde dehydrogenase"
FT                   /note="TIGRFAM: succinic semialdehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: met:M446_0786 succinic
FT                   semialdehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8306"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62448"
FT                   /db_xref="GOA:B8IVK8"
FT                   /db_xref="InterPro:IPR010102"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK8"
FT                   /inference="protein motif:TFAM:TIGR01780"
FT                   /protein_id="ACL62448.1"
FT                   /translation="MTTMTVEDRLLSLKRPDLLRTQAYIDGAFVDADSGETIAVDNPAT
FT                   GQVLGTVPRMGAAETERAIAAAQAALPDWRGRTAKERAAILRRWFSLILENQDDLAAIM
FT                   TAEQGKPLPESRGEIAYAAAFIEWFAEEAKRVYGDVIPAHGPDKRIVVLKQPIGVCAAI
FT                   TPWNFPAAMITRKAGPALAAGCTMVLKPASQTPFSALALCALAQQAGIPPGVLSCLTGS
FT                   AQAIGGAMTASPIVRKLSFTGSTEIGRELLAQCAKTIKKTSMELGGNAPFIVFDDADLD
FT                   LAVKGAIASKYRNAGQTCVCANRILVQDGIYDAFAERLASAVQAMRVGDGFAAGTVIGP
FT                   LIDAQAVVKVEEHIRDALDKGARLLTGGRRHALGGSFYEPTVLSGTTPAMKIFREETFG
FT                   PVAPLFRFRTEEEAVALANDTEFGLASYFYGRDIGRVWRVAEALEYGIVGINEGIISTE
FT                   VAPFGGVKESGLGREGSHYGIEDYLEIKYLCMGGI"
FT   gene            complement(47214..48872)
FT                   /locus_tag="Mnod_8307"
FT   CDS_pept        complement(47214..48872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8307"
FT                   /product="thiamine pyrophosphate protein domain protein
FT                   TPP-binding"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: met:M446_0778 thiamine pyrophosphate binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8307"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62449"
FT                   /db_xref="GOA:B8IVK9"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVK9"
FT                   /inference="protein motif:PFAM:PF02775"
FT                   /protein_id="ACL62449.1"
FT                   /translation="MRKGSDLLVQALENEGVDRIFGIPGEENLDVVESLRTSRIELVLT
FT                   RHEQAAAFMAATHGRLTGRPGVCLSTLGPGALNFTTGAAYAHLGAMPMLMITGQKPILS
FT                   ARQARFQIVDIIGAMRPITKMTRQIVSAASIPTLVRDAFRVATEERPGPVHLELPEDIA
FT                   AETADVAMVPSHPIDRPVAASAAIERAAAMILSAQRPLIMIGAAGNRPRLVEALSDFVR
FT                   RTRIPFFNTQMGKGAVTGGSNLYLGTAALSERDYVHQAIDRADLIISIGHDTVEKPPFL
FT                   MGQVAGGPKVIHIGYVSASVEQVFHPDAEVVGDIGSTVTALADRLGGRLDPDPGMLDLR
FT                   RSILERINDRAEEDRFPVTPQRLVHDVRAVMPEDGIVCLDNGMYKIWFARNYRTHVANT
FT                   LLLDNALATMGAGLPSAMMAKLLNPGRRVMAVCGDGGFMMNSQELETAVRLKLDLVVLI
FT                   LDDSAYGMIRWKQAVDAFADYGMTFGNPDFVAYANSYGATGHRITAVKDLIPTLEAAFA
FT                   AGGVHLVAVPVDYAENMRVLVEELQHKAGAAEPTG"
FT   gene            complement(48971..50278)
FT                   /locus_tag="Mnod_8308"
FT   CDS_pept        complement(48971..50278)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8308"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bcj:BCAM2659 putative tartrate transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8308"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62450"
FT                   /db_xref="GOA:B8IVL0"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL0"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62450.1"
FT                   /translation="MIVAAAADGGILPETHERQLASAIRKNTWRLVPILGLAYLFNYLD
FT                   RTSVGFAALQMNQAIGLTAAQFGWGAGILFFSYCLLEVPSNIAMYRFGARLWLARIMIT
FT                   WGLAAAATAFAVGPMSFYVIRFLLGVFEAGFFPGVIWYISIWFPARYRTQVLALFMAST
FT                   PLSSLLGSPISAALLGMDGILGLGGWQWMFLIEGLPACLLGLACLWLLADTPKDATWLT
FT                   EGERAALIAELAADKHEKPKKDLWAAMKDIRVLMLTGITFAFTIGSYGIGIWLPLILKN
FT                   HGLSTMQIGWVTAIPYLFATIGMLAWARLVDAAGRKIYNLMTALICGALGLALSVVFSS
FT                   LIPAVACLTLALIGTISARTVFYTIPQGFLTGAAAAGGLAFINSVGAFGGFVGPYLVGF
FT                   LKDATGSFDAGMLGMAAILFASTLLAWSLKLVIRNA"
FT   gene            50444..51400
FT                   /locus_tag="Mnod_8309"
FT   CDS_pept        50444..51400
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8309"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: smd:Smed_5902 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8309"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62451"
FT                   /db_xref="GOA:B8IVL1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62451.1"
FT                   /translation="MDLRDLAYFEVIADLGHLGRAAERLGRTQPALTKCIQRLEASVGA
FT                   ELFARSSRGLALTQVGEVLLARARRMRTAMDEALREVSDFAAGAAGHVRIGTGATMAEY
FT                   LLPQVCRALIAAAPAVTVELQIGMSGVLRTALRDNQLDLIIGPVLASDHDEFAHVTFGT
FT                   DDVVVVAARGHPLCGRPLSIEDLVKWKWVLPAKSVAMRQWLDTVFQAHGLPGPAVQIET
FT                   NSITMLPRLIGETDLLSFTSTRNLLPDRLGGRLERLGLDATTMRRPLGCVYRREGYLSP
FT                   AALRVVTLLQTQGSMLLSPDPSPSSARAAAQDGRVTA"
FT   gene            complement(51376..52419)
FT                   /locus_tag="Mnod_8310"
FT   CDS_pept        complement(51376..52419)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8310"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bcj:BCAM2658 putative
FT                   amidohydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8310"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62452"
FT                   /db_xref="GOA:B8IVL2"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL2"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACL62452.1"
FT                   /translation="MIERRSANYLPVRPDWLATGHEEPLEPELPIIDAHHHLWDRPGWR
FT                   YLFDEYLADIGGSGHAVQASVFMQAQAMYRADDSGPMRVVGETEFANGVAAMAASGQYG
FT                   PVRLCAGIVGHADLRLGDAVAEVLEAHLRAGNGRFRGIRHITVWDTDATLMNPLSAGPP
FT                   GLLSDTAFRAGFARLAPLGLSFDAWLFHPQLDELTDLARTFPDTTIVLDHCGGILGIGA
FT                   YAGRRQEIFAAWSRSIRALAQCPNVSVKLGGLGMRMNGFGFETGRMPPTSQHLAETWRP
FT                   YIETCIEAFGATRCMFESNFPVDKGSYGYGTVWNAFKRLTAGASSDERMALFSGTATRV
FT                   YAVTLPS"
FT   gene            complement(52464..53297)
FT                   /locus_tag="Mnod_8311"
FT   CDS_pept        complement(52464..53297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8311"
FT                   /product="citrate synthase"
FT                   /note="KEGG: rme:Rmet_4144 citrate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8311"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62453"
FT                   /db_xref="GOA:B8IVL3"
FT                   /db_xref="InterPro:IPR002020"
FT                   /db_xref="InterPro:IPR016142"
FT                   /db_xref="InterPro:IPR016143"
FT                   /db_xref="InterPro:IPR036969"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL3"
FT                   /inference="similar to AA sequence:KEGG:Rmet_4144"
FT                   /protein_id="ACL62453.1"
FT                   /translation="MADKDPAALLDAARTWWSTEIIDMKPGVIRFRGYPIEQLIGAVSF
FT                   PQMIWLMLRGSLPSLNESALLEAALVAAVDHGPQAPSIAISRMAVTCGLPLNGAMASAI
FT                   NVLDDVHGGAGEQCMELYADIARHLDAGLPLEQAVEAGVDAFMAAHGKIVSGFGHRFHP
FT                   VDPRAPRLLGLVEAARERGVVSGRFAEIGRTVEALLQRRKGRPIPMNIDGATAVIYAEL
FT                   GFSPPLGRGLFILSRSVGILAHAWEQTRQGGRIKGPMPPSVPYSYTGPAPRDFPG"
FT   gene            complement(53323..54600)
FT                   /locus_tag="Mnod_8312"
FT   CDS_pept        complement(53323..54600)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8312"
FT                   /product="L-carnitine dehydratase/bile acid-inducible
FT                   protein F"
FT                   /note="PFAM: L-carnitine dehydratase/bile acid-inducible
FT                   protein F; KEGG: rpi:Rpic_4040 L-carnitine dehydratase/bile
FT                   acid-inducible protein F"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8312"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62454"
FT                   /db_xref="GOA:B8IVL4"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL4"
FT                   /inference="protein motif:PFAM:PF02515"
FT                   /protein_id="ACL62454.1"
FT                   /translation="MTLPLAGVRVLDLSNVLAGPFCGYHLARLGAEVIKVENPKGGDLA
FT                   RRLGADPAMAERLMGLSFVAVNAGKQSVAIDFKAKAGKEIFLRLVEKADVVLENFRPKV
FT                   MERLGLGYDVLSERNPRLVYCAISGFGQSGPWQGRPAYDQIVQGLSGAMSVTGDAATAP
FT                   LRTGFPISDTIAGITAAFAISSALVEQRTTGRGRRIDVSLLEATLAAMGWVVSNHLNAN
FT                   VDPQPMGNENFTAAPSGTFQTASGPLNVAANEQKQYEALCDLVGRPDLKTDPRFAERQA
FT                   RKRNRAVLSAELNTALQARPAKEWEALFNASGIPAGCVLGVPEILREEQVVGRRFVETL
FT                   PETVKDAQPMRVTRPGFLLDEAYPVPAPPPRLGQDTERWLAELGYGANDIAALREQGTI
FT                   TSDNRPTVAPSAKLPEIKVRAETSSS"
FT   gene            complement(54656..56131)
FT                   /locus_tag="Mnod_8313"
FT   CDS_pept        complement(54656..56131)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8313"
FT                   /product="anion transporter"
FT                   /note="TIGRFAM: anion transporter; PFAM: sodium/sulphate
FT                   symporter; Citrate transporter; TRAP C4-dicarboxylate
FT                   transport system permease DctM subunit; KEGG: pfl:PFL_2538
FT                   anion transporter family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8313"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62455"
FT                   /db_xref="GOA:B8IVL5"
FT                   /db_xref="InterPro:IPR001898"
FT                   /db_xref="InterPro:IPR030676"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL5"
FT                   /inference="protein motif:TFAM:TIGR00785"
FT                   /protein_id="ACL62455.1"
FT                   /translation="MSSLGHQAALPVRTDKQSSQHGLDAALKRIGVPIALLAAVAIWLA
FT                   PTPDGLSVAGHKALALFGGIFALYLTEAIPLAVTSLLIVPAAALSGITSVRGALEGFSS
FT                   SSAYLIVGAFILATAMVKTRLAERITYLILSAIGSAPRRITLGVCLVNIVLAFLVPSST
FT                   ARTAILLPECLSILALYGATGRSTFAVNLLLTLTMTNATIGAGILTATVPNPVTVEFVA
FT                   KASGHTISYAEWLLYGFPPALLMTFATWALIQKVFPVDVDPAQADIDGTIRTNLAGLGR
FT                   MSAAEWRTFLVFSLVTLLWATQTFTQFDTTVVCLAGVVLLFLPGFGVITWEDANKGVSW
FT                   QVLLVAGGGISLGDILLKTGAAAWLANAIFHGLGLGGASTLVVIVVVMFIVQYLHVVFV
FT                   GTTAMATALLPIILGMAGTAQIDAVALALPAGMIIGGYPLLMFYNTLPSIIVHGTGRLR
FT                   VSDFPKVGIVICALACLVYALCAATYWRWLGLY"
FT   gene            56204..56446
FT                   /locus_tag="Mnod_8314"
FT   CDS_pept        56204..56446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8314"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8314"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62456"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62456.1"
FT                   /translation="MAEMPRRDFVGLSAKLVQIGGVGLSTFVPARGHLGYRIHGPFCGP
FT                   GPIANFQQAMTGRNEEKPRLQAATANLNACRRTKT"
FT   gene            57504..57926
FT                   /locus_tag="Mnod_8315"
FT   CDS_pept        57504..57926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8315"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: xau:Xaut_2572 DGPFAETKE
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8315"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62457"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL7"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACL62457.1"
FT                   /translation="MRVMVLVKATKDSEAGIMPSSELLEAMGKYNEELVNAGIMLAGEG
FT                   LKPSAQGKRVAFDGPSRTVTDGPFAETRELVAGFWLWEVRDMAEAVEWVKRCPNPMPGP
FT                   SEIEIRPVVEAADFGDAFTPELAEQEDRLRDRMAGR"
FT   gene            57986..58128
FT                   /pseudo
FT                   /locus_tag="Mnod_8316"
FT   gene            complement(58131..58883)
FT                   /locus_tag="Mnod_8317"
FT   CDS_pept        complement(58131..58883)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8317"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_7034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8317"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62458"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL8"
FT                   /inference="similar to AA sequence:KEGG:M446_7034"
FT                   /protein_id="ACL62458.1"
FT                   /translation="MILTALALKLKRQARGDFTSRHFEAMLIVQTVSWSLRDALSDRDI
FT                   EEMLLERDLTVDHSTINRWVLADAPSIERRLRQFRKPHRGPVRVDETSIRIRGQWRSLD
FT                   RAIDKHGEPVDFLLPAHRDLDAAKRFFRTMLQDQPLLAPDRIGTDGAGPDPPALAESRE
FT                   AGLLPRTPTHSVTKPLQQGSEGDHFRMKRPMPWVGGFQPFATARRTIQGFEAMRWLRKG
FT                   FGFAGAWTVCEQNQRLASCFGLPVANKA"
FT   gene            complement(59190..60128)
FT                   /locus_tag="Mnod_8318"
FT   CDS_pept        complement(59190..60128)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8318"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: met:M446_5617
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8318"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62459"
FT                   /db_xref="GOA:B8IVL9"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVL9"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACL62459.1"
FT                   /translation="MTKLTTRRDHLALLVAGVALGAGTRRASAQAVRWSAGTERPSITI
FT                   PLNATDCHHHIYDARFPPSPSATLRPPDASAEDYRQLQRRLGLTRNVVVQPSTYGIDNR
FT                   LLVESVRAFGDSARGIAMLDATVTSAELQRLHEAGIRGVRFGTRLPGGASMDDMEPVAR
FT                   KIAELGWHIQLVSEGEKIVELRDVLERLPVPVVFDHMGHLPEPAGPDHPAFRVIANLIE
FT                   TRGAWVKLTGAYILSKVGPPSYADRSRLARAYVKFAPERLVWGSDWPHPTSPVDAKPDD
FT                   AILLDLLADWAPDPKLQARILVSNPATLYGF"
FT   sig_peptide     complement(60039..60128)
FT                   /locus_tag="Mnod_8318"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.870 at
FT                   residue 30"
FT   gene            complement(60142..61062)
FT                   /locus_tag="Mnod_8319"
FT   CDS_pept        complement(60142..61062)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8319"
FT                   /product="SMP-30/Gluconolaconase/LRE domain protein"
FT                   /note="PFAM: SMP-30/Gluconolaconase/LRE domain protein;
FT                   KEGG: mrd:Mrad2831_4136 SMP-30/gluconolaconase/LRE
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8319"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62460"
FT                   /db_xref="InterPro:IPR005511"
FT                   /db_xref="InterPro:IPR011042"
FT                   /db_xref="InterPro:IPR013658"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM0"
FT                   /inference="protein motif:PFAM:PF08450"
FT                   /protein_id="ACL62460.1"
FT                   /translation="MSFFAPPPTVTAEIFTRLPDRFRKPRPTAWATANRGGHAIDSFLE
FT                   GPVFDRAGRLYVTDIPFGRIFRIDPNGTWELVAEYDGWPNGLKIHRDGRIFITCYKRGI
FT                   MLLDPEAGSVTPFLETAGSEGFRGVNDLTFAQNGDLYFTDQGQTGLQDPTGRVYRLRPS
FT                   GELTCLIDTVPSPNGIVIDSAMTNLFVAVTRAQQIWRIPLGTSGLVSKVGVFSQLHGGM
FT                   GGPDGIALDAEGCLVVAHTGFGSIWRLSPVAEPILRVKSPAGISTTNIAYGGPDHATLF
FT                   ITESQTGSILTARMPAPGQELFSHT"
FT   gene            complement(61168..62502)
FT                   /locus_tag="Mnod_8320"
FT   CDS_pept        complement(61168..62502)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8320"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_5619 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8320"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62461"
FT                   /db_xref="GOA:B8IVM1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62461.1"
FT                   /translation="MGGQDVSVPEQAPQSLEKATMRRVILRLVPFLMVCYFFALLDRVN
FT                   VGFAALQMNKDLGLTPAMFGFAASLFFVSYFLVEVPSNLALQRVGARRWIARIMITWGL
FT                   VTMGMALVIGPYSLYAMRFILGAAEAGFFPGAILYLTYWLPNEYRARILATFTVSIPLA
FT                   TFLGSPLSVSLLELDGVLGLKGWQWLFVLEGLPTVLLGICCLFLLTDKPRDAVWLSDAQ
FT                   REWLVGRLADEAARKKPIGHISLWQLARNRYFVTMALVCAGASATGSVLSVWQPQIIKS
FT                   FGLTNLQTGFVNAIPYGLATILMILWGRRSDRSGERTWHTAIPLMLAAFGLSYLNLSGG
FT                   IVTTIVAVSCALVGAYAFKGPFWALSAGWLSAGTLAAGLAGINAIANLIGGGLMVNIVG
FT                   LVKEATGSFALGMLPVAALDAAAAVCVLMISRAHARDARAAAALA"
FT   gene            complement(62579..63253)
FT                   /locus_tag="Mnod_8321"
FT   CDS_pept        complement(62579..63253)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8321"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   met:M446_5620 dimethylmenaquinone methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8321"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62462"
FT                   /db_xref="GOA:B8IVM2"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM2"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ACL62462.1"
FT                   /translation="MSIGFKIHPRTRKVDEATVEKFKAIAVANISDSMNRMVHGGPRLR
FT                   PLHAGGVLAGAALTIKQRPGDNLMVHAALNRASAGDVLVVDAGGDLTNAIMGELMLAHA
FT                   QQIGVAGVIVNGAVRDHGWIRANSLPVFAAGITHRGPYKNGPGEINATIALDGMVIQPG
FT                   DLIVGDDDGIVCVPFDQTEAVFAAANKKQQDEAKTMAAIKAGTVDRSWVERALRDAGCE
FT                   GI"
FT   gene            complement(63298..64212)
FT                   /locus_tag="Mnod_8322"
FT   CDS_pept        complement(63298..64212)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8322"
FT                   /product="Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like protein"
FT                   /note="PFAM: Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like; KEGG: mrd:Mrad2831_4139 phosphogluconate
FT                   dehydrogenase, NAD-binding, putative-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8322"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62463"
FT                   /db_xref="GOA:B8IVM3"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM3"
FT                   /inference="protein motif:PFAM:PF09130"
FT                   /protein_id="ACL62463.1"
FT                   /translation="MADRKQFRLGLVGYGEIGSTLGAGLRGAGLESIACYDKYAFDGPY
FT                   ADLIQSRARDAGVTLVRSNAELADASDLIFSVTPGASSLESADAFAPVLTNRHTFLDFA
FT                   SATPKIKRSVADKLAASGALLGDGSIEGTPLHGYSMRMLSSGPAGERVRDLLVPWGMQI
FT                   EFMGPVLGTASGIKILRSVLIKGIEALTDEMLLAARQYGIDEIVLASASKTLARPWMDT
FT                   VQSLTPSGAIHAKRRAEELEMSADAVQDAGVEPIMARAVAKRLRWKESLGLKDHFKGVV
FT                   PRTYQEALDAMELKAGLKRSEPA"
FT   gene            complement(64243..67311)
FT                   /locus_tag="Mnod_8323"
FT   CDS_pept        complement(64243..67311)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8323"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   met:M446_5622 FAD linked oxidase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8323"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62464"
FT                   /db_xref="GOA:B8IVM4"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM4"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACL62464.1"
FT                   /translation="MIPRLSPEPVTLSVYAVFCAELRARGFAGDLSVGAADRTVAATDN
FT                   SIYQLTPQAIAFPRGLDDLVRIATLLGEERFTEVRIAPRGGGTGTNGQSLTDGLVVDLS
FT                   RHMNRIVAIDPERRTARVEAGVVKDQLNAALKPFGLFFAPELSTSNRATIGGMISTDAC
FT                   GQGSCLYGKTRDHVLELTTVLSDGTVWHSGPLDEAELAAIQARSDRVGIIHRDVDRLQR
FT                   ENAALITERFPPLNRCLTGYDLAHIRRADGRFDLNAVLCGSEGTLGFLAEATLNVLPLP
FT                   SHAALVNLRYGSFDAALRDAQALVSFGAASIETVDSTVLALAQGDLIWEGVASFFPENG
FT                   GERAHGVNLIEFVGNSGAEVEEAVGRLTAALDAAGPVGGRRGYTVARGEMDVDRIWDMR
FT                   KKSVGLLGGMKGDKRPIAFVEDTAVPPENLADFIAEFRAALDRRGLDYGMFGHVDAGVL
FT                   HVRPAIDMKAPGAEALIREVTEDVVALTQRYGGLLWGEHGKGVRSEFSPRFFGPLYPVL
FT                   QSVKAAFDPRHQFNPGKIAVPEGGTLLTVDGVPTKGQRDRAIPPGVRAGYDEALHCNGN
FT                   GACFNWDPDDAMCPSWKGTRERRHSPKGRAQLMREWLRRLAAEGCDPLVEAIRLRARPG
FT                   WLAFPGRLVATLRRREDDFSHEVHEAMAGCLACKSCTGQCPIKVDVPSFRAKFLELYHG
FT                   RYLRPLRHHVVASLEALVPWLAKAPRLVNRATSLGLADAIGLVHTPRLSGLNLGREIER
FT                   RGVALANAEVLAKLSASERLMSVVVVQDAFTSYYETPVLLALLDLLIGIGVRPWLAPYR
FT                   PNGKPLHVHGFLGRFERRASASATDLGRLAATGVALIGLDPSMTLTYRSEYPQALPGRD
FT                   VPRVQLVQEWLTGRLERAPRTPDRETYWLLPHCTERATAPPAVAAWSTVFAAFGLGLST
FT                   LPSGCCGMAGTFGHEAEHRAMSERIYGLSWAAPVAEKGRSGRLVADGYSCRLQAKLIDG
FT                   VRLPHPVEILHAHVAAGAEVVAAAKRSPAEARR"
FT   gene            complement(67316..68650)
FT                   /locus_tag="Mnod_8324"
FT   CDS_pept        complement(67316..68650)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8324"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: met:M446_5623 major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8324"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62465"
FT                   /db_xref="GOA:B8IVM5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62465.1"
FT                   /translation="MAWGRPAEPAFAQTAAVDEHALYRKMLRRILPFLFICYVVSYLDR
FT                   VNVGFAALTMNKDIDLSATAFGVGAGLFFFGYFVAEIPSNLIMMRVGARLWIARIMITW
FT                   GLVSAATAFVTGPVQFGIARFLLGLGEAGFVPGVFLYLSMWFPSAVRARATALFLLGIP
FT                   VANIVGSPISGALVQLEGFGLKGWQWLLVLEAAPAVILGVACLLVLTDKPEKAAWLSAP
FT                   ERDFLVSRLASEKAAIEKKHNLTLAQALRNWRVLTLATINFCAIIGSLGIGLWLPQIIK
FT                   QLGLATSVVGFVTAIPYLCGAIAMVVWGRMSDRGSDRTIYPAISLFVGSAALVASAFTS
FT                   SPLLTIVALCIAVVGINSFVATFWAVPSSFLTGRAAAGGIAMIVSIGNLGGFVGPYMIG
FT                   FVRDLSGGFTAPLVAVGCSLLFGATLMVVFGRLVRRDDVATAIPA"
FT   gene            69126..69830
FT                   /locus_tag="Mnod_8325"
FT   CDS_pept        69126..69830
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8325"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="PFAM: regulatory protein IclR; Transcriptional
FT                   regulator IclR; KEGG: met:M446_5624 IclR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8325"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62466"
FT                   /db_xref="GOA:B8IVM6"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM6"
FT                   /inference="protein motif:PFAM:PF09339"
FT                   /protein_id="ACL62466.1"
FT                   /translation="MPKEARKRPKLEGVASAERVLTVLTAFRRGDDALELSELARRTSL
FT                   VKSTIMRLCISLEKFDLIERLDDGRYRLGVEAARIGSVYQQSFALEERVVPVLERLAAE
FT                   SLETASFYIRRGNQRLCLFRADSPYPLRMNVRPGDMRPMDNSAIAQVLSIFGDRMLPKQ
FT                   NDVKLPIYTSGVTDPHVASLAMPIFGTERRLIGALALSGPSSRLTAEQASVLEPRLRDA
FT                   AERLSSELGAQL"
FT   gene            69929..70147
FT                   /pseudo
FT                   /locus_tag="Mnod_8326"
FT   gene            70167..70561
FT                   /pseudo
FT                   /locus_tag="Mnod_8327"
FT   gene            complement(70563..71495)
FT                   /locus_tag="Mnod_8328"
FT   CDS_pept        complement(70563..71495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8328"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rec:RHECIAT_CH0002506 probable
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8328"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62467"
FT                   /db_xref="GOA:B8IVM7"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM7"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62467.1"
FT                   /translation="MLRESLNDLFAFIAVARTGSFTRAAAQLGVSQPALSQTVRGLEAR
FT                   LGVRLLTRTTRSVAPTEAGERLLKAVGPRFAEIEAGLAMLAELRGKPAGTVRITATEHA
FT                   ANTVLWPTLKRVLPEYPDIKVEIAVDYGLTDIVAERFDAGVRYGGTVAKDMTAVRIGPD
FT                   VRMAAVAAPAYFAGRSKPERPEDLTIHDCINLRLPTRGGLYAWEFEKDGRELRVWVEGQ
FT                   LVFNTVTLILLAALDGFGIAYLPEDGVQAHLDTGALVRVLEDWCEPFSGYHIYYPSRRQ
FT                   PAQALAVLVEALRWKSDRVEPARRGQARA"
FT   sig_peptide     complement(71418..71495)
FT                   /locus_tag="Mnod_8328"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.652) with cleavage site probability 0.371 at
FT                   residue 26"
FT   gene            71628..72050
FT                   /locus_tag="Mnod_8329"
FT   CDS_pept        71628..72050
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8329"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bbt:BBta_2281 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8329"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62468"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM8"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL62468.1"
FT                   /translation="MEIKRLGSQPSGKGPQEWFTGTVRVDPLFGSSEPARTSGALVTFE
FT                   PGARTAWHTHPLGQTLIVTAGCGWVQREGGPIEEIRPGDVVWFEPGEKHWHGATATIAM
FT                   SHIAIQEALNGSPVEWMEKARDDQYASPVAPASGQH"
FT   gene            72100..72867
FT                   /locus_tag="Mnod_8330"
FT   CDS_pept        72100..72867
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8330"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: bid:Bind_1760 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8330"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62469"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVM9"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL62469.1"
FT                   /translation="MSVTYSFEGQVALVTGAAMGMGLATAKAFAEAGAAVVLSDTNADA
FT                   LKSATEGLKAAGHRVLGVRCDVANEAEVASMIERTVETFGRLDAAFNNAGIQIPPADIV
FT                   DVPSEDYERVMAVNLRGVWNCMKHELRQMQAQGSGAIVNCSSIGGLKGLEFLAAYHGTK
FT                   HGVIGLTKCAALENAARGIRVNAVCPGTIDTPMVAAMVTERPEAMAEIIKKQPIGRLGR
FT                   PEEVASAVLWLCSDASSFVLGVALSVDGGFAAH"
FT   sig_peptide     72100..72192
FT                   /locus_tag="Mnod_8330"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.968) with cleavage site probability 0.704 at
FT                   residue 31"
FT   gene            72867..73376
FT                   /locus_tag="Mnod_8331"
FT   CDS_pept        72867..73376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8331"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ank:AnaeK_3353 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8331"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62470"
FT                   /db_xref="InterPro:IPR029000"
FT                   /db_xref="InterPro:IPR041183"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN0"
FT                   /inference="protein motif:COG:COG4925"
FT                   /protein_id="ACL62470.1"
FT                   /translation="MGRPMRRGMWTATLLTTTALVVLAAQAGLHGEPGPDRRPSSPTSQ
FT                   RGHAMESVRILLAGESVTATLEDGEAARAFKALLPLTLSLTDYNATEKISDLPKRLPTQ
FT                   GAPAGFDPEPGDLAYYAPWGNLAVFYKDFGYSRGLVRLGKLSRIPEAFRGPGPVTVTIE
FT                   AVTSRE"
FT   sig_peptide     72867..72941
FT                   /locus_tag="Mnod_8331"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.867 at
FT                   residue 25"
FT   gene            73402..74460
FT                   /pseudo
FT                   /locus_tag="Mnod_8332"
FT   gene            74542..75315
FT                   /locus_tag="Mnod_8333"
FT   CDS_pept        74542..75315
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8333"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: npu:Npun_R0578 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8333"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62471"
FT                   /db_xref="GOA:B8IVN1"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL62471.1"
FT                   /translation="MTTIQNDGFAGKVAFVTGATSGIGRATALAFARAGASVALADVSQ
FT                   EGSREAARIIEEAGGRVLAVRCDVSKAEDVKAALDRTVETFGGLDFAFNNAGVEQPVMA
FT                   AADIADEDFDRIVAVNLRGVFLCMKHQIPLMLRGGGGAIVNTSSGAGVKGFAGQAAYTA
FT                   TKHGVIGMTKCAALDYAKENIRVNAICPGIIDTPMMQRFTGGTPEGVARVVAQEPVGRM
FT                   GKPEEIAAAVLYLCSAPAAFVTGHAMVVDGGQTVG"
FT   gene            complement(75328..76221)
FT                   /locus_tag="Mnod_8334"
FT   CDS_pept        complement(75328..76221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8334"
FT                   /product="transcriptional regulator, LysR family"
FT                   /EC_number="4.2.1.1"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bja:blr5548 transcriptional
FT                   regulatory protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8334"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62472"
FT                   /db_xref="GOA:B8IVN2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN2"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62472.1"
FT                   /translation="MARENLTDLLSFTTVAQEGSFTRAAARLGVTQSALSHAMNGLEAR
FT                   LGLQLLNRSTRSVSPTEAGERLLRIVGPQFEQIEVELSALTELRETPAGTVRITAPEHA
FT                   AETVLWPALERLLPDYPDITVEVVTEQSLTNIVAERFDAGVRIGEHVEKDMVAVRIGPP
FT                   MRIAVVGAPAYFQGRPKPKQPEDLTAQRCINLRRPTRGGFYPWEFGRAGRELAVRVEGQ
FT                   LVFTSLHLIRNAALAGLGLAYLPEDQVQAQVAEGRLVRVLEDWCEPFPGYHLYYPSRRQ
FT                   AAPAFTVLVEALRHRG"
FT   gene            76389..77024
FT                   /locus_tag="Mnod_8335"
FT   CDS_pept        76389..77024
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8335"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: met:M446_0292 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8335"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62473"
FT                   /db_xref="GOA:B8IVN3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN3"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACL62473.1"
FT                   /translation="MDGSNAFELNRRDLMVGASATAALGAMPLAAGAKPAGTERPNLAK
FT                   VVFTVNGEQRELELDIRTSLLDAVREHLHLTGSKKGCDHGQCGACTMIVDGRRINACLT
FT                   LAVMHQGSEVTTIEGLGQPENLHPMQAAFIKHDGYQCGYCTPGQICSGVAVLAEIKAGI
FT                   PSHVTADLTATPEVTETEIRERMSGNICRCGAYSNIVAAMTEVAGRQA"
FT   sig_peptide     76389..76490
FT                   /locus_tag="Mnod_8335"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.980) with cleavage site probability 0.801 at
FT                   residue 34"
FT   gene            77021..77971
FT                   /locus_tag="Mnod_8336"
FT   CDS_pept        77021..77971
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8336"
FT                   /product="molybdopterin dehydrogenase FAD-binding"
FT                   /note="PFAM: molybdopterin dehydrogenase FAD-binding; KEGG:
FT                   met:M446_0293 molybdopterin dehydrogenase FAD-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8336"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62474"
FT                   /db_xref="GOA:B8IVN4"
FT                   /db_xref="InterPro:IPR002346"
FT                   /db_xref="InterPro:IPR005107"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="InterPro:IPR036683"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN4"
FT                   /inference="protein motif:PFAM:PF00941"
FT                   /protein_id="ACL62474.1"
FT                   /translation="MRSFTYERPSTPAEAAAAVARTPGAKFIAGGTNLLDLMKLQIETP
FT                   THLVDVNGLSLDRIEPTPEGGLRIGALMRNTDLAADPRVRKDYAVLSRALLAGASGQLR
FT                   NKATTAGNLMQRTRCPYFYDTAQPCNKRQPGSGCSALDGVSRQLAVIGGSDACIATNPS
FT                   DMAVAMRVLDATVETVDAKGAERTIPMAEFHRLPGDTPEVDTTLKPGELITAVTLPKPL
FT                   GGAQVYRKVRDRASYAFALVSVAAVVQPDGTGRVAFGGLAHKPWRVEAAEADLPRGAKA
FT                   VAARLLDGAKPTHDNAFKLKLAERTLGAALKQARA"
FT   gene            77975..80194
FT                   /locus_tag="Mnod_8337"
FT   CDS_pept        77975..80194
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8337"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   a/b hammerhead; aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: met:M446_0294 aldehyde oxidase
FT                   and xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8337"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62475"
FT                   /db_xref="GOA:B8IVN5"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR036856"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN5"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACL62475.1"
FT                   /translation="MKFDTPAGTNPIDQLKVVGRATDRIDGKYKTTGTAPYAYERHDVV
FT                   PNQAYGYVLGTGIAKGRVRAMHVEEARQAPGVLAVVTTLDTPRLGRGMLNAAYLFGGPE
FT                   VQHYHQAIAVVVAETFEQARAAAFLIRVDYAPEVGRFDLAAETPSAPPVGGDSGEGSGS
FT                   SGKERVGDFDGAFAQAPVTLDETYTTADESHAMMEPHATIAAWEGDKLTLWTSNQMIAW
FT                   AKGSIAKILGIPKQNVRVDSPYVGGGFGGKLFVRADAVLAALGAKAAQRPVKVALTRPL
FT                   IPNNTTHRPATIQRIRIGATKDGTITAIAHESTSGNLPDGSPETAVDQTKLLYAGANRL
FT                   TALRLAHLDLPEGNAMRAPGEAPGMMALEIAIDEMAEKLGLDPVEFRIRNDTQVDPNQP
FT                   GRRFSHRDLVGCLRLGAERFGWAKRNPIPGQARDGQWLVGIGMAAGFRNNLLGKSGARV
FT                   RLDAGGTVTVETDMTDIGTGSYTIIAQTAAEMMGVPLDTVVVRLGDSDFPASAGSGGQW
FT                   GANNSTAGVYAACVQLREAVAQRLGINSADAVFADGQVRSGNRVVPLGEAARAGELTAE
FT                   DAIEYGDLSKKQQQSTFAGHFVEVGVDVDTAEVRVRRMLAVCAAGRILNPKSARSQVIG
FT                   GMTMGVGAALMEKLSVDRRRGFFVNHDLAGYEVPVHADIPHQEVIFLDEVDPMSSPMKA
FT                   KGVGELGLCGVGAAVANAVYNATGVRVRDYPITVDKLLDRMPDAA"
FT   gene            80215..80688
FT                   /locus_tag="Mnod_8338"
FT   CDS_pept        80215..80688
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8338"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bxe:Bxe_B1954 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8338"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62476"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN6"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL62476.1"
FT                   /translation="MRAMTALATSLLLVAAAAAVAAEGTVTVQRSGSQPSAKGAAGQFT
FT                   GSVRVDPLLREAPPLRMSGALVTFEPGARTAWHTHPLGQTLIVTAGAGRVQQWGGPIQE
FT                   IQPGDVVRIPPGVKHWHGAAATAGMSHIAIAEALDGKVVDWMEHVTDTQYRGE"
FT   sig_peptide     80215..80280
FT                   /locus_tag="Mnod_8338"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.965 at
FT                   residue 22"
FT   gene            80732..81454
FT                   /locus_tag="Mnod_8339"
FT   CDS_pept        80732..81454
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8339"
FT                   /product="putative 5-amino-6-(5-phosphoribosylamino)uracil
FT                   reductase"
FT                   /note="KEGG: bra:BRADO2375 putative
FT                   5-amino-6-(5-phosphoribosylamino)uracil reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8339"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62477"
FT                   /db_xref="GOA:B8IVN7"
FT                   /db_xref="InterPro:IPR002734"
FT                   /db_xref="InterPro:IPR024072"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN7"
FT                   /inference="similar to AA sequence:KEGG:BRADO2375"
FT                   /protein_id="ACL62477.1"
FT                   /translation="MRPKIICHMVSSIDGRLHPSRFTVPAAGVDGDRLRRHYDEVAARF
FT                   GAQGWMVGRKTMQEIAKGAARTPAGAGVSSREPFVGNRKGRDLAVAIDPHGRVHYGQDH
FT                   VLGDHVVAVLSEAVSDAYLAELREDGVSYLFAGPDGTDLRRAMDALGQTFGVETILLQG
FT                   GASINGAFLKQRLIDEISLLIQPAIDGLAGVPSIFGYEGSADERPGAGQALRHLHTETL
FT                   EGGMVWLRYRVEDAPALG"
FT   gene            complement(81745..81945)
FT                   /locus_tag="Mnod_8340"
FT   CDS_pept        complement(81745..81945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8340"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_1886 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8340"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62478"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62478.1"
FT                   /translation="MILTALALKLKRQAHGDFKGRHFEAALIVQAVFWSLRCALSLGNE
FT                   LADPPLAIAMCRSASSRSAMM"
FT   gene            complement(82110..82637)
FT                   /pseudo
FT                   /locus_tag="Mnod_8341"
FT   gene            82805..82996
FT                   /locus_tag="Mnod_8342"
FT   CDS_pept        82805..82996
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8342"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8342"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVN9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62479.1"
FT                   /translation="MKRALIIFAAPLLMTAGTSCAYAKDPWKKYYKQEMKQEKEFYKAR
FT                   RKSEKAWHKYHKKYGYDW"
FT   sig_peptide     82805..82876
FT                   /locus_tag="Mnod_8342"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.982 at
FT                   residue 24"
FT   gene            complement(82984..83496)
FT                   /locus_tag="Mnod_8343"
FT   CDS_pept        complement(82984..83496)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8343"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4687 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8343"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62480"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62480.1"
FT                   /translation="MPETSHLRFVGHAASPAAEAAPPPSLLINDDVQYLLRRFASLSVR
FT                   AQELDDPEMAGWLDRAGLLAVAARLRAQDGIDLAVAGLSCVQRPDRQVFVRPLVTAPCL
FT                   AGWGSKGSVTAATIGLKLVAQVKAPRRPAWLSGTPPNGALLSPPGPAVAGSSRLADPPD
FT                   MVRSYQS"
FT   gene            83635..83859
FT                   /locus_tag="Mnod_8344"
FT   CDS_pept        83635..83859
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8344"
FT                   /product="addiction module antidote"
FT                   /note="TIGRFAM: addiction module antidote; PFAM: SpoVT/AbrB
FT                   domain protein; KEGG: lch:Lcho_1578 addiction module
FT                   antidote"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8344"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62481"
FT                   /db_xref="GOA:B8IVP1"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR013432"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP1"
FT                   /inference="protein motif:TFAM:TIGR02609"
FT                   /protein_id="ACL62481.1"
FT                   /translation="MLALKLTAIGNSVGVILPKEALSRLKLDKGDTVYLTETPDGYRIT
FT                   PYNEEFETQMKAAREIMRQNRDVLRELAK"
FT   gene            83870..84250
FT                   /locus_tag="Mnod_8345"
FT   CDS_pept        83870..84250
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8345"
FT                   /product="death-on-curing family protein"
FT                   /note="TIGRFAM: death-on-curing family protein; PFAM:
FT                   filamentation induced by cAMP protein Fic; KEGG:
FT                   lch:Lcho_1579 death-on-curing family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8345"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62482"
FT                   /db_xref="GOA:B8IVP2"
FT                   /db_xref="InterPro:IPR003812"
FT                   /db_xref="InterPro:IPR006440"
FT                   /db_xref="InterPro:IPR036597"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP2"
FT                   /inference="protein motif:TFAM:TIGR01550"
FT                   /protein_id="ACL62482.1"
FT                   /translation="MPIWIIKEVVLAVHDEQLAEHGGSSGVRDEGALDSALARPQNKEA
FT                   YGCTDIMELAAAYAFGVARNHPFIDGNKRTSFVVTLLFLHMNGFVLTAPQSDRVTTWLS
FT                   IAAGEMDEAAIAAWLRANTRPI"
FT   gene            84358..84504
FT                   /locus_tag="Mnod_8346"
FT   CDS_pept        84358..84504
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8346"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: sgr:SGR_4402 ArsR family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8346"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62483"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP3"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62483.1"
FT                   /translation="MDLDPLFKALADPTRRRLLDELALRDGQTLFELHARLVRCRNGPA
FT                   ARV"
FT   gene            84595..85929
FT                   /locus_tag="Mnod_8347"
FT   CDS_pept        84595..85929
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8347"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   xau:Xaut_4843 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8347"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62484"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Y5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62484.1"
FT                   /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLSA
FT                   ILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPDFR
FT                   TIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGRMKA
FT                   AESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKAALEA
FT                   EAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRDGFVQG
FT                   YNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGFATEANL
FT                   AALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRYRLRKQVV
FT                   EPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
FT   gene            86018..86875
FT                   /locus_tag="Mnod_8348"
FT   CDS_pept        86018..86875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8348"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   swi:Swit_5050 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8348"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62485"
FT                   /db_xref="GOA:B8ICV5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICV5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62485.1"
FT                   /translation="MSARLEWMNGPSLVWTAANRPRYDRRSQRYPSDMTNDEWLTLEPL
FT                   LPVAEGIGRPRTYPIRDIMNGIRYVQRYGIPWDAMPKDLPPASLCYDYWRLLTDGGHMD
FT                   RINHHLVMRDREKSGKEASPTLAIVDAQAVKCDAPQGERGYDAAKQVLGRKRHLAVDSD
FT                   GRLLAVMITPANVQDQEGGIPLVKRLVRLCPWIKTIVVDGGYKARFIEAVQAGTSRVVE
FT                   VVVRPQFGKGFVLLPKRWRIEQSIGALTVSRRLKLDYDTLLHISAAAMLFASITRLLAS
FT                   ITMK"
FT   gene            complement(86894..87207)
FT                   /pseudo
FT                   /locus_tag="Mnod_8349"
FT   gene            complement(87603..87887)
FT                   /locus_tag="Mnod_8350"
FT   CDS_pept        complement(87603..87887)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8350"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_3970 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8350"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62486"
FT                   /db_xref="InterPro:IPR038721"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62486.1"
FT                   /translation="MSDADPHAQDLDTWLAPFLAVMSRKTRRRWAPFYLRGLLGPGGRV
FT                   SRQPIGRRLELSGDDQLQYFIASLEGGFLWTVVLLEAAHAGGRPSGRAR"
FT   gene            88345..88713
FT                   /locus_tag="Mnod_8351"
FT   CDS_pept        88345..88713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8351"
FT                   /product="SPW repeat-containing protein"
FT                   /note="KEGG: mrd:Mrad2831_0406 SPW repeat-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8351"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62487"
FT                   /db_xref="GOA:B8IVP7"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP7"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_0406"
FT                   /protein_id="ACL62487.1"
FT                   /translation="MRAIENENGGIFLNGLCVACGVILSLMPWYLELGSGTYAARNAWI
FT                   CGGLIAIVGLMAISLSYDWEEYLNLAIGLWVAVAPWVLGFAAVTHAMWTHVVVGVTVAA
FT                   LAGLELWRLYQVPTARSV"
FT   gene            88855..89229
FT                   /locus_tag="Mnod_8352"
FT   CDS_pept        88855..89229
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8352"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8352"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62488"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62488.1"
FT                   /translation="MRVVGIVLSGYGNDGAEDLRVMPGVALTYWYELLVRAGAALKLCH
FT                   TTGWRLFAHSDRHMSRPAYETVRLPSGEHSAKDYCWIRNFNFPGYGRRGHAPAMDVWAM
FT                   NVWGCPKRPATLIRSAARIS"
FT   gene            89371..90411
FT                   /locus_tag="Mnod_8353"
FT   CDS_pept        89371..90411
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8353"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   rsp:RSP_4010 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8353"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62489"
FT                   /db_xref="GOA:B8IVP9"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVP9"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ACL62489.1"
FT                   /translation="MFSLAPHSASSWLKNLNVLSKTTEYFPGVLFSVTIGMAATFVSGA
FT                   YGGPTVLFALLLGMAFNFISTESRLAPGVVFSARTILRIGVAALGARITAEQVLGLGWS
FT                   TLVGVAAAVALTIGFGMAAARLLGLKTQFGVLTAGAVAICGASAAAAIAAVLPRHEMHE
FT                   RDTVFTIIAVTTLSTIAMVVYPVVSRMFHFSHADAGVFLGGTIHDVAQVVGAGYSVSPE
FT                   TGDIATIIKLLRVALLVPAVLSISILTSRIQAGAGPAAKPPALVPSFLVAFIVIVILNS
FT                   FHFIPPIVQSTLSDLSRWCIVIAIAALGAKTSLAALAQVGHRAMALMVAETAFIALFVL
FT                   VLVHVG"
FT   sig_peptide     89371..89514
FT                   /locus_tag="Mnod_8353"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.670) with cleavage site probability 0.521 at
FT                   residue 48"
FT   gene            complement(90627..90818)
FT                   /pseudo
FT                   /locus_tag="Mnod_8354"
FT   gene            complement(90805..91532)
FT                   /pseudo
FT                   /locus_tag="Mnod_8355"
FT   gene            91880..92935
FT                   /locus_tag="Mnod_8356"
FT   CDS_pept        91880..92935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8356"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: har:HEAR3441 putative
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8356"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62490"
FT                   /db_xref="GOA:B8IVQ0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ0"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACL62490.1"
FT                   /translation="MFLRQFEYLLAVADEEHFGRAADRCHVTQPTLSVAIKHLESELGV
FT                   QIFVRGRGHRLHGLTPDGELIIKWARKVVTLCEGMRAEIAAKHGNSPSRLRVGVTPSMS
FT                   PVLPVLLQLVRAEHPEIITDVHCINNEVIRTGLSKLLLDVAFTYLDDDEVGRYKTLKIC
FT                   TEKLSLLVPDVAEFADQTSISWHEAAKMPLALLRPNLHERHFIDGVFASVGCHPMVRAE
FT                   SGSIMHLMFQVQFGGLCTIIPEHFTLMPGLHRGTKALQLIDPVVSREVGLLWAEDEVMT
FT                   PLANLLVSAMKDLNKRGGLETILMNIGLEPCFRGQRDAHAPSIGAPFLASPECDLATAR
FT                   SKPPSDEIVWL"
FT   gene            93203..94273
FT                   /locus_tag="Mnod_8357"
FT   CDS_pept        93203..94273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8357"
FT                   /product="putative transposase"
FT                   /note="KEGG: met:M446_5589 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8357"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62491"
FT                   /db_xref="GOA:B8IVQ1"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ1"
FT                   /inference="similar to AA sequence:KEGG:M446_5589"
FT                   /protein_id="ACL62491.1"
FT                   /translation="MAQTVCVIPSDADLARLSAIVNDRARPLKHLQCAHIILLSAERLA
FT                   VLEVAQRAGVSRPAVWRWQQRYAEEGVDGLLRDKTRPPGKPPHSTDTVAEVLALTCSEP
FT                   PGAVTHWTGRAVADTVGISLRSVQRIWDAHRLQPHRVRSFKRSSDPAFAEKVEDIVGLD
FT                   MDPPRHAVVLSLDETSQIQALERTRPSRAVKPGRPETQTHDDHRHGTTTLFAALNVLEG
FT                   TVIGRCMQRHRHDEFLRFLNTIEAAVPGGEADPRDPGQLCYPQAPESARLAGAASALDL
FT                   PLLPDLWLVDNAVEGFFSALTQRRLRRGSFSGIVDLQAAINRSIAEHNDRPKPFVWTKP
FT                   AAAIFDAVNRNAAPSV"
FT   gene            complement(94379..97345)
FT                   /locus_tag="Mnod_8358"
FT   CDS_pept        complement(94379..97345)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8358"
FT                   /product="formate dehydrogenase, alpha subunit"
FT                   /note="TIGRFAM: formate dehydrogenase, alpha subunit; PFAM:
FT                   ferredoxin; 4Fe-4S ferredoxin iron-sulfur binding domain
FT                   protein; molybdopterin oxidoreductase; molydopterin
FT                   dinucleotide-binding region; molybdopterin oxidoreductase
FT                   Fe4S4 region; KEGG: met:M446_3266 formate dehydrogenase,
FT                   alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8358"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62492"
FT                   /db_xref="GOA:B8IVQ2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR006478"
FT                   /db_xref="InterPro:IPR006655"
FT                   /db_xref="InterPro:IPR006656"
FT                   /db_xref="InterPro:IPR006657"
FT                   /db_xref="InterPro:IPR006963"
FT                   /db_xref="InterPro:IPR009010"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR041924"
FT                   /db_xref="InterPro:IPR041925"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ2"
FT                   /inference="protein motif:TFAM:TIGR01591"
FT                   /protein_id="ACL62492.1"
FT                   /translation="MSSGTQNSNPAGSDPLVTGPSAPQDAGGSGGRPQAGGASSQGTKA
FT                   GGQAGPAPSGTLSLREMPAGIPGVVFELDGEPVEARPGETLWAVAQRLGNPIPHLCHKP
FT                   APGYRPDGNCRACMVEIEGERVLAASCKRVPAVGMKVKTQSDRAVKARAMVMELLVADQ
FT                   PERATSHDPDSHFWAQADGVGVTQSRFPSEARWQPDASHPAMRVNLDACIQCNLCVRAC
FT                   REVQVNDVIGMAYRNADAKVVFDFDDPMGQSTCVACGECVQACPTGALMPAAYLNEAQE
FT                   RVVYPDRAVDSLCPYCGVGCQVSYKVKDDRIVYAEGIDGPANHNRLCVKGRFGFDYVHH
FT                   PHRLTRPLIRLDNVPKDANDQVDPANPWTHFREATWEEALERAAGGLRRIREAHGRHAL
FT                   AGFGSAKGSNEEAYLFQKLVRLGFGSNNVDHCTRLCHASSVAALMEGLNSGAVSAPFSA
FT                   ALDAEVIVIIGANPTVNHPVAATFIKNAVKERGAKLIIMDPRRQVLSRHAHRHLAFKPG
FT                   TDVAMLNAMLNVIVAEGLTDQQYIAGYTENFDALKERIREFTPERMAPVCGIPAETLRE
FT                   VARLYARSRASIIFWGMGVSQHVHGTDNSRCLIALALTTGQIGRPGTGLHPLRGQNNVQ
FT                   GASDAGLIPMVYPDYQSVEKKAVRELFETFWGQSLDPQQGLTVVEIMKAIHAGEIRGLY
FT                   VEGENPAMSDPDLNHARGALARLDHLVVQDLFLTETAFHADVVLPASAFAEKAGTFTNT
FT                   DRRVQMARPVVPPPGEARQDWWIIQELARRMGLAWDYRGPADVFAEMTRVMPSLKNITW
FT                   ERLEREGAVTYPVDAPDEPGNEIIFYAGFPTESGRAKIVPAAIVPPDEVPDSEFPMVLS
FT                   TGRVLEHWHTGSMTRRAGVLDALEPEAVAFLAPRELGRLGVGPGDRIRLETRRGAVEVT
FT                   VRSDRDVPEGMVFMPFCYAEAAANLLTNPALDPLGKIPEFKFCATRVVPLAASSIAAE"
FT   gene            complement(97377..99080)
FT                   /locus_tag="Mnod_8359"
FT   CDS_pept        complement(97377..99080)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8359"
FT                   /product="Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit"
FT                   /note="PFAM: Respiratory-chain NADH dehydrogenase domain 51
FT                   kDa subunit; KEGG: met:M446_3267 respiratory-chain NADH
FT                   dehydrogenase domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8359"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62493"
FT                   /db_xref="GOA:B8IVQ3"
FT                   /db_xref="InterPro:IPR001949"
FT                   /db_xref="InterPro:IPR011538"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="InterPro:IPR019575"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR037207"
FT                   /db_xref="InterPro:IPR037225"
FT                   /db_xref="InterPro:IPR041921"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ3"
FT                   /inference="protein motif:PFAM:PF01512"
FT                   /protein_id="ACL62493.1"
FT                   /translation="MSRVQRFEHPGRGRERARPVPKGRQVDPRAKAEIAALLGEAPRRR
FT                   DLLIEHLHLIQDTYGQISAPHLAALADEMGLAFAEVFETATFYAHFDVVKEGEAAVPAL
FT                   TVRVCDSLTCAMHGAEALLATLQAEIGGPVRVVRAPCVGLCDHAPAAEVGHNFLPRATP
FT                   ERVKAAVAAGDTHPHIPDYVDYDAYRAAGGYRTLERLRAGELTVEAVLAILDDGALKGL
FT                   GGAGFPTGRKWRSVRGEPGPRLMAVNGDEGEPGTFKDQLYLNTDPHRFLEGTLIGAHVV
FT                   EAAEIYLYIRDEYPIARAILARELAKLPPGGPRIHLRRGAGAYICGEESSMIESLEGKR
FT                   GLPRHKPPFPFQVGLFGRPTLINNVETLYWVRDLIEKGAAWWKSHGRNGRTGLRSYSVS
FT                   GRVAAPGVKLAPAGLTIRELIDEFCGGMAAGHRFAAYLPGGASGGILPAAMDDIPLDFG
FT                   TLEKYGCFIGSAAVVVLSDQDDLRGAALNLMRFFEDESCGQCTPCRVGTRKARRLMEQG
FT                   VWDTDLLGELSQCMRDASICGLGQAAANPVTSLIKYFPDLFPTPRPVAAE"
FT   gene            complement(99318..100064)
FT                   /locus_tag="Mnod_8360"
FT   CDS_pept        complement(99318..100064)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8360"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8360"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62494"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62494.1"
FT                   /translation="MVPENWPVATAHDPRRLEEARHQVHSLVQWLARIERSYGSQGNGA
FT                   MPTLEWHNARNAITTHPLGRDLDLELRLPELVLQFREGGEAVSHPLHVEEHSPAHVEAW
FT                   LLVELLHRGMDRERFSKALPYDVSGLMSGDAVEFSPEAYENELRVLTAWFSNAASVIAR
FT                   TIDKSQPEQKQTVTVRPDDLSLEAGASGDRILGFRTGRAELPEPFFYIRRGQGGSAAGA
FT                   GESVLPVSQIPAHGGEDRVAQFLKEA"
FT   gene            complement(100135..100998)
FT                   /locus_tag="Mnod_8361"
FT   CDS_pept        complement(100135..100998)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8361"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: mrd:Mrad2831_1562
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8361"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62495"
FT                   /db_xref="GOA:B8IVQ5"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ5"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACL62495.1"
FT                   /translation="MAKPIVDMRSRPSFLHPFFGATPDTPEYGVVRWLNRRVGTKEIDH
FT                   FARGQSVEGFVGEMDAAGITAAVMVARSVPGVRISNDDLAAVARHNPKRLIGIASVDPT
FT                   DLGREKAVAEARRAVSELGMKGINLDAGFYGSPMRADDERLMPLYELCQELGVPVFVMS
FT                   GPTTPDLRLNDPFAVDRIAKTFPKLPIICSHGFYPHIDAIITVAFRNENVYVSPDMYTF
FT                   SPGGRLYIEAANGFMKDQFLFGSSFPFRPMKQGVDDFMALGLSPDALDAALWRNANRVL
FT                   GLGLGA"
FT   gene            complement(101193..102554)
FT                   /locus_tag="Mnod_8362"
FT   CDS_pept        complement(101193..102554)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8362"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: mab:MAB_0771c major
FT                   facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8362"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62496"
FT                   /db_xref="GOA:B8IVQ6"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ6"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62496.1"
FT                   /translation="MLSLRSSAKPPSQPPGSAELIDLHDPDKPNITKKARNVITLAATL
FT                   GYLFDAYAINIYGMTLGLIAVEFGVDVKTMGAIGSIFIVGYMLGSCVFGMLGDRFGRKV
FT                   TLGFSIFAYGSVTALTGLAVTPVQFAIGRFLTGLGGGGELTVGVPYVVESWDSKKRGLG
FT                   AGLMFAGYALGVVYAAIVSALILEWLGWRAMYFLAILPAILILFVRMQLEESPSYTATI
FT                   ERLKKAKLKRASFFTSLKTSPRLRRNVMWGALIYTSLAGIYYAETVFAVPFMVSTLKMS
FT                   TTVAVATLGLFNLSMFGFSIFCGHLSDYIGRKRAGAITLLVLAGSLWVMFSTTSIPLFV
FT                   ICGVLAFGGIGGSWAIGMVHVAELFPTEIRGSGYGWSVALGRFPSIFAPIAIGWLASLT
FT                   PGGMGDAMKYSCVVLLFALAAYLLGPETLDQTEVDHVLKNEDDQVLELHEAGSH"
FT   gene            103293..103412
FT                   /locus_tag="Mnod_8363"
FT   CDS_pept        103293..103412
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8363"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8363"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62497"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62497.1"
FT                   /translation="MLTAARLAMLPPIECCWPKRGDVAGSALHDYGDPVYRFA"
FT   gene            103837..105081
FT                   /locus_tag="Mnod_8364"
FT   CDS_pept        103837..105081
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8364"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mpt:Mpe_A0919 methanesulfonate monooxygenase, hydroxylase
FT                   alpha (large) subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8364"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62498"
FT                   /db_xref="GOA:B8IVQ8"
FT                   /db_xref="InterPro:IPR001663"
FT                   /db_xref="InterPro:IPR015879"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ8"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACL62498.1"
FT                   /translation="MPARNYQQWTANPPLQTGEWIDSRLYTDQEIFEEELEKIFKHTWV
FT                   PVCHESELPKPYDFRTTSIANEPIVVCRGPDNVVRAFLNVCPHRGMIIERRPSGSFYEA
FT                   SASGNPKRMTCMFHAWQFDLKGNCVYVSREKEGYQDRLSKEDVGLRRLRCEVKFGGFVW
FT                   VSLDDNPVPLEDWAGAPFECLRKTLDAEPLEVFHYHKAIVDTNYKLWHDTNCEFYHDFM
FT                   HYHNRVTGFNDAYFARKNEAFEHGHIVVGTFEVNYDQYEGFESRAGLSFPYLPPNQWYM
FT                   IDLFPGMNFNLRGSALRCDVVTPLGPNKTMIEFRGLGLKSDTKEERQTRINHHNSIWGP
FT                   FGRNLHEDLIGVQGQGTTMRPGSEPRRILHGRHENQTIHDENGMRHYYDEWGRWMNRLP
FT                   RDPSKPYAPPAVAAE"
FT   gene            105270..105806
FT                   /locus_tag="Mnod_8365"
FT   CDS_pept        105270..105806
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8365"
FT                   /product="aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit"
FT                   /note="PFAM: aromatic-ring-hydroxylating dioxygenase beta
FT                   subunit; KEGG: mpt:Mpe_A0920 methanesulfonate
FT                   monooxygenase, hydroxylase beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8365"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62499"
FT                   /db_xref="GOA:B8IVQ9"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVQ9"
FT                   /inference="protein motif:PFAM:PF00866"
FT                   /protein_id="ACL62499.1"
FT                   /translation="MGTSMLTGSDTARAGSYLDQRQTLARDAIYQASLLLDDQRWNDWL
FT                   ALCAEDFTYDIKSWSPEINYDMTYLHASRKDLDSLIRLLPKHNTDHSPLTRHTSVYTVE
FT                   ISPDGTTAQTVSSVVIFQHMLDGTNSHIDAGESRLFLVGKYYDQLRFDDAGVKFVSREV
FT                   RLLNRRLDKGSHWPL"
FT   gene            105960..106328
FT                   /locus_tag="Mnod_8366"
FT   CDS_pept        105960..106328
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8366"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   mpt:Mpe_A0922 methanesulfonate monooxygenase component;
FT                   iron sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8366"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62500"
FT                   /db_xref="GOA:B8IVR0"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVR0"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACL62500.1"
FT                   /translation="MGWRYLCEAAEVAENSLKLVDADGVRIVVANYGGGFRAIPPVCPH
FT                   MEEPLEESGVIANCVLTCTKHLWAWDLRSLDMVGEAEKPLKTYEVKQEGGRLLALVDEE
FT                   LTYDFEEDTGDDDDDFFK"
FT   gene            106339..107445
FT                   /locus_tag="Mnod_8367"
FT   CDS_pept        106339..107445
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8367"
FT                   /product="Oxidoreductase FAD-binding domain protein"
FT                   /note="PFAM: ferredoxin; oxidoreductase FAD/NAD(P)-binding
FT                   domain protein; Oxidoreductase FAD-binding domain protein;
FT                   KEGG: mpt:Mpe_A0921 methanesulfonate monooxygenase
FT                   component; reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8367"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62501"
FT                   /db_xref="GOA:B8IVR1"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR008333"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR039261"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVR1"
FT                   /inference="protein motif:PFAM:PF00970"
FT                   /protein_id="ACL62501.1"
FT                   /translation="MVSQFESLPRSDTNDRDDQSRRWNVEVQSKSGTLAFTCEPNENLL
FT                   YAGLRQGLTLPYECATGTCGTCRARVASGSVAVGWEAAPGHKGLKRDKGDILMCQTRPQ
FT                   SDCVLRVPAHVHTSPRHAVPRHHSAVIDCVRHLTQDVIHFEISLNDPMSFDAGQFVVLR
FT                   APHLQGMRAYSMVNFATETRRLELVIKRKPGGGFGNWIFEASREGQTVDVFGPLGRATF
FT                   HPEENYDLLMIAGGSGIAGMMSILSRAVQEDYFSSHKGYVFFGVRTLDDSFYLADFSEH
FT                   VAAANGNLEVTLAISDEAVASPVHPGHPHVRVVEGLVHEVCARAMKGRYDNVMSYIAGP
FT                   PPMVDGALRTLIIEGRMTPDRIRYDKFG"
FT   gene            107473..108207
FT                   /locus_tag="Mnod_8368"
FT   CDS_pept        107473..108207
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8368"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mpt:Mpe_A0917 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8368"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62502"
FT                   /db_xref="GOA:B8IVR2"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVR2"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACL62502.1"
FT                   /translation="MTATLLSLGLVSGLMIGCVGIGGVILVPVMTLGIGIPIGTAIAAA
FT                   MAGYVLTGLSGTLVFGRNGSIRWTLALSLCLGAAPGALLGAWASGAINAHIIEMLIAAL
FT                   AIMSGLYNLRGNSVVDTPPLALGTLGFVAMGACVGLLSAVTGTGGPVILVPLLLTFGYP
FT                   VLTAVGLGQAIQLPVAALATLGAYAFGSLDIYLSVLLSIGLAVGSTVGAGVAHHVPRAT
FT                   LRTIAASVLIATGAFIIFRLVI"
FT   gene            108557..109768
FT                   /locus_tag="Mnod_8369"
FT   CDS_pept        108557..109768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8369"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: met:M446_6453
FT                   oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8369"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62503"
FT                   /db_xref="GOA:B8IVR3"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVR3"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACL62503.1"
FT                   /translation="MLDRRELLRRAGLGAVVFSGTTLVSPLRGLADELARLPFGNGERP
FT                   LVAYPGKRPLLEMTSRPPQLETPFGIFDEGVITPNDAFFVRYHLADLPTAIDPDSFRLE
FT                   VTGHVETPLSLSLAELRALPGSEVVAVNQCSGNSRGFVAPRVAGGQLANGAMGNARWAG
FT                   VPLRSVLDKAGLRRGAVQVAFEGLDGPVLPATPDYAKALDLDHARDGEVLLAYAMNGAE
FT                   LPWLNGYPLRLVVPGYYGTYWVKHLNRITVLDQPFESFWMKSAYRIPANACACTEPGQA
FT                   PTATVPIGRYNVRSFVTNLADGARVPAGETLLRGIAFDGGSGVTEVAVSTDDGRTWRRA
FT                   ALGEDLGRYSFRPWSLRVDLAPGAHAIRVRATNRIGQTQPLDPLWNPAGYMRNVVETTR
FT                   VQAA"
FT   sig_peptide     108557..108652
FT                   /locus_tag="Mnod_8369"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.781) with cleavage site probability 0.751 at
FT                   residue 32"
FT   gene            109780..110103
FT                   /locus_tag="Mnod_8370"
FT   CDS_pept        109780..110103
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8370"
FT                   /product="putative sulfite:cytochrome c oxidoreductase
FT                   subunit B"
FT                   /note="KEGG: mrd:Mrad2831_4216 putative sulfite:cytochrome
FT                   c oxidoreductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8370"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62504"
FT                   /db_xref="GOA:B8IVR4"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVR4"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_4216"
FT                   /protein_id="ACL62504.1"
FT                   /translation="MTKRFLTAAAAAGLLAGGAALAGPRTYALPEPTAQLKEPRDKAHA
FT                   AGYEATQANCLTCHSVDYIAIQPPGKGRAFWDAEVTKMIKVYGAPISEADAKVIAAYLA
FT                   AVY"
FT   sig_peptide     109780..109848
FT                   /locus_tag="Mnod_8370"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.994 at
FT                   residue 23"
FT   gene            complement(110323..110397)
FT                   /pseudo
FT                   /locus_tag="Mnod_8371"
FT   gene            complement(110410..111927)
FT                   /locus_tag="Mnod_8372"
FT   CDS_pept        complement(110410..111927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8372"
FT                   /product="transposase IS66"
FT                   /note="PFAM: transposase IS66; KEGG: xau:Xaut_4598
FT                   transposase IS66"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8372"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62505"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024463"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="InterPro:IPR039552"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAF1"
FT                   /inference="protein motif:PFAM:PF03050"
FT                   /protein_id="ACL62505.1"
FT                   /translation="MAAPASPSPDDPETLKALLAEERAENERLRQIIKAMQRHRFGRRA
FT                   ESLPEDQLLLGLEEAEQVEAEGLAAEETAPAVRAERTARRRNNRGALPAHLPRVERVVD
FT                   IESPVCPCCSGSLHRIGEDVSERLDIVPAQVRVIVIRRPRYACRACEAIVLQASAPARL
FT                   IEGGLPTDDLVAHVLVAKYADHLPLYRQAQIFARQGIALDRSTLADWVGRAAFLLRPVH
FT                   ARLLGRLKASGKLFADETSAPVLDPGRGRTKTGQLWAYARDDRPWGGTDPPGVAYVYAP
FT                   DRTAKQPIAHLAGFRGVLQVDGYDGYKALARQGEVRLAYCWSHVRRAFYDLDGPIAAEV
FT                   LTRIAGLYRIEAEIRGRPAEERRTARQARSRPILEALEPWLREKLALISQKSKLAEAIR
FT                   YALSRWAGLSLFLDDGRVELDTNVVERAIRPLALTRKNALFAGSDGGAAHWAVIASLIE
FT                   TCKLTGVGPQAYLADVITRIIEGHPNSRIDELLPWAYPVTPTLRDVA"
FT   gene            complement(111995..112351)
FT                   /locus_tag="Mnod_8373"
FT   CDS_pept        complement(111995..112351)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8373"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: met:M446_1473
FT                   IS66 Orf2 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8373"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62506"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAF0"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ACL62506.1"
FT                   /translation="MIGPAGTVRVMLATRPVDFRKGIDGLAALVREAMGADPFSGTVYV
FT                   FRSKRADRTKLLFWDGSGVVLAAKRLEDGQFCWPKAQDGVVRLTAAQLSALLEGLDWKR
FT                   VHEARQVSAPAVAG"
FT   gene            complement(112348..112779)
FT                   /locus_tag="Mnod_8374"
FT   CDS_pept        complement(112348..112779)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8374"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   met:M446_1472 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8374"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62507"
FT                   /db_xref="GOA:B8IAE9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAE9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACL62507.1"
FT                   /translation="MSMSERMAMSEPVRRLELFTGAGRRRTWSEDEKAAIVAESEAPNT
FT                   SISAVARRHGLSASQLFTWRRLARQAAMDDQQAELRFVPAVLISEPQEPACAETSPKPR
FT                   WRHGCHGIEVEVAGATVRIGGEASEAQIAAVIRALKVSA"
FT   gene            complement(112815..113096)
FT                   /locus_tag="Mnod_8375"
FT   CDS_pept        complement(112815..113096)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8375"
FT                   /product="IS66 Orf2 family protein"
FT                   /note="PFAM: IS66 Orf2 family protein; KEGG: mag:amb3326
FT                   transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8375"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62508"
FT                   /db_xref="InterPro:IPR008878"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVR8"
FT                   /inference="protein motif:PFAM:PF05717"
FT                   /protein_id="ACL62508.1"
FT                   /translation="MIPVPSGVRVWIASGHTDMRRGMNGLCLQGQEALGRDPHAGDLSV
FT                   FRGRRGDLIKCLWHHGLGLSLYAKRLEKGRFLWPSRKRRFGGTFRELG"
FT   gene            complement(113093..113503)
FT                   /locus_tag="Mnod_8376"
FT   CDS_pept        complement(113093..113503)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8376"
FT                   /product="transposase IS3/IS911 family protein"
FT                   /note="PFAM: transposase IS3/IS911 family protein; KEGG:
FT                   rpe:RPE_1131 transposase IS3/IS911 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8376"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62509"
FT                   /db_xref="GOA:B8IVR9"
FT                   /db_xref="InterPro:IPR002514"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVR9"
FT                   /inference="protein motif:PFAM:PF01527"
FT                   /protein_id="ACL62509.1"
FT                   /translation="MDSHTHSARLRRLEIVETGRRRCWSEDEKLKVVRESLQRPRLVSA
FT                   TARRYGISRSLLLTWRRAFAASRSAPAVTPTFVPAVVVPAPEPTRERAETSRSSSTSSR
FT                   MVIVLGKGRRIVVDASVEAEAPARVLAVLEGR"
FT   gene            complement(113992..114462)
FT                   /pseudo
FT                   /locus_tag="Mnod_8377"
FT   gene            114766..116070
FT                   /locus_tag="Mnod_8378"
FT   CDS_pept        114766..116070
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8378"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="KEGG: met:M446_0736 peptidase S8 and S53 subtilisin
FT                   kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8378"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62510"
FT                   /db_xref="GOA:B8IVS0"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR015500"
FT                   /db_xref="InterPro:IPR022398"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS0"
FT                   /inference="similar to AA sequence:KEGG:M446_0736"
FT                   /protein_id="ACL62510.1"
FT                   /translation="MAAQPILADVQVVGAPAVIGRSDAITTGRIMSNVFTTASLPEHHD
FT                   ALLIVNMRQETMQVAPAMAMAAMPPPPETEGLSALSFFERAGQVKRIVPLRRSEQAGNA
FT                   PLRMAAASALMFAAQPPENTDAAAAVRFIEMKREQDTQQLHTALAADPNVLSVSRVPVR
FT                   YLTARRTSRTRLAGGGIGIEAAPPTGSVLWDLEKIRWQEARRAEGFMEAGNVRVAVFDT
FT                   GIDDGHTELKIDQYYWRHPDLTRPVSNRDIIGHGTHVSGIIAALIGRGVSVQGICDCKL
FT                   DVWKIFDDEPTYAPGQGAFVYYVNPIMYRRALADCVENPPDVLNLSIGGPAAPDATERD
FT                   LFDQLIEAGVTICAAMGNERQYGKANGFSHEAAAIDLREVAPRHGFEKWYLFTKSIGDA
FT                   RMRVSAGIKKFLRPRNVEIDGPDRCKGWTVERGVI"
FT   gene            complement(115996..116721)
FT                   /locus_tag="Mnod_8379"
FT   CDS_pept        complement(115996..116721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8379"
FT                   /product="peptidase S8 and S53 subtilisin kexin sedolisin"
FT                   /note="KEGG: met:M446_0736 peptidase S8 and S53 subtilisin
FT                   kexin sedolisin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8379"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62511"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS1"
FT                   /inference="similar to AA sequence:KEGG:M446_0736"
FT                   /protein_id="ACL62511.1"
FT                   /translation="MYWLPLTPHRPATEILGLCVYDASGDVAGAPRSAFPTNTAQFRLS
FT                   YGEAFTDLLIGETNKARMARGLNPASIVYKGYDIFQYDLQYVRTDEGFFRERKWYNFKE
FT                   CVNRAVSELTKKVQITGDIQDAVRAYNGSGPKAQQYARDVMRLLPYCEEAAATAVTPAV
FT                   AFSGAGAGLSFVAFEESGIAADEDDPGAPGNSDTNETADFETARFLANLGAPGASDDAS
FT                   LDSPTFAAIGAINLDISRA"
FT   gene            118357..118566
FT                   /locus_tag="Mnod_8380"
FT   CDS_pept        118357..118566
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8380"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8380"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62512"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62512.1"
FT                   /translation="MQEASRWFCSHTVHVPANPKSLRSHSMAAKPWTVRRAVVNERKSP
FT                   TRGIGRLTRKWSLAIPCCRGLVTW"
FT   gene            118621..118779
FT                   /locus_tag="Mnod_8381"
FT   CDS_pept        118621..118779
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8381"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bps:BPSL0940 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8381"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62513"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS3"
FT                   /inference="similar to AA sequence:KEGG:BPSL0940"
FT                   /protein_id="ACL62513.1"
FT                   /translation="MGGDGHRNGAVRDRSQVFNPKTETWTKRNADTGRFMDGKKDGTPF
FT                   KGVRKER"
FT   gene            118844..120406
FT                   /locus_tag="Mnod_8382"
FT   CDS_pept        118844..120406
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8382"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_4409 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8382"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62514"
FT                   /db_xref="GOA:B8IVS4"
FT                   /db_xref="InterPro:IPR018712"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS4"
FT                   /inference="similar to AA sequence:KEGG:Meso_4409"
FT                   /protein_id="ACL62514.1"
FT                   /translation="MAKNIVVFSDGTGQDGGVRPEQRVSNVYKMYRVCKVGPESGIDPA
FT                   EQVAFYDPGLGTDIGATALTAPVRFVQKMAASVSGRGITTNIADCYRFIIDHYEPGDRI
FT                   YLIGFSRGAYTVRCVANLLMYCGVPTKGAGGPLLRFCKMTRDIAREAVETVLEHGAGHP
FT                   RKDFDAERHELARRFRAKYGSDHDDGDGKSNVEPYFIGTFDTVAALGVAGPKRTLIKAG
FT                   LAAAVVIPLAIVIAVTSAVVGGISYLFDGPFWQADLITSGVLVVASAAVAFAVRRHLVA
FT                   AKTKTITDWPSPGEKRSHVAEWKGENFDRLLSAQVGYARAAIAIDERRKDFDRVKWGPT
FT                   ETPPPRAPGAPDQFRQFWFAGNHSDIGGSYDETESRLSDIALKWMLEQAVGIPDGLKVD
FT                   GMPTMADPMHPVEVMQIPRLRLHPSAAGVQHCEVAGMRDAIEERMSASWVPGWVRRWAQ
FT                   GKTWETKDREIRPDATVHPSVDERFALPAVVQCDGLASYRPAPLANHVRFKDRYGPQPK
FT                   PTA"
FT   gene            120440..120819
FT                   /pseudo
FT                   /locus_tag="Mnod_8383"
FT   gene            120800..121204
FT                   /locus_tag="Mnod_8384"
FT   CDS_pept        120800..121204
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8384"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mex:Mext_3531 integrase catalytic region"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8384"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62515"
FT                   /db_xref="InterPro:IPR025948"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62515.1"
FT                   /translation="MGRSELERRRQAVAGIREKYGLSERHACRIVGQHRGTHRYVPTVP
FT                   ADEDALTCAIIALASEYGRYGYRRVTALLQAAGWQVGKDRVQRIWRREGLKVPQKHRPR
FT                   GRLWLKGGLDLLRISGERFGWRCAFRTGQG"
FT   gene            121262..121807
FT                   /pseudo
FT                   /locus_tag="Mnod_8385"
FT   gene            121804..123862
FT                   /pseudo
FT                   /locus_tag="Mnod_8386"
FT   gene            complement(123865..124629)
FT                   /pseudo
FT                   /locus_tag="Mnod_8387"
FT   gene            124800..125348
FT                   /pseudo
FT                   /locus_tag="Mnod_8388"
FT   gene            125765..126964
FT                   /locus_tag="Mnod_8389"
FT   CDS_pept        125765..126964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8389"
FT                   /product="Patatin"
FT                   /note="PFAM: Patatin; KEGG: xau:Xaut_2133 patatin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8389"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62516"
FT                   /db_xref="GOA:B8IVS6"
FT                   /db_xref="InterPro:IPR002641"
FT                   /db_xref="InterPro:IPR016035"
FT                   /db_xref="InterPro:IPR021095"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS6"
FT                   /inference="protein motif:PFAM:PF01734"
FT                   /protein_id="ACL62516.1"
FT                   /translation="MAKDPIGEAKPNCVLVLQGGGALGAYHIGAYQALSEGGFEPDWFS
FT                   GISIGAINAAVLAGNQPADRLAKLEALWHAISWPEVLVPLKQLPLEIWHNNLSNAAALM
FT                   FGQPAFFTPRPVSPFVAPPGNPSTVSFYDTAPLRETLRDLADFDLINSAKVRLTLGATD
FT                   VATGDMVFFDNTKEGPFGPEHVMASGSLPPGFPATKVGDRYYWDGGCVSNTPLEAILED
FT                   QPKGHTVVFMIDLWGAAGQLPGTINDVFWRAKQIQYASRTWTQVDAVASKVNLRHAVRL
FT                   LRKQSIAEVDKAVPDDLYIDETRRLDIVHITYQPGKDQIPNSDAEFSRSSIAERRAAGY
FT                   ADMRSALEAQPWKHVEKPAHLAAIVHRVRHGKVMTDTEPNLHGAEIGAQVTPARKVANE
FT                   "
FT   gene            127120..127239
FT                   /locus_tag="Mnod_8390"
FT   CDS_pept        127120..127239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8390"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8390"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62517"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62517.1"
FT                   /translation="MILAALALTLKRQARGDFKARHSHVAQAALRVRARQRNL"
FT   gene            complement(127453..127842)
FT                   /locus_tag="Mnod_8391"
FT   CDS_pept        complement(127453..127842)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8391"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8391"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62518"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62518.1"
FT                   /translation="MTHQTHLTASHSLDYDRTLILVVEVSARSWVVAAQVPGLRQKSSQ
FT                   QQLAPQADALMGSRSGDTSRTAPGRRGDGAEAGLTVGIPRAARWEGNGPAEPRRMRIDG
FT                   SGQTRRAELARWDRGSGGRDEAWAA"
FT   gene            127926..128746
FT                   /pseudo
FT                   /locus_tag="Mnod_8392"
FT   gene            128799..129107
FT                   /locus_tag="Mnod_8393"
FT   CDS_pept        128799..129107
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8393"
FT                   /product="addiction module antitoxin, RelB/DinJ family"
FT                   /note="TIGRFAM: addiction module antitoxin, RelB/DinJ
FT                   family; PFAM: RelB antitoxin; KEGG: nha:Nham_4666 RelB
FT                   antitoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8393"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62519"
FT                   /db_xref="GOA:B8IVS9"
FT                   /db_xref="InterPro:IPR007337"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVS9"
FT                   /inference="protein motif:TFAM:TIGR02384"
FT                   /protein_id="ACL62519.1"
FT                   /translation="MPANALVQTRIDADVRDRASAVLENMGLTVSDAVRILLTRTANEG
FT                   ALPLELVTNSEAHDAWFRAKVLEALDDTRPDVPDDQAEAHFAQRRAAARRRAGELKS"
FT   gene            129110..129214
FT                   /pseudo
FT                   /locus_tag="Mnod_8394"
FT   gene            129924..130904
FT                   /locus_tag="Mnod_8395"
FT   CDS_pept        129924..130904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8395"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: mes:Meso_4315 transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8395"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62520"
FT                   /db_xref="GOA:B8IVT0"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT0"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL62520.1"
FT                   /translation="MQCKAQARTGQLARIVVIQEAGLDGFWIHRALVSEGIESYVVDSA
FT                   SIAVSRRHRRAKTDRIDGEALVRTLLAYKRGEPRVCAMVRVPTPEEEDQRRLCRELKTL
FT                   VGERIRHVNRLKGVLFSQGITDYEPRRPDRRERLDELRTGDGRPLPHHLKALVLRELEI
FT                   VELLDRQIEVVKAERDALLASAQPEEVPSKAVQMLLGLKGIGSGFAGALWSEGLFRHFD
FT                   NRRQVAAYAGLAPTPWKSGKIDHEQGVSKAGNPRLRAIAVEMAWLWLRHQPGSALSLWY
FT                   QDRVRCLGGRMKKVITVALARKLLVALWKYVTHGVVIEGAALKVA"
FT   gene            131354..131986
FT                   /pseudo
FT                   /locus_tag="Mnod_8396"
FT   gene            complement(132401..132613)
FT                   /locus_tag="Mnod_8397"
FT   CDS_pept        complement(132401..132613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8397"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8397"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62521"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT1"
FT                   /inference="similar to AA sequence:KEGG:M446_3784"
FT                   /protein_id="ACL62521.1"
FT                   /translation="MPSRSYDVRKGRKGWSVYASQTGKPVRLNGHPQIGLSLETAAQLA
FT                   AVLEVMDFLHAENASWMITDRPTIH"
FT   gene            132771..133625
FT                   /locus_tag="Mnod_8398"
FT   CDS_pept        132771..133625
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8398"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: nha:Nham_3644 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8398"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62522"
FT                   /db_xref="GOA:B8IVT2"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT2"
FT                   /inference="protein motif:PFAM:PF00126"
FT                   /protein_id="ACL62522.1"
FT                   /translation="MDTELARTFLAVVSAGNFVGAADRLNVSQSTVSTRIQALEYALGC
FT                   TLFVRNKSGATLTAAGRRFQRHAATLVRAVEQARQEVGIPEGFSGTIVVGGRIGLWEQF
FT                   LLHWLPFMQRSQQHLSIRAESGLEPEIMQGLVEGRIDIGVMYTPEIRPGLTIHALFEDR
FT                   LVYVSTDAEQNVLDPSTYIYVDWGPEFYARHSAVLAGLRSPALTVNIGWLGLQHMIRNG
FT                   GSAYLPHRIVKQYIDSNILFENADMPEFTLPVYAVTASGLNKSAIEAALKLMVEVSSNL
FT                   SQL"
FT   gene            complement(133752..135476)
FT                   /locus_tag="Mnod_8399"
FT   CDS_pept        complement(133752..135476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8399"
FT                   /product="choline dehydrogenase"
FT                   /note="TIGRFAM: choline dehydrogenase; PFAM:
FT                   glucose-methanol-choline oxidoreductase; GMC
FT                   oxidoreductase; KEGG: met:M446_4716 choline dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8399"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62523"
FT                   /db_xref="GOA:B8IVT3"
FT                   /db_xref="InterPro:IPR000172"
FT                   /db_xref="InterPro:IPR007867"
FT                   /db_xref="InterPro:IPR011533"
FT                   /db_xref="InterPro:IPR012132"
FT                   /db_xref="InterPro:IPR027424"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT3"
FT                   /inference="protein motif:TFAM:TIGR01810"
FT                   /protein_id="ACL62523.1"
FT                   /translation="MPQTDAREYDFIIVGAGSAGNVLATRLTEDPDTTVLLLEAGGPDY
FT                   RLDFRTQMPAALAYPLQGRRYNWAYRTDPEPHMNNRRMECGRGKGLGGSSLINGMCYIR
FT                   GNALDYDGWAQRPGLADWSYHDCLPYFRKAESRDVGPDAYHGGDGPLSVTTAKPGSNVL
FT                   FEAMVEAGVQAGYPRTPDLNGHQQEGFGPMDRSVTRHGRRSSTARGYLDQARARPNLTI
FT                   VTHALTDRILFEGRRASGVAYLRGGRGPVVARACREVLLCSGAIASPQILQRSGVGPAD
FT                   LLRGLDIPVVHDLPGVGENLQDHLEIYVQFECREPVSLAPALKLHNQPLIGAQWLFTGT
FT                   GIGASNQFEAGGFIRSSPDFAWPNLQYHFLPLAINYNGTNPIKSHGFQAHVGSMRSPSR
FT                   GRIRLTSRDPNDHPSLLFNYMSREQDWREFRDAIHITREIIAQPALDPYRGREISPGAD
FT                   LRSDAELDAFVRAHAETAYHPSCSCKMGEDAMAVVDGQGRVHGLEGLRVVDASIMPLIV
FT                   TGNLNAPTIMIAEKIADRIRGRAPLPRSEAPYFVAGDTPTRCHPVRGGGASGRRPPS"
FT   gene            complement(135608..137077)
FT                   /locus_tag="Mnod_8400"
FT   CDS_pept        complement(135608..137077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8400"
FT                   /product="betaine aldehyde dehydrogenase"
FT                   /note="TIGRFAM: betaine aldehyde dehydrogenase; PFAM:
FT                   Aldehyde Dehydrogenase; KEGG: pmy:Pmen_0482 betaine
FT                   aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8400"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62524"
FT                   /db_xref="GOA:B8IVT4"
FT                   /db_xref="InterPro:IPR011264"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016160"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT4"
FT                   /inference="protein motif:TFAM:TIGR01804"
FT                   /protein_id="ACL62524.1"
FT                   /translation="MLLTDIQRPFIGGRLAEEAGRCTFRSVNPATGEILAEVEHATRED
FT                   LEAAVAAAARGQAVWAATPARERGRVLMRAVALLRARNDELARLESLDTGKPIAETRVV
FT                   DVATGADVLEYYAGLAAAIEGRQIPLRETSFVYTRREPLGIVAGIGAWNYPIQIALWKS
FT                   APALAAGNAMIFKPSEVTPLTAFALAGIYAEAGLPDGVFSVLPGLGGEIGAWLTEHPAI
FT                   AKVSFTGGTLTGAKVMAGAARSTLKEVTMELGGKSPLIVLDDADLDRAADIAVAANFFS
FT                   SGQICTNGTRVFVPAPLKAAFEARVLKRVARIRIGDPLDEATNFGPLASHAHRDKVLAF
FT                   IRSGVEQGARLLIGGHALEGRFAAGAYVAPTVFTDCRDDMEIVREEIFGPVMSLLPYES
FT                   EAEALARANATLYGLAAGVVTRDLARAHRITHGLQAGICWINTWGESPPEMPVGGTKQS
FT                   GIGRENGIETLERYTRTKSIQVELSDFAPLF"
FT   gene            complement(137128..138336)
FT                   /locus_tag="Mnod_8401"
FT   CDS_pept        complement(137128..138336)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8401"
FT                   /product="choline ABC transporter, ATP-binding protein"
FT                   /note="KEGG: azc:AZC_1187 ABC transporter ATP-binding
FT                   protein; TIGRFAM: choline ABC transporter, ATP-binding
FT                   protein; PFAM: ABC transporter related; SMART: AAA ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8401"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62525"
FT                   /db_xref="GOA:B8IVT5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR022473"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT5"
FT                   /inference="protein motif:TFAM:TIGR03415"
FT                   /protein_id="ACL62525.1"
FT                   /translation="MKALSPVSRTSPENAIELRDVAIVFGRDVKAALALADQGATRELI
FT                   RERVNALMGTFKVNLDVKPGEICVLMGLSGSGKSTVLRAINGLNPVARGSVLVRHRGEA
FT                   VDMTRCRASTLREVRLNTVSMVFQQFGLLPWRSVRDNVGFGLELRGVPAAERQRIVDEK
FT                   LEMVGLASWADKMVQELSGGMQQRVGLARAFATDADILLMDEPFSALDPLIRDKLQDDL
FT                   LELQRKLHKTIVFVSHDLSEALKLGNRIAIMEGGHVVQFGTPSDIVLRPANSYVTEFVK
FT                   HMNPLEVLDSGAVMTPVSALRREGDAVLLDGSGEVRISLDCAERPVMAHIGGRAEALER
FT                   ADATGACGDPGRVVVAPVMLPLRAAIDLRLRSPYPIVFVDQLGRLAGLCDHSEIYRGLL
FT                   QNT"
FT   gene            complement(138348..139205)
FT                   /locus_tag="Mnod_8402"
FT   CDS_pept        complement(138348..139205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8402"
FT                   /product="choline ABC transporter, permease protein"
FT                   /note="TIGRFAM: choline ABC transporter, permease protein;
FT                   PFAM: binding-protein-dependent transport systems inner
FT                   membrane component; KEGG: azc:AZC_1186 ABC transporter
FT                   permease"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8402"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62526"
FT                   /db_xref="GOA:B8IVT6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR017784"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT6"
FT                   /inference="protein motif:TFAM:TIGR03416"
FT                   /protein_id="ACL62526.1"
FT                   /translation="MYNWIVDHKISLGIWLKAGVDFLSRHAQAVFDLISTVLGAMVQGL
FT                   TDTLLAVPPLAMIGLFAAGAYLLHRSLGLALFIVTSLLLVANLGYWQATIETLSLVIWS
FT                   TAACVVVGVPVGILAAHRPMFYAAIRPLLDLMQTIPTFVYLIPTLVLFGLGMVPGIIST
FT                   VIFALPAPIRLTQLGISSVPESLREAALAYGATRTQMLFKVELPSAMPTILAGVTQCIM
FT                   LSLSMVVIAALVGADGLGKPVVRALNTVNIAMGFEAGLAIVVLAIILDRVCKRPAPRSR
FT                   KAAQ"
FT   gene            complement(139279..140217)
FT                   /locus_tag="Mnod_8403"
FT   CDS_pept        complement(139279..140217)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8403"
FT                   /product="choline ABC transporter, periplasmic binding
FT                   protein"
FT                   /note="TIGRFAM: choline ABC transporter, periplasmic
FT                   binding protein; PFAM: Substrate-binding region of ABC-type
FT                   glycine betaine transport system; KEGG: azc:AZC_1185
FT                   glycine betaine/L-proline ABC transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8403"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62527"
FT                   /db_xref="GOA:B8IVT7"
FT                   /db_xref="InterPro:IPR007210"
FT                   /db_xref="InterPro:IPR017783"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT7"
FT                   /inference="protein motif:TFAM:TIGR03414"
FT                   /protein_id="ACL62527.1"
FT                   /translation="MRVFLVRVLFGVSLFATPAAADPAACKTVRFADVGWTDITATTAL
FT                   ASRILTGLGYTPKTQILSVPVTYASLGSKNIDVFLGNWMPTMEADRKPYLDKNEIEVLG
FT                   PNLTGAKYTFAVPAYLYEAGLKSFSDISKSHRQLKGKIYGIEPGNDGNRMILGIIKNNT
FT                   YNLGNFDLVESSEQGMLAQVERAIQRKEPILFLGWEPHPMNTKFPIRYLSGGDDTFGPN
FT                   YGGAEIFTNLRAGYVAQCPNLGRLFKNLTFDLPTENVVMGSILFDGLDPEKAADKWLKA
FT                   NPGAWQRWLDGVETFDGKPGLPAARASLGLN"
FT   sig_peptide     complement(140152..140217)
FT                   /locus_tag="Mnod_8403"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.996 at
FT                   residue 22"
FT   gene            140504..142537
FT                   /locus_tag="Mnod_8404"
FT   CDS_pept        140504..142537
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8404"
FT                   /product="putative transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; Aldehyde
FT                   Dehydrogenase; KEGG: azc:AZC_1184 betaine aldehyde
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8404"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62528"
FT                   /db_xref="GOA:B8IVT8"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR017757"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR039538"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT8"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL62528.1"
FT                   /translation="MKHLEALQSFEAARRRHLIEATMETLAEVGFKAATLSEIARRANV
FT                   SAGLFAHYFRGKDGLLEATLRFVAARLARVTAAKLAAASTRRERLFAVCDAALADEQFD
FT                   RRTSAVWLAFWGQLTHSKRYQRVQYIYQRRMITNLRHSLRGLVPADCVALHARMIAAMI
FT                   DGLWLRSHVANGTASGAEAGGAAARTIVRALIDGLLAGMPETAEPGASARPIAAALPVA
FT                   EAPPIRHRSPTTGEEIARFAPARATEIRRAVQDAQRGLAAWKAIGAADRAQILRRCAGL
FT                   LRAEGPDLARLESLETGRPLLHTAGLDLRDAGRALDHAAGIAERAAASWTDLGSGRFGH
FT                   VRRGPVGIIAATGHWSAAILDLCRQAAGLAHGNAVVLAADAYATETSTRLADLFVRAGL
FT                   PEGTLTVLRGDAESARLLRTYPGLATEAASAGGDDEVDLGAGLGRSKACTIVLPGADPA
FT                   RVAAAIFQGGRRWTGSSFAGQSRIYVHADMRPDLLDALRALASRLRLGSPLDPATQVGP
FT                   LLSPTHAAGLEDALRSDLAAMAALVVGGQVSRGGTTRAAWLTPTVLDRCTELMSLVRGH
FT                   NFAPVVTLIPFEDDQELIRRLVGRRATAGFGLFAGDPSRACRIANALDAAFCAINDDEA
FT                   VSAAEDLEAAPAHPFGWSLSEHSSQDLSRTTRIIGGKGCGPI"
FT   gene            complement(142663..143343)
FT                   /pseudo
FT                   /locus_tag="Mnod_8405"
FT   gene            143351..143560
FT                   /pseudo
FT                   /locus_tag="Mnod_8406"
FT   gene            complement(143751..144710)
FT                   /locus_tag="Mnod_8407"
FT   CDS_pept        complement(143751..144710)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8407"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rpe:RPE_4690 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8407"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62529"
FT                   /db_xref="InterPro:IPR010239"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVT9"
FT                   /inference="similar to AA sequence:KEGG:RPE_4690"
FT                   /protein_id="ACL62529.1"
FT                   /translation="MSVRPIFLAAFLVPTLAGSGHAADAPAPVPTLPPVDPQMVSAAFG
FT                   LRFVSDYNSRGIPQTNRNPGVQGYLEFQMLDGLLYAGIAGEQVDLPNRPSMEMDFSAGI
FT                   RPTYGAWSFDLGYLFYNYPGERRLQGLDSTIYTANNADYYEIVGKATYAVNDALILGVN
FT                   VYYSPSYFGTHAPGTYISGIAKYAIPEGTFGVMPSGFMLSAEVGHYFLGTTRASFGRFN
FT                   LPDYTYGNVGVAYTAKNFTIDLRFHDTTMTKSECGLITADPRSIANGTFRSNWCGAAVI
FT                   ATLSVDVTSKDPGIFAGQEPIASSVPGRTSDAEGPAVR"
FT   sig_peptide     complement(144642..144710)
FT                   /locus_tag="Mnod_8407"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 23"
FT   gene            complement(145070..145189)
FT                   /pseudo
FT                   /locus_tag="Mnod_8408"
FT   gene            145282..146034
FT                   /locus_tag="Mnod_8409"
FT   CDS_pept        145282..146034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8409"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_7034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8409"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62530"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU0"
FT                   /inference="similar to AA sequence:KEGG:M446_7034"
FT                   /protein_id="ACL62530.1"
FT                   /translation="MILNALALTLKRQARGDFRGRHVEATLIVQAVSWSLRDALSDRDI
FT                   EEMLLERGLQVDHSTLNRWVLAYAPALERRLRRFRKPPCGSGRVDETSIRVRGQWRSLD
FT                   RAIDKPGEAVDVLLTANRDLDAAQRVFRTMLQDQPLLAPDRIGTDGAGPHPPAIAKSRK
FT                   EGLLPRTPTHHVTKPLQQGIASDHVRVKRPMPRGGGFRSFTTARRTIQGVKAMLWRRKG
FT                   FGFAGAWTVREQNQLLAHCFGLPVANKA"
FT   gene            146315..146619
FT                   /pseudo
FT                   /locus_tag="Mnod_8410"
FT   gene            146609..147043
FT                   /locus_tag="Mnod_8411"
FT   CDS_pept        146609..147043
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8411"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mca:MCA2638 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8411"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62531"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU1"
FT                   /inference="similar to AA sequence:KEGG:MCA2638"
FT                   /protein_id="ACL62531.1"
FT                   /translation="MASKVFVDANVLWSPQQRNLLLQLAYQDLFAIHWTDTVIGEWLRN
FT                   LDLGQRTKCETRTLPLMRRHFPRAWLPTMPATPFGTTDPKDRHVAAGAVHITPSILLTW
FT                   NVGDFDDAALRSLGVEVQTPDRFLRRLLDGSPAAVLEFTR"
FT   gene            147356..147589
FT                   /locus_tag="Mnod_8412"
FT   CDS_pept        147356..147589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8412"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8412"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62532"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62532.1"
FT                   /translation="MLLAVGDEPQGREGEGFGDAIARFDQGLTQDELGDLPAVGRQPYH
FT                   QRHDRPAAAPIDQPGVGVAGSEEASLLERRRP"
FT   gene            147979..149331
FT                   /pseudo
FT                   /locus_tag="Mnod_8413"
FT   gene            149623..150057
FT                   /locus_tag="Mnod_8414"
FT   CDS_pept        149623..150057
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8414"
FT                   /product="YCII-related"
FT                   /note="PFAM: YCII-related; KEGG: sal:Sala_1484 hypothetical
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8414"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62533"
FT                   /db_xref="InterPro:IPR005545"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU3"
FT                   /inference="protein motif:PFAM:PF03795"
FT                   /protein_id="ACL62533.1"
FT                   /translation="MRVMVFVKATEDSEKGVSPTPEALEAFEAMDRFTEELVKAGVFVA
FT                   AAGLKPSAQAKRIAFDGPNRTVIDGPFAETRELVAGFSIWEVKDMDEAMAWAQRCPNPM
FT                   PGPSEIEIRPFFDAADLAEFLMPEERSTPREGERGKLGVA"
FT   gene            complement(150313..150789)
FT                   /locus_tag="Mnod_8415"
FT   CDS_pept        complement(150313..150789)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8415"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: met:M446_3648 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8415"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62534"
FT                   /db_xref="GOA:B8IVU4"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU4"
FT                   /inference="protein motif:PFAM:PF06983"
FT                   /protein_id="ACL62534.1"
FT                   /translation="MVAKNTICLWYDKDAEAAARFYVETFPESAMGAVHRAPADYPSGK
FT                   AGDVLTVEFTVAGIPCIGLNGGPVFQHNEAFSFQIATDDQAETDRLWNAIIGNGGQESA
FT                   CGWCKDRWGISWQITPRVLTAAMAAGGEAAKRAFTAMMTMRKIDVAAIEAARRG"
FT   gene            151150..151488
FT                   /pseudo
FT                   /locus_tag="Mnod_8416"
FT   gene            complement(151696..151977)
FT                   /pseudo
FT                   /locus_tag="Mnod_8417"
FT   gene            152114..153775
FT                   /locus_tag="Mnod_8418"
FT   CDS_pept        152114..153775
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8418"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   ana:alr7249 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8418"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62535"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC39"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62535.1"
FT                   /translation="MSLRPHHPLPPVPEDTARVAQTAFRRGNPYLLLRTRLGTIFADAA
FT                   FADLYPARGQPAYAPWRLALVTLLQFRESMSDRQAAEAVRARIDWKYLLGLDLADPGFD
FT                   YSVLCEFRGRLLQHEATGRLLARILDAARDQGVLKARGRQRTDSTHVLAAVRDLNRVEL
FT                   LAETLRAALNAVAALAPDWLRRVAPPDWHERYDRRIEDARLPETGPKREAYVLQVGADG
FT                   YRLLDALDGASAPPLAVALPAVAVLRRVWARHFERAGDGSPPAGTSVRLRPVQGRGPGD
FT                   RVESPYDVEARFRAKSGTEWTGYMVHLTETCDPDLPRLVVHADTTPANVHEAMRTGVIH
FT                   AALAGLDLIPSEHLVDAAYISAEHLVAAHERHGIALIGPARSNQSWQTREEGAFHVTDF
FT                   AVDWERCRVCCPEGRESTSWGTYRDKVSGRAFIRAGFSPAVCRVCPAKPRCTRAGSRRL
FT                   SLHPRAEHEALAAARMRQESEEGRQLYGQRQGIEATIAQGVRSFGLRRARYRGLAKMTL
FT                   QSVATAAALNLDRLAAWFSHRPLAPTRTSRFEALAA"
FT   gene            153936..155408
FT                   /locus_tag="Mnod_8419"
FT   CDS_pept        153936..155408
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8419"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   acb:A1S_0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8419"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62536"
FT                   /db_xref="GOA:B8IVU6"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR029471"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU6"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL62536.1"
FT                   /translation="MNELGLTPQDVRAARALIQWSQAELAKVADVSVSTIADFEKGLRT
FT                   PIPNNLIAIRRAFESAGVQFTPAGPTIFSELSLHIMTQAGVTEMRFRYALDGAAAVQQI
FT                   IATFGSAEGDGVELEPVQTASPTLKAAIDALIQQHGSAVPPLNKLKKIISSLGDNEYFL
FT                   LLPEYPATTVEKLRLERYLHSLNHPEDQSADERIDDLFGLLLERYNISSPRTDQRTLIG
FT                   AERDPRTCRFCGRTAAGGATFKKAAHVIPTALGNDHLKSAEECDECNGYFGCETEPSLI
FT                   AMLDLQRVFLGTQGRGKNDGRPKLRFGEDILLHDGERVNIQSKSVIKDASDTFVVNLGR
FT                   GAPLTPSSVYRALVKMVVSVVDEEELPHLKETIEWVRHGTHSERPLPKVASSVIPLPLN
FT                   PSAQITIYTRRHSHPHLPHIVGEFRLGCYIYVFAVPFSDQDQWDLVGFFDEASFQETFK
FT                   HYFQAAKWMQQDLSRQDKVVMSPRLKFVRRSS"
FT   gene            156308..156991
FT                   /locus_tag="Mnod_8420"
FT   CDS_pept        156308..156991
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8420"
FT                   /product="Resolvase domain protein"
FT                   /note="PFAM: Resolvase domain; KEGG: bja:bll5010 putative
FT                   resolvase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8420"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62537"
FT                   /db_xref="GOA:B8IVU7"
FT                   /db_xref="InterPro:IPR006118"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU7"
FT                   /inference="protein motif:PFAM:PF00239"
FT                   /protein_id="ACL62537.1"
FT                   /translation="MNRYVSYLRVSTGRQGRSGLGLEAQRAAVAAHAAGGRIVAELVEV
FT                   ESGRRADRPELGRAHRATLVVAKLDRLARDAHFLLGLHKAGVDFVACDMPSANRLTVGI
FT                   MALVAEEEATLISARTKAALAAAKARGVKLGGFRGRAGTAREIAIANAARNAKADAFAA
FT                   NLAPVLGRLDPDGRLLLRELAAALDAEEIPTATGRGRWTAAGVRRVRARLAALEAPIEP
FT                   VRLAA"
FT   gene            156994..157392
FT                   /locus_tag="Mnod_8421"
FT   CDS_pept        156994..157392
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8421"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8421"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62538"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62538.1"
FT                   /translation="MKGAIIGLAAALVVASPAAAGKLYRCTGRDVVAAEEDGTVGRTNR
FT                   DFWLGYYRSFFVDTDTGSIRWSSGKLEEWLVTQKGGSSNDFVATPRSSLSGASTDFIRV
FT                   TGWERRPSVTFLVFRLSMMITGTCEVAQ"
FT   sig_peptide     156994..157056
FT                   /locus_tag="Mnod_8421"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 21"
FT   gene            157546..158160
FT                   /locus_tag="Mnod_8422"
FT   CDS_pept        157546..158160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8422"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_4114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8422"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62539"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVU9"
FT                   /inference="similar to AA sequence:KEGG:Mpop_4114"
FT                   /protein_id="ACL62539.1"
FT                   /translation="MRRVIAYVDGFNLYHAIDDLQKPHLKWLDLWQLAQSICGTGETLI
FT                   EVNFFTAYPTWKPGPMKRHQVYVKALRHAGVNCVIGHFKTKQRECKRCGAQGDVHEEKE
FT                   TDVAIAVQITTDAFLDGYDRALIISADSDLAPALRTVRQHFPRKALNVIAPPGRKGHAR
FT                   DLQPLFEITAGRLAKCLLPATATAEDGTVIFTRPPSYDPPV"
FT   gene            158298..158606
FT                   /locus_tag="Mnod_8423"
FT   CDS_pept        158298..158606
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8423"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8423"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62540"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62540.1"
FT                   /translation="MAETGNLSGAEGVLVQVLGVLTQTAAAEDPEVADRLRQVLAKAAQ
FT                   DCFVGGDTGGLDAVVELRRALPSVADPDDRAAVRRAPAKRLSKRRSPLDGPSAGAGS"
FT   gene            complement(158604..158695)
FT                   /locus_tag="Mnod_R0095"
FT                   /note="tRNA-Phe2"
FT   tRNA            complement(158604..158695)
FT                   /locus_tag="Mnod_R0095"
FT                   /product="tRNA-Phe"
FT   gene            158850..159470
FT                   /locus_tag="Mnod_8424"
FT   CDS_pept        158850..159470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8424"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6980 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8424"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62541"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62541.1"
FT                   /translation="MSDHQMMTYAEFGEAIGRSAAAARAICVRKRWKRIVGNDGKAKIA
FT                   IPLEVLEKPRKPRPNARPVDPPVDDADGQPVERADARSVDSAVESADTLTVVAILREQV
FT                   ARLEEDLERTRTDLDEARAALEAERVRAAQVEVLTVLLEIERKRAEEAQEAGARRVEEV
FT                   QEASNRRIEDLKAERDRWAAQAERLATPAPPERRGFFGWLRRA"
FT   gene            complement(159725..160222)
FT                   /locus_tag="Mnod_8425"
FT   CDS_pept        complement(159725..160222)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8425"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: vvy:VV1888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8425"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62542"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62542.1"
FT                   /translation="MSKEPEEAFPLGETARDRDVALARGALGLIPVVGSVIGELVTMTI
FT                   PNQRAERLETYARHLGERLQALEPDALRKTFENPENVDLFEDGAFQSARALSDERRERI
FT                   ARIVARGLTSDERGRTEAKRILRLLSSVEDDHLIILASLGKKLALEKDFQMTSSMILER
FT                   CT"
FT   gene            complement(160255..160467)
FT                   /locus_tag="Mnod_8426"
FT   CDS_pept        complement(160255..160467)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8426"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_6458 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8426"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62543"
FT                   /db_xref="GOA:B8IVV3"
FT                   /db_xref="InterPro:IPR010985"
FT                   /db_xref="InterPro:IPR013321"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV3"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_6458"
FT                   /protein_id="ACL62543.1"
FT                   /translation="MRLAEPAQTTLDGLPTAAASGHAPAVEVMRRLTFDIPEALHRRIR
FT                   IYCAENDQRMADVIRDLLEERFPAW"
FT   gene            160468..160970
FT                   /pseudo
FT                   /locus_tag="Mnod_8427"
FT   gene            161484..162098
FT                   /pseudo
FT                   /locus_tag="Mnod_8428"
FT   gene            162108..162479
FT                   /locus_tag="Mnod_8429"
FT   CDS_pept        162108..162479
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8429"
FT                   /product="transposase, IS4 family protein"
FT                   /note="KEGG: acr:Acry_3482 transposase, IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8429"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62544"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV4"
FT                   /inference="similar to AA sequence:KEGG:Acry_3482"
FT                   /protein_id="ACL62544.1"
FT                   /translation="MATLRTWPGLTTVLATETLRGGNGTDSVPAQVRHSLGSSTAPSEV
FT                   LAQAIRRHGALATGEPWVLEVSFGEERSRVRERCAARHLALLRRVALDRRRADASLTAS
FT                   RPAQDRGLGRRRHGPAAQG"
FT   gene            162831..164178
FT                   /pseudo
FT                   /locus_tag="Mnod_8430"
FT   gene            164444..164989
FT                   /locus_tag="Mnod_8431"
FT   CDS_pept        164444..164989
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8431"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8431"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62545"
FT                   /db_xref="GOA:B8IVV5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV5"
FT                   /inference="similar to AA sequence:KEGG:M446_6884"
FT                   /protein_id="ACL62545.1"
FT                   /translation="MAAPVPLRSDFDAAALRRLARASRDPAQTRRLLALSAIDAGGSRT
FT                   QAAALGGVGLQTGRDWVLAFNADGPDGLIDAKAPGARPRLNARQREALRALVEQEPMPA
FT                   IHGVVRWRLVDLVQILFEDHGVSVSQQTLSRVQRGMGYRKLSARPRHHAQDPQATAAFK
FT                   KPSPPAGRRSRRPQAASR"
FT   gene            164953..165501
FT                   /pseudo
FT                   /locus_tag="Mnod_8432"
FT   gene            complement(165414..166097)
FT                   /locus_tag="Mnod_8433"
FT   CDS_pept        complement(165414..166097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8433"
FT                   /product="alkylhydroperoxidase-like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase-like protein, AhpD
FT                   family; uncharacterized peroxidase-related enzyme; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG: pol:Bpro_5171
FT                   alkylhydroperoxidase AhpD core"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8433"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62546"
FT                   /db_xref="GOA:B8IVV6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV6"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACL62546.1"
FT                   /translation="MPRTAVPNPEQVSADSKRALDMFTNNIGFTPNMLATFAQSPIAFN
FT                   AWATLRGSLSKSLDLKTRESISLAVSEVNGCNYCLGVHSHGAELVKMPADEIILARKGR
FT                   ASDPKRDAAVQFARKVIETRGQVRDADVKAVCDAGYTDANVMEIVALVAMYSLTNFFNN
FT                   VFDPEKDCSGRFVSGVSRASFRDRMTGMRLIPTLIDQNPWAQARKPMEMMRQGWSMSLF
FT                   QAWQQ"
FT   gene            complement(166132..166632)
FT                   /locus_tag="Mnod_8434"
FT   CDS_pept        complement(166132..166632)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8434"
FT                   /product="protein of unknown function DUF417"
FT                   /note="PFAM: protein of unknown function DUF417; DoxX
FT                   family protein; KEGG: reh:H16_A1804 hypothetical membrane
FT                   spanning protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8434"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62547"
FT                   /db_xref="GOA:B8IVV7"
FT                   /db_xref="InterPro:IPR007339"
FT                   /db_xref="InterPro:IPR016865"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV7"
FT                   /inference="protein motif:PFAM:PF04224"
FT                   /protein_id="ACL62547.1"
FT                   /translation="MTNPIRLLIAERGAGSLNFLALLRWALVVIFLWFGGMKFTAYEAA
FT                   GIAPFIEHSPIMSWLHALFGAQGASYVIGVIELSTAAALILGAVQPIFSALGAAMSAAT
FT                   YLITLTFFLSTPGVAEGTAGGFPAISAAPGQFLLKDLVLLAASLSLLLASVQGPWLNVR
FT                   SRE"
FT   gene            complement(166764..167183)
FT                   /locus_tag="Mnod_8435"
FT   CDS_pept        complement(166764..167183)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8435"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   bbr:BB1210 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8435"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62548"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV8"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL62548.1"
FT                   /translation="MKFRTIIAAACTALAISIAGAALARDGEGQTVTKNFEAAIPNIPG
FT                   RSPIAVEVDYAPGAASAPHTHAKSAFIYAYVISGSIESKVNDGETRIYRAGESWSEPPG
FT                   ATHSISRNASKTEPAKLLAVFVLDANDKALTTPIK"
FT   sig_peptide     complement(167109..167183)
FT                   /locus_tag="Mnod_8435"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.991 at
FT                   residue 25"
FT   gene            complement(167323..167793)
FT                   /locus_tag="Mnod_8436"
FT   CDS_pept        complement(167323..167793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8436"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: pol:Bpro_5176 pyridoxamine 5'-phosphate
FT                   oxidase-related, FMN-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8436"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62549"
FT                   /db_xref="GOA:B8IVV9"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVV9"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACL62549.1"
FT                   /translation="MIEITADMHAIIKQAILSFVATVNEDGTPNLSPKASLTVTNGILY
FT                   FADIASPQTILNLGRNPAIEINVVDIFQRRGYRFKGRALVLPPGDDEYLMIANRVRATN
FT                   GPEYPVDHIVKIETTSIIPLLSPAQIFARPPRSQDEIRDTYHQKYGVKPIGS"
FT   gene            complement(167825..168520)
FT                   /locus_tag="Mnod_8437"
FT   CDS_pept        complement(167825..168520)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8437"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   pol:Bpro_5174 glutathione S-transferase-like"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8437"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62550"
FT                   /db_xref="GOA:B8IVW0"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR004046"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="InterPro:IPR040079"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVW0"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACL62550.1"
FT                   /translation="MTLNHPIFERWPAQYPDRLQLFSLPTPNGVKVGIMLEETGLAYEP
FT                   HRIDIMAAENHDPAFLALNPNGKIPAIYDPDGPSGKPLALFESGAILLYLADKTGQFIS
FT                   ADPNTRYETIQWVMWQMGGVGPMFGQVGFFNKFAGKAYEDKRPRDRYATESARLLGVLD
FT                   ERLAGREWVMGADYSIADISLLGWVRNLIGFYEARELVGFGRFLHVQAWLDRGVARPAV
FT                   QRGLEVTAS"
FT   gene            complement(168548..169258)
FT                   /locus_tag="Mnod_8438"
FT   CDS_pept        complement(168548..169258)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8438"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: short-chain dehydrogenase/reductase SDR; KR
FT                   domain protein; KEGG: mms:mma_0972 short-chain
FT                   dehydrogenase/reductase SDR"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8438"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62551"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVW1"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL62551.1"
FT                   /translation="MNKSQKVVVVTGASQGIGAEVVKAFRKLDYRIVVTSRSIKQSDDE
FT                   NILSIVGDIGDPTTAQRVISEGVSRFGRIDTLVNNAGIYIGKPFTEHTAEDYAAVMNVN
FT                   MAGFYYITQLAIAEMEKHSSGHVVSVTTSIDQVAISGIYSVLAAMTKGGLNAATKSQAI
FT                   EYAKKGIRVNAVAPGNIKTPMHAPENHEALSAFQPIGRMGETSDIANAILFLDSAPFIT
FT                   GEILHVDGGQSAGR"
FT   gene            complement(169415..169960)
FT                   /locus_tag="Mnod_8439"
FT   CDS_pept        complement(169415..169960)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8439"
FT                   /product="alkylhydroperoxidase-like protein, AhpD family"
FT                   /note="TIGRFAM: alkylhydroperoxidase-like protein, AhpD
FT                   family; PFAM: Carboxymuconolactone decarboxylase; KEGG:
FT                   reh:H16_A1800 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8439"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62552"
FT                   /db_xref="GOA:B8IVW2"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVW2"
FT                   /inference="protein motif:TFAM:TIGR00778"
FT                   /protein_id="ACL62552.1"
FT                   /translation="MARTTALNPEQVPADSRPTLDAFTKNIGFTPNMMATFAQSPIAFN
FT                   AWATLLGSLSKALDVKTRDSIGLAVSEVNGCNYCLTVHSFTAEHMAKLPANEIILARKG
FT                   HASDPKRDAALQFARKVIETRGKVSDADVKAVRDVGYTDANVMEIVALVAMYSLTNFFN
FT                   NVFDPEQDFPAVTPAGSI"
FT   gene            complement(169997..170614)
FT                   /locus_tag="Mnod_8440"
FT   CDS_pept        complement(169997..170614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8440"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: bmj:BMULJ_04549
FT                   nitroreductase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8440"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62553"
FT                   /db_xref="GOA:B8IVW3"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVW3"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACL62553.1"
FT                   /translation="MTNAVIECILSRSSTKYYDPATTLSDDQIRELVRIGTTAPTSFHL
FT                   QNWRFIAVRTPEAKARLRPIAWNQPAITEAAVTFIICGQLADSNVIPERPAPVVEAGIM
FT                   PANLVPDWEIPARGLYQDFPQRQRDEAVRTATFGAAAMIYVARSWGLGSTPMIGFDDKA
FT                   VHREFGLAEDEVPVMLLSVGAECPGNWPQKPRRPVADVLQLV"
FT   gene            complement(170824..171741)
FT                   /locus_tag="Mnod_8441"
FT   CDS_pept        complement(170824..171741)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8441"
FT                   /product="Alcohol dehydrogenase GroES domain protein"
FT                   /note="PFAM: Alcohol dehydrogenase zinc-binding domain
FT                   protein; Alcohol dehydrogenase GroES domain protein; KEGG:
FT                   fra:Francci3_2731 alcohol dehydrogenase GroES-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8441"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62554"
FT                   /db_xref="GOA:B8IVW4"
FT                   /db_xref="InterPro:IPR011032"
FT                   /db_xref="InterPro:IPR013149"
FT                   /db_xref="InterPro:IPR013154"
FT                   /db_xref="InterPro:IPR020843"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVW4"
FT                   /inference="protein motif:PFAM:PF08240"
FT                   /protein_id="ACL62554.1"
FT                   /translation="MKAIMVTDQAAGLAGMKLTERPEPPAAINDVIVQIHASGFVPTEM
FT                   EWPSTWTDRRNRDRTPSIPGHELAGVVTALGYGTTGLSVGQRVFGLADWYRDGTLAEYV
FT                   AIEARNLAPLPGDVDFTVGASLPISGLTAWQGLFQHGRLQAGQSVLAHGAAGAVGTMVT
FT                   QFAREAGAYVIGTGRAADRQKALDFGAQEFVDLDNDALEDVGGVDLVFDVIGGDIGKRS
FT                   ARLIRAGGTLVSIVGPPEARPADGLTVDFVVESDRAQLSEIVQRVRDGRLRTNIGNVST
FT                   LDDALAALNPTERRRGKTIIRVRQ"
FT   gene            complement(172317..173279)
FT                   /locus_tag="Mnod_8442"
FT   CDS_pept        complement(172317..173279)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8442"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: mms:mma_0956 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8442"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62555"
FT                   /db_xref="GOA:B8IVW5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVW5"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL62555.1"
FT                   /translation="MIAVSATKLATADLNNLMQALEIDVIALTEMLIPSGYRAEMGTID
FT                   APAIHYTISGRGRISIGNGPSMSLEPHLLIIKPPNTPFAIEVDGASGPKRLISRDCWKR
FT                   HDGVLRIGMPTEQPEVIQICGFFNASFGQSVGLFRELHEPVVEKFEPTDKIDLKLREAI
FT                   EELCAQEIGMGAMTASLLKQVIVALVRRSMKSSRSWTDRFSILADRQITRAFADMVARP
FT                   GAAHTVRSLAHSAGLSRSAFMARFSEIFGRSPMGILRDLRMRQAALDLTTTSAPVDVVA
FT                   YNAGYESRSSFVRAFRKAYNVDPSEYRQRVKNGEGDKGA"
FT   gene            173570..173953
FT                   /locus_tag="Mnod_8443"
FT   CDS_pept        173570..173953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8443"
FT                   /product="transposase"
FT                   /note="KEGG: mrd:Mrad2831_5182 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8443"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62556"
FT                   /db_xref="GOA:B8IC28"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC28"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5182"
FT                   /protein_id="ACL62556.1"
FT                   /translation="MPSALSVDLRQRVVSAVAEGASCHQAAARFGVSVASVSRWSRQQE
FT                   GQGDVTPKPMGGDQRSQRIEAHAELILQTYQAHPQSFLHELCETLQEQGVPVSRSSLSR
FT                   FFARHRITRKKGRRTQLSRSGRM"
FT   gene            174010..174531
FT                   /locus_tag="Mnod_8444"
FT   CDS_pept        174010..174531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8444"
FT                   /product="putative transposase of insertion sequence"
FT                   /note="KEGG: mrd:Mrad2831_5181 putative transposase of
FT                   insertion sequence"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8444"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62557"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B8IAL5"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5181"
FT                   /protein_id="ACL62557.1"
FT                   /translation="MFLDETAATTSMVRRYGWAPRGERCRLAAPAGHWKTTTVIAGLRT
FT                   SGPDAIALLDGPVTGERFRAYVTDTLVPTLRPGDTVILDNLGAHKVAGVREAIAATGAR
FT                   LLYLPPYSPEFNPIEQAFAKLKALLRRAAARSVSELWAAIHQAFKCFSPAECRNYFTAA
FT                   GYEDDAYAST"
FT   gene            174604..175938
FT                   /locus_tag="Mnod_8445"
FT   CDS_pept        174604..175938
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8445"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   xau:Xaut_4843 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8445"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62558"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Y5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62558.1"
FT                   /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLSA
FT                   ILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPDFR
FT                   TIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGRMKA
FT                   AESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKAALEA
FT                   EAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRDGFVQG
FT                   YNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGFATEANL
FT                   AALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRYRLRKQVV
FT                   EPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
FT   gene            complement(176215..176916)
FT                   /locus_tag="Mnod_8446"
FT   CDS_pept        complement(176215..176916)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8446"
FT                   /product="putative transposase"
FT                   /note="KEGG: oan:Oant_4519 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8446"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62559"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVW9"
FT                   /inference="similar to AA sequence:KEGG:Oant_4519"
FT                   /protein_id="ACL62559.1"
FT                   /translation="MTVLSYSGYRFPRDIIQRAVWLYLRFTLRFRDVEELLAERGITVT
FT                   YESIRRWVLTFGPTIARGLRARRPKPHARWHLDEVFVRISGTQMDLWRAVDAEGEVLDV
FT                   LLQTKRDRRAAQKLMRKLLKKQGMAPETWVTDKCPAYGAALREMKLSRVDHVQRKRANN
FT                   RAESSHVPVRRREAKLQGFESPGSAQRVLSMPAATYNTFTVPRHLVSARTHRLFRAEAF
FT                   AMWRGAAGAPA"
FT   gene            177097..177744
FT                   /locus_tag="Mnod_8447"
FT   CDS_pept        177097..177744
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8447"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8447"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62560"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX0"
FT                   /inference="similar to AA sequence:KEGG:M446_1352"
FT                   /protein_id="ACL62560.1"
FT                   /translation="MSCEPPRSARTFDALLTLPLRALSVLAETFPFQVSLREESHTIGN
FT                   LDPPRPAAGVLADAQPSAAPFGTTHELLGLHDAGVERHHPYATLADAAIDCPRADRWLS
FT                   RARARQQGRYGAFWDSEDLASVDAADPGLGRPAARFLHGLNLTGIAPITLANDPFWNVR
FT                   AFDNALSRHDGYRLSSFICAMNQLVLDDITESAPRMIDTMGVPDRQDFDARP"
FT   gene            complement(178284..178499)
FT                   /locus_tag="Mnod_8448"
FT   CDS_pept        complement(178284..178499)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8448"
FT                   /product="putative molybdenum-binding oxidoreductase"
FT                   /note="KEGG: rle:pRL80077 putative molybdenum-binding
FT                   oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8448"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62561"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX1"
FT                   /inference="similar to AA sequence:KEGG:pRL80077"
FT                   /protein_id="ACL62561.1"
FT                   /translation="MSGDGGRTWTGAALAPRNGHGWRERSCALAFASDGPVTLMCRATD
FT                   AAFRTQPMGGLRNEVHRVPVTVSRVG"
FT   gene            complement(178565..179161)
FT                   /locus_tag="Mnod_8449"
FT   CDS_pept        complement(178565..179161)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8449"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3139 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8449"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62562"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX2"
FT                   /inference="similar to AA sequence:KEGG:M446_3139"
FT                   /protein_id="ACL62562.1"
FT                   /translation="MPSPKSVHLTAALVLAVAVGRASAEERPAQDWPAASRAAADAIVA
FT                   KYGPPQEQTATLLIWYRNGPWIRTVVHKLGAEHDFPVKHQDVLEQSLPYKVPLNLYSAV
FT                   ATFNGSVIPDRTRGTLTAFGASEAENILSLNLARAVVRGEMNAEQARDAQVAAERDLAN
FT                   GKTPEIAAKLRIEQQQEGDVTDPDTAMILPPGRTP"
FT   sig_peptide     complement(179087..179161)
FT                   /locus_tag="Mnod_8449"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.998 at
FT                   residue 25"
FT   gene            179294..179764
FT                   /locus_tag="Mnod_8450"
FT   CDS_pept        179294..179764
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8450"
FT                   /product="(2Fe-2S)-binding domain protein"
FT                   /note="PFAM: ferredoxin; [2Fe-2S]-binding domain protein;
FT                   KEGG: met:M446_3138 2Fe-2S iron-sulfur cluster binding
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8450"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62563"
FT                   /db_xref="GOA:B8IVX3"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR002888"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="InterPro:IPR036884"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX3"
FT                   /inference="protein motif:PFAM:PF01799"
FT                   /protein_id="ACL62563.1"
FT                   /translation="MAHQLSLNVNGRAAPVSVDDPDTPLLYVLRDDLGLRGPRFGCGLG
FT                   QCGACTVHVDGQAVLSCITPMSSLKPEAKIVTLEGLGSPEKLHPVQAAFIAEQAAQCGY
FT                   CINGMIMQSAALLNQNRKPDEAAIRQALAGNLCRCGTHLRIVRAVQRAAQSL"
FT   gene            179776..181998
FT                   /locus_tag="Mnod_8451"
FT   CDS_pept        179776..181998
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8451"
FT                   /product="aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding"
FT                   /EC_number="1.3.99.16"
FT                   /note="PFAM: aldehyde oxidase and xanthine dehydrogenase
FT                   molybdopterin binding; KEGG: met:M446_3137 aldehyde oxidase
FT                   and xanthine dehydrogenase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8451"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62564"
FT                   /db_xref="GOA:B8IVX4"
FT                   /db_xref="InterPro:IPR000674"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008274"
FT                   /db_xref="InterPro:IPR012368"
FT                   /db_xref="InterPro:IPR037165"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX4"
FT                   /inference="protein motif:PFAM:PF02738"
FT                   /protein_id="ACL62564.1"
FT                   /translation="MNAPVFSRRALLQGGALVVGFSLAGRSALAQTAASVATNGFSKAI
FT                   APDQVDSFLALGADGRATIFSGKVDLGTGVETAMAQIAAEELDLPLDHVTVVQGDTALT
FT                   PDQGPTYGSLSIQKGGVEIRQAAATARARLVQLASERLGAPIDALVTENGSVRPKAGGT
FT                   GVSYADLLKDGRFETKVDSAVTTKDPAQFALVGKSVPRLDIPEKMTGHFTYMQDFRVPG
FT                   MVHARVVRPPAISATLKSVDEGSVASIPGLIKVVRQGNFLAVVTEREWAAIKAASQLKA
FT                   TWSAWAGLPAQDQLWEHVRATKVTKDDVTSSTGDAEGALAQASKVLQATYDFAIHTHGS
FT                   IGPSCAVAEFKDGLLTCWTASQMTHALRMQLAAMTGLAPEAVRCIYIEGSGCYGRNGHE
FT                   DAAGDAALLARAVGRPVRVQWSRADEHGWDPKGPPTLIDLKAGLDAAGNVAAWSSQFHV
FT                   PEGAAGNVPLVAATLAGLPHETTMAPGNVIQNSALPYGFPNVRTVCHRLADTPFRPSWI
FT                   RTPGRMQNTFANEAFLDECAATAGADPLEYRLRVLKDPRGITVLKRVAEIAGWQARPSP
FT                   LKEDARADVLRGRGLSYVRYELNRTYVAGVAEVEVDRKTGQVRVPRFFVAQDCGQIINP
FT                   DGVRNQLDGNVIQTVSRVLMEEVTFDRSAVTSLDWASYPIITFPDVPQVVTDLIDRPTE
FT                   KPWGAGEPSAAIVPAAISNAIFDATGARLRSVPFSPAKVKAALQGT"
FT   sig_peptide     179776..179868
FT                   /locus_tag="Mnod_8451"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.998) with cleavage site probability 0.991 at
FT                   residue 31"
FT   gene            182166..183026
FT                   /locus_tag="Mnod_8452"
FT   CDS_pept        182166..183026
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8452"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; integrase domain
FT                   protein SAM domain protein; KEGG: nha:Nham_0858 phage
FT                   integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8452"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62565"
FT                   /db_xref="GOA:B8IVX5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX5"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL62565.1"
FT                   /translation="MTHDAVSPLRRRMIEDMTIRRFGEHTKRDYIRQIREFTIFLGRAP
FT                   DLAEPEDLRRYQLHMASLGASYARMNLAITALRFFFHVTLGRSGFADRLARIPTPERLP
FT                   VVLSPEEVALLLAHAPSLKYRAALSVAYGCGLRVSEIANLKVTDIDSARMLIRVEQGKG
FT                   RKDRFVMLSPDLLDLLRQWWRVKRPRGWLFPGQQPAQPITTRQLNRACHAAAEAARIDK
FT                   RVSMHTLRHSFATHLLERKTDIRVIQVLLGHRKLDTTAVYTRVALKAIREVTSPLALLA
FT                   SPPPP"
FT   gene            183042..184247
FT                   /locus_tag="Mnod_8453"
FT   CDS_pept        183042..184247
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8453"
FT                   /product="putative transposase"
FT                   /note="PFAM: putative transposase; KEGG: bxe:Bxe_C0821
FT                   putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8453"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62566"
FT                   /db_xref="GOA:B8IVX6"
FT                   /db_xref="InterPro:IPR007069"
FT                   /db_xref="InterPro:IPR026889"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX6"
FT                   /inference="protein motif:PFAM:PF04986"
FT                   /protein_id="ACL62566.1"
FT                   /translation="MARSSLEVADILNRHGDAFLARHRPSHGQMKVMAAIRACRTAALG
FT                   GHVVRCEGCDHVAIASNSCRNRHCPKCQGQTARAWLERRQADLLPVPYYHVVFTLPAPV
FT                   AAVAFQNKAAVYDLLFRTAADTLLTIAADPKHLGAKIGLTAVLHTWGSAMTHHPHVHIV
FT                   VPGGGLSSDGSRWIACRPGFFLPVRVLSRLFRRLFLTRLAEAHRVGRLGFHGELAPLAE
FT                   AGAFAAHLAPLRRAEWIVYAKRPFAGPEAVLAYLSRYTHRVAIANSRLIAMDERGVTFR
FT                   WKDYRARDGAKGREWIKTMTLAPDEFIRRFLLHVLPDGFHRIRHYGLFASGTRAANITR
FT                   IRSLLAPMQAPCAAKPEPAAMTDPPAGPACPCCGGRLVVIERFRRGEVPKLRPSAVRIN
FT                   TS"
FT   gene            complement(184743..185246)
FT                   /locus_tag="Mnod_8454"
FT   CDS_pept        complement(184743..185246)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8454"
FT                   /product="transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: met:M446_6904 transposase and inactivated
FT                   derivatives-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8454"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62567"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX7"
FT                   /inference="similar to AA sequence:KEGG:M446_6904"
FT                   /protein_id="ACL62567.1"
FT                   /translation="MVLTSATDASLRWCSTPPPWHVDAVGGRPPHHWKTTTLIAGLRLQ
FT                   GFTAPYVLDGAVNRATFEAYVGQILVPDLKPGDLVIMDNLPSHKGPRVRQMIEAAGARL
FT                   LHLPRYSPDLNPIENAFAKLKALLRKAAERTVEGLWDAVGRLLEKITSDDCAGFFAHAE
FT                   YVSV"
FT   gene            185251..186252
FT                   /locus_tag="Mnod_8455"
FT   CDS_pept        185251..186252
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8455"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: nha:Nham_3939
FT                   transposase IS116/IS110/IS902"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8455"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62568"
FT                   /db_xref="GOA:B8IVX8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL62568.1"
FT                   /translation="MDLAKHVFQAHGASAAGAVLFRKKLRREQVLSFFAGQPRCRVALE
FT                   ACASAHHWARAIGELGHEVKLIPPAYVKPFVKRQKNDAADAEAICEAAQRPTMRFVAVK
FT                   SEAKQAAAVIFRARDLLVGQRTQIINALRGHLGEYGLIAPQGPSNIERLIVQVEDPTSG
FT                   IPAAARACLVRLVAVLRHLQDEIAELDKAVAARAKADAAARRLMTVPGIGPLIATAIEA
FT                   LAPPAETFRSGRDFAAWVGLTPIQRSTGGKERLGRTSRMGERTLQRLLIFAASAVVRWA
FT                   KRKGVPAGSWLGRMLARKPPMLVIVALANKNARVAWALLAKGGTYRAPAVAA"
FT   gene            complement(186415..186675)
FT                   /pseudo
FT                   /locus_tag="Mnod_8456"
FT   gene            complement(186677..187137)
FT                   /pseudo
FT                   /locus_tag="Mnod_8457"
FT   gene            complement(187148..188476)
FT                   /locus_tag="Mnod_8458"
FT   CDS_pept        complement(187148..188476)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8458"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   met:M446_4016 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8458"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62569"
FT                   /db_xref="GOA:B8IVX9"
FT                   /db_xref="InterPro:IPR004752"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVX9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62569.1"
FT                   /translation="MNAPAVVRPEKTPFWSALFTDRRIAPALGLGFTSGIPFLLVYATQ
FT                   AAWLSDIGISIATIGLLSELTLAYKFKFVWAPFLDRYDPPLLGRALGRRRGWIVVAQLS
FT                   VMAMLAGIAFGDPAHWLAWTIAFSLALGFAGATLDLVIDGWRITSVRPPEKQAVLSSWT
FT                   EIGWRVGNLAAGAGALFLADRIGWRGAYLSMGALMGVGMLAAVLAPEPPSDQLPHQARA
FT                   GFADTVWAPIRELLTRLGPMAPAILLLVAGFRMPGYVASAMAVPLFKHQGFSNTDIATV
FT                   TKLFGFWIGLGGTFLAGALVPRIGMLPSLLIGTVAGSASHLSLAYLAAHGGDGGTAFWT
FT                   FAVTVSIDGFAYAFASVVLITYMSTLASEEHAASQFGLLTSLCAFPGSLLAGLSGFVVE
FT                   WTGFPWFFVWTSLIGLPVALLAFYVWAKVGISDEATQPPKTAS"
FT   gene            complement(188897..189697)
FT                   /locus_tag="Mnod_8459"
FT   CDS_pept        complement(188897..189697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8459"
FT                   /product="transcriptional regulator, IclR family"
FT                   /note="TIGRFAM: beta-ketoadipate pathway transcriptional
FT                   regulators, PcaR/PcaU/PobR family; PFAM: regulatory protein
FT                   IclR; Transcriptional regulator IclR; KEGG: rpt:Rpal_1174
FT                   transcriptional regulator, IclR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8459"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62570"
FT                   /db_xref="GOA:B8IVY0"
FT                   /db_xref="InterPro:IPR005471"
FT                   /db_xref="InterPro:IPR012794"
FT                   /db_xref="InterPro:IPR014757"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY0"
FT                   /inference="protein motif:TFAM:TIGR02431"
FT                   /protein_id="ACL62570.1"
FT                   /translation="MPRVRRSETDQQLVDEHGPDFSEALARGLRVISAFGAERRLMTLA
FT                   DVARVVDLPRATVRRALYTLDCLGYVRSDGRLFQLTPKVLSLATAYLASNSLSATLQQT
FT                   VEQISAQLNEACSAAILDGDDIVFIARAGPTRMLGVGVDVGYRIPAYCSSMGRVLLGGL
FT                   DEKDLAAFLDRIRPEPLTPHTLVDRAALQAAIHRDRERGYSLVDQEAEVGYRSLAVPVR
FT                   RYDGRIVCALNAGANADRVAVDRMVESFFPVLRDAATVLGPQMI"
FT   gene            complement(189799..191049)
FT                   /locus_tag="Mnod_8460"
FT   CDS_pept        complement(189799..191049)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8460"
FT                   /product="FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase"
FT                   /note="PFAM: FAD-dependent pyridine nucleotide-disulphide
FT                   oxidoreductase; KEGG: azo:azo2529 probable putidaredoxin
FT                   reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8460"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62571"
FT                   /db_xref="GOA:B8IVY1"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR028202"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY1"
FT                   /inference="protein motif:PFAM:PF00070"
FT                   /protein_id="ACL62571.1"
FT                   /translation="MRHGGPLVIVGASYAGLQVAASAREAGYEGRIVLVGAEDSLPYQR
FT                   PPLSKGFLSGKVGETDLALRPASFFDAVRIELELGTKATALEPASRSVSLSNGRRLAFG
FT                   SLVVATGSRARRHPALDGRAGNIRYLRSLDDARVLRERLSAAREVVVVGGGFIGLEVAS
FT                   AIRGLGKEVTLLAAGSRLLPRAIDGEIAGFLLRLHRAHGVKVELDAAVVGVEVKGEHAR
FT                   QVHVSNGRSFPCDLVLVGVGADPDVALLASAGICSPDGVPVDQYGRTDHPDIFAAGDCT
FT                   LHFNRYAGTILRLESVQHAIDQAKVVADALVGRDRSYDAVPRFWSDQYDAKLQMVGLPR
FT                   GADRRVLRGAPEEGRFSVLHFSKGRLICVQGIGRPADVAAGRRLLAAGRSPPPALAGDR
FT                   SRDLADFLADEAPRASA"
FT   sig_peptide     complement(190987..191049)
FT                   /locus_tag="Mnod_8460"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.669) with cleavage site probability 0.344 at
FT                   residue 21"
FT   gene            complement(191046..191369)
FT                   /locus_tag="Mnod_8461"
FT   CDS_pept        complement(191046..191369)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8461"
FT                   /product="ferredoxin"
FT                   /note="PFAM: ferredoxin; KEGG: pol:Bpro_5152 ferredoxin"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8461"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62572"
FT                   /db_xref="GOA:B8IVY2"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR001055"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY2"
FT                   /inference="protein motif:PFAM:PF00111"
FT                   /protein_id="ACL62572.1"
FT                   /translation="MPRIVFVGRDGAEHGVEVPAGISAMAAAIRSNVRGIEAECGGSLD
FT                   CATCHVYVDNRFVGLLPEPSELEREMLACVAADRRETSRLSCQIVLTPELEGLTLHLPE
FT                   VQS"
FT   gene            191558..192904
FT                   /locus_tag="Mnod_8462"
FT   CDS_pept        191558..192904
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8462"
FT                   /product="Rieske (2Fe-2S) domain protein"
FT                   /note="PFAM: Rieske [2Fe-2S] domain protein; KEGG:
FT                   bbt:BBta_0877 putative dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8462"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62573"
FT                   /db_xref="GOA:B8IVY3"
FT                   /db_xref="InterPro:IPR017941"
FT                   /db_xref="InterPro:IPR036922"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY3"
FT                   /inference="protein motif:PFAM:PF00355"
FT                   /protein_id="ACL62573.1"
FT                   /translation="MMSREQNDHITRSGPGTPLGTLMRRYWQPAALVDELQGERPVVPV
FT                   QLLGEKFVLFRDEAGRYGLLDRDCPHRGADLAFGRLEHGGLRCAFHGWLFDVEGRCLET
FT                   PAEPVGSKLCRNIRQRAYPVVERSGILFAYLGEGEPPAFPELDCFLAPNAYTFAFKGLF
FT                   ECNWLQALEVGIDPAHASFLHRFFEDEDTASSYGKQFRAASADSELPMTKILREYDRPL
FT                   INVERTEYGMRLIALREIDEERTHVRVTNQVFPHAFVIPMSADMTITQWHVPVDDERCY
FT                   WYAIFTSYTSPVDKKRMREQRLELYELPEYRSRKNRTNDYGFDPHEQAHATYTGMGLDI
FT                   NVHDQWAVESMGPIQDRTREHLGQSDKAIVLYRRILREQIDKAVKGDVPLMVLDGRHAK
FT                   SIQGPATMDGIGPSKGWETYWMEVDVRRRRGAPWMPAVPTDVARLNAAE"
FT   gene            192946..194382
FT                   /locus_tag="Mnod_8463"
FT   CDS_pept        192946..194382
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8463"
FT                   /product="glutamine synthetase catalytic region"
FT                   /note="PFAM: glutamine synthetase catalytic region; KEGG:
FT                   rpb:RPB_2269 glutamate--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8463"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62574"
FT                   /db_xref="GOA:B8IVY4"
FT                   /db_xref="InterPro:IPR008146"
FT                   /db_xref="InterPro:IPR014746"
FT                   /db_xref="InterPro:IPR036651"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY4"
FT                   /inference="protein motif:PFAM:PF00120"
FT                   /protein_id="ACL62574.1"
FT                   /translation="MTFVQDHGLWTDAQADAARDVRERCDPERIDTVRLSFPDQHGILR
FT                   GKTLVASEAVKALTGGCAITTTMLAKDTSHRTVFPVFTAGGGFGMREMEGAADVVMVPD
FT                   PTTFRTLPWAPRTGWLLCDLYFQDGRPVPFATRGIYRSVLDRLSERSLEYVAGLEVEFH
FT                   VFKLDDPRMAPADAGQPGEPPSVSLISHGYQYLTEQRYDQVEPILEILRKDVLALGLPL
FT                   RSIEVEYGPSQCEFTFQPTAGAVPADLMVLFRSAVKQTCRRHGYHATFMCRPRIPNVVS
FT                   SGWHLHQSLRDARTGANAFVPGDGSQPLSGFGMGFLGGLLAHARAATVFTTPTINGYKR
FT                   YRSYSLAPDRAVWGRDNRGVMIRVLGGPGDPATRLENRVGEPAANPYLYMAAQVLAGLD
FT                   GADRNLDPGPSADTPYEAEADLLPTSLREAVFALREDPFFRGALGESFVDYYTHIKNAE
FT                   IERFQSEITEWEQREYFEIF"
FT   gene            194409..195641
FT                   /pseudo
FT                   /locus_tag="Mnod_8464"
FT   gene            complement(195706..195906)
FT                   /pseudo
FT                   /locus_tag="Mnod_8465"
FT   gene            195907..196176
FT                   /pseudo
FT                   /locus_tag="Mnod_8466"
FT   gene            complement(196449..196772)
FT                   /pseudo
FT                   /locus_tag="Mnod_8467"
FT   gene            complement(197056..197613)
FT                   /locus_tag="Mnod_8468"
FT   CDS_pept        complement(197056..197613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8468"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bph:Bphy_6975 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8468"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62575"
FT                   /db_xref="InterPro:IPR032345"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY5"
FT                   /inference="similar to AA sequence:KEGG:Bphy_6975"
FT                   /protein_id="ACL62575.1"
FT                   /translation="MDGREQLIERSIPFLDEVKNMTAGPEVERWLNETYGPGSALYEDL
FT                   SRLIKQGVEEGWAANIEVGGRRYRRSRLCEPMARTLNFSITAVYMDSQGGRMAVDYHDG
FT                   EPGDADASFRGDYHGHPYGELNMVVPLDENAVLAGPSGWCHAGWTAPAPGSHHYPEVKG
FT                   GALIALFFLPAGRISYDVKPPS"
FT   gene            complement(197615..198337)
FT                   /locus_tag="Mnod_8469"
FT   CDS_pept        complement(197615..198337)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8469"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: cti:RALTA_A1302 putative
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8469"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62576"
FT                   /db_xref="GOA:B8IVY6"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY6"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACL62576.1"
FT                   /translation="MANLDLVQALDGVMKGRFATRFYIDRPVSHGTIRDILDAARYAPS
FT                   GANIQPWRVYVLAGAVKAEICRDIVATHAAEAAHHASEYTYYAPSLPDLYQSRKQAFGR
FT                   IFYGSLGIAQDDLRGRAAQTAKNYDFFGAPVGLIFTLDRRLEKGSWLDLGMFLQNVMLA
FT                   AKVRGLDTCPQETLAKYHRVLRRHLPIAAEDVVVCGMALGVCDAAAVATRGVMERASVE
FT                   AFASFHGFEAPRAHDQGE"
FT   gene            complement(198340..199575)
FT                   /locus_tag="Mnod_8470"
FT   CDS_pept        complement(198340..199575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8470"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems, periplasmic component"
FT                   /note="KEGG: mag:amb2327 ABC-type branched-chain amino acid
FT                   transport systems, periplasmic component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8470"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62577"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY7"
FT                   /inference="similar to AA sequence:KEGG:amb2327"
FT                   /protein_id="ACL62577.1"
FT                   /translation="MPFSPALAQRFLRRGSLALTGLWLAVSPAVAEGGPPVRIGVLTDL
FT                   SSLYADNSGNGSVVAARMAVEDFGGRVLGRPIEVIAADHQNKTDVGAALARRWLDADDV
FT                   KVIADVPNSAIALAVQDITRERRRFFLASGAATSRLTGDACSPTGIHWTYDTYALAQGT
FT                   ARAVTRRGGKSWYFVTADYALGTQFEEDGRRVIQAAGGRVLGSVRHSIGSPDFSSYLLQ
FT                   AQGSGAQVVGLADAGGDLILALKQAAEFGVVQSGQTLAGLLVFIADIHGLGLPAAQGLI
FT                   LSTAFYWDLNDETRAWSQRFVARTNKVPTMIHAGTFGAVTHYLRAMAAANTDDGPTGAA
FT                   QMRKMPVNNFMTRDGHIREDGPLVRDIYLMQVKSPAESKTRFDYYKLLETIPGEEAFRL
FT                   ISAGNCPLVTRG"
FT   sig_peptide     complement(199480..199575)
FT                   /locus_tag="Mnod_8470"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.983 at
FT                   residue 32"
FT   gene            199688..200713
FT                   /locus_tag="Mnod_8471"
FT   CDS_pept        199688..200713
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8471"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bph:Bphy_6977 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8471"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62578"
FT                   /db_xref="GOA:B8IVY8"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY8"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62578.1"
FT                   /translation="MTRGAGTRASILNRLDLNLIRLFDAVMRERHVARAGQSLGLSQSA
FT                   VSHGLRRLRTLIGDDLFVRTVQGMEPTPRALAMAVQVRDALTAIEGAIGPQRFDPASST
FT                   RQFRLAATDHITAVVAPALMRTFETEAPLASILIRPATRIDLTMQVDLGQIDIVVGIFS
FT                   QIPHRLHARTLFEDRDVLVTAPDHPEAGGATDIRTLARDPLMVVTVGGTEDGLPDGRLS
FT                   ERGLTRQTEMFDRDALNRAFRAAGLVPRLSVLQPHFLAVPSLLADSRRVAIVPASLAHG
FT                   FEAAGVARVSMPPWEPRTMAVQMVWHERWRQDPAHAWLREALFRASRGIADAVGQATDQ
FT                   S"
FT   gene            complement(200929..201021)
FT                   /locus_tag="Mnod_8472"
FT   CDS_pept        complement(200929..201021)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8472"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8472"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62579"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVY9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62579.1"
FT                   /translation="MFDFLTRFPDIRRHAALSCQARQQKRPLWL"
FT   gene            complement(201108..201809)
FT                   /locus_tag="Mnod_8473"
FT   CDS_pept        complement(201108..201809)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8473"
FT                   /product="putative transposase"
FT                   /note="KEGG: oan:Oant_4519 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8473"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62580"
FT                   /db_xref="GOA:B8IVZ0"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ0"
FT                   /inference="similar to AA sequence:KEGG:Oant_4519"
FT                   /protein_id="ACL62580.1"
FT                   /translation="MNAPSYAGYRFPSDIIQRAVWMYLRFTLSYRDVEELLAERGISVA
FT                   YESIRRWVLSFGPAIARRLRASRPKPHGRWHLDEVFVQISGRQMYLWRAVDAEGEVLDV
FT                   LVQPKRDRRAAQKLMRKLLKKQGMAPEAWVTDKCPAYGAALREMKLSGAEHVQRKRANN
FT                   RAESSHVPVRRRDRKQQGFKSARSAQRFLSMHAATYNTFTVPRPLVSAPTHRLLRAEAF
FT                   DMWRSAAGVAA"
FT   gene            202153..202849
FT                   /pseudo
FT                   /locus_tag="Mnod_8474"
FT   gene            202813..204153
FT                   /locus_tag="Mnod_8475"
FT   CDS_pept        202813..204153
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8475"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   bpt:Bpet2958 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8475"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62581"
FT                   /db_xref="GOA:B8IVZ1"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ1"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62581.1"
FT                   /translation="MGAAVAARGADVSRATRLSALLGVARSPRQVYFGWWVVVCAFVVA
FT                   TFAWGVGFYGPSIFLAALHLKHGWPVSLTSAAVTAHFLVSAGIVSQIARLHVRLGLVAV
FT                   TRLGAASASAGMLGWALAAAPWQLFPAALLTGTGFALTSGAAINAMVSPWFRRLRPAAL
FT                   GAAFNGASVGGIVFAPLWQFLIVRLDLLGAAVVMGAAMTGSLWWCAGRFLRPTPESLGL
FT                   LPDGAAVQAAEARAEPAARQPALPAGAAALTDRRFLTLSAAFSLGLFAQIGIIVTLVLV
FT                   AAPMLGEDWASVAVSLVTACAIAGRTLVGMLLPARSDWRIVASGNFTLQAVGTLALVAA
FT                   GTQSLVLLLAGCVLFGIGVGSQLSLPPQIAGVEFTPTDAPRVMALVTAANQTSYAFAPA
FT                   ILGLLRDLSRGSTAPLLMMVLMQALAAAIVLSGRSAAGSGTDAPPRQ"
FT   gene            204334..205074
FT                   /locus_tag="Mnod_8476"
FT   CDS_pept        204334..205074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8476"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; KEGG:
FT                   reh:H16_B0314 transcriptional regulator, GntR-family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8476"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62582"
FT                   /db_xref="GOA:B8IVZ2"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ2"
FT                   /inference="protein motif:PFAM:PF00392"
FT                   /protein_id="ACL62582.1"
FT                   /translation="MIVNGQIQDRLIIPGPTCREDDAMTAMRDAHSRLKDLVLQHAFHP
FT                   GQQLRARDLADRLKISATPVREALIRLSVEGLIVSVPHKGFYTKPLDLSELSDRYELAF
FT                   MVSRYAVEKGIAHFTMRGLEEPAVPKIGGVGDVASKQHLALSQSVFVGQLLERIAGLAG
FT                   NTAALALMQTFNDHTRYIRLLDLEDAGTARMVFANVSRLIGHLREKNPDLAVFELKILL
FT                   VGTIERLPTLVKEVNVRALKHFFL"
FT   gene            205241..205699
FT                   /locus_tag="Mnod_8477"
FT   CDS_pept        205241..205699
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8477"
FT                   /product="ParB domain protein nuclease"
FT                   /note="SMART: ParB domain protein nuclease; KEGG:
FT                   hbu:Hbut_1584 transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8477"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62583"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ3"
FT                   /inference="protein motif:SMART:SM00470"
FT                   /protein_id="ACL62583.1"
FT                   /translation="MPIETAFEPVDVRREGEDDRWWTLRLLPVRALIPHERTDALHVDR
FT                   LFGRIRERDVWTHPLLVESRHHVILDGHHRHAASERLQLSVVPCAVVDYDHRYIRVGSW
FT                   REDRHVDRSAVMHAAIRGPLLPPKTSRHSTEFPISECLVPLAQLRTGH"
FT   gene            complement(205825..205926)
FT                   /pseudo
FT                   /locus_tag="Mnod_8478"
FT   gene            complement(206041..206184)
FT                   /pseudo
FT                   /locus_tag="Mnod_8479"
FT   gene            complement(206204..207439)
FT                   /locus_tag="Mnod_8480"
FT   CDS_pept        complement(206204..207439)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8480"
FT                   /product="protein of unknown function DUF1612"
FT                   /note="PFAM: protein of unknown function DUF1612; KEGG:
FT                   nha:Nham_4505 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8480"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62584"
FT                   /db_xref="InterPro:IPR011670"
FT                   /db_xref="InterPro:IPR021068"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ4"
FT                   /inference="protein motif:PFAM:PF07756"
FT                   /protein_id="ACL62584.1"
FT                   /translation="MRSPYAVDKLFTAATWRRLAGPAERAAEALLRLDERLARTEPALA
FT                   DGVRARAHFVDAQAALGLEGRLVLMEDLVLHDAAMPVRRPTPELGRAAHILATRRRIAA
FT                   ARPDWPFAREGWSALFGAAGRDPDGTEAPLGSPSTETPRRGDATEPQPWARPRFGQDSF
FT                   DDEDDGATSSGDEDELWTADEASDSAFADIDQLLARSRRTLAEFNDLTTDEGRAVLRVR
FT                   DPQYGEAERLAAWRRIALKDVQELPTVLAAAVALDAWFALDPSERQPFLGPLLAAALLH
FT                   QRGTARHHLPALALGLRESRTRWLTVHPAPERLGAILRAVEAAAHAAGRDLDRLSLARE
FT                   LMLRRAQAKRRTSRLPQLVEVFLASPLVTVQSAAQRLGTSAQAIEAMLADLGPACPREL
FT                   TGRRRYRAWGIV"
FT   gene            207614..208675
FT                   /locus_tag="Mnod_8481"
FT   CDS_pept        207614..208675
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8481"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG:
FT                   mrd:Mrad2831_6128 integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8481"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62585"
FT                   /db_xref="GOA:B8IVZ5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ5"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL62585.1"
FT                   /translation="MEFDPADPAPAPPHGSSFALPVPLAAALPPGPALLERLEAYARAA
FT                   QGAFAPNTLRALAADSRIFAAWCRAHGRSVLPAAPQTVADFIDAQAARKSRATVERYRS
FT                   SIAMLHRAAGLPNPCTDERVRLAVKRMSRAKGRRQKQAEPLNRPSIDRMLAVKTPERLH
FT                   RRVAEGDREVPLIALRNAALMAVAYDTLLRRSELVSLLIEDLERVEDGSGTILVRRTKT
FT                   DQEGEGAVKYLAPDTVGHVSAWLEAAGLTSGPLFRPVTKGGRVGAAALGDAEVHRLYRE
FT                   IALAAGVKLARPPSGHSTRVGATQDMFAAGFELLEVMQAGSWKTPAMPARYGERLRAQR
FT                   GAARKLATLQNRA"
FT   gene            complement(209258..210193)
FT                   /locus_tag="Mnod_8482"
FT   CDS_pept        complement(209258..210193)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8482"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mes:Meso_4524 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8482"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62586"
FT                   /db_xref="GOA:B8IVZ6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62586.1"
FT                   /translation="MATSRTRMPSFQELTAFEAAGRHGSFTRAADELALTQGAISKQIR
FT                   QLETTLETVLFERAKGRVMLTAAGRALLPTVGRLLQDYVTAAHSVMASAGSEVTLKLAV
FT                   LPTFATRWLIPRLPRFLASHPHITINLVTEPEPFDLMAQSVDAAIHFGAPNWAQADCIR
FT                   LCDEAVVAVSGPAYAERYALNCPADLVRATLLQQASRPGLWRDWFAAMGFVHPFPFRGP
FT                   LFDQFAMTIEAAKVGIGIALLPSFLVEQELADGSLIQIAAPLLTGSGSYYIVVPIDRRR
FT                   EFTIVSFVDWLVAEAATSASGRSKNLLTEI"
FT   gene            210310..211878
FT                   /locus_tag="Mnod_8483"
FT   CDS_pept        210310..211878
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8483"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: gox:GOX2110
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8483"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62587"
FT                   /db_xref="GOA:B8IVZ7"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="InterPro:IPR029510"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ7"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL62587.1"
FT                   /translation="MSQAVEAAPVAHPLADEVAALLESFGAELPRQAEGSCIVRSPLTG
FT                   ELIVRVQETSPDEARAAIGRAHDAFLAWRQVPAPRRGELVRLLGEELRANKAALGRLVT
FT                   IEVGKIVSEGLGEVQEMIDICDFAVGLSRQLYGLTMGSERADHSLMEQWHPAGIVGVIS
FT                   AFNFPVAVWSWNAALAFVCGDSVVWKPSEKTPLTAIAVQALAERVIARFPEAPEGLSTL
FT                   ILGGRDVGEVLVDDQRVPVVSATGSTAMGRVVGQRVAARFARAILELGGNNASIVCPSA
FT                   DLDLALCAIAFAAMGTAGQRCTTLRRLFVHDSVYDALVPRLKQVYASVSVGNPLEGDAL
FT                   VGPLIDEAAYTGMERALAEAREVGGIVHGGGRHTHGVAPGGFYVRPALVEMPAQVGPML
FT                   HETFAPILYVMRVRSFDEALDLQNGVPQGLSSSIFSNDMRETSRFLSATGSDCGIANVN
FT                   MGSSGAEIGGAFGGEKETGGGRESGSDAWKAYMRRQTTAINYGRAMPLAQGVKFEIADE
FT                   GSAKA"
FT   gene            211875..213104
FT                   /locus_tag="Mnod_8484"
FT   CDS_pept        211875..213104
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8484"
FT                   /product="aminotransferase class I and II"
FT                   /note="PFAM: aminotransferase class I and II; KEGG:
FT                   bbt:BBta_1248 aminotransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8484"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62588"
FT                   /db_xref="GOA:B8IVZ8"
FT                   /db_xref="InterPro:IPR004838"
FT                   /db_xref="InterPro:IPR004839"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ8"
FT                   /inference="protein motif:PFAM:PF00155"
FT                   /protein_id="ACL62588.1"
FT                   /translation="MNAPLQTGPVFRPAARLASIEVSEILRITAEASARKRAGRPVIVL
FT                   GAGEPDFDTPEPVKTAAARAMREGRTKYTILDGAPELKAAVREKFRRDNGLDYALDEIT
FT                   CGTGAKQVLYNAFMASLDPGDEVVIPAPFWTSYADIVAICGGVPIIVPCAETDGFRLTP
FT                   QALERAIGPRTRWLLLNSPSNPTGSAYTADDLVGLAEVLDRHPHVWLMSDDMYEHILYD
FT                   GRRFATPASAAPQLRLRTLTVNGVSKAYAMTGWRIGYGAGPKALIQAMATVQSQSTSCP
FT                   SSISQAAALEALVGDQASISDRRVAFQRRRDLVVEALNAMPGLSCRRPEGAFYTFANCA
FT                   GLLGRTTPDGTVLEDDRAFCRHLLESADVAVVPGSCFGLAGFFRISYATSEAELTEACG
FT                   RIRTACAALA"
FT   gene            213227..214621
FT                   /locus_tag="Mnod_8485"
FT   CDS_pept        213227..214621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8485"
FT                   /product="protein of unknown function DUF1338"
FT                   /note="PFAM: protein of unknown function DUF1338; KEGG:
FT                   xca:xccb100_3977 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8485"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62589"
FT                   /db_xref="InterPro:IPR009770"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVZ9"
FT                   /inference="protein motif:PFAM:PF07063"
FT                   /protein_id="ACL62589.1"
FT                   /translation="MSANKTIVSPDLVRTRFSRAMSDMYRAEVPQYGTLMDLVRTVNLD
FT                   VRRGDALLDRRLRDNDEIERLELERHGAIRVGTAAELATMRRLFAVMGMVPVGYYDLSV
FT                   AGVPVHSTAFRPVDAEALRRNPFRVFTSLLRLDLLPDETLRREAAEILGSRSIFTSGCL
FT                   DLIALAERDGGLDAAEADAFVAEALETFRWQSEATVPAEVYARLRKVHPLVADIVCFKG
FT                   PHINHLTPRTLDIDAVQDGMPGKGITPKAVIEGPPRRRVPILLRQTSFRALQEPIRFRS
FT                   SGTAENGTHTARFGEIEQRGVALTPKGRALYDRLLTEVRDRVQVKPDGSNAADYSAALA
FT                   EVFRAFPDDEATLRSEGLAYFRYAPTGKPGAPAEADLDTLVASGFVGAEPITYEDFLPV
FT                   SAAGIFASNLGDEGQRNHTRRAARAAFERDLGATVTDEDALYAAAERASIAAVRAALAA
FT                   SMRGAA"
FT   gene            complement(214813..215427)
FT                   /locus_tag="Mnod_8486"
FT   CDS_pept        complement(214813..215427)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8486"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; Cupin 2
FT                   conserved barrel domain protein; KEGG: pde:Pden_4870
FT                   transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8486"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62590"
FT                   /db_xref="GOA:B8IW00"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW00"
FT                   /inference="protein motif:PFAM:PF01381"
FT                   /protein_id="ACL62590.1"
FT                   /translation="MDVVLDPDPREGRAGGNAEQSLGQRLRELRRSRKLTLQQVSDRSG
FT                   ISLSSLSKIERDELSPTVTTLERIAAGYEIDSAAIFGGREAVHRAPGRRSITRADGGRS
FT                   MPTGTCDNVWLCPELSHKLMTPILTTVTARSLEDYTEWARYEAEVFMYVLSGSVIVHSQ
FT                   IYEPTRLATGESMYYDASTPHLWVTESKDPAKVLWLYATYR"
FT   gene            complement(215466..217481)
FT                   /locus_tag="Mnod_8487"
FT   CDS_pept        complement(215466..217481)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8487"
FT                   /product="Hydantoinase B/oxoprolinase"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase B/oxoprolinase; KEGG: bpe:BP0821
FT                   hydantoin utilization protein B"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8487"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62591"
FT                   /db_xref="GOA:B8IW01"
FT                   /db_xref="InterPro:IPR003692"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW01"
FT                   /inference="protein motif:PFAM:PF02538"
FT                   /protein_id="ACL62591.1"
FT                   /translation="MNLDMTALQVLANYCAAAAESMGWTLMRTAYSTFVKETEDFSCQV
FT                   LTRDGLTVASPKTFGATWYTGLDYGDLIRLFDYEEGDICITSDPYAGYVATHTPDIHMW
FT                   KPVFRDGRIVCFVGCHIHNTDVGGAVPATLSRTNTEIHQEGLRIPPMRLMRHGVLNADL
FT                   LALIANNVRLPEQNHGDLNAQIACVNVGERKIHEIIDRFGADDFVTGLDDLLEYADNQA
FT                   RAVIRTIPDGEYAFADYADEDQTGGYPVRIAATLKVHGDTLTVDFTGSDPQLASALNMP
FT                   TGGKERHALATVGTVYALYCLDPTMMLNAGLMRPTRVILPEGTVMNAVMPAAVGMRSLL
FT                   CNLAQTVVIGAFCRAVPERLPASPGSAVSIMNVKTTTKGGRTVMASIGPVGGGAGGGPF
FT                   ADGSEGCGANMSFLKNTPVEINEAEVPITIRRYGLVPDTGGPGLYRGGTALEMEFQLHA
FT                   PQSMVTARNRDRSVFSAWGLAGGRAGTVSRFARNPGSETCTELGSQDVVVCEPGDVILI
FT                   QGPGAGGYGDPLERPPEAVLSDVRRGLVSRARAETDYGVVIGPDLTLDAAATAALRERG
FT                   RSEAPCPEFGFGEGRLAFERVWTRDRYAALTAILAEVPVSWRFFVKHQIFADLKQRGEA
FT                   AQGGAADVYRAYEAVAARFSDLPRVQALPQVVQSAA"
FT   gene            complement(217478..219526)
FT                   /locus_tag="Mnod_8488"
FT   CDS_pept        complement(217478..219526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8488"
FT                   /product="Hydantoinase/oxoprolinase"
FT                   /EC_number="3.5.2.9"
FT                   /note="PFAM: Hydantoinase/oxoprolinase;
FT                   Hydantoinaseoxoprolinase domain protein; KEGG: bbr:BB3858
FT                   hydantoin utilization protein A"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8488"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62592"
FT                   /db_xref="GOA:B8IW02"
FT                   /db_xref="InterPro:IPR002821"
FT                   /db_xref="InterPro:IPR008040"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW02"
FT                   /inference="protein motif:PFAM:PF01968"
FT                   /protein_id="ACL62592.1"
FT                   /translation="MGYRVGVDIGGSFTDFALFDEATQSLRTLKVFSRPDEPGAEVMEG
FT                   VHLVGERYGIAPSDISYFTHGTTVGINTVIQRKGLRLALFTTENFRDVLELARLKIPDM
FT                   YNLLSKRPEPLITRDRVFGIAERLNADGSVQRPIDEASVGEAVAAARAAGAEGIVVAFL
FT                   HAYRNPVHEQAAKAVIARLAPDVPVFLSSETWPIVREYERTITAVIGAYVQPRVAHYLG
FT                   SLQAALKTAGVDAEPRLTKSNGGVMTAEQGKSECVQMILSGTASGVIGAAYVAETCGVK
FT                   HCMSLDIGGTSADVAVIIDGQPQYGIGELIGDFQIYIQSVSVSSIGEGGGSIAWIDAQG
FT                   VLKVGPESAGSRPGPACYGRGGTRPTITDAFAALGLVGLAEIGYSAVTIDREKARAAVA
FT                   TLATPLGRTIEETAEAIIRIAVSGMYTDTSALVSRFGIDPRDFSCLAFGGAGPMMACFL
FT                   ARELNMRDVLVPPTPGVLSALGGLIADIKSDFIKTLYTDLVPDLGGTIRAEFADLEAQA
FT                   VSWLRDDQGYAGDYTLSHSAELRYKGQSFELDTKIPAGPASAGDVAAIAEAFHAEHQRV
FT                   YGHCDRRAAVQIMALRLIISGGTAKPGFLRQPLVEGVATPLRHAEVWLDGAMRSVGVFH
FT                   RADLKPGQSFAGPAVVTQDDCTTVVPPGMAVRVDEYTNLRIAQEAAR"
FT   gene            complement(219574..220614)
FT                   /locus_tag="Mnod_8489"
FT   CDS_pept        complement(219574..220614)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8489"
FT                   /product="extracellular solute-binding protein family 1"
FT                   /note="PFAM: extracellular solute-binding protein family 1;
FT                   KEGG: mes:Meso_3744 twin-arginine translocation pathway
FT                   signal"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8489"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62593"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW03"
FT                   /inference="protein motif:PFAM:PF01547"
FT                   /protein_id="ACL62593.1"
FT                   /translation="MPTLTRTRSVAASLVAVTAVASGQARAADLTVTAFGGVWEKSLRT
FT                   CYIEPFQKQTGKTVDVVLGTGPQYVAQISANPQKPPIDVLLHLIDSAEDAKNKGLVETI
FT                   DPAKVPNLADVPEPFKRIAGGTAVATHYGAAGLAYNADRIKNPPKTWAEFIDRTIKGDW
FT                   QASLPGINVASTTPTAVIWNFNDVLGGKGADVAPAVAKLKAMRDSGNIVFWNDVNQFLT
FT                   QMQSGEAEIGIYWDGRAWAAKDGGFKALNFVYPEPGGVVSPTVVQKVKNGSPLAWDFIN
FT                   FLFAPDRQSCWAAAIQYPVVNTKAEYKPEQKARMPSWQSVRWPPFAEILANNAQWVETW
FT                   NKQIGR"
FT   sig_peptide     complement(220531..220614)
FT                   /locus_tag="Mnod_8489"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 28"
FT   gene            complement(220666..221487)
FT                   /locus_tag="Mnod_8490"
FT   CDS_pept        complement(220666..221487)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8490"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_3746
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8490"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62594"
FT                   /db_xref="GOA:B8IW04"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW04"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL62594.1"
FT                   /translation="MISLPLLRRLERVLPQTVLTAFVVLFFVFLLAPIVFVVLVSFSDA
FT                   AFVQFPVQSYSLRWYYRLLEYTPFLTSLLFSLKLAVLAALAAALLGVPAALVLARSGTA
FT                   TADAVSTFLLSPISIPMILLGVALLFNLSSLGLGISFTSLLIGHTVVSLPYVVRTVVAV
FT                   YRGIGREYEEGAAILGASRWQIFRYITLPLISSGIFSGMLFSILISLDNLSLSLFFTSA
FT                   QTNTLPVVMLSYLQNQFDPAIAAIGTVQMLIAFLALLLIDRTVGLKHMSST"
FT   gene            complement(221484..222350)
FT                   /locus_tag="Mnod_8491"
FT   CDS_pept        complement(221484..222350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8491"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: mes:Meso_3745
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8491"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62595"
FT                   /db_xref="GOA:B8IW05"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW05"
FT                   /inference="protein motif:PFAM:PF00528"
FT                   /protein_id="ACL62595.1"
FT                   /translation="MQPLIKAQAWRRRLSSLLALLPALTFLILFFAVPLAENAVRSVAV
FT                   PTAEGTRISGEYYARLFTDPYYLGILAQTVWVSFEATLICVVIGFPIAYYLVRHGGRWT
FT                   SLLIFLLVAPLLTSIIMRTFGWSVILARNGVLNVVLLDLGLIERPLRLLQGPASVIIGL
FT                   VHVLVPFMVISIAAVLRGIDRQLEEGAQILGAGRLRTFWEVTLPLSLDGIATGSIVVFM
FT                   LANGSFLTMLLLGGGSVVTLPLLIYQQFLLVQNLGFASAMGNVLLALAVASLFLQLRLL
FT                   RRRGTRA"
FT   sig_peptide     complement(222240..222350)
FT                   /locus_tag="Mnod_8491"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.917 at
FT                   residue 37"
FT   gene            complement(222334..223473)
FT                   /locus_tag="Mnod_8492"
FT   CDS_pept        complement(222334..223473)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8492"
FT                   /product="spermidine/putrescine ABC transporter ATPase
FT                   subunit"
FT                   /note="KEGG: mes:Meso_3743 spermidine/putrescine ABC
FT                   transporter ATPase subunit; TIGRFAM: spermidine/putrescine
FT                   ABC transporter ATPase subunit; PFAM: ABC transporter
FT                   related; Transport-associated OB domain protein; SMART: AAA
FT                   ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8492"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62596"
FT                   /db_xref="GOA:B8IW06"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005893"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR013611"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW06"
FT                   /inference="protein motif:TFAM:TIGR01187"
FT                   /protein_id="ACL62596.1"
FT                   /translation="MRADGIAPNGAAGLQVDAVTKAFGGVVALQPCSFTVPAGAMCALL
FT                   GPSGCGKTTTLRIVAGFELPNSGRVLIGGEDKTYAPPQRRRLGMVFQSYALFPHMTVAQ
FT                   NVAFGLRMAGLPRAEIEERTRRMLDVIRLPQFADRHPAQLSGGQQQRVALARALVTEPS
FT                   VLLLDEPLGALDKSLREQMQFEIRQLQQRLGITTLIVTHDQEEALTMSDLIVVMSKGRI
FT                   LQVGTPTEVYERPKSRFVSEFLGTSNILACRVRSQDSGGAVRVGVAGLTPEAAFTAWSR
FT                   HPPGADAEVLVAIRPEHIHMAPSSGHEGITGFVDGQITGHVFRGATHVYQVAVPGLEVP
FT                   FIVYQQVTGPMADVALPLGTPVALTWPEGAARVVDATAH"
FT   gene            223673..225115
FT                   /locus_tag="Mnod_8493"
FT   CDS_pept        223673..225115
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8493"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   azc:AZC_2474 FAD dependent oxidoreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8493"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62597"
FT                   /db_xref="GOA:B8IW07"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016167"
FT                   /db_xref="InterPro:IPR016169"
FT                   /db_xref="InterPro:IPR016171"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW07"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACL62597.1"
FT                   /translation="MLEKLAAIVGASGILSSAADMAPFVEDWRGLSQGEALCVVLPATP
FT                   EQAAEVVRLCARTGTPVLPQGGNTSLCGGAVPPSGGPRPVIVGLQRLRRIRAIDPVNDT
FT                   ITVDAGCVLATVQATAAEHGRLYAVSLGAEGSCQVGGTIATNAGGTGVLRYGNTRDNVL
FT                   GLEVVLPDGTIWDGLTALRKNNTGYDLKHLFIGSEGTLGLITGAVLKLHPLPTARSVAW
FT                   LSVAEPQAAIEALSLFRASCGSRLSAFEMINDSQAALVVKHVPGRRIPVTGGGWHVLVE
FT                   LADTGNEASLDAAMQAVLEDALDRGLVTDAVVGASEAQREALWAVRHGVSEANKKEGVS
FT                   LTSDTAVPISAVPAFIASATAAVRAIIPGLTVLVVAHLGDGNVHFIPFFSFAAWEVLAE
FT                   REAIVQRIRHAVDDAAMALGGTFSAEHGVGATHLPEMARYKPPVELAMMRAIKQAFDPS
FT                   DLFNSGRLLPLRATAPTSASHS"
FT   sig_peptide     223673..223732
FT                   /locus_tag="Mnod_8493"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.986) with cleavage site probability 0.823 at
FT                   residue 20"
FT   gene            225133..226074
FT                   /locus_tag="Mnod_8494"
FT   CDS_pept        225133..226074
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8494"
FT                   /product="dihydrodipicolinate synthase"
FT                   /note="TIGRFAM: dihydrodipicolinate synthase; PFAM:
FT                   dihydrodipicolinate synthetase; KEGG: azc:AZC_2478
FT                   dihydrodipicolinate synthase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8494"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62598"
FT                   /db_xref="GOA:B8IW08"
FT                   /db_xref="InterPro:IPR002220"
FT                   /db_xref="InterPro:IPR005263"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW08"
FT                   /inference="protein motif:TFAM:TIGR00674"
FT                   /protein_id="ACL62598.1"
FT                   /translation="MLTANALRGILPAIPTPVRDDDTVDEGALKALFAWLLKQGIDGIV
FT                   PLGGTGEYGALARAERIRTARLSVEAMNGQGPVIAGVLDTGYHDALQATREFADVGIDA
FT                   VLVLTPYYTNPTQAGIRDYFLRLADTAPVPILIYEIPYRTRIAINPAVTHELSRHERII
FT                   GMKACNTDMYHFLQVVAGVDPDFAVLSGEDSLYPLHVAAGARGGIIVTANILPRAWRAI
FT                   HEAASAGRTAEALALHRRLIPLMNLAFAETSPGPMKSVMDIIGVNAPRMLPPLQQPSPD
FT                   LIKKLRQELKIHIDNWEILPASGRRTSAIPAS"
FT   gene            226077..226357
FT                   /pseudo
FT                   /locus_tag="Mnod_8495"
FT   gene            complement(226769..227329)
FT                   /locus_tag="Mnod_8496"
FT   CDS_pept        complement(226769..227329)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8496"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_6371 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8496"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62599"
FT                   /db_xref="GOA:B8IW09"
FT                   /db_xref="InterPro:IPR001584"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW09"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62599.1"
FT                   /translation="MSGKGNCYDNARVERFFKTLKSELVRRSAFQTRAEATDALARSID
FT                   GFYTPRRRHAALGFVSPVQVERRCTGSTALHSTEASPLCTDLTHDPEQVVAWFVRRWSV
FT                   EVTFQELRAHLGVETQRQWSDTAIARTTPCLFALVSSVTLLASRVPARARCQVVTAAWY
FT                   LKPRPTFSDPWRWCAGCSGASRV"
FT   gene            227353..227907
FT                   /pseudo
FT                   /locus_tag="Mnod_8497"
FT   gene            complement(227976..228284)
FT                   /locus_tag="Mnod_8498"
FT   CDS_pept        complement(227976..228284)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8498"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8498"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62600"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW10"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62600.1"
FT                   /translation="MAAPVPLRWDFDAEALRRLARASHDPAQTRRLLALSAIYAGSSRS
FT                   QAAALGGIWLQPARSSCNPGRGARRNASGPARRMDGAMTQRPAKLRTGTSITVAAYG"
FT   gene            complement(228561..229589)
FT                   /locus_tag="Mnod_8499"
FT   CDS_pept        complement(228561..229589)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8499"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; KEGG: bbt:BBta_2261 AraC family transcriptional
FT                   regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8499"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62601"
FT                   /db_xref="GOA:B8IW11"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR020449"
FT                   /db_xref="InterPro:IPR032687"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW11"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL62601.1"
FT                   /translation="MRAPLGNAGPAKLLSAAATGLVGFIQSRRLCLDSVLGSVGVDSRH
FT                   LGDPLAKLDLRKYCDLLDLAARRSGDDNFGLSFGQQFQPVQLGLIGYIAISSDNALHAA
FT                   ENLAQYFRYHQQLTSTNLSFSDPFYKLTYRIEDPRILNRHQDAVLTLGMFCNVFRHCSG
FT                   ADWCPDELHLEHARTGNWRDIESAFGAPVRFECRTNALLFRPERVVSRMPQADSNLLSL
FT                   LCRNIMTLGLEVQRTSAAIRTEGYIRQNIAAGNLSLEHASRSLSISSRTLQRKLVEENI
FT                   TFGLLVENFRKSESRNKLLSSEMGVSDIAYDLGYSETSAFVRAFTRWYGISPSKFRKMH
FT                   RI"
FT   gene            229830..231227
FT                   /locus_tag="Mnod_8500"
FT   CDS_pept        229830..231227
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8500"
FT                   /product="Ethanolamine ammonia lyase large subunit"
FT                   /note="PFAM: Ethanolamine ammonia lyase large subunit;
FT                   KEGG: gbe:GbCGDNIH1_1891 ethanolamine ammonia-lyase heavy
FT                   chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8500"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62602"
FT                   /db_xref="GOA:B8IW12"
FT                   /db_xref="InterPro:IPR010628"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW12"
FT                   /inference="protein motif:PFAM:PF06751"
FT                   /protein_id="ACL62602.1"
FT                   /translation="MATYQCTLGGERHTFADLKAVLAAASALKSGDELAGIAAANSKVR
FT                   MAARFVLADTPLMTFLEDLVVPYEDDEVTRLIIDSHDRNAFAPVASLTVGGLRDWLLSE
FT                   AADETALTALAPGLTPEMVAAVSKLMRNQDLISVASKCRVVTAFRTTLGLRGRLATRLQ
FT                   PNHPTDDARGIAASVLDGLLYGVGDAVIGINPATDSVSNAIALMEMLDAVRQEYRIPTQ
FT                   TCVLTHVTNCIEIMNRGAPVDLVFQSVAGTEAANRGFGVDLNVLHEAYDAARGLNRGSV
FT                   GQNAMYFETGQGSALSSGSHHGVDQQTVETRAYAVARAFAPLLVNTVVGFIGPEYLYDG
FT                   KQITRAGLEDHFCGKLLGLPMGCDVCYTNHAEADQDDMDGLMTLLSAAGCTFLIAIPGS
FT                   DDIMLNYQSLSFHDVLYLRSLLGVRAAPEFEAWLQEMGVNDGRTAARNQTQLEARFMGR
FT                   LIDGRAA"
FT   gene            231224..232027
FT                   /locus_tag="Mnod_8501"
FT   CDS_pept        231224..232027
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8501"
FT                   /product="Ethanolamine ammonia-lyase light chain"
FT                   /EC_number="4.3.1.7"
FT                   /note="PFAM: Ethanolamine ammonia-lyase light chain; KEGG:
FT                   gbe:GbCGDNIH1_1892 ethanolamine ammonia-lyase light chain"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8501"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62603"
FT                   /db_xref="GOA:B8IW13"
FT                   /db_xref="InterPro:IPR009246"
FT                   /db_xref="InterPro:IPR042251"
FT                   /db_xref="InterPro:IPR042255"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW13"
FT                   /inference="protein motif:PFAM:PF05985"
FT                   /protein_id="ACL62603.1"
FT                   /translation="MNKPVKEPAPPSSGRSIADPWAALRGVTPARIGLGRSGNAIPTRG
FT                   VLDFQYAHALARDAVHEPLDVAALTRALQPLRTIAVASNVPDRGTYLRRPDLGRVLSPE
FT                   SLTAFEGLKPADIVFVVADGLSATGIQAHAAPLVHACATELADWDIGPIVLAVQGRVAL
FT                   GDDIAARLGARLCVMIIGERPGLTVSDSIGIYLTFGPRPGRQDSERNCISNIHPNGGLS
FT                   STQAACKLGWLAREALRRQYSGVALKDDMPSILESGAGAPKLSSS"
FT   gene            232091..233464
FT                   /locus_tag="Mnod_8502"
FT   CDS_pept        232091..233464
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8502"
FT                   /product="ethanolamine transproter"
FT                   /note="TIGRFAM: ethanolamine transproter; PFAM: amino acid
FT                   permease-associated region; KEGG: mpo:Mpop_0691
FT                   ethanolamine transproter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8502"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62604"
FT                   /db_xref="GOA:B8IW14"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004757"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW14"
FT                   /inference="protein motif:TFAM:TIGR00908"
FT                   /protein_id="ACL62604.1"
FT                   /translation="MSGTDVKLHKGLNAFHLWGIAVGLVISGEYFGWSYGWAQAGTLGF
FT                   LVTTLAVALMYVTFIFSFTELTTAIPQAGGPFAYALRAFGDAGGAVAGFATLVEFVFAP
FT                   PAIALAIGAYLNVQYPSLDPKHAALGAYLVFMALNIIGVQIAATFELVVTILAVGELLI
FT                   FMNVVAPAFSVSNFTAGGWAGQDTFGPAAIGGIFAAIPFAIWFFLAIEGVAMAAEEAKD
FT                   PKRTIPVAYITGVLTLTALAFGVMLFAGGAGDWRVLSNLNDPLPQAMKRVVGDSSGWLH
FT                   MLVWLGLFGLVASFHGIIMGYGRQIFALARAGFLPHVFARLHPRFQTPHLATLAGGAVG
FT                   IAAIYSDNLVSIAGQSLTASIVTMAVFGALTMYIVSMAALFRLRRTEPNLARPYRAPLY
FT                   PYAPAFALILATVCFLALVVYNPLIFIFFFIIMALAVAASLIARQSGEDKLADGSASL"
FT   gene            233572..234873
FT                   /locus_tag="Mnod_8503"
FT   CDS_pept        233572..234873
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8503"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bph:Bphy_7058 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8503"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62605"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW15"
FT                   /inference="similar to AA sequence:KEGG:Bphy_7058"
FT                   /protein_id="ACL62605.1"
FT                   /translation="MTNAPRQTSVRRRGFLGGLMLATTAAGAAMTTARATGQADEKVGL
FT                   DRAKWAPRNHAAVSRLIAEHGNTSPNYNPGRRPYAVFDWDNTSIMNDCQEALLMYQINT
FT                   LSFKLTPAEFAEIIRQNVPPGKFSDDYKNAAGTTVDLDAICADLDADYMWLHGAYKGLS
FT                   GSQPLADIVKTAHFEDFRAKLYFLYEAVNDTHGVDIGYPWVIYLLTNMTVPDVSRLAEA
FT                   SNDAALGAALVRTKYTSPVDRAGRAGVVSVSHFHGIRLCTEVGGLMDTLQRNGIDVYVS
FT                   TASLEDVVAVFATFPKYGYNIQRSHVLGLRLEQEGDVFKNAYRKGWPLNWGPGKTAVIK
FT                   RELVSKKGYGPILVAGDSDGDYDMLRDFADTRVGLIVNRMKKGKIGELSKAAADTLHAE
FT                   APRFLLQGRQETTGNWRPQESSIKYGKTEPQLLA"
FT   sig_peptide     233572..233679
FT                   /locus_tag="Mnod_8503"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.574 at
FT                   residue 36"
FT   gene            234916..235101
FT                   /pseudo
FT                   /locus_tag="Mnod_8504"
FT   gene            235158..236492
FT                   /locus_tag="Mnod_8505"
FT   CDS_pept        235158..236492
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8505"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   xau:Xaut_4843 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8505"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62606"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Y5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62606.1"
FT                   /translation="MAKVFRSWDVDQGWLLPPSLHEFVPPGHMAHFVRDTVREALDLSA
FT                   ILDTYTEERGYPPYHPGMMVALLLYGYSRGLYSSRQLARACEERVDFMAVTGLNRPDFR
FT                   TIADFRKRHLTALSDLFVQVLRLCRAAGLVGFAHVAVDGTKLKANASRHKAMSYGRMKA
FT                   AESTLAAEVEAWLDQAREADAAEDRAHGTDHRGDETPAWMADKQRRLETIRAAKAALEA
FT                   EAADPPDPEDEDGPGASSGMRWQGRPLRGEDGGPPDRAQRNFTDPDSRILPTRDGFVQG
FT                   YNGQIAVDAAHQVIVAHRLVTNPADSRALVPLVDGVCTHLGRKPREVSGDAGFATEANL
FT                   AALQERRITAYLAPGRARHGEADAAGRRRLTKMPLMSAMAVRLKRAGRRSRYRLRKQVV
FT                   EPVFGQIKQARGFRQFLLRGLDQVRGEWAMICTAHNLLKLAQAAR"
FT   gene            236666..237067
FT                   /pseudo
FT                   /locus_tag="Mnod_8506"
FT   gene            237087..237596
FT                   /pseudo
FT                   /locus_tag="Mnod_8507"
FT   gene            237678..237992
FT                   /pseudo
FT                   /locus_tag="Mnod_8508"
FT   gene            complement(237991..239395)
FT                   /pseudo
FT                   /locus_tag="Mnod_8509"
FT   gene            complement(239526..240374)
FT                   /pseudo
FT                   /locus_tag="Mnod_8510"
FT   gene            241142..241369
FT                   /locus_tag="Mnod_8511"
FT   CDS_pept        241142..241369
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8511"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8511"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62607"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW17"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62607.1"
FT                   /translation="MNPRERALLVILSQAGEWVPLAELRSRGLGDIAMLASNAVAQGWV
FT                   EYGLRHVTCASRIRGAQPWTGATDMPRRGS"
FT   gene            complement(241375..242298)
FT                   /locus_tag="Mnod_8512"
FT   CDS_pept        complement(241375..242298)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8512"
FT                   /product="pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding"
FT                   /note="PFAM: pyridoxamine 5'-phosphate oxidase-related
FT                   FMN-binding; KEGG: ret:RHE_CH01279 putative pyridoxine
FT                   5'-phosphate oxidase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8512"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62608"
FT                   /db_xref="GOA:B8IW18"
FT                   /db_xref="InterPro:IPR011576"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW18"
FT                   /inference="protein motif:PFAM:PF01243"
FT                   /protein_id="ACL62608.1"
FT                   /translation="MRTAEPCPAAPWHEGEIAIQNSLGVAERMEGLGHRVIRDHLIEQH
FT                   QSFYPQLPFVVLGAVDASGAVWATLRAGKPGFLHAPDPFHLRVEAARDPTDPADAGIND
FT                   GAAVALLGIELATRRRNRLNGTVRDSGPDGFAIEVEESYGNCPRYIQPRRSTFVPDSGV
FT                   IAAAPAVSSHLDDRAQEIIAGADTFFVATYVERDGGHRQVDVSHRGGRPGFVRIGSDGV
FT                   LTIPDFSGNRFFNTLGNMVVNPRAGLVFVDFATGNLLQMTGQAEVILEAPEVAAFEGAE
FT                   RLWRFRPETIVFRAKTLPLRFSLVKG"
FT   gene            complement(242328..242945)
FT                   /locus_tag="Mnod_8513"
FT   CDS_pept        complement(242328..242945)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8513"
FT                   /product="Glutathione S-transferase domain protein"
FT                   /note="PFAM: Glutathione S-transferase domain; KEGG:
FT                   mpo:Mpop_5005 glutathione S-transferase domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8513"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62609"
FT                   /db_xref="GOA:B8IW19"
FT                   /db_xref="InterPro:IPR004045"
FT                   /db_xref="InterPro:IPR010987"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="InterPro:IPR036282"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW19"
FT                   /inference="protein motif:PFAM:PF02798"
FT                   /protein_id="ACL62609.1"
FT                   /translation="MKLYHRSLSGHAHRARLFLSLVGAPCEIVEVDLAKGEHKSPDFLK
FT                   LNPFGQVPVLEDEGTVIPDSNAILVYMAKKLGRTDWLPDDPVGAACVQRWLSVAAGQIA
FT                   FGPAAARLITVFGAAFNADEVIARAHAILKLIDAELAARSWIAADRPTIADVALYSYIA
FT                   AAPEGNVDLSPYANIRAWLGRIEALPGFTPFTKTAAGLNAVA"
FT   gene            243094..244002
FT                   /locus_tag="Mnod_8514"
FT   CDS_pept        243094..244002
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8514"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mex:Mext_4490 LysR
FT                   substrate-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8514"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62610"
FT                   /db_xref="GOA:B8IW20"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW20"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62610.1"
FT                   /translation="MDRWQAMRIFVRVADSGGFSGAARQLNMSPPAVTRAVAALEDLIG
FT                   TRLLTRTTRSVKLTEAGGRYLEDCRRILADIEEAEAAAAGSYATPSGLLTVTAPVQFGR
FT                   IYVLPVITEYLSRYSAVTARALFVDRVINMVEEGADVGVRIGHLADSGLTATRVGTVRR
FT                   VVCAAPSYLDRYGAPKEPRDLHDHAVIGSTSVGGLAEWRFGGGRRTAVTVRPRLICTTI
FT                   DAALAAAIDGHGIVRLLSYQVAPALAEGRLRTVFDDQEEEAMPIHVVSSDGRRAPAKVR
FT                   AFIDLAVQRLRANPMINADNP"
FT   gene            complement(244439..245644)
FT                   /locus_tag="Mnod_8515"
FT   CDS_pept        complement(244439..245644)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8515"
FT                   /product="aminotransferase class V"
FT                   /note="PFAM: aminotransferase class V; DegT/DnrJ/EryC1/StrS
FT                   aminotransferase; aromatic amino acid beta-eliminating
FT                   lyase/threonine aldolase; KEGG: rle:pRL80073 putative
FT                   cysteine desulfurase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8515"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62611"
FT                   /db_xref="GOA:B8IW21"
FT                   /db_xref="InterPro:IPR000192"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR020578"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW21"
FT                   /inference="protein motif:PFAM:PF00266"
FT                   /protein_id="ACL62611.1"
FT                   /translation="MTASRTDSLDLTAVRRDTPGVLHRIHLNNAGAALMPAPVLQAVTD
FT                   YLGRESEIGGYEAAAEQAGQLDDVYNSIAKLVGGHRDEIAVTENATVAWQRAFYAMDFQ
FT                   PGDRILTTSAEFAANYIAFLQIAKRFDVTVDVIPNDDAGALDPTALERMIDGKVRLIAI
FT                   TWIPTNGGLVNPAVEVGKIANAHGIPYLLDACQAVGQMPVDVDTLGCDMLTATGRKFLR
FT                   APRGTGFLYIRKTLLDRTEPAMLDLFGAKVVELGDYELRPDARRFETWETNYSTRLGLR
FT                   AAVDYALAIGLEAIEDRCRRLADLLRAHLAAIPGLQLRDLGSRRSAIISFTLDGVEAAL
FT                   VMQQLKEKQINVSVSPPSSTPIDASARHLPPVVRVSPHYYNSEDEVETFVAAVRACAQD
FT                   VT"
FT   gene            complement(245755..246693)
FT                   /locus_tag="Mnod_8516"
FT   CDS_pept        complement(245755..246693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8516"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mrd:Mrad2831_1081 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8516"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62612"
FT                   /db_xref="GOA:B8IW22"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW22"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62612.1"
FT                   /translation="MNSTDLMFFAAVAEAGGIGRAATILNTVQSNVTGRIRALEQALHT
FT                   PLFYRGTRGVTLTRAGERLLPYATQVARLLADAEQAVLSDETPRGPLRLGSMETTAALR
FT                   LPKLLTAYASCYPEVDIELELGPTEALIASVLERKIEAAFVSGPVSQDDLATLPVLEEE
FT                   LVLVAGAKIRSHDDVIAMLASKREARVLVFKTGCSYRLRLEGILAAHGLVHVRRMEFGT
FT                   LDGIIGCVEAGMGVSLLPRVVAAPMQRTGRVSIHALPEDAGSAQTLLVYRKDSLLTAAF
FT                   ERFLDHTFKVFDLLPRDAAPASEHVLSCPTS"
FT   gene            246816..247796
FT                   /locus_tag="Mnod_8517"
FT   CDS_pept        246816..247796
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8517"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   mrd:Mrad2831_1082 2-nitropropane dioxygenase NPD"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8517"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62613"
FT                   /db_xref="GOA:B8IW23"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW23"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACL62613.1"
FT                   /translation="MALRTRLTDFFGIRHPIVLAPMDPAAGGALAAAVSAAGGLGLIGG
FT                   GYGDREILEAEFAKAGNQRVGCGFITWSMAKSPELLDLALARKPAAMMLSFSDPAPFAE
FT                   KVHAAGVPLICQVHNLDHARRALDVGASVLVAQGTDAGGHGLTTRGTITLVPSVVDLVA
FT                   RTRPEALVLAAGGIADGRGIAAALMLGADGALLGTRFWATQEALIHPAAKDRVVAATGD
FT                   ETVRTSVYDIVRNRPWPAEYTGRLMRNRFIETWHGREDELRGLAAGEREKVEAADRSGD
FT                   YDVSNVTVGEAIGLVQDLPPAGELVARLAAETEARLTGVMRAVVV"
FT   gene            247820..248209
FT                   /locus_tag="Mnod_8518"
FT   CDS_pept        247820..248209
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8518"
FT                   /product="4-oxalocrotonate tautomerase"
FT                   /note="PFAM: 4-oxalocrotonate tautomerase; KEGG:
FT                   mex:Mext_2146 4-oxalocrotonate tautomerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8518"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62614"
FT                   /db_xref="InterPro:IPR014347"
FT                   /db_xref="InterPro:IPR037479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW24"
FT                   /inference="protein motif:PFAM:PF01361"
FT                   /protein_id="ACL62614.1"
FT                   /translation="MPVLRFDLVGGRSPEELQVLLDAAHDAMLEAFQVTPGDRYQIVHE
FT                   HPAAHLVVEDTGLGIPRTDKRVVLQVTTRPRSREMKETFYRLLCENLQARCGISPTDVV
FT                   VSMVSNTDDDWSFGHGRAQFLTGEL"
FT   gene            248362..248631
FT                   /locus_tag="Mnod_8519"
FT   CDS_pept        248362..248631
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8519"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   mpo:Mpop_2495 protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8519"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62615"
FT                   /db_xref="GOA:B8IW25"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW25"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ACL62615.1"
FT                   /translation="MRTEPIHLRTADAQNVSLGAILTTILILVYFGFVAMGAFAPALLA
FT                   EPVVSGGTVTWAFAYGLFVIVLGVVLTGLYVLVVNRAEARRAGE"
FT   sig_peptide     248362..248499
FT                   /locus_tag="Mnod_8519"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.821) with cleavage site probability 0.670 at
FT                   residue 46"
FT   gene            248637..250256
FT                   /locus_tag="Mnod_8520"
FT   CDS_pept        248637..250256
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8520"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: xau:Xaut_0986 SSS family
FT                   solute/sodium (Na+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8520"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62616"
FT                   /db_xref="GOA:B8IW26"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW26"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACL62616.1"
FT                   /translation="MILHRPTARTALALTAALSTQPAWAAAGETSGVNLTAIGLFLAFV
FT                   VLTLWITWQAAQRTKSADDFYAAGGSITGFQNGLAIAGDAMSAGAFLGLTALVFTSGFD
FT                   GLIYAIGYTTGMPIVVFLLAERLRKLGRYTFTDVVCARLAEGPVRVFAACASLVVVAFY
FT                   LIAQMVGAGQLIQLLFGLDYLYAEFVVGVLMICYVMFGGMVATTWVQIIKAGLLLAGAT
FT                   LIVLLVLAAFGFDFGALLARATAVHPKGAAILAPQASAKDPLSALSLGLALMLGTAGLP
FT                   HILMRFFTVPDARAARVSVFWAATFMNYFYALVFVLGFGAMTLTAGDPAYIDAAGALRG
FT                   GGNMAAIHLSHAVGGNAMMGFISAVAFATILAVVSGLTLAGASAVSHDLYAGVIRRGQL
FT                   DERSEVRISRMATFVLGLIAIGLGIAFKGQNVAYMVSLAFAVACSSTFPVLLLALYWRG
FT                   LTTAGAVAGGTVGLLSALGLTLLGPAVWVKVLGNPAPVFAMDPPTLVTLPLALVTCWLV
FT                   SRLDRSAQGASDRARFEAQQAA"
FT   sig_peptide     248637..248714
FT                   /locus_tag="Mnod_8520"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 26"
FT   gene            250450..250785
FT                   /locus_tag="Mnod_8521"
FT   CDS_pept        250450..250785
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8521"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8521"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62617"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW27"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62617.1"
FT                   /translation="MIYKLFARQAVAPAVDARIREIIAALDEDKIALYAQAPADEVRAP
FT                   RLIEHVQTRVTACSQAPDWAEITVGFGTLDVDISSDLWGFIVVPRTLRTFSMTEVSVVG
FT                   PGHPTMM"
FT   gene            250854..251909
FT                   /locus_tag="Mnod_8522"
FT   CDS_pept        250854..251909
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8522"
FT                   /product="2-nitropropane dioxygenase NPD"
FT                   /note="PFAM: 2-nitropropane dioxygenase NPD; KEGG:
FT                   azo:azo1158 probable 2-nitropropane dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8522"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62618"
FT                   /db_xref="GOA:B8IW28"
FT                   /db_xref="InterPro:IPR004136"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW28"
FT                   /inference="protein motif:PFAM:PF03060"
FT                   /protein_id="ACL62618.1"
FT                   /translation="MSLTAHFLDLLEMKYPIVQAPMAGVSTPELAAAVSNAGGLGSIGI
FT                   GASTVSQARQMIEATRARTDRPFNVNVFCHPPAPRDTARESAWLAHLAPLFAEFGATVP
FT                   ETVREIYKSHLEDEEAFQLLLETRPPVVSFHIGLPEAGRLAAFRDAGIKTMATATNPEE
FT                   AAQIEAAGIDVIVAQGIEAGGHRGMFDPEAHDPALSTSVLVSLLIRQTTRPVLAAGGIM
FT                   EGRGIRAALDLGAAGAQLGTAFILCPESAANAAYRAALRSERAYDTRLTSAISGRPARG
FT                   LVNRLILHGLTPGSPPACAYPLAYDAAKLLHAAAAAQGSDAAAAQWAGQGAPLAREMPA
FT                   ADLLAQLIREM"
FT   gene            251941..252912
FT                   /locus_tag="Mnod_8523"
FT   CDS_pept        251941..252912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8523"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: bja:blr6271
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8523"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62619"
FT                   /db_xref="GOA:B8IW29"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW29"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACL62619.1"
FT                   /translation="MTSGTLLAGLAAASIASTSPQAVPSVSVTTTYHRTEVDGVSIFYR
FT                   EAGPKDAPTIVLLHGYPSSSRMYDPLLPLLADRYHLIAPDYPGFGHSDAPPPSQYCYTF
FT                   DHLAETTHNLLTKLGVGQYVLFMQDYGGPVGFRIALAHPEQVRALIVQNANAYAEGLGV
FT                   KWKGIADYWRDPAAHPGQLDAFTSLEGAKQRHLGNSPNVERYSPDTWMDEYAMLSRPGS
FT                   REIQGALFYDYRTNVASYPAWQAWMREHKPPTLVIWGRYDPSFIVPGAEAYKRDLPDAE
FT                   IRILDAGHFALDEQADEVARLTRDFLEHHLSPRDPTGMQRAR"
FT   sig_peptide     251941..252009
FT                   /locus_tag="Mnod_8523"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.980 at
FT                   residue 23"
FT   gene            complement(252963..253079)
FT                   /pseudo
FT                   /locus_tag="Mnod_8524"
FT   gene            complement(253276..254844)
FT                   /locus_tag="Mnod_8525"
FT   CDS_pept        complement(253276..254844)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8525"
FT                   /product="SSS sodium solute transporter superfamily"
FT                   /note="TIGRFAM: SSS sodium solute transporter superfamily;
FT                   PFAM: Na+/solute symporter; KEGG: mex:Mext_1155 SSS family
FT                   solute/sodium (Na+) symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8525"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62620"
FT                   /db_xref="GOA:B8IW30"
FT                   /db_xref="InterPro:IPR001734"
FT                   /db_xref="InterPro:IPR018212"
FT                   /db_xref="InterPro:IPR038377"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW30"
FT                   /inference="protein motif:TFAM:TIGR00813"
FT                   /protein_id="ACL62620.1"
FT                   /translation="MQAANNPLAITFFFVFMALTLGITYWAARRTRTTEQFFAADGQIT
FT                   AWQNGWALAGDFLSAAALLGIAGIITSNGFDGLIYSIGFLVGWPIISFLIVEPLRNLGK
FT                   FTFADVVAYRLQQRPVRMAAAIGTLTVILLYLIAQMVATGSLIKLLFGLPYVVSVVVVG
FT                   TAMLTYVIFGGMLATTWVQVIKAVLLSLGGLLLAVLVLAHFDMNPLHLFSAAADKYGEH
FT                   VLQPGAKAAGSGWDAISLGVGLMFGTAALPHVLMRAFTVPDVKEARMSILYATGIIGSF
FT                   HLLVFVIGFGAMVLVGPEAVTKAGGGGNMAAPLLALTVGGSGFFGFICAVAFATMLAVV
FT                   AGLTLSGVATVCHDLWVNVVRGGHSPEREQLTVARIATVVIAALAVFLGIVFEGQNVAF
FT                   MAGLAFAVAASANFPALLLSITWKRFTTSAAVASILFGTFSALLLIWLSPTVQVDVLGR
FT                   SLADVSQAWWFVPLKNPALISMPLSFLIAVVVSLVTDEDGAEGTFHEMRQRIMFGASRD
FT                   TYSER"
FT   gene            complement(254855..255151)
FT                   /locus_tag="Mnod_8526"
FT   CDS_pept        complement(254855..255151)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8526"
FT                   /product="protein of unknown function DUF485"
FT                   /note="PFAM: protein of unknown function DUF485; KEGG:
FT                   mpo:Mpop_1561 protein of unknown function DUF485"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8526"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62621"
FT                   /db_xref="GOA:B8IW31"
FT                   /db_xref="InterPro:IPR007436"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW31"
FT                   /inference="protein motif:PFAM:PF04341"
FT                   /protein_id="ACL62621.1"
FT                   /translation="MRASDKYAYSERKYQFEKLCNRRSRVAAALSFVMILMYFSFMAMF
FT                   AFSKSTMGIIIAPGLSLCILLGAGVIVGSFALCFGYVVWANRVYDPSVRRIMD"
FT   sig_peptide     complement(255005..255151)
FT                   /locus_tag="Mnod_8526"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.994) with cleavage site probability 0.981 at
FT                   residue 49"
FT   gene            complement(255260..256375)
FT                   /locus_tag="Mnod_8527"
FT   CDS_pept        complement(255260..256375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8527"
FT                   /product="Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase"
FT                   /note="PFAM: Nitrilase/cyanide hydratase and apolipoprotein
FT                   N-acyltransferase; KEGG: mex:Mext_1157 nitrilase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8527"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62622"
FT                   /db_xref="GOA:B8IW32"
FT                   /db_xref="InterPro:IPR003010"
FT                   /db_xref="InterPro:IPR036526"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW32"
FT                   /inference="protein motif:PFAM:PF00795"
FT                   /protein_id="ACL62622.1"
FT                   /translation="MPAQYPQFKAAACHVASVFLDSTASAEKAVTLIGEAARSGADLVV
FT                   FPEGYMPGFPLWAALRAPIHNHDLFRRLAAQSVRLDGPEIGAVRAAARRHGVLVSLGFS
FT                   ESTEASVGCLWNSNVLIGRNGAILNHHRKLVPTFYEKLVWANGDARGLRVTPTEIGRVG
FT                   MLICGENTNPLARYALMAQGEQVHISTYPPTWPTRPPGERAAYDLARAIEIRAGAHAFE
FT                   AKVFNIVCSGVLDGVARAILCDGDPALADIVERTPAGVSMVLGPTGVHVAEPHQGDEGI
FT                   VYAEIDVAACVEPKQFHDVVGYYNRFDIFHLNVDRSPREPVSFEAAAAQPAGYAADRGG
FT                   TGPVPFGSSAVASGPDDEEPALVHPFRRVGN"
FT   gene            complement(256478..257374)
FT                   /locus_tag="Mnod_8528"
FT   CDS_pept        complement(256478..257374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8528"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: mpo:Mpop_1559 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8528"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62623"
FT                   /db_xref="GOA:B8IW33"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW33"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62623.1"
FT                   /translation="MFDWNDLTFFLELARHGRLMPAARRLKVDHTTVSRRIAELERNLD
FT                   SRLFQRCSGGFVLTEAGHKLFVIAEAIEQKMLSVPEALGLQEAGQLLGRVRVATMEGIA
FT                   AFYLAAKFSEFAASMPGVVVELVTERHLINLTKREADISVSFVPPQGPRLLVRRVGEFR
FT                   LALFASERYLARRGRPATRADLQDHDFVDYVEDLVAIEPVHWLLEVLTPSNVVFRSTSM
FT                   AAQQTAVASGAGMALLPLFSAKTNPALIPVLPNEVVVRRDLYLGVHEDIEYVGRVRAVT
FT                   RFLTSLFTQEAAYLNQF"
FT   gene            complement(257518..259146)
FT                   /locus_tag="Mnod_8529"
FT   CDS_pept        complement(257518..259146)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8529"
FT                   /product="General substrate transporter"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bbr:BB2073 putative
FT                   sugar transport protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8529"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62624"
FT                   /db_xref="GOA:B8IW34"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW34"
FT                   /inference="protein motif:PFAM:PF00083"
FT                   /protein_id="ACL62624.1"
FT                   /translation="MAAANIESYAGAPADAPGMASSADRREMRKVIIGSSLGTVFEWYD
FT                   FFLYGTLAGFFGPLFFSPALGETGAFLASLATYGAGLVLRPFGSLLFGRMGDTAGRKMT
FT                   FLITVALMGIATAGVGLIPTFAQIGIAAPIILVTLRCLQGLAMGGEYGGAATYVAEHAV
FT                   KGRSGRATGWIQICASGGFFLSLLAVFACRGLVGADEFRAWGWRLPFVASVALLAISMF
FT                   IRARLHESPVFKAMKAEGKASKAPVAEAYGVARWRNLMLLSLFGCVAGVGVVWYAGQFY
FT                   ALFFLQKVLKVDFDTATACMAVALALATPFFVLFGALSDRIGRKPIIMGGMLLAAVTYF
FT                   PLFGALTHYANPILERATAAAPVVIRSNDCHLLLLSGPQTDCERVRELLNVAGVTHRVE
FT                   PGEGAGATTQVGTATVTGYDAPALTVALRAAGYPAAADPAQVNTVMVTVILFVMVLFVC
FT                   ITYGPVAIYLVELFPARIRYTALSMPYHIGTGYFGGFMLYFATLISTTTGNIYGGLWYA
FT                   VVIAVASTAIGLWKLPETLGRDIRA"
FT   gene            259295..260344
FT                   /locus_tag="Mnod_8530"
FT   CDS_pept        259295..260344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8530"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; KEGG:
FT                   mva:Mvan_5892 oxidoreductase, molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8530"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62625"
FT                   /db_xref="GOA:B8IW35"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW35"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACL62625.1"
FT                   /translation="MDRASAQAGPHSLPSSDAADASRPPVLYEAHGLIRDIPLQPHEMT
FT                   AAVTATDKLFMLAHLGVLRIAPEAWQLTVGGLVDRPLQLRLEDLARFLPAQIEAVHQCA
FT                   GSPTAPTVATRRVACVVWGGVRLGDILREAGVQSGATHLWSDGADSGTFGGTHVPYFRK
FT                   DLPLARVDADVLLATRLNGDPLPNRHGGPVRLVVPGFYGTNSVKWLWRLTLADRRADGL
FT                   FTTLYYNDPLPDGTTRPVYGLEPESIIVDPAPNTPVPRRAEIRGWAWGDAPVVEVKVSG
FT                   DAGRTWVGAALGPRNGRAWQEWRCPWAFATAGPTMLICRATDAAGRMQPMDGARNEVHR
FT                   VIVEVSQER"
FT   gene            complement(260727..261479)
FT                   /locus_tag="Mnod_8531"
FT   CDS_pept        complement(260727..261479)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_7034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8531"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62626"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW36"
FT                   /inference="similar to AA sequence:KEGG:M446_7034"
FT                   /protein_id="ACL62626.1"
FT                   /translation="MILNALALTLKRQARGDFKGRHVQATLIVQAVSWYLQYALSYRDI
FT                   EEMLLERGLKVDHSTINRWVLAYAPALERRLRMFRKPHCGSVRVDETDIKILGQWRYLY
FT                   RAIDKHGEPVDFLLTAQRDLDAAKRFFRKMLQDQPLLAPDRIGTDGAGPYPPAIVESRK
FT                   EGLLPRTPIHHVTKHLQQGIESDHFRVKRPMPRVGGFRSFTTARRTIQGVKAMLWLRTG
FT                   FGFSGAWTVREQNQLLAHCFGLPVANKA"
FT   gene            complement(261842..264952)
FT                   /locus_tag="Mnod_8532"
FT   CDS_pept        complement(261842..264952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8532"
FT                   /product="acriflavin resistance protein"
FT                   /note="PFAM: acriflavin resistance protein; KEGG:
FT                   sme:SMa1884 cation/multidrug efflux protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8532"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62627"
FT                   /db_xref="GOA:B8IW37"
FT                   /db_xref="InterPro:IPR001036"
FT                   /db_xref="InterPro:IPR027463"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW37"
FT                   /inference="protein motif:PFAM:PF00873"
FT                   /protein_id="ACL62627.1"
FT                   /translation="MSLNLSAIAVRERAVTLFTILLLVAAGAYAFIMLGRAEDPNFTIK
FT                   TLTVTTAWPGATAREMQDLVAEPLEKRLQELTWYDRVETTTRPGYAYMTVTLKDSTPPS
FT                   VVQEEFYQARKKLADEARNLPSGVYGPFVNDEYSDVSFALYALKAKGMPMRELVRQAEV
FT                   IRQDLLHVPGVKKINILGERPEQIFVEFSYAKLATLGVSAQDIVAALQRQNTVTPAGSI
FT                   DTRGPRVFIRVDGAYDSVQAIADTPIVAAGRTLKLSDIAEVRRGYEDPPTYLIRRQGEP
FT                   IIMLAAVMQEGWDGLALGKALEDRTAAIAQTLPLGMTLDKVTDQAVNITSAVDEFMMKF
FT                   AMALGVVLLVSLVSLGWRVGIVVAAAVPLTLAVVFLIMLETGRFFDRITLGALILALGL
FT                   LVDDAIIAIEVMVVKMEEGMDRIKAAAYAWSHTAAPMLSGTLVTIAGFLPVGFARSTAG
FT                   EYAGNIFWVVGFALIVSWIVAVVFTPYLGVKMLPAIKPIEGGHHAIYDTPNYRRLRRLI
FT                   TFAVRHKFVTCGIVGIAFALSGVGMGAVKQQFFPTSDRPEVLVEVRLPEGTSIETTTAT
FT                   VEKLEHWLDKQPEARIVTSYVGQGAPRFFFAMAPELPDPAFAKIVVLTPNAEAREALKH
FT                   RLREAVAQGLAPEAYIRVTQLVFGPYTPFPVEFRVMGPDPAQLYGISEKALDIMRGIPD
FT                   VRQANRDWGNRTPVLRFVPDQDRLNLIGLSPTEVGQQLQFLLTGIPVTQVREDIRNVPI
FT                   VARSAGGERLDPARLADFSLMSRDGRPIPLDQIGHSETRLEEPILKRRDRTPVITTRSD
FT                   INEATQPPEVSKEIMTALQPLIASLPAGYRIEMGGSIEEAGKANAALGKVFPAMIAATL
FT                   IVIMLQVRSFSMMTMVMLTAPLGLVGVVPALLAFNQPFGFNAILGLIGLAGILMRNTLI
FT                   LTEQIKENRAAGLDDYHAVIEATVQRTRPVILTALAAVLAFIPLTHSVFWGSMAYTLIG
FT                   GTAVGTVLILLFLPALYAAWFRIKPTADESHETSTEEPELRTAMAAE"
FT   sig_peptide     complement(264860..264952)
FT                   /locus_tag="Mnod_8532"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.966) with cleavage site probability 0.779 at
FT                   residue 31"
FT   gene            complement(264949..266061)
FT                   /locus_tag="Mnod_8533"
FT   CDS_pept        complement(264949..266061)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8533"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   mlo:mll2830 component of multidrug efflux system"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8533"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62628"
FT                   /db_xref="GOA:B8IW38"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW38"
FT                   /inference="protein motif:TFAM:TIGR01730"
FT                   /protein_id="ACL62628.1"
FT                   /translation="MRKRPAMVLGSVLVAGVGAVAFASVSLRTQEASAVTDPRQDPPIV
FT                   RLATAAGVTGSERGFTGTIGARVQSNLGFRVPGKVVERLVNVGQQVKAGQPLMRIDETD
FT                   LRLALTAKRNAVAAAHASVVQLKADEQRYASLLTKGWVSRQRYEQAKAASDTAEAQLAA
FT                   AEAEARVAENEATYSVLLADADGTVVETLGEPGQVVSAGQAVVRLAQAGPREAVVALPE
FT                   TIRPAIGSVAEASVYGGDGRRYTAHLRQLSDSADAQTRTYEARYVLDGAAAAAPLGATV
FT                   TIRLASQASQPEVQVPLGAVLDDGEKTGVWLLDRATSTVTFRPVKLVRVTSETAVISGL
FT                   SSGDPVVSLGAHLLREGARVRTASQSRSNR"
FT   sig_peptide     complement(265990..266061)
FT                   /locus_tag="Mnod_8533"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.930 at
FT                   residue 24"
FT   gene            266146..266751
FT                   /locus_tag="Mnod_8534"
FT   CDS_pept        266146..266751
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8534"
FT                   /product="transcriptional regulator, TetR family"
FT                   /note="PFAM: regulatory protein TetR; KEGG: sme:SMa1887
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8534"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62629"
FT                   /db_xref="GOA:B8IW39"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW39"
FT                   /inference="protein motif:PFAM:PF00440"
FT                   /protein_id="ACL62629.1"
FT                   /translation="MRVSRVQAEKNRQTVIDVASRLFREHGFDGIGLKGLMEGAGLTQG
FT                   GFYKQFASKEDLAAQASKRALESAFARWEAAAASNPTDPLGAAVAFYLSMEHREEKMDG
FT                   CPVVALGSDAARQGVDVKASFEAGIRKYLELLGRWVADTDGEEPSGKAMAILSTMVGAV
FT                   VLSRAVNDEHLSKRFLQAAAESVLTASSAGDAQLGPRQ"
FT   gene            266816..268053
FT                   /pseudo
FT                   /locus_tag="Mnod_8535"
FT   gene            268054..269262
FT                   /locus_tag="Mnod_8536"
FT   CDS_pept        268054..269262
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8536"
FT                   /product="Beta-ketoacyl synthase"
FT                   /note="PFAM: Beta-ketoacyl synthase; KEGG: mlo:mlr2832
FT                   3-oxoacyl-(acyl carrier protein) synthase II"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8536"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62630"
FT                   /db_xref="GOA:B8IW40"
FT                   /db_xref="InterPro:IPR000794"
FT                   /db_xref="InterPro:IPR014030"
FT                   /db_xref="InterPro:IPR014031"
FT                   /db_xref="InterPro:IPR016039"
FT                   /db_xref="InterPro:IPR018201"
FT                   /db_xref="InterPro:IPR020841"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW40"
FT                   /inference="protein motif:PFAM:PF00109"
FT                   /protein_id="ACL62630.1"
FT                   /translation="MRRVVVTGLGAVTPLAAGVEASWSRLLGGRSGIRRLSDDVVGDLP
FT                   AKVGGAVPSAEEDPDAGFDPDAVMAPKDQRKVDRFILFALAAAEEALAQANWKPVSETE
FT                   RLRTATVIASGIGGFPAITEAVRTVDSRGVRRLSPFTIPSFLVNLAAGHISIRHGFKGP
FT                   LGAPVTACAAGIQAIGDAARLIRANEADIAVCGGTEACMNIVSLGGFAAARSLSTGFNG
FT                   TPAEASRPFDMARDGFVMGEGAGILVIEELSHALARGAKPFAELVGYGTTADAHHVTSG
FT                   PEDGDGARRAMQIAIAQAGISPGEVRHLNAHATSTPVGDLGELEAIKRVFGADSSIAVS
FT                   ATKSATGHLLGSARSPSASPSRPSARRGVSRGQARPSAGPPCGRGCWRAARRARPRRGW
FT                   HVI"
FT   sig_peptide     268054..268119
FT                   /locus_tag="Mnod_8536"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.910) with cleavage site probability 0.451 at
FT                   residue 22"
FT   gene            complement(269287..270036)
FT                   /locus_tag="Mnod_8537"
FT   CDS_pept        complement(269287..270036)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8537"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mlo:mll2846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8537"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62631"
FT                   /db_xref="GOA:B8IW41"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW41"
FT                   /inference="similar to AA sequence:KEGG:mll2846"
FT                   /protein_id="ACL62631.1"
FT                   /translation="MTNQMQSIHERIMTARRATDNGRGGLSGLDDAASSRRRWLRPLLY
FT                   GTTCAILLAGGGFGLYQFPVFAETAAQQVTGKPKAAPQPAPRRAQPDNAATPAAAATAP
FT                   ADLFLTHANELGVKTCAATYAGLGKALTEGTQFTVQTQTAKADADRYGVQGVVGMAFPS
FT                   GKGGYSGTAAGIVFAAPTAQGCEGDMVRVVPFAQNCQAAAAFLPKGSQPLQPLSGIAIY
FT                   ALSTGGQAMLMPSGNGCVAISILRSTS"
FT   gene            complement(270096..270749)
FT                   /locus_tag="Mnod_8538"
FT   CDS_pept        complement(270096..270749)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8538"
FT                   /product="Invasion associated locus B family protein"
FT                   /note="PFAM: Invasion associated locus B family protein;
FT                   KEGG: bov:BOV_0072 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8538"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62632"
FT                   /db_xref="InterPro:IPR010642"
FT                   /db_xref="InterPro:IPR038696"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW42"
FT                   /inference="protein motif:PFAM:PF06776"
FT                   /protein_id="ACL62632.1"
FT                   /translation="MFVRIMTRAAVILLVLILAGLSGGGTHAAGQKRKAVPVAPQTTAS
FT                   AVQPAPSYTLTPGFSVKLPDVALPADVPLGQYRRVIRPFPNWTLICDENLEKKQKVCNI
FT                   SQTIVGPDGATVFSWSLAATLEGQPFFILRIPPGVGPNATLGLDLADGAPPITVPIKGC
FT                   DAKICIAYLPVGQRLRTAAAKGGPVQVSYASDSLPNAVSFRAPLAGLTAALSVI"
FT   sig_peptide     complement(270663..270749)
FT                   /locus_tag="Mnod_8538"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.999 at
FT                   residue 29"
FT   gene            complement(270761..277234)
FT                   /locus_tag="Mnod_8539"
FT   CDS_pept        complement(270761..277234)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8539"
FT                   /product="YadA domain protein"
FT                   /note="PFAM: YadA domain protein; Haemagluttinin domain
FT                   protein; Hep_Hag repeat-containing protein; KEGG:
FT                   mlo:mll2848 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8539"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62633"
FT                   /db_xref="GOA:B8IW43"
FT                   /db_xref="InterPro:IPR008635"
FT                   /db_xref="InterPro:IPR008640"
FT                   /db_xref="InterPro:IPR011049"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW43"
FT                   /inference="protein motif:PFAM:PF03895"
FT                   /protein_id="ACL62633.1"
FT                   /translation="MNKGAYKPNCAGGGLLEGYSGGQRRRVMAVLRCAHRVLGMRRKRL
FT                   GLGPLGLSSVTVSRSGASVLLLAAAFGAAAPHPAEANTIWSVQGCTTFNSGQVGNEGNL
FT                   GGTNNNPADGSGTFSTIAGCDANGNGLLGVTLYGTRTRATGTGAVAIGYNASAAKWAAA
FT                   YGLDAAASGMGATALGFSAVASGANAVSIGSAGGDGTTALSVANSTTASGAGAVAIGSN
FT                   AVSGAKATATDSIAFGGQSIVYGGATSAIAVGRGASVNGAYAIALGDGTSIDGAGSIVI
FT                   GRGANATGGGSDTNAIAIGVGAVSYSNSVALGDGASADQNTYLKQNGAVAIGPSASTAD
FT                   GTTRAVALGSGAAVSPVSGVIDGAMALGAGARARNNGAVAIGKASTASGADSIAQGTNA
FT                   TAANTNTIAIGNGAQATGSQSISIGTGNVVSGANSGAIGDPTTITGSGTYTLGNNNGTV
FT                   GANESGIFGNNNTLPAGSDNSRIVGNSNTVNSANVMVMGNGVTVGTGLSGAVVLGNSST
FT                   VSAAVGTPNTTIKGTTYPFAGGAPAAGDVVSVGSGTAPRQIQNVAAGRISGNSTDAING
FT                   SQLFATNQAVGTLGTQVTNLGSSTATALGGGATYNATTGTVSAPSYTVNGNTYTNVGSA
FT                   LGAATTHYYSVNDGGTAGGNYNNNGATGAKALAAGVDASATGASAIAIGASAVASGTNN
FT                   AIAIGTSAAASGNRTISIGNLAGTGSTGFDNLAMGVQSGQNNSSSVNTAIGFQVGNSVS
FT                   STGNVALGNLGAGSNVSNTSTQSPVFAAVTGNNVAVGAVAGQGVKGALNVAMGWKAGQI
FT                   VDGYNNVGVGALAGYTTTGNNNVGLGTFASSTVAGHRNVGVGNNAGSSVTGASNSGIGD
FT                   NAGVTVKGDANFAGGLGAGNSVTGSRNIALGNLAGSNISASDAIALGTQSLAGASSAIA
FT                   IGNGAQATGAQSISIGTGNVVSGTNSGAIGDPTTITGSGTYTLGNNNGTVGANESGIFG
FT                   NNNTLPAGSDNSRIIGNFNTVNSANVMVMGNGVTVGTLLDGAVVLGNRSTVSAAVDTPS
FT                   AIINGTTYTFAGPAPADGDVVSVGPNFAPRQIQNVAAGRISGTSTDAINGSQLYATNQA
FT                   VGTLGTQVTNLGSSTATALGGGASYNSTTGIVSAPTYNVGGGSVYNTVGDALAAIDVTA
FT                   NKGWQLQANGDTASQVKPGDTVQLLDGQNIKVTRSGTEVTIATANDLTATSLTTGNAKL
FT                   DTSGLTVADGTNTTSYGANGFAITNGPSVTVAGIDAGGKKLTNLAAGTVSAASTEAVNG
FT                   SQLYALGQSATTVLGGNAAYTTTGQLTMSNVGGTGQNTVDAAIAAVNTTAGKGWQLQAN
FT                   GDTASQVKPGDTVQLLDGQNIKVTRSGTEVTIATANDLTATSLTTGNAKLDTSGLTVAD
FT                   GTNTTSYGANGFAITNGPSVTVAGIDAGGKKLTNLAAGTVSAASTEAVNGSQLYATNQT
FT                   LSTVASNTSSYLGGGANVATGTAPSYAIGGSVYNTVGDALAAIDVTANKGWQLQANGDT
FT                   ASQVKPGDTVQLLDGQNIKVTRSGTEVTIATANDLSVTSLTAGNAKLDTSGLTVADGTN
FT                   TTSYGANGFAITGGPSVTVAGIDAGGKPLTGVAAGTVSAASTDAVNGSQLYATNQNITS
FT                   LQTDALRWNSSLGAYDASHGSGSAQKITNVAAGALSSSSTDAVNGSQLYAVSQNIATLN
FT                   DSAVKYDDASKGKISLAGQNGTTITNLRAGTVSSTSTDAINGSQLYNTSKSVATALGGG
FT                   STVNSDGTVSAPTFTIQGSNYNDVGSALGAVDGNLTTLNTQVANISNGGGIKYFHTNSS
FT                   LADSQANGMNSVAVGPTAVAAGENSIATGNNAQAQADNAVALGANATASNAGDVALGSG
FT                   STTAKAVQTSTMTVNGNTYNVAGTATATVSAGSVGAERTITNVAAGRVNATSTDAINGS
FT                   QLYATNQEVASLGGQVTTAIAATKNAVQYDTDGNGNRKNSITLQGGDANAPVLLSNVAA
FT                   GAGDTDAVNVQQLRRSAASTLASANTYTDDRTSYAISTANAYTDNRTSYAISTANAYTD
FT                   VRSAQTLSVANAYTDYKFGQLSGQIGEVRKEARQAAAVGLAAASLRYDDRPGKLSAAIG
FT                   GGAWRGQGALAVGVGYTNDDQTVRANLSASTAGREWGVGAGLSFTLN"
FT   gene            complement(277215..277697)
FT                   /locus_tag="Mnod_8540"
FT   CDS_pept        complement(277215..277697)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8540"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62634"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW44"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62634.1"
FT                   /translation="MTEQPRLPLMSLPLGSRTCERIASKARSVEQAMRERFAAQWSAAQ
FT                   IDLLYLHYLYGVVMTALPDAEPRVQIGFLRHLAGRSLTTDAVTTALHACPASGDPSSLA
FT                   RSQPPKPSDSATRRPFATTPTQGRSNSSNPTSIQFGAPHEHVHSTREGKPNEQGGI"
FT   gene            complement(277694..278680)
FT                   /locus_tag="Mnod_8541"
FT   CDS_pept        complement(277694..278680)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8541"
FT                   /product="diguanylate phosphodiesterase"
FT                   /note="PFAM: EAL domain protein; KEGG: rpd:RPD_0308 GGDEF
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8541"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62635"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW45"
FT                   /inference="protein motif:PFAM:PF00563"
FT                   /protein_id="ACL62635.1"
FT                   /translation="MSAPILGNVVGNAGGGPDAGSAAIRLGFAAEPIVDLAVCGAPPLY
FT                   SECLVRMMVAESVLLRGAEIVEDIEAAGSIGLLDAAVVDLVLDALAEESHVILGCNISP
FT                   RTLADADAWAWVMRRIEVRSWLASRLVLEITESCLLNELDGVAERLGQAKRLGCRLAID
FT                   DFGAGFATSVYLQGVDVAWDIVKIDRLCFADLRNTPSGRVDLCSLFSLARAFAPLVVVE
FT                   GIETREHFDAARAAGAQYGQGWMFEGPVRHRWATSGDDIGEHLAAAMMAHGAIVRPSGP
FT                   APTIVAPATPRRGDPPEPGGTYLLSRVDRIGDRVRALVGRAKAGGVS"
FT   gene            complement(278677..279276)
FT                   /locus_tag="Mnod_8542"
FT   CDS_pept        complement(278677..279276)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8542"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8542"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62636"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW46"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62636.1"
FT                   /translation="MKSPRSFSGHRGNPRLRETPGRVAFGRRERSPEHEAPFRKARLDI
FT                   LGAELSLLLGGETSGEPGFVSVVPGDEPALSIGCEETRLSVEIDPPTGYFVLHESGLNS
FT                   CSVGTANEERLLDHIIERIATLSGDLTPHTADVTVAMLVGRSLEEVERHLILRTLVLFA
FT                   GARAETAFALGIDGVELHARVRRDLKSAPAASRGPQ"
FT   gene            complement(279991..280291)
FT                   /pseudo
FT                   /locus_tag="Mnod_8543"
FT   gene            complement(280463..281774)
FT                   /pseudo
FT                   /locus_tag="Mnod_8544"
FT   gene            281949..282170
FT                   /locus_tag="Mnod_8545"
FT   CDS_pept        281949..282170
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8545"
FT                   /product="transposase and inactivated derivative"
FT                   /note="KEGG: cak:Caul_4245 transposase and inactivated
FT                   derivative"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8545"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62637"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW47"
FT                   /inference="similar to AA sequence:KEGG:Caul_4245"
FT                   /protein_id="ACL62637.1"
FT                   /translation="MDQLTLSNEQWERIAPHLPGKAGDPGRTAADTRLFVEALFWMARV
FT                   GSPWRDLPASFGKWNSVFQRFRRWTQKG"
FT   gene            complement(282207..282302)
FT                   /pseudo
FT                   /locus_tag="Mnod_8546"
FT   gene            282526..283572
FT                   /pseudo
FT                   /locus_tag="Mnod_8547"
FT   gene            283911..284768
FT                   /locus_tag="Mnod_8548"
FT   CDS_pept        283911..284768
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8548"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   swi:Swit_5050 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8548"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62638"
FT                   /db_xref="GOA:B8ICV5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICV5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62638.1"
FT                   /translation="MSARLEWMNGPSLVWTAANRPRYDRRSQRYPSDMTNDEWLTLEPL
FT                   LPVAEGIGRPRTYPIRDIMNGIRYVQRYGIPWDAMPKDLPPASLCYDYWRLLTDGGHMD
FT                   RINHHLVMRDREKSGKEASPTLAIVDAQAVKCDAPQGERGYDAAKQVLGRKRHLAVDSD
FT                   GRLLAVMITPANVQDQEGGIPLVKRLVRLCPWIKTIVVDGGYKARFIEAVQAGTSRVVE
FT                   VVVRPQFGKGFVLLPKRWRIEQSIGALTVSRRLKLDYDTLLHISAAAMLFASITRLLAS
FT                   ITMK"
FT   gene            complement(285384..286211)
FT                   /locus_tag="Mnod_8549"
FT   CDS_pept        complement(285384..286211)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8549"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpm:BURPS1710b_A2311 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8549"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62639"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW49"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62639.1"
FT                   /translation="MRRRRRGAGARTGGRCSRGISSLTPLCWQLRLFPGRVPEDLEPHA
FT                   PGRQDARHRGICRDRRDGDGTRSGCLADREALRARVGRRGGSRDSRSEFLLLWLRYIPW
FT                   GQRGSRSSIRCRILHRRGGLAPCHSRVRVGRSVIRPRQVSRWNALERRERRHREERSRR
FT                   AGRGPLIPIIGMILRLCHAGTCRTGSRPDCLPVLATPPAQAHPQSREHPYGSQSARNQQ
FT                   PEPRLQNRADRMCGGRRSRRARRGRTHGSADVSRRCTRRLIERRWRRRAGCVS"
FT   gene            286260..288446
FT                   /locus_tag="Mnod_8550"
FT   CDS_pept        286260..288446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rde:RD1_A0035 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8550"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62640"
FT                   /db_xref="InterPro:IPR007791"
FT                   /db_xref="InterPro:IPR025266"
FT                   /db_xref="InterPro:IPR028932"
FT                   /db_xref="InterPro:IPR029024"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW50"
FT                   /inference="similar to AA sequence:KEGG:RD1_A0035"
FT                   /protein_id="ACL62640.1"
FT                   /translation="MAGFILPGLVYVGDSLPSATGFGRSDNCLIDPRLPVAKGNADISG
FT                   QYMDYWPAYESMRPSSRRALLEWLSGERSDPGTYIGYVFVYLYGLERRAVLDGSAEERP
FT                   AIRSEVERLLAVYRHNGSFRRYAGELLSALDILDLGPDDDPLPVFAPSGGSLPPAVSIA
FT                   IGRRIRAGQPIEGDWLLAWTMAHPETRVRTAARRAFDYLRQGFADEFRRRHPSGGLVVK
FT                   PRQGKAAPIAYHAASGTFTATLGAERLGRLPDLSRYPEPLALGRELLEICTDRLDAYSR
FT                   HLGRTTGEAAAPMLQAVALLPPGLLRERALTGPAGESLEWLSARAHDSLPVPFAEVSIQ
FT                   VSGQTAEKATPARLRNLADILCRFGLGLVPDPRFPTRLPAGTSSILLFPFDAPCETVVG
FT                   PSDAYMAAFLTLSVGVLIAKADGVISADERAALRDMASGAPGTSPTERCRLAADARWLE
FT                   ANPVELSSLRARLSDLGEHHRQAVGDALVRVASSDGTHHRAEVSLLEKVFRQLGLERDR
FT                   LYAGLHRAGRDPAPPDMASGAADEPVRVVAGPVQEKTYAIPAVPSEALPGTLTPPEPVN
FT                   DRAPQPIDGAASATAPAAAGPADIDRLAAIRAETAAISSVLAGVFEAMADGGDNLPAMA
FT                   APSAETSEAAEMDGVFDGLDARYDQFLRELAGRAAWPRAAFDRLAREFGLMPGAAMEDL
FT                   NRWAFDRFDDVLVEEGDPILINLHLIPASLPAAA"
FT   gene            288455..289782
FT                   /pseudo
FT                   /locus_tag="Mnod_8551"
FT   gene            289779..292130
FT                   /locus_tag="Mnod_8552"
FT   CDS_pept        289779..292130
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8552"
FT                   /product="DEAD/DEAH box helicase domain protein"
FT                   /note="PFAM: helicase domain protein; DEAD/DEAH box
FT                   helicase domain protein; SMART: DEAD-like helicases; KEGG:
FT                   rsp:RSP_0224 ATP-dependent helicase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8552"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62641"
FT                   /db_xref="GOA:B8IW51"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011545"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW51"
FT                   /inference="protein motif:PFAM:PF00270"
FT                   /protein_id="ACL62641.1"
FT                   /translation="MTRQVELPVAAGRAEEASRAFDRLAEPVRRWIWQQGWSTLRDVQE
FT                   RAVPAILAGGDVILAARTAAGKTEAAFLPLLSRVLPKRDGGRPGFSLLYVSPLKALIND
FT                   QFRRLESLLEACDMPLHRWHGDVSADAKRRARERPQGVVLITPESLEATLVRRGREAPR
FT                   LFGALDAIVIDELHAFIGTERGRQLQSVLSRIEACAGRDRIDRVGLSATLGDMDLAREA
FT                   LRPGASDAVTLVESQEGGTELLLQIRGYERPLRQPTAPPKDRLQQPSGPGPNEEREAAS
FT                   AVPDLCAVEAIQTASLVEEPVARHLFEVLRGRRNLLFAGSRQNVEIYTDRLRALSEAAR
FT                   LPNEFFAHHGNLSRAERETVELRLREDARPTTAVATTTLELGIDIGDVESVAQIGPGWS
FT                   VSSLRQRLGRSGRRPGKPAVLRIYVIEDEAGPTLHPADRLRLDLVQAVAMVELLLERWC
FT                   EPPRTRGLHLSTLVHQTLALIVQTGGLRPGTAWQLLCEHGPFRNVSRDLFVEVLRSMAR
FT                   PEAELVEMSPDGLLMLGPRGERLTAGHDFFAVFQSPEEYRIVEGSRPLGTVPLDTTLAP
FT                   GQTIIFAGRRWCIETVDERAKVVVVIPTNAALPPRFDGSGAGLHDRVAAAMRACLSGTH
FT                   VPPFLDAGARTLLGQARDAFFAFGLDRGSIVEVEGDCVIFPWAGSPKLETLTLALRTRH
FT                   FQASPFQHVIEVRDCSARNLRAALAEIAGSPPPDGHELARFAVKPMREKYDAYLTEALL
FT                   VQAMTVERLEAQALPGIARLVLDPPFSSGP"
FT   gene            292153..293427
FT                   /locus_tag="Mnod_8553"
FT   CDS_pept        292153..293427
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8553"
FT                   /product="integrase family protein"
FT                   /note="PFAM: integrase family protein; KEGG: smd:Smed_5431
FT                   phage integrase family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8553"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62642"
FT                   /db_xref="GOA:B8IW52"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW52"
FT                   /inference="protein motif:PFAM:PF00589"
FT                   /protein_id="ACL62642.1"
FT                   /translation="MQGRAIGHAHRAAAGPALLDADLHGDAVDHRRHVRDALAGILPFD
FT                   ARERLAALLTDEDTATLKHLARTGMGADTLRALASDLGYLEAWCRAATGHPLPWPATEA
FT                   LALKFVAHHLWDPVQRESDPRHGMPAPVSDDLRARGLLRVAGPHAVAPVRRRLAHWSTL
FT                   HRFRGLDGPFKAPRLRTALSLAVRASRRPRTRKSARPVTVAVVEKLLATCLFDHQLVDR
FT                   RDGALLLVAFASGGRRRAEVAGLRVEDLVREAPVLLDPADPDSPRVPKITIRLGRTKTT
FT                   TAEEDARVVVIGRAAQALLDWLTAAWIEAGAVFRRIDRWGRLGATALDPQGVNAILKAR
FT                   CARAGLDPALFSAHGLRSGFMTEAGRQGVPLPEAMRLSQHRSVQQAARRGSARRSRAAP
FT                   SRAGLSRGRRRGRRGRPCPSCRRRP"
FT   gene            complement(293231..293572)
FT                   /pseudo
FT                   /locus_tag="Mnod_8554"
FT   gene            complement(293676..294872)
FT                   /locus_tag="Mnod_8555"
FT   CDS_pept        complement(293676..294872)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8555"
FT                   /product="CitB domain protein"
FT                   /note="TIGRFAM: CitB domain protein; KEGG: bbt:BBta_4212
FT                   putative citrate utilization protein B (CitB)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8555"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62643"
FT                   /db_xref="GOA:B8IW53"
FT                   /db_xref="InterPro:IPR012830"
FT                   /db_xref="InterPro:IPR036197"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW53"
FT                   /inference="protein motif:TFAM:TIGR02484"
FT                   /protein_id="ACL62643.1"
FT                   /translation="MLATDTKTSGTTAHHASAALAEADRLMTVCNSCRYCEGLCAVFPA
FT                   MEMRRSFSDGDLNYLANLCHSCGACFYDCQFSPPHAFDVNVPRVLAQVRNESYAHYAWP
FT                   RALAPLFARNGTAIALITSACVAAFLFGFMALNDPKVMFGAQLGEGAFYRLMPHNAMAF
FT                   LFGAAFLYALVALGLGLLRFWRDIGETRATLQDVGYNWQATQDTLRLRYLDGGGAGCMN
FT                   QDDNPSKDRRRFYHHLTFYGFMLCFASTSVATLYHYLLGREAPYPWWDLPVVLGTLGGI
FT                   GLVIGPLGLLRAKAVRDETMRAPEGRGMENAFTLMLFALGTTGLALLVLRSTPAMGTLL
FT                   AVHLGAVFGFFVTMPYGKFVHGLYRYAALVRFAKERKALHGPSPAECAVAVPNPKAGR"
FT   gene            complement(294859..296247)
FT                   /locus_tag="Mnod_8556"
FT   CDS_pept        complement(294859..296247)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8556"
FT                   /product="precorrin 3B synthase CobZ"
FT                   /note="TIGRFAM: precorrin 3B synthase CobZ; PFAM: fumarate
FT                   reductase/succinate dehydrogenase flavoprotein domain
FT                   protein; HI0933 family protein; FAD dependent
FT                   oxidoreductase; KEGG: bja:blr2320 tricarballylate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8556"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62644"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR012831"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW54"
FT                   /inference="protein motif:TFAM:TIGR02485"
FT                   /protein_id="ACL62644.1"
FT                   /translation="MRPTSQRYDVLVIGGGNAALCAAISARREGASVLVLEAADAFWRG
FT                   GNTRHTRNMRCAHDTATEILTGPYTEEEFFEDLLLVTGGRTDEDLARHMIRESKEMLTW
FT                   IEEQGVRWQPSLGGTLSLGRTNSFFLGGGRAMLNALYATAERLGVEVRYEAEVTDLEIE
FT                   DGHFLSATLRDGERIRAGTLVAAAGGFESNIAWLKRYWGEAADNFLIRGTSNNKGTILK
FT                   LLLDRGVQEVGDPTQCHAVAIDARAPKYDGGIITRLDCVVFGIVVNKHAQRFYDEGEDI
FT                   WPKRYAIWGRLVAAQPDQIAYIIFDASSLELFMPSLYPPIQARTIPELALALGLDPDAL
FT                   ARTVADFNAAVRPGTFDDKILDDCRTEGLTPPKSHWARRIETAPFYAYPVRPGITFTYL
FT                   GTRVDKQARMIMADGTPAANMFAAGEIMAGNVLGQGYAAGIGMTIGAVFGRIAGREAAR
FT                   HARN"
FT   gene            296610..297263
FT                   /locus_tag="Mnod_8557"
FT   CDS_pept        296610..297263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8557"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: mrd:Mrad2831_5092 GntR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8557"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62645"
FT                   /db_xref="GOA:B8IW55"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW55"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL62645.1"
FT                   /translation="MNVWKPADQPNGMSAYELLLRAIEDGELTPGTRLREAELAERFAI
FT                   SRTPIREALARLESHGLVTHEPHRGATLTKLGYAQVTELYDLREVLEGMAARLAATHAS
FT                   DTEIDVLEEMVARDRTLTHDPRILARTNRLFHRQIHACARNRFLQGMLENMRLSLVLLA
FT                   GTTLAEPGRAEPAVDEHAAIVARIRVHDRDGAEEAARAHIRASFKTRIRMYQSD"
FT   gene            complement(297241..298980)
FT                   /locus_tag="Mnod_8558"
FT   CDS_pept        complement(297241..298980)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8558"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; FAD dependent oxidoreductase;
FT                   KEGG: bja:blr2722 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8558"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62646"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW56"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACL62646.1"
FT                   /translation="MDSAWDVIVVGSGAGGLTAASIAAAEGCSVLLVEQAPVVGGTTAI
FT                   SGGMVWIPGNGKAAQSPDRLEAARIYLEHTAPPGDRQRLEAFLASGADAVRDLEARTAL
FT                   RLQPVPTYPDYYPDLPGATSSGRVLEPEPYDAGQLGDAFALLRDPLPEFTLFGGMMISR
FT                   QDIPHLRRVGRSWRSAWHVAKLLLRYGAQRLRARRGTTLYLGNALVARLLQSARDLGVT
FT                   IRTRTSAERLVTDRSGRVAGVELVDGEGRRTTAQARRGVVLATGGLSHGGAMRASYVPT
FT                   AAGTLTATVDPGKAARGARLATEVGARLSEPTEQGAFWVPASTFTRRDGSRGVFPHTVT
FT                   DRAKPGLIAVGSDGRRFVNEAVSYHEFVRAQLASAGRAVPAWLLCDRQFLWKYGLGKVK
FT                   PFTRFPGADIASGYLKRGSTLADLAAAIGVPAAALADTVETFNRDARCGEDPAFGRGRD
FT                   IYQRHLGDADHAPNPCVAPIEHAPFYAVAVWPADLGMSAGIVTDAQARVLGADGSPIPG
FT                   LFACGNDMASIMQGAYPGPGITLGPALTFGWIAGRGAASALREQTEQPTAGEPAALSPT
FT                   GTS"
FT   gene            complement(298989..299699)
FT                   /locus_tag="Mnod_8559"
FT   CDS_pept        complement(298989..299699)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8559"
FT                   /product="short-chain dehydrogenase/reductase SDR"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; KR domain protein;
FT                   KEGG: azc:AZC_1315 short-chain dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8559"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62647"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW57"
FT                   /inference="protein motif:PFAM:PF00106"
FT                   /protein_id="ACL62647.1"
FT                   /translation="MTASSSIALVFGGSRGIGAACVDVLAASGWQVAFTYVSRAPEDAP
FT                   HRHYPADIRDAAAVARVFDRVESDLGAAPTAIVANAGINVPAAPMAQFDPDNFRQLVEV
FT                   NVVGAFNILAEAARRVRDGGAIVAVTTSLVRHAVPGTGPYTASKAAVESMVRAMAKELA
FT                   GRRVRVNGVAPGPVDTDLFNAGKTEEAKQRMAAFSPFNRIGRPEEVAQVVRFLLSEESS
FT                   WVHGQIVQPNGGMA"
FT   sig_peptide     complement(299619..299699)
FT                   /locus_tag="Mnod_8559"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.612) with cleavage site probability 0.458 at
FT                   residue 27"
FT   gene            complement(299770..300732)
FT                   /locus_tag="Mnod_8560"
FT   CDS_pept        complement(299770..300732)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8560"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KEGG: mka:MK0724
FT                   nucleoside-diphosphate-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8560"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62648"
FT                   /db_xref="GOA:B8IW58"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW58"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL62648.1"
FT                   /translation="MSKTILVTGGCGWLGSEIVRTLLARGDSVVATDLAISPALSALLA
FT                   REPRLAAAAADLGEWPQVLRLFEQHRVDAVIHAAAIVGVVQAADIPLKALRVNVEGSIN
FT                   LFEAMRLHGVKRVVHVSTEETYGDFQAPIIDEEHSQKPVSVYGLTKLAVEHYGRVYSRE
FT                   SGLECINVRTCWVYGPHLPRLRLPRTFIEAALRGEAFHQPDGGNFAVDQVHISDTVAGI
FT                   LLALDKPQHRFDAYNVATGAAPSIADTAEAVNRAIPGARITVGDCGPYYHGGSVLSARK
FT                   GALDIRRAEVELGYRPRYDIQRGIEATIAVTRGEPVPAL"
FT   gene            complement(300747..301169)
FT                   /locus_tag="Mnod_8561"
FT   CDS_pept        complement(300747..301169)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8561"
FT                   /product="Cupin 2 conserved barrel domain protein"
FT                   /note="PFAM: Cupin 2 conserved barrel domain protein; KEGG:
FT                   cti:RALTA_A2099 conserved hypothetical protein, RmlC-like
FT                   cupin domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8561"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62649"
FT                   /db_xref="InterPro:IPR011051"
FT                   /db_xref="InterPro:IPR013096"
FT                   /db_xref="InterPro:IPR014710"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW59"
FT                   /inference="protein motif:PFAM:PF07883"
FT                   /protein_id="ACL62649.1"
FT                   /translation="MATVIKEPNAFAHATAEKHAVTRNLAELPWVQYPGHFNQALSKAI
FT                   VTPETVGSRFFDHRISSYEPGAHVESHSHAVQEQIYHVLAGEGVLIVDGERRLVRANDV
FT                   TYIPPGVIHEFHCTGTDPLVFLVITSPPTDEEPQPR"
FT   gene            complement(301186..302097)
FT                   /locus_tag="Mnod_8562"
FT   CDS_pept        complement(301186..302097)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8562"
FT                   /product="NAD-dependent epimerase/dehydratase"
FT                   /note="PFAM: NAD-dependent epimerase/dehydratase;
FT                   short-chain dehydrogenase/reductase SDR; 3-beta
FT                   hydroxysteroid dehydrogenase/isomerase; polysaccharide
FT                   biosynthesis protein CapD; dTDP-4-dehydrorhamnose
FT                   reductase; Male sterility domain; KR domain protein; KEGG:
FT                   cmi:CMM_0635 putative NDP-sugar epimerase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8562"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62650"
FT                   /db_xref="GOA:B8IW60"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW60"
FT                   /inference="protein motif:PFAM:PF01370"
FT                   /protein_id="ACL62650.1"
FT                   /translation="MTRRVLVTGAAGLLGRFVVDELLAHGALVRGLDRRAGTAPIEWHV
FT                   ADVTDPQAVAKAVTGTDAVLHIAAVPNIWSGDGQTIMRVNTLGTYTLLDAAEAAGLKRF
FT                   VFCSSDSVAGYTVREGRMLAPLYAPLDLDHPLRATDPYGVSKVLGEDLARAHAYRGMAV
FT                   VALRTVFVAYPEMAGEIIARARDPENYRGPAVGGPSSAGGGPLHHHIDPRDLARAFRLA
FT                   LELPLEPGAFERFYLSAQVTLSPEPTLDRLRRLHGNDVEIRQPEIYERQPFAPLYDLTH
FT                   AADRLGFLAEHDQRHLVTDLPQ"
FT   gene            complement(302094..302930)
FT                   /locus_tag="Mnod_8563"
FT   CDS_pept        complement(302094..302930)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8563"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bja:blr3667 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8563"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62651"
FT                   /db_xref="GOA:B8IW61"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW61"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL62651.1"
FT                   /translation="MAGAIGINTYSYIWTVPAAESVRRLADLGYRTFELVIHPGHLPLD
FT                   GFSTADRRHLVAVLDEVGATDCALNLPSLDHNLASSTPRVRAASVQMFRDAIDLASDLG
FT                   IGWLVTVPGRMSPLFPPGISERTAWMRESIEALLPHAEARGVGLAVENIPIAAFPDAAS
FT                   LGDFVRSFASPKVAACYDAANAHFIGEDPVAGMHSLSDCLRILHLSDTGRTVWRHDPVG
FT                   TGTVPFAEVARAVTSINFTGPCMLEIIDPEPEAAILRSHDILAALGCEAWQKEAQA"
FT   gene            complement(302930..305509)
FT                   /locus_tag="Mnod_8564"
FT   CDS_pept        complement(302930..305509)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8564"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: inner-membrane translocator; ABC transporter
FT                   related; SMART: AAA ATPase; KEGG: xau:Xaut_2704 ABC
FT                   transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8564"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62652"
FT                   /db_xref="GOA:B8IW62"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR032823"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW62"
FT                   /inference="protein motif:PFAM:PF00005"
FT                   /protein_id="ACL62652.1"
FT                   /translation="MRTGPSASRRLWEHPIVVLTAVLLAASGLALAWGMPIQRITQIAI
FT                   YTLYGAGVNFLIGYLGLVPFGASFFFGCAGYALAITSGALGGSEISGLVIAAGFALILA
FT                   ALVGSVILRRRGLYFSLLTLACSQIAFEVAFKWTSVTGGENGLQNVLRPLFPSALAFHA
FT                   FTVAVVLGLLWGLWRLAHAPFGRLMQALRDNEQRVVSLGYDTYRTKLIALTIAGGVIGV
FT                   GGGLMALLLQGVYANNLDWQHAGDAVLMAALGGVHHFLGPLWGAIVFIVLEDRLSAITE
FT                   NWWLIFAPLIIVFALLSPEGIQGIFQRLVGRNRWTLTRDGIPERPARIVPYAPGGAVTG
FT                   RDGGTPILVVRGLSKRFGSIVTQNDVSLEVSRTGLHSLIGPNGAGKTTFFNLLTGIIRA
FT                   DAGSIQFEGQEIGRLPPHRRARLGLARSFQILSVFPHLTAFENVRIAVQAAEGHWYGFW
FT                   RDAYDDEVANGRVWSLLDAVGLAGRADELCASLSHGEKRLLEIAVSLATNAKLLLLDEP
FT                   LAGLAESDRKVVSALIRRLAQSHAILLIEHDIDRVLAMSDRITVLHQGRLIADGKPAEV
FT                   ARNPDVVTAYLGRAHGAPPRRVGQMATPPVPRPAAAPLLQLEGVSAGYGGGTVLDGVSL
FT                   TVQAGEVVALLGRNGVGKTTLLRTITGTLPASAGRILLDGREIGALRPDQINRHGIALV
FT                   PEGRRLFPNLTVQENLKLAMRPGGTSQEEICDLFPKLRVLMRARAENLSGGERQMVAIS
FT                   RALMMPSRLILLDEPFEGLAPAVVQEVREAVAKLTARASLMIVEHHAESVLAMADRAYV
FT                   LVNGRVAFGGSAGELAADTALQERLLGVAQVSESVAPRDGLMIEGAA"
FT   sig_peptide     complement(305411..305509)
FT                   /locus_tag="Mnod_8564"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.992 at
FT                   residue 33"
FT   gene            complement(305506..306375)
FT                   /locus_tag="Mnod_8565"
FT   CDS_pept        complement(305506..306375)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8565"
FT                   /product="inner-membrane translocator"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   xau:Xaut_2705 inner-membrane translocator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8565"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62653"
FT                   /db_xref="GOA:B8IW63"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW63"
FT                   /inference="protein motif:PFAM:PF02653"
FT                   /protein_id="ACL62653.1"
FT                   /translation="MLDALVSQTANGLVLGFIYVLIAVGLSITFGLLGVINFAHGAFFA
FT                   LGAYVAWQMYQVFGWPAVVLAPPIVGLVGMAVEVTIIRRLYGKEPLLSLIVTFALALLI
FT                   EALIRFVWGADGKPFNPPPVLVGIVEAGPLLITTYRVAVLVATTATLLGLWVFLAFTPY
FT                   GRILRAGSRDPEMVELLGINLPRVLTAVFGLGCGLAAIAGVLAAPLWTVSPSMAASAVM
FT                   PAFVVVAIGGLGSFRGAVVAGLAVGVVMSLTIQFKAEAAAASMYALMFAVMLLRPRGLF
FT                   GERWERFE"
FT   gene            complement(306437..307672)
FT                   /locus_tag="Mnod_8566"
FT   CDS_pept        complement(306437..307672)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8566"
FT                   /product="Extracellular ligand-binding receptor"
FT                   /note="PFAM: Extracellular ligand-binding receptor; KEGG:
FT                   xau:Xaut_2706 extracellular ligand-binding receptor"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8566"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62654"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW64"
FT                   /inference="protein motif:PFAM:PF01094"
FT                   /protein_id="ACL62654.1"
FT                   /translation="MKKPSMTQRRALAAISAALMLSVSGRAALAQQDAEPVRIGMIYAK
FT                   QGPGASIGEYLQRGSTLAVEQAGRKVLGRPIELVWLDEPNPQVSQQNMQRLIDENKVVA
FT                   VVGGNYSSSALAMMSVANREKIPLILTGAAASEITGKNCNRYTFRTQATVPVQMRGLMP
FT                   FVSQIGKKVYFLTASYAFGQDILRSGRGLLKEVGATEVGVDEVPVNTADYSSYILKIRQ
FT                   ARPDVIVGGLVGGDFSNYLKQANEMGMKDRARFAAIAVTDTDFWDVGPAASTGIYVKPW
FT                   YYNDPTNTAAEKKMVADFEKKYNQPPSDKTWSGWIGMRALLESIEAAKSTDAKAIVTAL
FT                   EKWKNTDGDIPAFFREWDHQLVRPAVIVRVKKQITDKWDFFDVVKKTSDSEAETLKAFG
FT                   TKDEIGCAMPPL"
FT   sig_peptide     complement(307580..307672)
FT                   /locus_tag="Mnod_8566"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.898 at
FT                   residue 31"
FT   gene            complement(307727..309517)
FT                   /locus_tag="Mnod_8567"
FT   CDS_pept        complement(307727..309517)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8567"
FT                   /product="thiamine pyrophosphate protein central region"
FT                   /note="PFAM: thiamine pyrophosphate protein domain protein
FT                   TPP-binding; thiamine pyrophosphate protein central region;
FT                   thiamine pyrophosphate protein TPP binding domain protein;
FT                   KEGG: gtn:GTNG_1949 acetolactate synthase large subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8567"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62655"
FT                   /db_xref="GOA:B8IW65"
FT                   /db_xref="InterPro:IPR000399"
FT                   /db_xref="InterPro:IPR011766"
FT                   /db_xref="InterPro:IPR012000"
FT                   /db_xref="InterPro:IPR012001"
FT                   /db_xref="InterPro:IPR029035"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW65"
FT                   /inference="protein motif:PFAM:PF00205"
FT                   /protein_id="ACL62655.1"
FT                   /translation="MPRMKGGEVIAEYLVKQKVPYVFGICGHGNVGILDAMHAVRDEVT
FT                   LVSPRHEQCAGHMADAYFRIRHQPVATLTSTGPGSANMVMSLATALSDSSAFLAITANV
FT                   PTSQANRAPFQELYAHNQADFAQVLRPVVKRSFQPSRVDMLPLALRQAFDTMVTGRPGP
FT                   VNLDIPYNVFQEEAETEVPPLSHVHGAHRPAASEADVARALELLAAARKPVFFIGQGTT
FT                   LADAGPEISALQQRLGIPVITSPNGMGCVPADDPLTLGFIGRNGAYPANQAGRHADLVL
FT                   CIGTRFDDRSSSTWHPGYSWNFPTTKLIQVDIDPAELGRNYPPTLGIIADAKAFAGQLN
FT                   DALVSRSDLSPETWATWRAEIAGWQAEWDAFVRPNFSAITTPIRPEYVVGTLQAALPDD
FT                   VILSLDSGVHHNWFMQFWRPRRPRSMLNSWGYSSMGFGVCGVLGAQLAAPDRPCVAVVG
FT                   DGGFMMAPYVVATAVEYNLPCVWIVWNNFAWGAIRDLQYGLFEGREHGTAFYKGNQGPG
FT                   GERYNPDFAAWARACGADGVTVTRSQDLAGAVEAAVRNRRPCVIDVHVDAEVRPPSTGT
FT                   WQLPPIPFKEPVFGAPYRPS"
FT   gene            complement(309548..311002)
FT                   /locus_tag="Mnod_8568"
FT   CDS_pept        complement(309548..311002)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8568"
FT                   /product="Aldehyde Dehydrogenase"
FT                   /note="PFAM: Aldehyde Dehydrogenase; KEGG: bxe:Bxe_B2498
FT                   putative aldehyde dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8568"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62656"
FT                   /db_xref="GOA:B8IW66"
FT                   /db_xref="InterPro:IPR015590"
FT                   /db_xref="InterPro:IPR016161"
FT                   /db_xref="InterPro:IPR016162"
FT                   /db_xref="InterPro:IPR016163"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW66"
FT                   /inference="protein motif:PFAM:PF00171"
FT                   /protein_id="ACL62656.1"
FT                   /translation="MADSAPHGSPGQRQATGRLLIAGEWTTGEASAPVLDKYRLQPFAE
FT                   VCLPGREQVRRCIARADAAFRASTLDNHARGAVLDRAAALIEQRSEELVDILRQEAGFP
FT                   RSDAAGEVRRCAATFRLSAEEARDFGGEIVPIEGAGGQTGRIGFTLRVPLGVVCAITPF
FT                   NAPLNTVAHKVGPALAAGNAVVLKPSMHTPLSSCLMAEVLIAAGLPPGLISVLHGGAEV
FT                   AQWLLDEPVVRFYAFTGSTEVGRAIQERVGLRRTQMELGSIAHCILCADANLHVALPKV
FT                   VNASFRKAGQVCTSIQVLLVERSRLDEVETRLAALVTALPYGDPGRPDTVVGPVISEES
FT                   ARRIESWIGQALEGGARRLAGGERVGAVVPPTLLGDVDPGTPIGCREVFGPVLCIAPFD
FT                   TLDEAIARVNATPFGLATGLFTNRLDAALTAARRLEVGGVHINETPSSRVDVMPYGGTK
FT                   DSGFGREGPRYAVREMSEERMITLFP"
FT   gene            311139..312089
FT                   /locus_tag="Mnod_8569"
FT   CDS_pept        311139..312089
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8569"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pna:Pnap_3816 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8569"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62657"
FT                   /db_xref="GOA:B8IW67"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW67"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62657.1"
FT                   /translation="MDFRQLRYFAQIVESGSLSKASRNLYVAQPALSQQLAKLEDEVGK
FT                   PLLHRSTRGVTPTENGLALYHHARFMLRQLDQALSIARQESGQIEGMVSIGLPATTVLA
FT                   IGTPLVRRIRTKYPGIMLNVVEGMSGHLTHMIRLCQLDLAILFNSDVASDLPSTVLLDE
FT                   ELFVILPSNSPLVPHDRTSITIAEAAALPLILPTGTHGLRRRISAEFEERNLTAHVVAE
FT                   IDSLSLVMSCVYDGIGATIKPISSLQLGGKRRKEWRALSISDARLSRRNYLYSINADLL
FT                   SPAASVVANEVRETARHLVTTGQWQGVSLIDNSSD"
FT   gene            312508..313365
FT                   /locus_tag="Mnod_8570"
FT   CDS_pept        312508..313365
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8570"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   swi:Swit_5050 IS4 family transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8570"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62658"
FT                   /db_xref="GOA:B8ICV5"
FT                   /db_xref="InterPro:IPR002559"
FT                   /db_xref="InterPro:IPR025161"
FT                   /db_xref="UniProtKB/TrEMBL:B8ICV5"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62658.1"
FT                   /translation="MSARLEWMNGPSLVWTAANRPRYDRRSQRYPSDMTNDEWLTLEPL
FT                   LPVAEGIGRPRTYPIRDIMNGIRYVQRYGIPWDAMPKDLPPASLCYDYWRLLTDGGHMD
FT                   RINHHLVMRDREKSGKEASPTLAIVDAQAVKCDAPQGERGYDAAKQVLGRKRHLAVDSD
FT                   GRLLAVMITPANVQDQEGGIPLVKRLVRLCPWIKTIVVDGGYKARFIEAVQAGTSRVVE
FT                   VVVRPQFGKGFVLLPKRWRIEQSIGALTVSRRLKLDYDTLLHISAAAMLFASITRLLAS
FT                   ITMK"
FT   gene            313381..313776
FT                   /pseudo
FT                   /locus_tag="Mnod_8571"
FT   gene            314029..314946
FT                   /locus_tag="Mnod_8572"
FT   CDS_pept        314029..314946
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8572"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: mex:Mext_0646 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8572"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62659"
FT                   /db_xref="GOA:B8IW69"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW69"
FT                   /inference="protein motif:PFAM:PF00892"
FT                   /protein_id="ACL62659.1"
FT                   /translation="MALGHIRMHSSLLPILALLGSMIAQLSAGALSKSLFPSVGASGVT
FT                   TLRTAFAAGILLAIWRPWRLPLTVREAWIIGIYGAALGLMNLLFFLSIESIPVGISVSI
FT                   QFLGPLGVALLTSRRITDFVWIFLAVSGLFLLLPVQGTIALDLNGVAYACAGGLCWALY
FT                   ILFGRRAGLINGGQAVSLGMVAATIVVAPFGVASAGAGLFAAPIVIACLGIAVISSVLP
FT                   YSLEMFALRRTTGQVFGILMSLQPAVGALVAFLLLQEVITIIQCLAISLIIMASVGIMF
FT                   TENRVGTSYAAASMKRSSRSSGLS"
FT   sig_peptide     314029..314115
FT                   /locus_tag="Mnod_8572"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.990) with cleavage site probability 0.636 at
FT                   residue 29"
FT   gene            315010..315309
FT                   /locus_tag="Mnod_8573"
FT   CDS_pept        315010..315309
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8573"
FT                   /product="putative transposase"
FT                   /note="KEGG: fre:Franean1_4461 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8573"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62660"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW70"
FT                   /inference="similar to AA sequence:KEGG:Franean1_4461"
FT                   /protein_id="ACL62660.1"
FT                   /translation="MARGPKAVVLNLRENERTELHRLLRGTARVRRSPNACASSSPVPS
FT                   QARPIWAAATALGVSRQTVALWRQRFAVHRLEGLVDAPRSGALSQPTTSASVDV"
FT   gene            complement(315837..316190)
FT                   /locus_tag="Mnod_8574"
FT   CDS_pept        complement(315837..316190)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8574"
FT                   /product="transcriptional coactivator/pterin dehydratase"
FT                   /note="PFAM: transcriptional coactivator/pterin
FT                   dehydratase; KEGG: reh:H16_A0431 pterin-4A-carbinolamine
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8574"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62661"
FT                   /db_xref="GOA:B8IW71"
FT                   /db_xref="InterPro:IPR001533"
FT                   /db_xref="InterPro:IPR036428"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW71"
FT                   /inference="protein motif:PFAM:PF01329"
FT                   /protein_id="ACL62661.1"
FT                   /translation="MSAQAEQLIAKSCTPCRGGIPPLKPDEAETHRHQTPDWALLDDAH
FT                   RIERRFAFDSFADAFKFVQRVAELAETEGHHPDITFGWGYATISLQTHKINGLHENDFI
FT                   LAAKIDQTAMTEH"
FT   gene            complement(316699..317339)
FT                   /pseudo
FT                   /locus_tag="Mnod_8575"
FT   gene            complement(317571..317927)
FT                   /locus_tag="Mnod_8576"
FT   CDS_pept        complement(317571..317927)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8576"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8576"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62662"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW72"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62662.1"
FT                   /translation="MLTDITPTHDRSSASSHALGRAAPALEEHASHGNAPNYVRMPLKR
FT                   ELQSMPFGERVRALMACADHHLEEMDRLEDPDRTDPLTEWDRRQLASHRASLRRVLERA
FT                   AEFGIKLTVTDEWV"
FT   gene            complement(319328..320575)
FT                   /locus_tag="Mnod_8577"
FT   CDS_pept        complement(319328..320575)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8577"
FT                   /product="histidine kinase"
FT                   /note="PFAM: ATP-binding region ATPase domain protein;
FT                   histidine kinase HAMP region domain protein; histidine
FT                   kinase A domain protein; KEGG: met:M446_3565 integral
FT                   membrane sensor signal transduction histidine kinase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8577"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62663"
FT                   /db_xref="GOA:B8IW73"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="InterPro:IPR003661"
FT                   /db_xref="InterPro:IPR004358"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR036097"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW73"
FT                   /inference="protein motif:PFAM:PF02518"
FT                   /protein_id="ACL62663.1"
FT                   /translation="MRQVRRRLFWKVYLTLLASLLGAAFAMAGLWWALGESPHKRWEML
FT                   EARIASEASALSGPSALADPAVQRLSEAFGADVALYDRSGGLLAARGTRAVLLGGESTG
FT                   PPVRWVLRSALPDGRTLLVSIRPSPGTRIARIVSLTLLVAAFVGLAAFPVTARLTQRLE
FT                   RLRSGVARWGEGDLRVRVDESGGDEVAAVARTFNLAAGRVDALLAAQRTLLANASHELR
FT                   SPLARLRMAVDLWSARPEGSARAEIVRNLAELGALVDEILLSSRLEHAHADLDRSESVD
FT                   LLGLAAEEAARVGAEAEGEPVSVFGDAVLLGRLLRNLLENGFTHGVPPVRVHVEPRGEK
FT                   ARIVVSDHGPGIPPEERERVFEPFYRPRGRAEATGGWGLGLALVRQIAERHGGRAACED
FT                   GEAGRSRFVIDLDRKP"
FT   sig_peptide     complement(320489..320575)
FT                   /locus_tag="Mnod_8577"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.957 at
FT                   residue 29"
FT   gene            complement(320572..321267)
FT                   /locus_tag="Mnod_8578"
FT   CDS_pept        complement(320572..321267)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8578"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: met:M446_3564 two component
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8578"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62664"
FT                   /db_xref="GOA:B8IW74"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW74"
FT                   /inference="protein motif:PFAM:PF00072"
FT                   /protein_id="ACL62664.1"
FT                   /translation="MAERLLIIDDDRRLAAMVSEYLSAEGYAVASRFTAREGHDALRRE
FT                   RFDAVILDVMLPDCDGFELCRQIRTHSGVPILMLTAKGDDTDRIIGLEIGADDYLPKPF
FT                   NPRELLARIRALLRRQRAPQEAALLDFGRLQIDPSSRVVRLDGVERRLTSHQFDLLLAF
FT                   ATNAGRVLSRERLMDLVKGEELDALDRSIDVHVSRLRAVIEDDPRHPRRLITIRGAGYV
FT                   FARQQDAER"
FT   gene            complement(321287..321913)
FT                   /locus_tag="Mnod_8579"
FT   CDS_pept        complement(321287..321913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8579"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3563 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8579"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62665"
FT                   /db_xref="GOA:B8IW75"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW75"
FT                   /inference="similar to AA sequence:KEGG:M446_3563"
FT                   /protein_id="ACL62665.1"
FT                   /translation="MSNGAITSEPMDAQAPAPVPRRRYLRRTVLALGILIGGGAGGLAL
FT                   ARGGPFHEGFASWDPGQRLARLQFMAKHALDAVGATSDQENRIHDIIASASTALVKEGA
FT                   PTADMRKRLIDLLKAPTVDPAAIEALRAEMVRSVDARSKIVAGALVDASGQISAEQRTK
FT                   LVDRFTTMMEQHRGFGRWRHHWDEDNEHRDRMPGEAGPGARPERN"
FT   gene            322096..322452
FT                   /locus_tag="Mnod_8580"
FT   CDS_pept        322096..322452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8580"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: azc:AZC_0678 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8580"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62666"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW76"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62666.1"
FT                   /translation="MMDDDRPPRRGRILGTLLALLGIVVLLALAMTCCARPAQAQFCSG
FT                   CGCKGGPGYRGPNGQCVSWRMLDKVCGSPPTTHCKAELVNARPGAKPGERTARPTRPRA
FT                   PRERVARQTVPNPF"
FT   sig_peptide     322096..322218
FT                   /locus_tag="Mnod_8580"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.988) with cleavage site probability 0.845 at
FT                   residue 41"
FT   gene            322554..322694
FT                   /locus_tag="Mnod_8581"
FT   CDS_pept        322554..322694
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8581"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8581"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62667"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW77"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62667.1"
FT                   /translation="MSANVSAVSDGTLVARQASSKPLILRVRWERVTKRKSEMLEDVCP
FT                   S"
FT   gene            323016..324314
FT                   /locus_tag="Mnod_8582"
FT   CDS_pept        323016..324314
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8582"
FT                   /product="putative signal peptide"
FT                   /note="KEGG: mpo:Mpop_3987 putative signal peptide"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8582"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62668"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW78"
FT                   /inference="similar to AA sequence:KEGG:Mpop_3987"
FT                   /protein_id="ACL62668.1"
FT                   /translation="MPLTARAAVIVLSLGSLTPARAQEVEVDAEPNRLNREQPVTVADP
FT                   TPPLPERSDSIGKWTFGGTFRLRYDARFDDARPGGDRRTSSHLSWDTLGLKLAYDSDTV
FT                   FGAAQYRFYGASFLYSRRSGYEGYPGEVNFPMYAYVGYKLSPFDSITFGLNQVPFGLVP
FT                   YFSTTWLETLGFAMGIEEVYNFGVKYSHVEPEYNYQLGFYPGANPNAFGISRDSARYST
FT                   NIVRADSYVPFGSDNAEQNMIVGRAEYFFIKNDFASLAAGVSIWHSDIYNFTTRQTGTK
FT                   QLEAIHVNATRGQWGFKSIFARQDINPKNPIRNDLITIGGYDGSYNMATHGNFIAAEVS
FT                   YKLQDDVGPFNLVPYFSYSRYIKDQKNFRDSQRFVVGGAWTLKADPGLIIYTELVTGKN
FT                   DPYVGAGQYVSGLAQGGDNKWKSSIYINIGYYF"
FT   sig_peptide     323016..323084
FT                   /locus_tag="Mnod_8582"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 23"
FT   gene            complement(324373..325368)
FT                   /locus_tag="Mnod_8583"
FT   CDS_pept        complement(324373..325368)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8583"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: mes:Meso_0590
FT                   transcriptional regulator, AraC family with amidase-like
FT                   domain"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8583"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62669"
FT                   /db_xref="GOA:B8IW79"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW79"
FT                   /inference="protein motif:PFAM:PF00165"
FT                   /protein_id="ACL62669.1"
FT                   /translation="MLYAGDSEVGMAKLSVGFILARRFTLCAFANFVDVLRLSADEGDR
FT                   SRPILCTWRVLSPTMDPIASSCGIVVQPEERLGDPARFDYLVVVGGLVDEIENLHPDTV
FT                   RFLGRAAAAGVPLVGVCTGTFILHRAGLMQGYRACVSWFHHDDFLERFDGLKPVSDQIF
FT                   VVDRDRLTCSGGISSAHLAAFIVERHLGRARAAKSLHIMIIDEAMAAEEPQPGMPLALA
FT                   TDDALVRKALLLMQQSMDAPLSIGRVVTQLGVSRRKLERHFREALGMTPLEADRLIRVE
FT                   QAKHLLKTTGRSSTQIAADTGFCDLPHLIRVFRAVEGTTPDAFRRMSAPP"
FT   gene            325440..326693
FT                   /locus_tag="Mnod_8584"
FT   CDS_pept        325440..326693
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8584"
FT                   /product="sarcosine oxidase, beta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, beta subunit family;
FT                   PFAM: FAD dependent oxidoreductase; KEGG: dsh:Dshi_2117
FT                   sarcosine oxidase beta subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8584"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62670"
FT                   /db_xref="GOA:B8IW80"
FT                   /db_xref="InterPro:IPR006076"
FT                   /db_xref="InterPro:IPR006278"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW80"
FT                   /inference="protein motif:TFAM:TIGR01373"
FT                   /protein_id="ACL62670.1"
FT                   /translation="MTHFSFAQVIRGALTGQKHWTPQWPDAQPKAAYDVVIVGAGGHGL
FT                   GAAYYLAKEHGITNVAVIDKGWLGGGNTGRNTTIIRSNYLYDESARLYDHALDLWETLS
FT                   QDLNYNVMYSKRGVMMLAHNVHDVQSFQRHVHSNRLNGVDNQWLSAKEAKRFCPPLDIS
FT                   PSARYPVMGAALQRRAGTARHDAVAWGYARAAAARGVHIIQNCPVTAIRRGPDGRVIGV
FT                   ETAKGFIGAKKVAVSAAGHTSVVMETAGVRLPLESYPLQALVSEPVKPIFPCVVMSNSV
FT                   HAYISQSDKGELVIGSGTDQYVSYSQRGGLPLIEHTLAAICEIFPIFRRMRMLRKWGGI
FT                   VDVTPDRSPIIGKTPVPGLYVNCGWGTGGFKATPGAAHVLAHTVAKDEPHPINAPFTLE
FT                   RFTTGRLIDEAAAAAVAH"
FT   gene            326705..327007
FT                   /locus_tag="Mnod_8585"
FT   CDS_pept        326705..327007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8585"
FT                   /product="sarcosine oxidase, delta subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, delta subunit family;
FT                   PFAM: Sarcosine oxidase delta subunit heterotetrameric;
FT                   KEGG: oan:Oant_0302 sarcosine oxidase, delta subunit
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8585"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62671"
FT                   /db_xref="GOA:B8IW81"
FT                   /db_xref="InterPro:IPR006279"
FT                   /db_xref="InterPro:IPR038561"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW81"
FT                   /inference="protein motif:TFAM:TIGR01374"
FT                   /protein_id="ACL62671.1"
FT                   /translation="MLLIRCPYCGEDRPELEFAYAGEAHIARPQDPSKLTDEEWRDFLF
FT                   IRSNPRGHHFERWRHVNGCGRFFNAVRETVSDRFLLTYKAGEPRPDLASLTGGTE"
FT   gene            327004..330003
FT                   /locus_tag="Mnod_8586"
FT   CDS_pept        327004..330003
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8586"
FT                   /product="sarcosine oxidase, alpha subunit family"
FT                   /note="TIGRFAM: sarcosine oxidase, alpha subunit family;
FT                   PFAM: glycine cleavage T protein (aminomethyl transferase);
FT                   Glycine cleavage T-protein barrel; KEGG: dsh:Dshi_2115
FT                   sarcosine oxidase alpha subunit family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8586"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62672"
FT                   /db_xref="GOA:B8IW82"
FT                   /db_xref="InterPro:IPR006222"
FT                   /db_xref="InterPro:IPR006277"
FT                   /db_xref="InterPro:IPR013977"
FT                   /db_xref="InterPro:IPR023753"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="InterPro:IPR029043"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR041117"
FT                   /db_xref="InterPro:IPR041854"
FT                   /db_xref="InterPro:IPR042204"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW82"
FT                   /inference="protein motif:TFAM:TIGR01372"
FT                   /protein_id="ACL62672.1"
FT                   /translation="MTSHRLPNRGRVDHRRPIRFSFDGKDYQGLAGDTLASALLANGVH
FT                   LIGRSFKYHRPRGVVSAGSDEPNALLGTHRGPGRFEPNTRATIQELRDGLVATSQNRWP
FT                   SLAFDVGSINDRLGSLFSAGFYYKTFMWPRAFWDRVYEPVIRNAAGLGVSPTEPDADRY
FT                   ASRFAHTDVLIVGAGPAGLAAALAAGRSGASVMLVDETAEPGGSLLSEPAVAIDGKPAW
FT                   DWLAATLAELAALPNVTVMTRTTAIGYYHQNLVGLAQRLTDHLAAPPADAPRERLWKVR
FT                   AGQVVLAQGALEKPLVFDGNDRPGVMLAGAAQTYLNRYGVRVGDRTAIVTAHDSAWYAA
FT                   FDLAEAGAKPVAIVDIRPIVDLALTDKARALGIELLLGHTVTGTEGRLRVKSLRVNPVR
FT                   NGKAGAARRIACDAVLMCGGWTPCLHLFSHTKGSLAWDETLQAFLADKKSEAVHIAGAG
FT                   RGLWGIAAALTDGAAAGARAARDAGRAAEAQAHRVTADRTGSGITLKELPTDRNPAAAK
FT                   AFIDFQNDVTAKDIRLAVREGMRSIEHVKRYTTNGMATDQGKMSNINGLMIAADALGKQ
FT                   PPQVGLTTFRPPYTPTTFGTFAGYHQGATFEVTRKTPIDPWAEANGAVFEPVSLWRRAW
FT                   YFPKADEDMHAAVARECRATRASLGIFDASTLGKIEVVGPDAVTFMERMYTNPWAKLGI
FT                   GRCRYGLLLGEDGFIRDDGVIGRLAADRFHVTTTTGGAARVLTMMEDYLQTEWPDLKVW
FT                   LTSTTEQWATVALNGPNARKLLEPLVKGLDLSDAAFPHMSVAKCTVAGFPARLFRVSFT
FT                   GELGFEVNVPARHGRALWEKLMAAGRQYDICPYGTETMHVLRAEKGYIIVGQDTDGTLT
FT                   PDDAGLSWAIGKAKHDFVGKRSLVRPDMVAKGRKQLVGLLTEDPKTILQEGAQIVADPN
FT                   QPKPMTMLGHVTSSYWSEALGRSIAMAVIADGRARDGEMLHIPMPDRILKARVVKSTVF
FT                   YDPEGTRLSV"
FT   gene            330016..330531
FT                   /locus_tag="Mnod_8587"
FT   CDS_pept        330016..330531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8587"
FT                   /product="Sarcosine oxidase gamma subunit"
FT                   /note="PFAM: Sarcosine oxidase gamma subunit; KEGG:
FT                   dsh:Dshi_2114 sarcosine oxidase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8587"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62673"
FT                   /db_xref="InterPro:IPR007375"
FT                   /db_xref="InterPro:IPR027266"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW83"
FT                   /inference="protein motif:PFAM:PF04268"
FT                   /protein_id="ACL62673.1"
FT                   /translation="MNVMNAQFAPVAIAELPPATRISLRLADPGAAPALALPAKIGART
FT                   ATGNRSALCLGPDEWLIEAPGAEAGALTATLADLATRIAMSAVEVSDREVTYRLEGPAV
FT                   LDLLATGCPLDLARMPTGSGTRTVFDTVQIVLTREAGDRFHLTVWRSFAPHVRALLDLA
FT                   ARELAVGL"
FT   gene            330550..331812
FT                   /locus_tag="Mnod_8588"
FT   CDS_pept        330550..331812
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8588"
FT                   /product="glycine hydroxymethyltransferase"
FT                   /EC_number="2.1.2.1"
FT                   /note="PFAM: glycine hydroxymethyltransferase; aromatic
FT                   amino acid beta-eliminating lyase/threonine aldolase;
FT                   aminotransferase class I and II; KEGG: dsh:Dshi_2113
FT                   glycine hydroxymethyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8588"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62674"
FT                   /db_xref="GOA:B8IW84"
FT                   /db_xref="InterPro:IPR001085"
FT                   /db_xref="InterPro:IPR015421"
FT                   /db_xref="InterPro:IPR015422"
FT                   /db_xref="InterPro:IPR015424"
FT                   /db_xref="InterPro:IPR019798"
FT                   /db_xref="InterPro:IPR039429"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW84"
FT                   /inference="protein motif:PFAM:PF00464"
FT                   /protein_id="ACL62674.1"
FT                   /translation="MLDTARLSDNAVAAAIGRELGRQQNQIELIASENIVSRDVLIAQG
FT                   SVLTNKYAEGYPGKRYYGGCEYVDEVETLAIDRVKRLFGAAYANVQPHSGAQANQAVFL
FT                   ALLQPGDRIMGLSLAHGGHLTHGSSVTMSGKWFDVVDYQVRESDQLIDMEAVRARALET
FT                   RPKLIVAGASAYPREIDFAGFRAIADEVGAYLMVDMAHYAGLIAAGLYPNPVPHAHITT
FT                   STTHKTLRGPRGGIILTNDEALAKKLNSAVFPGNQGGPLMHVIAAKAVAFGEALQPSFR
FT                   DYAARVIANARALAATLKAGGLDIVSGGTDCHMVLVDLRPKGVKGRDAERALERAGLTC
FT                   NKNAIPFDPEKPFVTSGIRLGTSAGTTRGLSEAEFIRVGQLVLKVVEALAVSGPEGDAA
FT                   VEAEVLAEVRRVCAAHPIYAG"
FT   gene            331929..333305
FT                   /locus_tag="Mnod_8589"
FT   CDS_pept        331929..333305
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8589"
FT                   /product="L-serine dehydratase 1"
FT                   /EC_number="4.3.1.17"
FT                   /note="TIGRFAM: L-serine dehydratase 1; PFAM: serine
FT                   dehydratase alpha chain; serine dehydratase beta chain;
FT                   KEGG: jan:Jann_0316 L-serine ammonia-lyase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8589"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62675"
FT                   /db_xref="GOA:B8IW85"
FT                   /db_xref="InterPro:IPR004644"
FT                   /db_xref="InterPro:IPR005130"
FT                   /db_xref="InterPro:IPR005131"
FT                   /db_xref="InterPro:IPR029009"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW85"
FT                   /inference="protein motif:TFAM:TIGR00720"
FT                   /protein_id="ACL62675.1"
FT                   /translation="MFLSVFDIFKIGVGPSSSHTMGPMLAAARFLDALREGRDSVPGSG
FT                   APARLEASLHGSLAFTGKGHATDRAVILGLLGFRPETLDPDDAERREAALRATGHIDVP
FT                   GLGLIAFDPDKGVVFDYGPPLPGHANGMVLRAFDAVGNLHLAETYYSIGGGFVLTEREL
FT                   EHRDAAPDPTPRPYPFATAAEMLAMGETSGLPIAAMKRANEGPGLDAGLDRIWSVMDAC
FT                   IDRGLATEGTLPGGLNVRRRARAIHQALLAERGTNAAQPHTVNDWLSVYAMAVNEENAA
FT                   GGRVVTAPTNGAAGVVPAVIRYYRDHVVGASHEGVRDFLLTAAAIGGIIKTNASISGAE
FT                   VGCQGEIGSAAAMAAAGLCAALGGTNAQIENAAEIALEHHLGMTCDPARGLVQVPCIER
FT                   NGLGAIKAVAAASLALRSNGIHIVPLDACIETMRQTGLDMSVKYKETSTGGLAVNLPEC
FT                   "
FT   gene            333338..333514
FT                   /pseudo
FT                   /locus_tag="Mnod_8590"
FT   gene            complement(333825..334392)
FT                   /pseudo
FT                   /locus_tag="Mnod_8591"
FT   gene            complement(334389..334772)
FT                   /locus_tag="Mnod_8592"
FT   CDS_pept        complement(334389..334772)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8592"
FT                   /product="ISSpo6, transposase orf A"
FT                   /note="KEGG: nha:Nham_4172 ISSpo6, transposase orf A"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8592"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62676"
FT                   /db_xref="GOA:B8IW86"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW86"
FT                   /inference="similar to AA sequence:KEGG:Nham_4172"
FT                   /protein_id="ACL62676.1"
FT                   /translation="MPAALSADLRARVVAALEEGLSCSQVAARFGVSAASASRWRAKAQ
FT                   RTGSPAPHPMGGDRRSARLDEHAPFLLDQVAQKPDLTLADLQAKLRERGVTAALGTIWR
FT                   LLSRHKLTYKKRRRLLRSSSART"
FT   gene            334884..335318
FT                   /locus_tag="Mnod_8593"
FT   CDS_pept        334884..335318
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8593"
FT                   /product="Domain of unknown function DUF1801"
FT                   /note="PFAM: Domain of unknown function DUF1801; KEGG:
FT                   mes:Meso_0627 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8593"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62677"
FT                   /db_xref="InterPro:IPR014922"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW87"
FT                   /inference="protein motif:PFAM:PF08818"
FT                   /protein_id="ACL62677.1"
FT                   /translation="MADKKTEVADATAAKDAKTASQLIDVKITELADWRGEMLARIRNL
FT                   IREADLDVIEEVKWRKPSNPAGVPVWSHAGIICTGEIYKDKVKLTFAKGALLDDPSGLF
FT                   NSSLESNIRRAIDIEKGVQIDETALKALIRAAVALNTNSR"
FT   gene            complement(335535..335921)
FT                   /locus_tag="Mnod_8594"
FT   CDS_pept        complement(335535..335921)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8594"
FT                   /product="Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase"
FT                   /note="PFAM: Glyoxalase/bleomycin resistance
FT                   protein/dioxygenase; KEGG: dar:Daro_3438
FT                   glyoxalase/bleomycin resistance protein/dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8594"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62678"
FT                   /db_xref="GOA:B8IW88"
FT                   /db_xref="InterPro:IPR004360"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="InterPro:IPR037523"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW88"
FT                   /inference="protein motif:PFAM:PF00903"
FT                   /protein_id="ACL62678.1"
FT                   /translation="MDPVVHFEMPYEDRDRMVQFYESAFGWKAQKLGPEMGNYVIVTTA
FT                   NADVKPDAPRGSINGGFWEKRADWPAQVPAIVIGVGDIRGTMEKILRAGGKILGDPMQI
FT                   PGVGEYVSFLDTEGNRASLLQPSM"
FT   gene            complement(335979..336146)
FT                   /pseudo
FT                   /locus_tag="Mnod_8595"
FT   gene            336294..336632
FT                   /locus_tag="Mnod_8596"
FT   CDS_pept        336294..336632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8596"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6738 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8596"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62679"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW89"
FT                   /inference="similar to AA sequence:KEGG:M446_6738"
FT                   /protein_id="ACL62679.1"
FT                   /translation="MRLTTLSLTVVAALTGPALAQPGATVGLPIGAGLAPKPAPAQKPV
FT                   TAAPGGAIFPTAISPKYAHESAGKARQKTCLDQDNANKAAGGAGNGGLNWIQKGGGYYS
FT                   ECNKRLKG"
FT   sig_peptide     336294..336356
FT                   /locus_tag="Mnod_8596"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 21"
FT   gene            complement(336663..336907)
FT                   /pseudo
FT                   /locus_tag="Mnod_8597"
FT   gene            336909..337484
FT                   /pseudo
FT                   /locus_tag="Mnod_8598"
FT   gene            337489..337673
FT                   /pseudo
FT                   /locus_tag="Mnod_8599"
FT   gene            complement(338039..338158)
FT                   /locus_tag="Mnod_8600"
FT   CDS_pept        complement(338039..338158)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8600"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8600"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62680"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW90"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62680.1"
FT                   /translation="MILTALALTLKRQARGDFKARHSHVSHAALRVRARQRNL"
FT   gene            complement(338565..339143)
FT                   /locus_tag="Mnod_8601"
FT   CDS_pept        complement(338565..339143)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8601"
FT                   /product="putative cytochrome P460"
FT                   /note="KEGG: met:M446_1367 putative cytochrome P460"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8601"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62681"
FT                   /db_xref="InterPro:IPR032033"
FT                   /db_xref="InterPro:IPR038142"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW91"
FT                   /inference="similar to AA sequence:KEGG:M446_1367"
FT                   /protein_id="ACL62681.1"
FT                   /translation="MTNRPSSPSRGLRAVSAAAFGLVLAVLGGIALAQQDKYTLKVPGG
FT                   LAFSEFKGYGGWPVVSTSQNDKLVAVILANPEMIEAYRAGIPDNGKPFPDGAKMAKIHW
FT                   TPKKNQYFPDTTVPGTQHDVDFMVKDSKRFADSGGWGWAAFKYDAASDTFAPSTEADQP
FT                   PQANDAKCGFACHTIVETRDYVFTEYGKR"
FT   sig_peptide     complement(339042..339143)
FT                   /locus_tag="Mnod_8601"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.992 at
FT                   residue 34"
FT   gene            339651..340370
FT                   /locus_tag="Mnod_8602"
FT   CDS_pept        339651..340370
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8602"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mpo:Mpop_2092 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8602"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62682"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW92"
FT                   /inference="similar to AA sequence:KEGG:Mpop_2092"
FT                   /protein_id="ACL62682.1"
FT                   /translation="MLHQRTSSHAPEAPPLGIGYYTVPEAARLLRMPARNINRWLGGYS
FT                   FKSGGKPGQMPPLWTPELPVTEDDRLELGFRDLIELRFVNAFVKEGLDLRVIRSCLDYA
FT                   RKCVQDDRPFSTPRFRTDGRTIFLESLKASEASEFLDLKQGQYVIKAVMERTFRDLDID
FT                   DDVVARWRPFHGKDSIVIDPQRAFGQPIAADYGVSTIALAEAVKAEGSVDRVARLYEVA
FT                   PSVVRGAVKFEESLLAA"
FT   gene            340367..340759
FT                   /locus_tag="Mnod_8603"
FT   CDS_pept        340367..340759
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8603"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: pst:PSPTO_0931 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8603"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62683"
FT                   /db_xref="InterPro:IPR041375"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW93"
FT                   /inference="similar to AA sequence:KEGG:PSPTO_0931"
FT                   /protein_id="ACL62683.1"
FT                   /translation="MKVLIDENLPKALACGLNGLFAGEHEIVHIRDLYGPAVKDIDWIP
FT                   DLSKQGRWVVISGGRAIKKKKAEYHVFRSSRSVGFFLAPGLLKAPLIKQAERILANWEG
FT                   IETFAAGSAPGAMYEIHMSSMKIAPL"
FT   gene            341011..341226
FT                   /locus_tag="Mnod_8604"
FT   CDS_pept        341011..341226
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8604"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1583 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8604"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62684"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW94"
FT                   /inference="similar to AA sequence:KEGG:M446_1583"
FT                   /protein_id="ACL62684.1"
FT                   /translation="MTDTSTVGTLIARNIVPLEQLDAAVSAYMADPALGPRETANGVSR
FT                   GLQDEAQRLLVWTAILLTLAALGEAE"
FT   gene            341575..342101
FT                   /pseudo
FT                   /locus_tag="Mnod_8605"
FT   gene            342062..342598
FT                   /locus_tag="Mnod_8606"
FT   CDS_pept        342062..342598
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8606"
FT                   /product="putative transposase"
FT                   /note="KEGG: met:M446_6883 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8606"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62685"
FT                   /db_xref="InterPro:IPR038717"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW95"
FT                   /inference="similar to AA sequence:KEGG:M446_6883"
FT                   /protein_id="ACL62685.1"
FT                   /translation="MAQIAQATGGKPIEVWFADEARVVQTNTITRRGARRGTRPAAPKD
FT                   QRTASASLFGAICPARGTGAGLVMPRCTTEAMNRHLAEIATAVAPGAHAVLVLDQAGWH
FT                   TTRKLAVPGNITLRPLPARSPELNPVETLWQFMRENWLGNRIYVSYETILDHCCHAWNN
FT                   LIDQPWRIISIGLRA"
FT   gene            complement(343464..343703)
FT                   /locus_tag="Mnod_8607"
FT   CDS_pept        complement(343464..343703)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8607"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3752 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8607"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62686"
FT                   /db_xref="GOA:B8IW96"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW96"
FT                   /inference="similar to AA sequence:KEGG:M446_3752"
FT                   /protein_id="ACL62686.1"
FT                   /translation="MKVELDKISRTVAILCSFFGGGVALLCCGAFLFLVAAVKFLVWLI
FT                   GSEVLGVVIVAMPFIIIAAGLGYWGASKMLSIGH"
FT   sig_peptide     complement(343593..343703)
FT                   /locus_tag="Mnod_8607"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.901) with cleavage site probability 0.619 at
FT                   residue 37"
FT   gene            complement(344406..345428)
FT                   /locus_tag="Mnod_8608"
FT   CDS_pept        complement(344406..345428)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8608"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS116/IS110/IS902 family protein;
FT                   KEGG: mlo:mlr6069 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8608"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62687"
FT                   /db_xref="GOA:B8I9N1"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9N1"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL62687.1"
FT                   /translation="MGEYIGLDVSLKETALSVRRDGKRVWRGRCASDPAVIARVLRKHA
FT                   PEAQRIVFETGPLSVWFYHALRAEGLPAICIDARHAKAALDMAANKTDANDADGLAHLA
FT                   EVGFFREVRVKGYDSLLVRTLVAARSKLVQVTTELSNQIRGLMKTFGLIVPGAKGGSFE
FT                   AEVRRLLSGDHGLARVILPLLEAWNAVRRRAAELGRQLLAGARQSQACQRLMAIPGIGA
FT                   ITATAFVTAIEDPANFRSSRSVAAWFGLTTRRYQSGEVDYDGHISRRGDAHMRGLLYEA
FT                   ATVLLTRSQVDSDLRAWGLKLRERLGFKRAAVAVARKLAVVMHAMLKSGHSYRAKAAMA
FT                   "
FT   gene            complement(345636..347075)
FT                   /locus_tag="Mnod_8609"
FT   CDS_pept        complement(345636..347075)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8609"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mpo:Mpop_3824 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8609"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62688"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW98"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62688.1"
FT                   /translation="MTRFIAGEDRQQVTLLPDCLDDYVAADNPVRLAEAFVDELDLAAL
FT                   GCAGAVPEATGRPAYDPATLLKLYLYGYLNRIPSSRRLERESPRNLELIWLTGRLMPDF
FT                   KTLADFRKNNGPAIQATCAQFVVLCRRLNLFSKAIVAVDGSKFKAVNNRDKNFTVAKLE
FT                   ARVAQVEASVARYLAALDRADREPSDVAEARTARLTEKIAALREQMQDLQAMRQRVEEA
FT                   PDQQVALTDPDARSLATRGKGTGLVGYNVQAAVDVEHHLIVAHAVTNVGSDRAQLAPMG
FT                   VLAQEATGCEPITVLADRGYLNGDQVLVCEGTGVLPCVPKTLTSGNVKRGLFTGQDFIY
FT                   DAQKDHYTCPAGQHLTKAPARSDRRDEIDHYRNRTACPACALKPRCTTEAARRIKRWVH
FT                   EGVLDAMQARLDGMPDAMKVRRQTVEHPFGTLKAWMGATHFLTRTLAKVRTEMSLQVLA
FT                   YNMKRMIQIFGVGALITAIRA"
FT   gene            347457..347720
FT                   /locus_tag="Mnod_8610"
FT   CDS_pept        347457..347720
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8610"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8610"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62689"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW99"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62689.1"
FT                   /translation="MDEKPRISVEAIEFAPIGQDQLSADITVQFGGPQQGFTMHGVVIS
FT                   DSGEESLNWKLAVVEAKRLARFFGTETTLTELDDEREAPEFA"
FT   gene            complement(348063..348275)
FT                   /locus_tag="Mnod_8611"
FT   CDS_pept        complement(348063..348275)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8611"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3921 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8611"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62690"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA0"
FT                   /inference="similar to AA sequence:KEGG:M446_3921"
FT                   /protein_id="ACL62690.1"
FT                   /translation="MSASDMGGMSAHGRHHFTLEVRPSRDVAGHYTWAIRDHGKLYRRS
FT                   DWPYPSEAEARAVAEAEIARLVAQR"
FT   gene            348526..349379
FT                   /pseudo
FT                   /locus_tag="Mnod_8612"
FT   gene            complement(349392..350069)
FT                   /locus_tag="Mnod_8613"
FT   CDS_pept        complement(349392..350069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8613"
FT                   /product="RES domain protein"
FT                   /note="PFAM: RES domain protein; KEGG: mes:Meso_4398
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8613"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62691"
FT                   /db_xref="InterPro:IPR014914"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA1"
FT                   /inference="protein motif:PFAM:PF08808"
FT                   /protein_id="ACL62691.1"
FT                   /translation="MAGTYPPANFADARLRLHTVAPGERYGRIYMAKYPDPIGYGKAKS
FT                   RFSDPRRRKEQSRFGVLYLGETLTVCFLEAALRDRRDGKVGVLGVEETELEDRRYAEIE
FT                   AATSLRLVDLRENAAVAMGVPTDVLRGTRHTLGRVWSLAFHEHPATPDGIIYPSRLNGQ
FT                   INLAIYGRAVSKLKAVRVRRLIDVAELAPLLGEFQVALLPPLDFEILLSDLHDALHSTI
FT                   RRG"
FT   gene            complement(350071..350835)
FT                   /locus_tag="Mnod_8614"
FT   CDS_pept        complement(350071..350835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8614"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mes:Meso_4397 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8614"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62692"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA2"
FT                   /inference="similar to AA sequence:KEGG:Meso_4397"
FT                   /protein_id="ACL62692.1"
FT                   /translation="MTNAKARSTGRSAGAGEGRRAGRATLMTTFSVDAGVVPKGAAGFT
FT                   FKAPNKAAQVLAGNPFKIKPLLQSYSEAFAKSQKAGRPVSFRVEVDPTGGATVTPVEER
FT                   APDAEAISVEEVHERSPELERALATARERGRIRAAEVLAGDDMLSAEAFAELLGTTRVT
FT                   VNAKRQSGQLLGLDGAKRGFRFPVWQLDPNGKPYPELAALRERLGAPWAVYRFLIQRHG
FT                   SLDGLTGREALEHGKGAEVVAAAEGVARGDFT"
FT   gene            351033..351734
FT                   /locus_tag="Mnod_8615"
FT   CDS_pept        351033..351734
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8615"
FT                   /product="putative transposase"
FT                   /note="KEGG: oan:Oant_4519 putative transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8615"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62693"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA3"
FT                   /inference="similar to AA sequence:KEGG:Oant_4519"
FT                   /protein_id="ACL62693.1"
FT                   /translation="MTPPSYAGYCFPPSVIQRAVWMYLRFALSYRDVEELLAERGIIVA
FT                   SESIRRGVLTFGPVIARRLRASRPTPHGRWHLDEMLVQIAGRQMDLWRAVDAEGEGLDR
FT                   LVQSRRDRRSAQTLMRQRLKKPGIAPDAWVTGKRPAYGAALREMTLSRVDHAQRQRANN
FT                   RAESSQVPVRRRQRKLQGFKLPRSAQQFLSLHAATDNVFTVPCHLVSARTHRLFRAEAF
FT                   QTWRSAAGVAA"
FT   gene            352426..352665
FT                   /pseudo
FT                   /locus_tag="Mnod_8616"
FT   gene            complement(352652..354289)
FT                   /locus_tag="Mnod_8617"
FT   CDS_pept        complement(352652..354289)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8617"
FT                   /product="transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein"
FT                   /note="PFAM: transposase IS204/IS1001/IS1096/IS1165 family
FT                   protein; KEGG: mlo:mll5961 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8617"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62694"
FT                   /db_xref="InterPro:IPR002560"
FT                   /db_xref="InterPro:IPR017894"
FT                   /db_xref="InterPro:IPR029261"
FT                   /db_xref="UniProtKB/TrEMBL:B8IVI6"
FT                   /inference="protein motif:PFAM:PF01610"
FT                   /protein_id="ACL62694.1"
FT                   /translation="MILSSSLPGCTIERVFRHTDHLVVIAHGRRCHGRCPTCGTPSSAV
FT                   HSRYDRRPADLPSMGQPVTLRLRIRRFYCHHPACRRRTFAEPLPRLIPPRARRTRRLAQ
FT                   AQTRIGLAVGGEAGARLTGHLGMQTSPDTILRLVHRLPLPRANAPRAVGIDDWAIRKGR
FT                   SYGTLLVDLERRCPIDLLPDRSGATVAAWLRRHPSIQIVARDRSTEYARAATAGAPAAL
FT                   QVADRWHLLLNLRQVLERWLGRVHGRLRQLPPLASGDGRQPGERPRAYRRSAAEIAVSL
FT                   DSRARRLAAYEDVRRRHLAGETLLAIGRATGLARATVRKYAQAESFPERAIRRPNPSRL
FT                   DPYLAHLEQRMAEGCENAMALWREIRRQGFAGTHRQVHRFVAERRTARKWLSQPASTST
FT                   EAIRPSPIASPKQLAWILVQPLATLQPRAAADLARIRQDPEAARIADLARRFTMLVRAC
FT                   GLGGDRPADPASELDRWLLETRNCGVAALETFAAGLAQDGAAVRAALTTSWSNAQAEGQ
FT                   ISRLKMLKRTMYGRASFALLRSRILIAA"
FT   gene            complement(354432..354545)
FT                   /pseudo
FT                   /locus_tag="Mnod_8618"
FT   gene            complement(354561..355065)
FT                   /pseudo
FT                   /locus_tag="Mnod_8619"
FT   gene            complement(355068..355613)
FT                   /locus_tag="Mnod_8620"
FT   CDS_pept        complement(355068..355613)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8620"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6884 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8620"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62695"
FT                   /db_xref="GOA:B8IWA5"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR025959"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA5"
FT                   /inference="similar to AA sequence:KEGG:M446_6884"
FT                   /protein_id="ACL62695.1"
FT                   /translation="MAAPVPLRSDFDAETLRTLAKGSRDPAQTRRLLALSAIDAGSSRS
FT                   EAAALGGVGLQTVRDWVLAFNADGPDGLIDAKAPGARPRLNADQRAALRALVEQGPMPA
FT                   IHGVVRWRLVDLAQILCEDHGVSVSQQTLSRVLRGMGYRKLSARPRQHAQDPQAAAAFK
FT                   KPSPPAGRRSRRPQAASR"
FT   gene            complement(355649..355951)
FT                   /locus_tag="Mnod_8621"
FT   CDS_pept        complement(355649..355951)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8621"
FT                   /product="ISGsu7, transposase OrfA"
FT                   /note="KEGG: met:M446_5626 ISGsu7, transposase OrfA"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8621"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62696"
FT                   /db_xref="GOA:B8IWA6"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA6"
FT                   /inference="similar to AA sequence:KEGG:M446_5626"
FT                   /protein_id="ACL62696.1"
FT                   /translation="MSTDMRVDAGTVGPGRGGRMSRQRKRDAVLRLLRGEDLESVSRSL
FT                   GVTAATLSGWRDAFLAAGEASLSTRPTDGEALESGRLIPALGERDSGGVAARAAS"
FT   gene            complement(356227..357129)
FT                   /locus_tag="Mnod_8622"
FT   CDS_pept        complement(356227..357129)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8622"
FT                   /product="Phosphogluconate dehydrogenase, NAD-binding,
FT                   putative-like protein"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   Phosphogluconate dehydrogenase, NAD-binding, putative-like;
FT                   KEGG: met:M446_5621 phosphogluconate dehydrogenase,
FT                   NAD-binding, putative-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8622"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62697"
FT                   /db_xref="GOA:B8IWA7"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015814"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA7"
FT                   /inference="protein motif:PFAM:PF09130"
FT                   /protein_id="ACL62697.1"
FT                   /translation="MSAQKQQFRLGLVGYGEIGSTLGRGLRGAGLEHVTAYDKYAFDGP
FT                   YAGLIQSRAQDAGVTLVRSNQELADAADLIVSVTPGSASLDSAAAFVGCLSERHIFMDF
FT                   ASATPKIKLGVAERLAGGGALVGDGSIEGTPKNGYAMPILVSGPSGERVRDLLNPWGMQ
FT                   ISYVGDTLGTASGIKILRSVLIKGIEALTDEMLLAARHYGIDEIVLASACKTLARPWMD
FT                   TVESLTPSGVIHAKRRAEELEMSAEAVADAGIEPVMARAVAARLRWKESLGLKERLNGV
FT                   EPGNYKEAINQIVGAMTAS"
FT   gene            complement(357190..360393)
FT                   /locus_tag="Mnod_8623"
FT   CDS_pept        complement(357190..360393)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8623"
FT                   /product="FAD linked oxidase domain protein"
FT                   /note="PFAM: FAD linked oxidase domain protein; KEGG:
FT                   mrd:Mrad2831_4140 FAD linked oxidase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8623"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62698"
FT                   /db_xref="GOA:B8IWA8"
FT                   /db_xref="InterPro:IPR004113"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR016164"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="InterPro:IPR036318"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA8"
FT                   /inference="protein motif:PFAM:PF02913"
FT                   /protein_id="ACL62698.1"
FT                   /translation="MADAEASAMIPALTSLPIPTSLYAAFLAELRVRGFVGELSDGIAD
FT                   RTVLATDNSIYQIRPEAVAFPRDRDDLVRIGALLGDPRFAEVRVSPRGGGTGTNGQSLT
FT                   GGLVVDVSRHMNRILEIDVENRVVRVEPGVVKDQLNRELARHGLFFAPELSTSNRATIG
FT                   GMISTDACGQGSCLYGKTRDHVRELTTVLTDGSVWTSRPLGDEDLAAVCARPDRVGEIH
FT                   RVVNEIVTRDAALIEERFPKLNRCLTGYDLAHVRDRQGRFDLNAVLCGSEGTLGLIVEA
FT                   TLSVLPIPQHAALISLRYDSFDAALRDARALVELGPASIETIDSRVLALARGDIVWHEV
FT                   SAFFPDDPEGPAEGVNLVEVLAETAGDLEAQLTRVTQRLEHEGRTRGRRGFTVARETAG
FT                   APNDEAVRTIGAGVQGSMRLAEDGDEAEGDGVRVAPPEAVDAVTRIWSMRKKAVGLLGN
FT                   MKGDARPIAFVEDTAVPPENLADYIAEFRAALDRRGLVYGMFGHVDAGVLHVRPAIDTK
FT                   DPAQDRLIREITEEVVALTGKYGGVLWGEHGKGVRSEFSPQVFGPLYPALQRIKAAFDP
FT                   RDQLNPGKIAAPEGGRLLTVDGVPTKGGFDRTIPASVRVNFDEALHCNGNGACFNYDPD
FT                   DAMCPSWKGTRERRHSPKGRAQLMREWLRLLVGQGIDPMAESRRLRGRSGWRAFPARLW
FT                   ASLSRDRDFSHAVKEAMDGCLACKSCVGQCPIKVDVPTFRAKFLELYHGRYLRRPRDHV
FT                   VGLIEILLPLAARAPRLANVLSTSKPGVWLMRVVGLTATPRLSGIDLVREAERRGVTVA
FT                   SAGALRVLSPTERARSVLIVQDAFTSHYETSLVLDLVDLLIELGFKPWLAPYLPNGKPL
FT                   HVHGFLGAFERRARRNAAALRALAETGVDLVGIDPSMTLTYRSEYVGALGPEQVPRVHL
FT                   VQEWLATRLGERSSSGAQAEYLLLPHCTERTTAAAGLRDWQTVFARLGHRLTILPAGCC
FT                   GMAGTYRHESEHRATSERIYDLSWAGHVDRAGRSDRLLADGYSCRSQVKLVDSIQLSHP
FT                   IEALLAALRSGGQTARLAA"
FT   gene            complement(360479..361864)
FT                   /locus_tag="Mnod_8624"
FT   CDS_pept        complement(360479..361864)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8624"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   rpc:RPC_3077 major facilitator superfamily MFS_1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8624"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62699"
FT                   /db_xref="GOA:B8IWA9"
FT                   /db_xref="InterPro:IPR000849"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWA9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62699.1"
FT                   /translation="MYNATANADPILSPKAATRFRWVVMNLIFVVYTLAAADRANIGIV
FT                   LPFVKKEFAMSNTEAGAVVSLFFIGYSVMQIPAGFLVRKLGTRTVFPIFMLLTSLFTGL
FT                   LGTAGSALAMKLNRLALGFAEAPLPVSMLSTMNRWFPAREKGTAVGLFLAAAKFGPVIV
FT                   PPLGALIIATLGWQYVFFVCAMPGLIFAVLWYFLVVDDPARSRFVSAAEVAHIRDEAPI
FT                   QSAAAANSMPVTIAAEPSKGRFSRLDRVIRGRRVRLIATAKETFRSGNIWGLALGYLMM
FT                   TGIINVILAWLPTYLTNVKHFSLMNVGFVASAPFVGGVLGNIIGGWFSDRIVGKRRKPT
FT                   ILISAISTVFMMVALIQAPNEPVTLATLLFLTGFLLNVGYSSFTVYPAGLTTKDAYPLA
FT                   VSVVNTGGQAGGALFPFLTGLLLDAYSWDAVFLFLGASSLVALAVMLLVVEPIETEPGA
FT                   AIQ"
FT   gene            complement(361972..362682)
FT                   /locus_tag="Mnod_8625"
FT   CDS_pept        complement(361972..362682)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8625"
FT                   /product="Dimethylmenaquinone methyltransferase"
FT                   /note="PFAM: Dimethylmenaquinone methyltransferase; KEGG:
FT                   bpt:Bpet4448 putative dimethylmenaquinone methyltransferase
FT                   family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8625"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62700"
FT                   /db_xref="GOA:B8IWB0"
FT                   /db_xref="InterPro:IPR005493"
FT                   /db_xref="InterPro:IPR036704"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB0"
FT                   /inference="protein motif:PFAM:PF03737"
FT                   /protein_id="ACL62700.1"
FT                   /translation="MAVQIVTAGPVPSTLPAAEEQELRALVTPLISDNLDRLAGIVGLN
FT                   RYNGKGKIVGTAITIKTRPGDNLGMYQAMTMMQPGHVLVVDGGGDLNNALCGDLMRAYA
FT                   VARGCAGFVIDGAIRDVTTFAAGDFPCYARGVVHRGPYKSGPAHINVPVCIGGQVVNPG
FT                   DVVVGDEDGLVVFAPEQVRYVVEKANAKLRQEQAIMAEIEAGAPRQEWLHGMIESFGIK
FT                   PHVTELSAPQQHRS"
FT   gene            complement(362752..363594)
FT                   /locus_tag="Mnod_8626"
FT   CDS_pept        complement(362752..363594)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8626"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bch:Bcen2424_5389
FT                   amidohydrolase 2"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8626"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62701"
FT                   /db_xref="GOA:B8IWB1"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB1"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACL62701.1"
FT                   /translation="MREILSTAEQVMTFADFHGAADCHFHIMDEAFPTVPNPAVRNRTA
FT                   DVAQYRAFAAEVGTTRGVVVQPSLYGTNNSHTLEALRALGAGYRAVVVIDESVPMATLR
FT                   AWDRVGVRGVRFNQVQAGATTMAMMPAVAQRIADLGWHIQLHIKASALAEHEAMLRALP
FT                   VPLVLDHVGRVEHADMARPGFDTILRLLAGGRTWVKLSAPYQDSRRGPPGYEDAVEVGR
FT                   RLASENEDRLVWGSDWPHVTEPEKPEAGPLSTFLAASLKDEGRIRKALIQNPALLYGF"
FT   gene            complement(363627..365558)
FT                   /locus_tag="Mnod_8627"
FT   CDS_pept        complement(363627..365558)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8627"
FT                   /product="TRAP dicarboxylate transporter, DctM subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctM
FT                   subunit; PFAM: Tripartite ATP-independent periplasmic
FT                   transporter DctQ component; TRAP C4-dicarboxylate transport
FT                   system permease DctM subunit; KEGG: art:Arth_3603 TRAP
FT                   dicarboxylate transporter, DctM subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8627"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62702"
FT                   /db_xref="GOA:B8IWB2"
FT                   /db_xref="InterPro:IPR004681"
FT                   /db_xref="InterPro:IPR007387"
FT                   /db_xref="InterPro:IPR010656"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB2"
FT                   /inference="protein motif:TFAM:TIGR00786"
FT                   /protein_id="ACL62702.1"
FT                   /translation="MVNILANGAPEAVHLGSAPAPEALPERGALARAYQRVMEMIGWLA
FT                   RAVLFVVLVGELCLILVEVSQRIFFGHSFLWAEEISRLALLTIAFIGGALAYRSHQHTT
FT                   VALVTDALSAPLRRMVMAMIDVTILMIAAVAFLAATDLLQINAQSIMPMLQWNLGLTVV
FT                   PFIAGMLLIGLFAIERLLIVHRLVPVVQAAIAAGIIGGIVYTMSLIPEIRLETGSALVA
FT                   MLVVFFAIILLGLPVAFAMLLGSILFLLATDLAPTVAVAQNTIDGSGHFILLTLPFFIW
FT                   AGMIMEKGGISRRLVGLAMALVGHFRGGLLQVVIMTTYLVSGVSGSKIADVVAVGSVMR
FT                   DELERKGYHPKDGAAVLSASAAMSETIPPSIAMLVLGSVVPVSIGAMFIAGLLPAAVLA
FT                   LILMALVYVMAVRNPTIHVEKASRAVVVEATLGAILPLLMPAILVVGIKFGLATPTEVS
FT                   SVAVLYGILLCALVYRSIGWGSFIKIAVECAITSGMVLFIIAAAGSFAWIMAAGNLPQH
FT                   LVTLLHAAGDNRYLFLAGSILILIVVGSLLEGLPALIILGPILYPMATQLGIDGVHYAM
FT                   VLLLSMGVGIFMPPLGIGFYVACSVMGTSVEQTSKAILPYLLALLFGILAVSAVPFFSL
FT                   ALLHVFGR"
FT   gene            complement(365576..366562)
FT                   /locus_tag="Mnod_8628"
FT   CDS_pept        complement(365576..366562)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8628"
FT                   /product="TRAP dicarboxylate transporter, DctP subunit"
FT                   /note="TIGRFAM: TRAP dicarboxylate transporter, DctP
FT                   subunit; PFAM: TRAP dicarboxylate transporter- DctP
FT                   subunit; KEGG: oan:Oant_4429 TRAP dicarboxylate
FT                   transporter, DctP subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8628"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62703"
FT                   /db_xref="GOA:B8IWB3"
FT                   /db_xref="InterPro:IPR004682"
FT                   /db_xref="InterPro:IPR018389"
FT                   /db_xref="InterPro:IPR038404"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB3"
FT                   /inference="protein motif:TFAM:TIGR00787"
FT                   /protein_id="ACL62703.1"
FT                   /translation="MVLSRRGLIAAGLSAPFIAQSNFAQAAQHTLKFVYPDTPSHPFMQ
FT                   VARRFADSVKSRTEGAVEVQVFTTGQLGSQGNMLTGMQTGIIDLCCHTSGFVQTLYPKF
FT                   MVVDLPFLFKDAETAERMLDGPIGPKLLQDLPSKGIYGLSYGHFGWRVVSTIGRSVKVP
FT                   SEAKGMKIRVQPGAIYAAMFNTLGANPIQIDLSEIYLALSQSAIEAIETPMISMAASKH
FT                   DEVIKVITKTNHVYNPGIMMASKRKLDSLASKYQQVIREASFEMTKDARSTISKASQEV
FT                   EGRFASQGITIQPADRAAYRTAMQPVYDQFRPIIGADLMDEVLSQVA"
FT   sig_peptide     complement(366482..366562)
FT                   /locus_tag="Mnod_8628"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.721 at
FT                   residue 27"
FT   gene            367122..367793
FT                   /locus_tag="Mnod_8629"
FT   CDS_pept        367122..367793
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8629"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: pna:Pnap_0602 transcriptional regulator,
FT                   GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8629"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62704"
FT                   /db_xref="GOA:B8IWB4"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB4"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL62704.1"
FT                   /translation="MGRGQDRAYGVLRQRLVGGHYRPGFHLREEPLAQEFGLSRTPIRA
FT                   ALKRLVEDGLATDAGHGIHVAEWSEADIEETFRLRMLLEPHATELAVQRGGGALVEHLE
FT                   SCNCIMADAIAKNDDDAIGIIQEVNRKFHHTLIIFAGSPRLRSILETMIDMPVVVRSFF
FT                   LYSYEELNQSLHHHRDIAFAARIRDGELGRRAMQLHLRMSYARVLQHRGSRDRLPVLDS
FT                   L"
FT   gene            368307..369266
FT                   /locus_tag="Mnod_8630"
FT   CDS_pept        368307..369266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8630"
FT                   /product="Transposase and inactivated derivatives-like
FT                   protein"
FT                   /note="KEGG: met:M446_7034 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8630"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62705"
FT                   /db_xref="InterPro:IPR032874"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB5"
FT                   /inference="protein motif:COG:COG3316"
FT                   /protein_id="ACL62705.1"
FT                   /translation="MILHALVLKLKRQARGDFRGRHFEATLIVQVVSWYLRYALSYRDI
FT                   EEMLLERGLEVDHSTINRWVLAYAPAIERRLRMFRKPHCGSVRVDETYIKIRGQWRYLY
FT                   RAIDKHGEAVDFLLTANRDLDAAKRFFRKMLREEPLLAPDRIGTDGAGPYPPALAESRQ
FT                   DGLLPRTPTHHVTKHLQQGIESDHFRVKRPMPRVGGFPPSPRPGGRSRASRPCCGCARA
FT                   SGLRGPGPCGSRTSCWRTASDFPSRTKRESGAEQALLRPEPEFATSPHRARDQACGSSC
FT                   PSAASRAASACRSAMNSSTTDPRPWRKGAASARTRLRA"
FT   gene            complement(369128..369415)
FT                   /locus_tag="Mnod_8631"
FT   CDS_pept        complement(369128..369415)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8631"
FT                   /product="SpoVT/AbrB domain protein"
FT                   /note="PFAM: SpoVT/AbrB domain protein; KEGG: nar:Saro_3971
FT                   AbrB family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8631"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62706"
FT                   /db_xref="GOA:B8IWB6"
FT                   /db_xref="InterPro:IPR007159"
FT                   /db_xref="InterPro:IPR037914"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB6"
FT                   /inference="protein motif:PFAM:PF04014"
FT                   /protein_id="ACL62706.1"
FT                   /translation="MPEPLRRTVQVAGNGRMNLPADMRRVLGLTGPGRVILTQDEDGIR
FT                   ITTADQALKRVRALAAPFLQGRGSVVDEFIAERHAEAAREAAEGQDEPHA"
FT   gene            369639..370199
FT                   /pseudo
FT                   /locus_tag="Mnod_8632"
FT   gene            complement(370166..370411)
FT                   /locus_tag="Mnod_8633"
FT   CDS_pept        complement(370166..370411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8633"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_6497 resolvase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8633"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62707"
FT                   /db_xref="GOA:B8IWB7"
FT                   /db_xref="InterPro:IPR006119"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62707.1"
FT                   /translation="MWHCPDMLVGYARVSTQDRNLDLQRDALTKAGCERIFEEKKSGKT
FT                   GTKRPACRPSQRETASASLNHSPTRDHAGTLARSAR"
FT   gene            complement(370584..371297)
FT                   /locus_tag="Mnod_8634"
FT   CDS_pept        complement(370584..371297)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8634"
FT                   /product="extracellular solute-binding protein family 3"
FT                   /note="PFAM: extracellular solute-binding protein family 3;
FT                   KEGG: bch:Bcen2424_4651 extracellular solute-binding
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8634"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62708"
FT                   /db_xref="InterPro:IPR001638"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB8"
FT                   /inference="protein motif:PFAM:PF00497"
FT                   /protein_id="ACL62708.1"
FT                   /translation="MGGHDVKTLGWPTDNPLRVAINLGNSALAREDCDGQLRGIAVDLA
FT                   FALGDWLGSSIRLVIFPSAGAVMKAVDEDESDVAFLAIDPARADRVAYTRPYLLIEGVF
FT                   AVREASPMRDVGDVDRPRVRIASAAGAAYHSHLTLALQHAELVTVPTPGDALRRLGEGA
FT                   CDVAAGVRQAVEDFANQCEGIRVLPSRFMAIEQAVATPLRMKFDVNLFDKFIREIINIG
FT                   KLDDFLIKNEHDTSI"
FT   gene            complement(371345..372721)
FT                   /locus_tag="Mnod_8635"
FT   CDS_pept        complement(371345..372721)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8635"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: spe:Spro_2507 benzoate
FT                   transport"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8635"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62709"
FT                   /db_xref="GOA:B8IWB9"
FT                   /db_xref="InterPro:IPR004746"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWB9"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62709.1"
FT                   /translation="MNVTTERIDVQNVIDGNPISRLQMRVILLCFLVVFLDGYDTAVIG
FT                   FVAPALAKAWSVPPPALKPLLSAALFGLAAGALAAGPLADRIGRKVVLVISVALFGGLT
FT                   LLSAFATDLTQLTILRFLTGLGLGAAMPNATTLTAEYCPARHRSFLVTVMFCGFTLGSA
FT                   GGGFLGGFLIPAYGWQSAFWVGGLAPLALAAALITLLPESVQFLVVRRGGGMRVAGILR
FT                   RLAPGRAVTGDAVFVTPDLGAAQARSSLGSLFQNGLAAGTACLWLTYFMGLLVIFLLRS
FT                   WLPTLVTGAGLSLERAAMLGGAFELGGTVGALLVAWCMDRFGAHRAIALSYLLGAVTVC
FT                   VVAYLVAAPLLLAPAIFMAGFFLSGSQTSLSPLAAAFYPTHARATGVAWMLGMGRFGGI
FT                   LGALSGGVLLGLGWDFQAILTALAVPALGAAAAIWFKGRWRGREIGGGQQTAGLQLGHG
FT                   "
FT   gene            complement(372759..374168)
FT                   /pseudo
FT                   /locus_tag="Mnod_8636"
FT   gene            complement(374207..374974)
FT                   /locus_tag="Mnod_8637"
FT   CDS_pept        complement(374207..374974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8637"
FT                   /product="2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase"
FT                   /EC_number="4.1.2.20"
FT                   /note="TIGRFAM: 2,4-dihydroxyhept-2-ene-1,7-dioic acid
FT                   aldolase; PFAM: HpcH/HpaI aldolase; KEGG: ret:RHE_CH02300
FT                   2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase protein
FT                   (4-hydroxyphenylacetate catabolism protein)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8637"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62710"
FT                   /db_xref="GOA:B8IWC0"
FT                   /db_xref="InterPro:IPR005000"
FT                   /db_xref="InterPro:IPR012689"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC0"
FT                   /inference="protein motif:TFAM:TIGR02311"
FT                   /protein_id="ACL62710.1"
FT                   /translation="MNLPENRFKRALREGRQQIGLWCSLPGSYAAECVAGSGYDWLLFD
FT                   TEHSPGDPLTVLAQLQAVAPYDVAPVVRPASNDTVLIKRFLDLGAQTLLIPYVQDAHEA
FT                   QAAVAATRYPPEGVRGVSGLTRATRFGRVAAYAKRASEEICVLVQVETREALDRLEEIA
FT                   AVEGVDGIFVGPADLAASLGHVGEPGHPEVVSAVEDAVRRIRASGKPAGILTPDPDFAR
FT                   RCIALGTTFTAVAIDVGVLARGTEAVMRQFTAG"
FT   gene            complement(375312..376091)
FT                   /locus_tag="Mnod_8638"
FT   CDS_pept        complement(375312..376091)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8638"
FT                   /product="fumarylacetoacetate (FAA) hydrolase"
FT                   /EC_number="4.1.1.77"
FT                   /note="PFAM: fumarylacetoacetate (FAA) hydrolase; KEGG:
FT                   ret:RHE_CH02299 putative 2-oxo-hepta-3-ene-1,7-dioate
FT                   hydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8638"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62711"
FT                   /db_xref="GOA:B8IWC1"
FT                   /db_xref="InterPro:IPR012690"
FT                   /db_xref="InterPro:IPR036663"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC1"
FT                   /inference="protein motif:PFAM:PF01557"
FT                   /protein_id="ACL62711.1"
FT                   /translation="MLEHDHRKAAEAILKAERERIPCPQLSKTFPAMELADAYRVQDLW
FT                   AEARIANGARLIGHKIGLTSRAMQMASKMTEPDYGRILDDALYNDGARIQTELFIKPRL
FT                   EVELAFIMGEDLEGPGCRIYDVMRATEFVVPALEIIDYRTEVPRAIVDTIADNAAFGAI
FT                   VVGGRPIRPFDVDVRWIGATLSQNGIIEESGVSAAIMGHPAAGIAWLVNKLAAVEAKLK
FT                   KGQIVLGGSFTRPVDIRKGDVIQADYGPLGAIGVSFM"
FT   gene            complement(376120..377013)
FT                   /locus_tag="Mnod_8639"
FT   CDS_pept        complement(376120..377013)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8639"
FT                   /product="intradiol ring-cleavage dioxygenase"
FT                   /note="PFAM: intradiol ring-cleavage dioxygenase; Catechol
FT                   dioxygenase domain protein; KEGG: bja:blr0926 catechol
FT                   1,2-dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8639"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62712"
FT                   /db_xref="GOA:B8IWC2"
FT                   /db_xref="InterPro:IPR000627"
FT                   /db_xref="InterPro:IPR007535"
FT                   /db_xref="InterPro:IPR015889"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC2"
FT                   /inference="protein motif:PFAM:PF00775"
FT                   /protein_id="ACL62712.1"
FT                   /translation="MRIERQQDVTPAVLEVMARTRDPRLREIMISLVTHLHGFIRDVRL
FT                   TEAEFREATAILNEIGALASDTHNEFVLMAGSLGVSSLVCLLNNGDHGNTETSQSLLGP
FT                   FWRLNAPRVENGGTIVRSDTPGDPLFVNARVIDGQGRPIAGAEVDVWHASPVGLYENQD
FT                   PEQAEMNLRGKFTTDAEGRFWFRSVMMVGYPIPTDGVVGRLLKAQDRHPMRPAHLHALI
FT                   FKPGFKVLISQVYDPNDPHIDSDVQFGVTKALLGDFVRHDAPHPSVTDVPAPWYSLDYA
FT                   YVMEAGEAVLPRPPIK"
FT   gene            377488..378180
FT                   /locus_tag="Mnod_8640"
FT   CDS_pept        377488..378180
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8640"
FT                   /product="transcriptional regulator, GntR family"
FT                   /note="PFAM: regulatory protein GntR HTH; GntR domain
FT                   protein; KEGG: ret:RHE_CH02297 probable transcriptional
FT                   regulator protein, GntR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8640"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62713"
FT                   /db_xref="GOA:B8IWC3"
FT                   /db_xref="InterPro:IPR000524"
FT                   /db_xref="InterPro:IPR008920"
FT                   /db_xref="InterPro:IPR011711"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC3"
FT                   /inference="protein motif:PFAM:PF07729"
FT                   /protein_id="ACL62713.1"
FT                   /translation="MPGLALVDDGKNTMASQLVDRLREAIVSGQLEAGSKINLERARES
FT                   FGVSLSPLREALARLISDGLVVFEDNRGYRVAPVSLSNLEEITRLREEFEILALRQAIA
FT                   VGTVDWEGDVMRALHRMNRIERDPDKPDTLKQWEAYHREFHLTLIAGCRMPLLLNFCSV
FT                   LLSLNDRYRRSFLRRTPGGDRNVAQEHSEIAQGAVARDAEFACARLREHIHRTGTNLQR
FT                   HLADKLAP"
FT   gene            378198..379007
FT                   /locus_tag="Mnod_8641"
FT   CDS_pept        378198..379007
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8641"
FT                   /product="Xylose isomerase domain protein TIM barrel"
FT                   /note="PFAM: Xylose isomerase domain protein TIM barrel;
FT                   KEGG: bam:Bamb_5912 xylose isomerase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8641"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62714"
FT                   /db_xref="GOA:B8IWC4"
FT                   /db_xref="InterPro:IPR013022"
FT                   /db_xref="InterPro:IPR036237"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC4"
FT                   /inference="protein motif:PFAM:PF01261"
FT                   /protein_id="ACL62714.1"
FT                   /translation="MHASLDQPLGLAHFTCIAVPPLDLVRLAARTGYASVGLRLHPAFP
FT                   GAPVYELPPRSAAFREVRQALSDEGVHLHDIEFVTIGEDFASASLTGILEAAAGLGAQR
FT                   LSVCGDDPDRDRLVARFAELCDLAAEFGMGVDLECMAWRQVASLPDAVRVVENAGRPNG
FT                   GVLVDALHLSRTGGSPEDVSAVPADLIRSAQLCDAPAEAPQSTDGIIREARAGRLIPGE
FT                   GALPLGALLAALPLTASLSVEVPMAGTSSPEEHVRANLAAARRLLVG"
FT   gene            379159..380520
FT                   /locus_tag="Mnod_8642"
FT   CDS_pept        379159..380520
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8642"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: sma:SAV1779
FT                   3-(2-hydroxyphenyl) propionic acid transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8642"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62715"
FT                   /db_xref="GOA:B8IWC5"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62715.1"
FT                   /translation="MAPYDHHSASAGLEPPGLHAPKKAALASWIGSAVEYYDFFIYGTA
FT                   AALIFPKLFFAPDNPQAAAIASFATFGVAYITRPLGAVALGHIGDKFGRKKVLTFTLLL
FT                   MGFSTFMIGCLPTYGQAGILAPILLVIARLLQGVSAAGEQAGASSMTLEHAPPDRRAFF
FT                   TSFTLSGTQAGLILATLAFLPISAMPEEQMLSWGWRIPFFLSLIVVAVGFWVRRTLPET
FT                   PAFEEEKEQHHDARVPVLALFRDQWPDVLRVIFAAIISVVSTIFAVYTLSYAVNVVKIP
FT                   RPTMLTLLILANVVALAAIPLWAMLADRIGRRPVFIFGAIGCAVLIYPYLWAISRADVT
FT                   WIYVLGLLLSGVVYSAANGIWPCLYAEMFETRIRLSGMAISTQIGFAIGGFAPGIAAVV
FT                   QGQGQDGWVPVAIFVMITCAIAAASIMTARETYRTPMHALGKRVPSAPARVQTA"
FT   gene            380581..381414
FT                   /locus_tag="Mnod_8643"
FT   CDS_pept        380581..381414
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8643"
FT                   /product="Shikimate dehydrogenase substrate binding domain
FT                   protein"
FT                   /note="PFAM: UBA/THIF-type NAD/FAD binding protein;
FT                   Shikimate/quinate 5-dehydrogenase; Shikimate dehydrogenase
FT                   substrate binding domain protein; KEGG: bph:Bphy_6410
FT                   shikimate dehydrogenase substrate binding domain protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8643"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62716"
FT                   /db_xref="GOA:B8IWC6"
FT                   /db_xref="InterPro:IPR000594"
FT                   /db_xref="InterPro:IPR013708"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC6"
FT                   /inference="protein motif:PFAM:PF08501"
FT                   /protein_id="ACL62716.1"
FT                   /translation="MIRGTTTLIAHLGFPTESFKAPMIYNPWFEKTGIDAVVMPMGVRA
FT                   ENYPDVFRSIFRLTNIRGALVTMPHKITTVSLLDEVSTTAKIAGSCNAVLLRPDGSLLG
FT                   DMFDGAGFVRGIQRKGRDLTGARVLVVGSGGVGSAIAASLAAAGIGEIGVYDYNPTAAE
FT                   ALAGRLREHYPALGIRTGSDDPTGFDVVVNATPLGMKEGDPLPVDVARLDPGTFVGEVV
FT                   MKQEHTPFLEAAQEKGCPIQVGTDMLFEQIPAYLEFFGFGTTTAEELRAVARVSY"
FT   gene            381435..381879
FT                   /pseudo
FT                   /locus_tag="Mnod_8644"
FT   gene            complement(382049..382531)
FT                   /locus_tag="Mnod_8645"
FT   CDS_pept        complement(382049..382531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8645"
FT                   /product="CMP/dCMP deaminase zinc-binding"
FT                   /note="PFAM: CMP/dCMP deaminase zinc-binding; KEGG:
FT                   mrd:Mrad2831_4793 CMP/dCMP deaminase zinc-binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8645"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62717"
FT                   /db_xref="GOA:B8IWC7"
FT                   /db_xref="InterPro:IPR002125"
FT                   /db_xref="InterPro:IPR016193"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC7"
FT                   /inference="protein motif:PFAM:PF00383"
FT                   /protein_id="ACL62717.1"
FT                   /translation="MTDDDKKFMARAIELSEKTSLVESAGGVFGCVIVQDGEILAEGAN
FT                   RVVAENDPTWHGEIEAIRKACKAQGSFKLRDATLYTSAEPCPMCMAAAYWAGIKAIYYA
FT                   ATNEDALRYGDFDDSMIYGELKKPVSARAIPTRQIMRAEAVEVWKKYHEKTDRVPY"
FT   gene            complement(382550..383491)
FT                   /locus_tag="Mnod_8646"
FT   CDS_pept        complement(382550..383491)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8646"
FT                   /product="antibiotic biosynthesis monooxygenase"
FT                   /note="KEGG: pna:Pnap_2696 antibiotic biosynthesis
FT                   monooxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8646"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62718"
FT                   /db_xref="GOA:B8IWC8"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR038762"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC8"
FT                   /inference="similar to AA sequence:KEGG:Pnap_2696"
FT                   /protein_id="ACL62718.1"
FT                   /translation="MNVPSTTRVTAIVTRVSLRAGAEDDFARWQAALTRVAGEAPGFVS
FT                   IEVVPVAPQALDWHVVQRFRTAAELDAWRGGEARAACLATLRPLLHPEQPVAPDEAAPD
FT                   FHALACVTEVITTRVEPGREHAFRAWAEAAQAAQARFPGYAGTLVQAPLPPQIPYWTAL
FT                   VRFATPGQLDAWLGSPERQALLRQADPAVATWTSRRLDGPFAGWFSEEPGAAPPAWKQT
FT                   TLVLLVLFPVVMLEIRFLSPLTAGLPPAVATFVGNAISVALVSWPLMRVAATGLGWWLR
FT                   PAPGRRRRNEILGAFVLLGLYAAELATFTLLP"
FT   gene            383980..385038
FT                   /locus_tag="Mnod_8647"
FT   CDS_pept        383980..385038
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8647"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: ana:alr7249 unknown protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8647"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62719"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWC9"
FT                   /inference="similar to AA sequence:KEGG:alr7249"
FT                   /protein_id="ACL62719.1"
FT                   /translation="MSLRPQPPLPPVPEDTARVAQTAFRRGNPYLLLRTCLGPIFADAA
FT                   FADLYPTRGQPAYAPWRLALVTLLQFREGLSDRQAAEAVWARIDWYRKYLLGLDLTDPG
FT                   FDSSVLCEFRGRLLARILDAARDQGVLKAHGRQRTDSTHVLAAVRDLNRIELLAETLRA
FT                   ALNAIATVAPDWLRGVAPPDWHERYDHRIEDARLPETGPKREAYVLQVGADGYHLLDAP
FT                   DGASAPPLAATLPAVAVLRRVWARHFMRAGDDPDIGAGVRLVPVQGPGPGDRVETPYDS
FT                   DARFRAKSGTDWTGSTVHLTETCDPDLPRLVVRPGHARPRDPPPDRRGPPGLALRARGL
FT                   VGPVRSLRRRSR"
FT   gene            385040..385579
FT                   /pseudo
FT                   /locus_tag="Mnod_8648"
FT   gene            complement(385681..385893)
FT                   /locus_tag="Mnod_8649"
FT   CDS_pept        complement(385681..385893)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8649"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3784 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8649"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62720"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD0"
FT                   /inference="similar to AA sequence:KEGG:M446_3784"
FT                   /protein_id="ACL62720.1"
FT                   /translation="MCIRRFTVRKARKGWGVYCAHTGEPARVNGREQTGLSREAATELA
FT                   SSLKILAYIQAELDERRAGNPHTLH"
FT   gene            complement(385958..386080)
FT                   /pseudo
FT                   /locus_tag="Mnod_8650"
FT   gene            complement(386393..386587)
FT                   /pseudo
FT                   /locus_tag="Mnod_8651"
FT   gene            complement(386590..387186)
FT                   /pseudo
FT                   /locus_tag="Mnod_8652"
FT   gene            complement(387317..388477)
FT                   /locus_tag="Mnod_8653"
FT   CDS_pept        complement(387317..388477)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8653"
FT                   /product="dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase"
FT                   /note="PFAM: dihydroxy-acid and 6-phosphogluconate
FT                   dehydratase; KEGG: bid:Bind_3081 dihydroxy-acid
FT                   dehydratase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8653"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62721"
FT                   /db_xref="GOA:B8IWD1"
FT                   /db_xref="InterPro:IPR000581"
FT                   /db_xref="InterPro:IPR037237"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD1"
FT                   /inference="protein motif:PFAM:PF00920"
FT                   /protein_id="ACL62721.1"
FT                   /translation="MTSKRTLRSQAWFGRQDKMGFYYRSFLKNSGAPQDQFDGRPVIGI
FT                   CNTWSELSPCNAHFRTIAEHVRLGVLDAGGFPLEFPVSSLGEVTMRPTAMLFRNLASMD
FT                   VEEGIRAHPLDGVVLLMGCDKTTPSLLMGAASADLPTIGVSGGPQLRGVYQGRAIGSGT
FT                   NIISMSEQLRAGEITLEEFHEAESAMNRSSGRCMTMGTASSMASMVEALGVGLPGNAAI
FT                   PAVDARRNNLARMAGRRIVAMVEEDLVLSKILTRSAFENAIRTLAAIGGSTNAVVHLLA
FT                   IAGRVGVELTLDDFDCLGRDVHCLVDLMPSGRFLMEDFYYAGGLPAVLRTLGEKGLLAQ
FT                   PVCGGRSTSRPTAAFSGTTVLHDPDVTRGRAAPAFRDGIDVNVPVR"
FT   gene            complement(388497..389384)
FT                   /locus_tag="Mnod_8654"
FT   CDS_pept        complement(388497..389384)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8654"
FT                   /product="6-phosphogluconate dehydrogenase NAD-binding"
FT                   /note="PFAM: 6-phosphogluconate dehydrogenase NAD-binding;
FT                   KEGG: mpt:Mpe_A2972 2-hydroxy-3-oxopropionate reductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8654"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62722"
FT                   /db_xref="GOA:B8IWD2"
FT                   /db_xref="InterPro:IPR006115"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR015815"
FT                   /db_xref="InterPro:IPR029154"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD2"
FT                   /inference="protein motif:PFAM:PF03446"
FT                   /protein_id="ACL62722.1"
FT                   /translation="MTTTSPSVAFLGIGLMGGPQARNLLKAGFAVTAWNRSPAKAEALA
FT                   PLGAQVASTPAEAVRGAEVTVIMLENGPIVADVLFAKGAAEALAPGSVVVDMSSIKPAE
FT                   AIDHAHRLAARGVAYVDAPVSGGTVGAEQGTLAIMAGGDAAVFALVEPVLRAMGRPVHV
FT                   GPAGAGQFAKLANQIIVGVTIGAVAEALLLARQGGADPIKVREALRGGFAESRILDLHA
FT                   QRMIERDFATRGRSVTHLKDLDNALDAAGALDVAAVPYTALTADLFRGLLTNAGDLDHS
FT                   GLILELERRNGIAT"
FT   sig_peptide     complement(389319..389384)
FT                   /locus_tag="Mnod_8654"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.870) with cleavage site probability 0.830 at
FT                   residue 22"
FT   gene            complement(389381..389674)
FT                   /pseudo
FT                   /locus_tag="Mnod_8655"
FT   gene            complement(389708..390748)
FT                   /locus_tag="Mnod_8656"
FT   CDS_pept        complement(389708..390748)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8656"
FT                   /product="Pyridoxal phosphate biosynthetic protein PdxA"
FT                   /EC_number="1.1.1.262"
FT                   /note="PFAM: Pyridoxal phosphate biosynthetic protein PdxA;
FT                   KEGG: bja:blr4374 4-hydroxythreonine-4-phosphate
FT                   dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8656"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62723"
FT                   /db_xref="GOA:B8IWD3"
FT                   /db_xref="InterPro:IPR005255"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD3"
FT                   /inference="protein motif:PFAM:PF04166"
FT                   /protein_id="ACL62723.1"
FT                   /translation="MTTTDTAASHRPLIAFAVGCPAGIAPELTARMLVDSTVTSAAQIV
FT                   TIGDRCVIERGAAVAGVELDLRYVAPGEPIPQNSARPIFVDLCNLDPADISVGTLSEPA
FT                   GRSVLANFKHAIALGARGEADAVAFSPFNKASMRLAHPAYEDEIVFVSKMLGFQGTASE
FT                   FNILPELWNARVTSHVPISAVASLITFDNVLRALRLTDQAMREGGYKAPRIAVAGLNPH
FT                   AGDSGNFGREEIDVIGPAIAAGQAGGILCHGPLPPDTVFVRARKGEFDAVLTMYHDQGQ
FT                   VAMKLIGFDRGITLLAGFPFPLLTAAHGSAYDIAGKGIADPGALRAALLLAARMGARRQ
FT                   AAAAVA"
FT   gene            complement(390822..391763)
FT                   /locus_tag="Mnod_8657"
FT   CDS_pept        complement(390822..391763)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8657"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: pap:PSPA7_3078
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8657"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62724"
FT                   /db_xref="GOA:B8IWD4"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD4"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACL62724.1"
FT                   /translation="MERDTLWTGPVVDAHQHFWDPLINPHPWLRPEARIPFRYGDYSAI
FT                   KRRYLPNDYLADAAGHDIRETVYVETEWDPSGPIDETRYASSLAERYGLPNAIVAQAWL
FT                   DRSDVQPVLAAQAAFPLVRSVRHKPGGPASPDRVGQQRTLMSDDAWRRGYALLEGHSLH
FT                   FDLQTPWWNLHEAVRLARDFPRTTIVLNHAGLPSDRSADGLKGWHRAMAAFAEEPNVRV
FT                   KISGIGQPGRPWTVADNGWIVEEIIALFGPARTMFASNFPVDSLCGTFDTIWSGFKQIV
FT                   SRYSIEHQRRLFCDTAREIYRTGAQPRAVAAQ"
FT   gene            complement(391763..393067)
FT                   /locus_tag="Mnod_8658"
FT   CDS_pept        complement(391763..393067)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8658"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: major facilitator superfamily MFS_1; KEGG:
FT                   pae:PA2210 major facilitator transporter"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8658"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62725"
FT                   /db_xref="GOA:B8IWD5"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD5"
FT                   /inference="protein motif:PFAM:PF07690"
FT                   /protein_id="ACL62725.1"
FT                   /translation="MTGLDQTHSDLASDGIATPVASTVRWRIFGIIFVLVVINLIDRVT
FT                   LSIAMPTIAKEFAIEPAMQGLVLSAFFWSYALLQIPGGWLIDRFGPRALIAGATVGWGF
FT                   FQAVAGLATGGVSLLASRIGLGAAEAPLFPAGAKLNSIWLSPKERARGAVLVDSGAPLG
FT                   AAFGGVIIAWLILSLGSWRTAFVVAGLVTMLLGVLAWWYLRDDPTDHPGVNAGELAAIQ
FT                   ATAGPATGVVTAGPRGIAAGSFAAILVGRMSWAMINFGLLTWGPSYLAQARGFDLKQMG
FT                   GATFVIFLAGMVGSLTSGFLVDRLLARGLSRGVVYKWALGLTGLGVMLAFLVLPQVADP
FT                   VAAVALLSATLFLLYFGSLYWSLPAILAPKDRVGVVGGAMNFAGSASGIAIPIITGLIL
FT                   QATGAYLMVLYFFAACAALYVAGSLLIDFKPAEAR"
FT   gene            393350..394264
FT                   /locus_tag="Mnod_8659"
FT   CDS_pept        393350..394264
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8659"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: pol:Bpro_3514 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8659"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62726"
FT                   /db_xref="GOA:B8IWD6"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD6"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62726.1"
FT                   /translation="MLRRLKSRQLLLLIALSEARSLRKAAAALNMTQPTATKLLQNLEN
FT                   NVGLALFERGRRGMQPTIYGEVIIRHARLVLADLNRTRLELQSLSSGGTGRIRIGAVIS
FT                   AIPVLLARAVARLKQQHSGLSVTIDVGTSDALVPALAKGELDVLLARPLVLADRPEFNY
FT                   EELTEEPIQIVARAGHALAASERLRLGDLAGSAWTLLPPGTPMRKVLEPIFAQIGPGEP
FT                   RNVVETSSIMTMIALLQESEMLAVMPADVTNFNTRHGLLCRLPISLPPIMGSYGIVTRR
FT                   DRPLSPSTTTFLQHLKATMQRFD"
FT   sig_peptide     393350..393424
FT                   /locus_tag="Mnod_8659"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.632) with cleavage site probability 0.354 at
FT                   residue 25"
FT   gene            394651..395352
FT                   /pseudo
FT                   /locus_tag="Mnod_8660"
FT   gene            395495..396655
FT                   /locus_tag="Mnod_8661"
FT   CDS_pept        395495..396655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8661"
FT                   /product="protein of unknown function UPF0118"
FT                   /note="PFAM: protein of unknown function UPF0118; KEGG:
FT                   gdi:GDI1272 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8661"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62727"
FT                   /db_xref="GOA:B8IWD7"
FT                   /db_xref="InterPro:IPR002549"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD7"
FT                   /inference="protein motif:PFAM:PF01594"
FT                   /protein_id="ACL62727.1"
FT                   /translation="MAVTREQGAVSPSPANACADERDEREAREAVAAGEAVPHGVRSVG
FT                   ILVLSLLAVVYTLYLGRELILPTVLALVLKLLLGPVMRILHERLRLPNSLAAALLILVV
FT                   FGAIAGVGFTISIPASVWIQRAPESLSLLKEKLAVLHHPLDLLQQGLHAIENLTGTIGQ
FT                   EGQNQTITTRPASGLAGYLATGTATILVRFFTTMILLFFLLASGDRLLRGFIEVLPSFS
FT                   NKRQAVEIAHEIGTNISGYLLTITMMNTLVGVATGLAMWACGLGTPLLWGATAFLLNYI
FT                   PILGPLAGLVIFFVAGVLSLDWPWYALMPVGLYLLIHIAEGETITPMLLAKRFTLNPVL
FT                   VIVSLFFWHMLWGVPGALLAVPLLAMLKIVADRVEPLKPVGHIIGS"
FT   gene            complement(397050..397820)
FT                   /locus_tag="Mnod_8662"
FT   CDS_pept        complement(397050..397820)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8662"
FT                   /product="protein of unknown function DUF81"
FT                   /note="PFAM: protein of unknown function DUF81; KEGG:
FT                   mrd:Mrad2831_5981 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8662"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62728"
FT                   /db_xref="GOA:B8IWD8"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD8"
FT                   /inference="protein motif:PFAM:PF01925"
FT                   /protein_id="ACL62728.1"
FT                   /translation="MVAINKGPAVSDIVIFPLCICFAGFVSGLTGFAFALIASGTLLSI
FT                   KPPLETAALVLICSIISQSISLVRLRTIPPWSTTASMIVPGLFGAPIGIYLLHDLSPNV
FT                   IKCFIGIFLIGYACVVMCLSANYKIRFGNSWTDGVVGFMGGILGGIAGLSGALPTAWSL
FT                   VRGWEPRTQRAIYQSFSVVMQVWALGILATYDTLPSALAADLTIAVPILLVSVFSGLMM
FT                   FARIDQRMFRSIVLLLLAAIGATTSAGALLALFR"
FT   gene            complement(397977..398309)
FT                   /locus_tag="Mnod_8663"
FT   CDS_pept        complement(397977..398309)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8663"
FT                   /product="putative sulfite:cytochrome c oxidoreductase
FT                   subunit B"
FT                   /note="KEGG: met:M446_6452 putative sulfite:cytochrome c
FT                   oxidoreductase subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8663"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62729"
FT                   /db_xref="GOA:B8IWD9"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWD9"
FT                   /inference="similar to AA sequence:KEGG:M446_6452"
FT                   /protein_id="ACL62729.1"
FT                   /translation="MTSLISRLALVSLAILGLSCAAAWIESARAKPMTYDLPEETSKLR
FT                   PGAGVEVAEAHCLTCHSPDYIAMQPGGKGRAFWAAEISKMLKAYGAPISDDDAKTITDY
FT                   LATTYP"
FT   sig_peptide     complement(398217..398309)
FT                   /locus_tag="Mnod_8663"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.432 at
FT                   residue 31"
FT   gene            complement(398320..399525)
FT                   /locus_tag="Mnod_8664"
FT   CDS_pept        complement(398320..399525)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8664"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: met:M446_6453
FT                   oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8664"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62730"
FT                   /db_xref="GOA:B8IWE0"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE0"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACL62730.1"
FT                   /translation="MLQRRDVLRGAAMLATAGPFATLARAAAPESVTLPFGNGKHPLVA
FT                   YPGKRPLIQMTSRPPQLETPFSVFDEGVITPNDAFFVRYHLAGLPNEIDPESFRLEIKG
FT                   KVDRPFSLSLTELKTLETVEVTAVNQCSGNSRGFFEPRVAGGQLANGAMGCARWRGVPL
FT                   KTVLDRAGVQASATQVMFEGLDGPVLPATPDFAKALDLDHARDGEVLLAYAMNGEDLPW
FT                   LNGYPLRLVVPGYYGTYWVKHLNRITVLDTRLQNFWMKAAYRIPDNTCACTKPGESPAG
FT                   TVPINRFTVRSFITNLLDGDRVRADAETTLRGIAFDGGYGISDVLVSGDDGRSWTAAKL
FT                   GEDHGRYAFRGWQASLRLPTGEHKLRVRAMNRIGQSQPLDPLWNPAGYMRNVVETTRVT
FT                   AR"
FT   sig_peptide     complement(399445..399525)
FT                   /locus_tag="Mnod_8664"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.936 at
FT                   residue 27"
FT   gene            complement(399585..400667)
FT                   /locus_tag="Mnod_8665"
FT   CDS_pept        complement(399585..400667)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8665"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   mpo:Mpop_0213 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8665"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62731"
FT                   /db_xref="GOA:B8IWE1"
FT                   /db_xref="InterPro:IPR018383"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE1"
FT                   /inference="protein motif:PFAM:PF03601"
FT                   /protein_id="ACL62731.1"
FT                   /translation="MTVLRDGRPLIDHRPIHGLRRRVADLAPGVALCAAVTLVAVGLQQ
FT                   LEERAFAHPYVEALVIAILLGMAVRTIWEPSPIWRSGIAFSAKQLLEVAVVLLGTSISV
FT                   AAIISSGPVLFAAIVGTVIVSILASFAISRLLGLATRISILIACGNSICGNSAIAAVAP
FT                   VIGASSDDVASSISFTAILGVLIVLGLPLLIPLLSLGASQYGILAGLTVYAVPQVLAAT
FT                   VPAGLVATQVGTLVKLVRVLMLGPVVVGLSLLAPLVRERAPKPGKARKIDPFKLVPWFI
FT                   LGFLCLAALRSIGGVPDVAVGPITRVAGYLTVISMAALGLGVDLRVIGRVGGRVTLAVT
FT                   LSLVLLLLISLGLIHLLRLG"
FT   gene            complement(400755..402155)
FT                   /locus_tag="Mnod_8666"
FT   CDS_pept        complement(400755..402155)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8666"
FT                   /product="sodium:dicarboxylate symporter"
FT                   /note="PFAM: sodium:dicarboxylate symporter; KEGG:
FT                   cvi:CV_3707 C4-dicarboxylic acids transport protein (Na+/H+
FT                   dicarboxylate symporter)"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8666"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62732"
FT                   /db_xref="GOA:B8IWE2"
FT                   /db_xref="InterPro:IPR001991"
FT                   /db_xref="InterPro:IPR018107"
FT                   /db_xref="InterPro:IPR036458"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE2"
FT                   /inference="protein motif:PFAM:PF00375"
FT                   /protein_id="ACL62732.1"
FT                   /translation="MATLNGSLHDPRRSSGPGSGDAAKRPVPIYKRLYPQVLFALAAGI
FT                   ALGHFYPGLAEQMKPFGDGFIKMIKMMIGPVIFITVSVGIAKMGDLKEVGRVGLKALIY
FT                   FEILTTLALVIGLVVGNVLKPGVGINADPATLDASSITGFVASSQKLSTVDFLLHIIPT
FT                   TFFDAFAKGEILQVLFVAVLFGVALSHFSQHTKLLVKILEEASHGLFGIIGFIMRIAPL
FT                   GAFGAMAFTVGKYGIGSLQQVFLLVVGVYVTCIAFVFLVLGFVARLTGFSLWRFLVYIK
FT                   EEIFVVIGTSSSETVLPRMLVKMEKLGCAKPVVGLVLPTGYSFNLDGTCVYLTMAALFI
FT                   AQAFNIDLTLGEQLSILGVMLLTSKGAAAVSGAAFVTLAASMSSIHHLPVSGLALLLGV
FT                   DRILAEVRAVTNLIGNGVGTLAISKWENALDTARMQQVLSGEAAPTAEEAEQAENTGTT
FT                   TGAAVPVI"
FT   gene            complement(402320..403159)
FT                   /locus_tag="Mnod_8667"
FT   CDS_pept        complement(402320..403159)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8667"
FT                   /product="amidohydrolase 2"
FT                   /note="PFAM: amidohydrolase 2; KEGG: bpe:BP0616
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8667"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62733"
FT                   /db_xref="GOA:B8IWE3"
FT                   /db_xref="InterPro:IPR006680"
FT                   /db_xref="InterPro:IPR032465"
FT                   /db_xref="InterPro:IPR032466"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE3"
FT                   /inference="protein motif:PFAM:PF04909"
FT                   /protein_id="ACL62733.1"
FT                   /translation="MKIIDFRIRPPFKDFLGTAMYAGAERRDRMTRSIGFTPSLAAQER
FT                   SIDLLIQEMDQAGVTHGVVVGRESGSLGSVDNAVVKEFCDTHSGRFIPVASIDPTDRRK
FT                   AATAIDTAIAAGFKAFNIEPGGATVPMHTDDRRLYPIYAHLEDRGLPLIIMTGGNAGPD
FT                   ISFTSPEHLDRVLADFPALRIVSSHGNWPWVHQILHIAFRRPNLYLSPDYLLANLPGMD
FT                   DYVRAADGWLADRILYASAFPFAPVHDYAKWFQKLPIKPENLEMIMWRNARDLLKIL"
FT   gene            complement(403316..403987)
FT                   /locus_tag="Mnod_8668"
FT   CDS_pept        complement(403316..403987)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8668"
FT                   /product="Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region"
FT                   /note="PFAM: Fe-S type hydro-lyase tartrate/fumarate beta
FT                   region; KEGG: rsp:RSP_3145 putative tartrate dehydratase
FT                   beta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8668"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62734"
FT                   /db_xref="GOA:B8IWE4"
FT                   /db_xref="InterPro:IPR004647"
FT                   /db_xref="InterPro:IPR036660"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE4"
FT                   /inference="protein motif:PFAM:PF05683"
FT                   /protein_id="ACL62734.1"
FT                   /translation="MTNTLKTVELKLPASTENLRALEIGTVVYLTGRLFTAREGVYKRA
FT                   IEEGAGMPAANVDLGTANFHCSPAATIEPDGRFTIGAVTATASFRFAKWLDGWFKLSGC
FT                   NIIIGKGGMTSEIYRSIFVPNNAIYLTTVGYGTGALLGRGIREVPGVYWRNELGLAQAV
FT                   WVLDVERFGPFIVESDLEGRSLFERENDKITPGLAKLYEGTKPATLRRYGETSDKTEEV
FT                   I"
FT   gene            complement(403993..404952)
FT                   /locus_tag="Mnod_8669"
FT   CDS_pept        complement(403993..404952)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8669"
FT                   /product="hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit"
FT                   /EC_number="4.2.1.2"
FT                   /note="TIGRFAM: hydro-lyase, Fe-S type, tartrate/fumarate
FT                   subfamily, alpha subunit; PFAM: Fe-S type hydro-lyase
FT                   tartrate/fumarate alpha region; KEGG: rsh:Rsph17029_3883
FT                   tartrate/fumarate subfamily Fe-S type hydro-lyase alpha
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8669"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62735"
FT                   /db_xref="GOA:B8IWE5"
FT                   /db_xref="InterPro:IPR004646"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE5"
FT                   /inference="protein motif:TFAM:TIGR00722"
FT                   /protein_id="ACL62735.1"
FT                   /translation="MISISKIESTAETLMAKAAIEIPEDYLAGLRRCADTEKGDLSSFV
FT                   IQAMLENYEAAKEDRRAMCGDTGVPRWYVKYGNDARPEGGPIAVEGALRRATATATRTV
FT                   PLRPNRVHPLWRTDHDNNVGINAPEIEYAFHPDADWIDLTTVHKGGLFGSDYRMLFPGD
FT                   GLQGIKRFFLDTLVAFGKRGLACQPAIIGVGLGGSKDACMVLGKQASCLRTVGSRNPDP
FT                   KIAELEIELRELGNSIGMGAMGFMGSSMVVDCNIEVGYCHTGGMPMSVHMFCLSSRRAT
FT                   ARIHGDGRVEYRTDPEWFTDYSRRETVDWTAPLSVAAE"
FT   gene            complement(405110..406849)
FT                   /locus_tag="Mnod_8670"
FT   CDS_pept        complement(405110..406849)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8670"
FT                   /product="fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein"
FT                   /EC_number="1.4.3.16"
FT                   /note="PFAM: fumarate reductase/succinate dehydrogenase
FT                   flavoprotein domain protein; KEGG: har:HEAR3333 fumarate
FT                   reductase, or succinate dehydrogenase, flavoprotein
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8670"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62736"
FT                   /db_xref="GOA:B8IWE6"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE6"
FT                   /inference="protein motif:PFAM:PF00890"
FT                   /protein_id="ACL62736.1"
FT                   /translation="MMIERIETDILVLGSGGAGLFAALHAYDRDPTLSVTLATKGLLGK
FT                   CGCTRMVQGGYNVALHKGDSVERHFMDTIEGGKWLPNQELAWTLVSTAPERVRELENEV
FT                   GCFFDRNADGSLHGKAFAGQTFDRTVHKGDLTGIEIINRLMEQVWKRKAIRKLEEHRAL
FT                   ALIPDRSGTALSGVLMIDVRTGGLRFVQAGAVLLATGGGPTMYRYHTPSGDKSMDGLAM
FT                   ALRAGLPLRDMEMVQFHPTGLLAGPDTRMTGTVLEEGLRGAGGHLLDGAMRRFMGDYDP
FT                   RLERATRDIVSRSIYSEMRAGRTSPNGGVFIRMSHLGPDKVRKQFKGMVDRCRDCGFDL
FT                   AGGLVEVVPTAHYFMGGVVCRPDTSTELPGLFVAGEDASGMHGANRLGGNGVANSTVFG
FT                   GIAGDVMPGWVHENGRRRVPDEEVLKAEAARCLHPFGRKPGDVNALRERLMDLMWDDVG
FT                   VVRDASGLARGLAGLDEIEGELLETGIPDGDRAFNLTWHDWMNLQSLVETSRVVALAAQ
FT                   RRTNSRGAHFRSDFPEPGDLATSTYTVVRRSGEGLSISDEPVLFTRVRPGESLLEPTPV
FT                   AAE"
FT   gene            complement(406858..407205)
FT                   /locus_tag="Mnod_8671"
FT   CDS_pept        complement(406858..407205)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8671"
FT                   /product="succinate dehydrogenase, cytochrome b subunit"
FT                   /note="KEGG: rsh:Rsph17029_3885 succinate dehydrogenase,
FT                   cytochrome b subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8671"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62737"
FT                   /db_xref="GOA:B8IWE7"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE7"
FT                   /inference="similar to AA sequence:KEGG:Rsph17029_3885"
FT                   /protein_id="ACL62737.1"
FT                   /translation="MSAPRSYCRNALWIAAMVHRISGLGLAAFLPFHFLALGLSLQGAS
FT                   ELDGFLHWTDTPVVKIAEGGLVFLLAVHFLGGLRVLFVENFDWRVNQLRLASAAGATAA
FT                   VIAFAFLVRVL"
FT   gene            complement(407202..407531)
FT                   /locus_tag="Mnod_8672"
FT   CDS_pept        complement(407202..407531)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8672"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: jan:Jann_3967 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8672"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62738"
FT                   /db_xref="GOA:B8IWE8"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE8"
FT                   /inference="similar to AA sequence:KEGG:Jann_3967"
FT                   /protein_id="ACL62738.1"
FT                   /translation="MNVRLYVWQRGTAALMAPLVLIHMAVMFYATRHGLSASDILSRTR
FT                   GSIAWALFYGTFVAAAAIHAAIGLRGILTEWVPMQPRTASLAASAFGVLLVVLGARAVF
FT                   AVVFG"
FT   gene            complement(407528..408262)
FT                   /locus_tag="Mnod_8673"
FT   CDS_pept        complement(407528..408262)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8673"
FT                   /product="succinate dehydrogenase and fumarate reductase
FT                   iron-sulfur protein"
FT                   /EC_number="1.3.99.1"
FT                   /note="TIGRFAM: succinate dehydrogenase and fumarate
FT                   reductase iron-sulfur protein; KEGG: bpt:Bpet0399 fumarate
FT                   reductase iron-sulfur protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8673"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62739"
FT                   /db_xref="GOA:B8IWE9"
FT                   /db_xref="InterPro:IPR001041"
FT                   /db_xref="InterPro:IPR004489"
FT                   /db_xref="InterPro:IPR006058"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR012675"
FT                   /db_xref="InterPro:IPR025192"
FT                   /db_xref="InterPro:IPR036010"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWE9"
FT                   /inference="protein motif:TFAM:TIGR00384"
FT                   /protein_id="ACL62739.1"
FT                   /translation="MSHQESGSLSVSIWRGGHDGAFKTYTVPSRENQTVLDVVTHVQRH
FT                   IDPTLSYRFACRVGMCGSCGMTVNGRPRWTCRTHVSKVAKGGTLKIAPLSNLPIIKDLA
FT                   ADMRPFFEKWQKAGGVFEPSRTRWDPVEAIRPDEPERAAADAGIECINCGVCYAGCDTV
FT                   RWNNEYLGPAALNRAWTLMNDRRDSGQEPRLAAVAASGGCHACHSHQSCQEFCPQSLNP
FT                   TGSISLLKRMATKAYLRGELKS"
FT   gene            complement(408363..409283)
FT                   /locus_tag="Mnod_8674"
FT   CDS_pept        complement(408363..409283)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8674"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rsh:Rsph17029_3893 LysR family
FT                   transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8674"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62740"
FT                   /db_xref="GOA:B8IWF0"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF0"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62740.1"
FT                   /translation="MAIRELRTFLAVAEGGSFAAASRQVGRTQSAVTVQMKALEDEFGV
FT                   TLFDRSKRPPSLSAAGRAFLPHAIEAVAAYDRLFQVASDALVEGHLRLGVVPSVITGLM
FT                   PRALKDLRERYPALHVELAMGLSKDLVGRVQRGVLDAAVVSDFTLTDSGLRWSPYAREP
FT                   LILIAPTDMPGRKAEELLESQPFIRYSRQAWVGQLIDDFLKRRNFKVREIMALDTLEAI
FT                   RTMVHHGLGVSVVPQRAGEDPSELPVRTLRFSGTPAHRVVGVVQTEGHTKTALVNVLLD
FT                   VLKQEAGVVAQVRRRPRAGQGTALA"
FT   gene            complement(409572..409898)
FT                   /pseudo
FT                   /locus_tag="Mnod_8675"
FT   gene            410015..410926
FT                   /locus_tag="Mnod_8676"
FT   CDS_pept        410015..410926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8676"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rso:RSc1094 transcriptional
FT                   regulatory DNA-binding transcription regulator protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8676"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62741"
FT                   /db_xref="GOA:B8IWF1"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF1"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62741.1"
FT                   /translation="MSLRALRTLVAIAQCGSLGRAAEAVGLTQSAVSLHVRALEQEFRI
FT                   SLFDRSRRQLVLTDAGRTAVVRAREILALYDGIASELADGGELAGRLRIGAIQTALAGP
FT                   LPDAMATLRTAHPRLRIHVASGMSAELAGRLDMGEIDAAITTEPVKPHPAGLVAMRLYQ
FT                   EGFWVVAPPGATERDASRLLQEWPFIRFDRRVWAGRIIDQELRRMRLRVDGDVELDSRE
FT                   GILRMVAAGLGVAIVPLSEVARAALGPLTCLPFGDPQRHRWVVLLEREDRPAHRLACAL
FT                   AEAVRLAATDIGMPAPPADPEG"
FT   sig_peptide     410015..410089
FT                   /locus_tag="Mnod_8676"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.869) with cleavage site probability 0.608 at
FT                   residue 25"
FT   gene            411434..412723
FT                   /locus_tag="Mnod_8677"
FT   CDS_pept        411434..412723
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8677"
FT                   /product="oxidoreductase molybdopterin binding"
FT                   /note="PFAM: oxidoreductase molybdopterin binding; Mo-co
FT                   oxidoreductase dimerisation domain; KEGG: mrd:Mrad2831_5873
FT                   oxidoreductase molybdopterin binding"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8677"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62742"
FT                   /db_xref="GOA:B8IWF2"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="InterPro:IPR030835"
FT                   /db_xref="InterPro:IPR036374"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF2"
FT                   /inference="protein motif:PFAM:PF00174"
FT                   /protein_id="ACL62742.1"
FT                   /translation="MKDADRDDDLVSRTRRRFLGQGAALVGGALAGGAAAGTARAERTA
FT                   PVPNAPPNVPEWMKAPGADVGSELYGTPSRFEKEVVRNLARNLKQYTSASSRAPLQEFD
FT                   GIITPNGLFYERHHGGIPDIDPAQHRLMVHGLVEIPLLLTMNDIRRFPSESHIYFIECS
FT                   GNPGFEAMNGRTASDLVGLVSCAEWTGVRLKTVLEEAGLKPDARWVVAEGADAAALTRS
FT                   IPIEKCLDDALLVYSQNGERLRPQQGYPLRIVLPGFEGNMNVKWLRRLNVTAEPAYSRE
FT                   ETSKYTDSMPDGTARQFTFYMEAKSIITRPSGTHRIEKGFNEISGLAWSGHGRITQVEV
FT                   SVDDGRTWQAAQLQEPVLTRALTRFRFPWTWDGRPTVILSRATDETGYLQPSLAELTAV
FT                   RGMKSFYHNNAIIPWRITASGEVTNGFVKA"
FT   gene            412704..413261
FT                   /locus_tag="Mnod_8678"
FT   CDS_pept        412704..413261
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8678"
FT                   /product="cytochrome c class I"
FT                   /note="KEGG: mrd:Mrad2831_5874 cytochrome c class I"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8678"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62743"
FT                   /db_xref="GOA:B8IWF3"
FT                   /db_xref="InterPro:IPR009056"
FT                   /db_xref="InterPro:IPR036909"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF3"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5874"
FT                   /protein_id="ACL62743.1"
FT                   /translation="MVSSRHRLSACAAALVALVAAADAGERYGIGRPATQAEIAAWDID
FT                   IDRDGRKLPPGRGSVAHGREVFDTQCASCHGERGEGGIGDRLVGGQGSLASGKPVKTVG
FT                   SFWPYAPTLFDYIRRAMPLNAPQSLSDDDVYAVSAYILKLNGLVPDDAVLDPASLARIR
FT                   MPNRDGFVPDPRPDVHRSNASK"
FT   sig_peptide     412704..412772
FT                   /locus_tag="Mnod_8678"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.589 at
FT                   residue 23"
FT   gene            413499..414717
FT                   /pseudo
FT                   /locus_tag="Mnod_8679"
FT   gene            414785..415633
FT                   /locus_tag="Mnod_8680"
FT   CDS_pept        414785..415633
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8680"
FT                   /product="nitroreductase"
FT                   /note="PFAM: nitroreductase; KEGG: jan:Jann_3965
FT                   nitroreductase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8680"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62744"
FT                   /db_xref="GOA:B8IWF4"
FT                   /db_xref="InterPro:IPR000415"
FT                   /db_xref="InterPro:IPR016446"
FT                   /db_xref="InterPro:IPR029479"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF4"
FT                   /inference="protein motif:PFAM:PF00881"
FT                   /protein_id="ACL62744.1"
FT                   /translation="MSETSYSAARIAAVFRERFGDEVAADPGLNGLAEIHRIAAHHVHR
FT                   RYADRPVDPALVRLLCACALSAPSKSDLQQRDVVIVSDPDLRRRIAGLLPHMPWVGVAP
FT                   AFLVVCANGRRLPQISILRDKPFPNDHLDLFFNAVGDAAIALTTCLHAAEAVGLGGCPI
FT                   SEIRNHAAQVSAWLNLPERVIPFAGLCLGWPAGESRISPRLPLAMTLHESRYDEGDLAA
FT                   GIAAYDERREAILPYPEQRQTARWGVAEAYGWSEDKARQYAEPQRADFGAFVRRSGFNL
FT                   D"
FT   gene            416160..416615
FT                   /locus_tag="Mnod_8681"
FT   CDS_pept        416160..416615
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8681"
FT                   /product="thioesterase superfamily protein"
FT                   /note="PFAM: thioesterase superfamily protein; KEGG:
FT                   pgn:PGN_1271 probable thioesterase superfamily protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8681"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62745"
FT                   /db_xref="InterPro:IPR006683"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF5"
FT                   /inference="protein motif:PFAM:PF03061"
FT                   /protein_id="ACL62745.1"
FT                   /translation="MKAIQDHYPPNFAHCYGCGPANPFGHHLKSYLLDNHTEARFTPDQ
FT                   RYSGGVPDNVYGGMIASLLDCHGTASAAAFAYRARGRAMGDEGPPIRFVTASLHVNFRK
FT                   PTPLGEELLITCKLKSLEGKKALVLLSLSARGEECARGEMLAVELKS"
FT   gene            416676..417254
FT                   /locus_tag="Mnod_8682"
FT   CDS_pept        416676..417254
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8682"
FT                   /product="uncharacterized peroxidase-related enzyme"
FT                   /note="TIGRFAM: alkylhydroperoxidase-like protein, AhpD
FT                   family; uncharacterized peroxidase-related enzyme; PFAM:
FT                   Carboxymuconolactone decarboxylase; KEGG: azo:azo2506
FT                   4-carboxymuconolactone decarboxylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8682"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62746"
FT                   /db_xref="GOA:B8IWF6"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR004675"
FT                   /db_xref="InterPro:IPR010195"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF6"
FT                   /inference="protein motif:TFAM:TIGR01926"
FT                   /protein_id="ACL62746.1"
FT                   /translation="MNSRTNAPIGRYPVSTLSDMPADIRDRLLAVQEKSGFIPNVFLVF
FT                   AHRPDEFRAFFAYHDALMDKPSNLTKAEREMIVVATSNANQCQYCVVAHGAILRIRAKN
FT                   SLIADQIAVNYRKADITARQKAMLDFAMKVALEAYAVGEDDFSTLAQHGFDAEDAWDIA
FT                   AISSFFGMSNRMANVTSLRPNDEFYTLGR"
FT   gene            complement(417618..419753)
FT                   /locus_tag="Mnod_8683"
FT   CDS_pept        complement(417618..419753)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8683"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1352 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8683"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62747"
FT                   /db_xref="GOA:B8IWF7"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF7"
FT                   /inference="similar to AA sequence:KEGG:M446_1352"
FT                   /protein_id="ACL62747.1"
FT                   /translation="MQILRAALATGVGVIVLALGLLFVNYGVLSTPKATAYRDLDPSAP
FT                   ECRDGLTRGWTILAETGRPRLIGAAMVEDGGWRDASNDENAAVASDPSWSTRFRCALQR
FT                   HIVPAERPDSKPLDYTLGFLEFQEDGEPYALVSRSGDRDVPTTSEMLSQAMESQMSARG
FT                   ADATGIRPVITQLDALKHHLSTGSHYVLVFVHGWRHDARIGDSNVADLRLYAAHAARFL
FT                   QQRCPTDPKACETKVTGIYVGWRGARVDERGLRQLFGDTVGGFFGDVSAAATLFDRKPV
FT                   SEAIAPAAISALRSIESVLAARRPDGSERNNRLIVAGHSLGGNMLATGLKDDVLKAVHR
FT                   HRFGEVLPPVLGNLVVLINPASEASKWTAIQRAVWQRIALHADEHTPAADLARDTGFFP
FT                   PEQRPVVMSLTAALAFPAGGLRPGDCAWIGLEVDDGFQAARRRIRKRLANTDTMFNSGV
FT                   DYDWATHDLFPTFKLDFRPAAGYLDRVAARFEGRQPRGMSCEPPRSARTFDALLTLPLR
FT                   ALSVLAETFPFQVSLREESHTIGNLDPPRPAAGVLADAQPSAAPFGTTHELLGLHDAGV
FT                   ERHHPYATLADAAIDCPRADRWLSRARARQQGRYGAFWDSEDLAPVDAADPGLGRPAAR
FT                   FLHGLNLTGIAPITLANDPFWNVRAFDNALSRHDGYRLSSFICAMNQLVLDDITESAPR
FT                   MIDTMGVPDQQDFDARP"
FT   gene            complement(420422..420853)
FT                   /locus_tag="Mnod_8684"
FT   CDS_pept        complement(420422..420853)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8684"
FT                   /product="3-demethylubiquinone-9 3-methyltransferase"
FT                   /note="PFAM: 3-demethylubiquinone-9 3-methyltransferase;
FT                   KEGG: met:M446_3648 3-demethylubiquinone-9
FT                   3-methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8684"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62748"
FT                   /db_xref="GOA:B8IWF8"
FT                   /db_xref="InterPro:IPR009725"
FT                   /db_xref="InterPro:IPR028973"
FT                   /db_xref="InterPro:IPR029068"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF8"
FT                   /inference="protein motif:PFAM:PF06983"
FT                   /protein_id="ACL62748.1"
FT                   /translation="MVAKNTICLWYDKDAEAAARFYVETFPESAMGAVHRAPADYPSGK
FT                   AGDVLTVEFTVAGIPCIGLNGGPVFQHNEAFSFQIATDDQAETDRLWNAIVGNGGQESA
FT                   CGWCKDRWGISWQITPRVLTAAMAAGGEAARRRNAPSRP"
FT   gene            421356..421589
FT                   /locus_tag="Mnod_8685"
FT   CDS_pept        421356..421589
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8685"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6870 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8685"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62749"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWF9"
FT                   /inference="similar to AA sequence:KEGG:M446_6870"
FT                   /protein_id="ACL62749.1"
FT                   /translation="MKVTADIDCTPEEARVFLGFPDVQPLQAAVMAHMEKRMLAEFARF
FT                   SPDRLMKTWMSLFGQNPPARASGARRDVPKGS"
FT   gene            complement(421839..422903)
FT                   /locus_tag="Mnod_8686"
FT   CDS_pept        complement(421839..422903)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8686"
FT                   /product="phytanoyl-CoA dioxygenase"
FT                   /note="KEGG: met:M446_0322 phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8686"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62750"
FT                   /db_xref="GOA:B8IWG0"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG0"
FT                   /inference="similar to AA sequence:KEGG:M446_0322"
FT                   /protein_id="ACL62750.1"
FT                   /translation="MSFTRTAARAAGTLASIARVPIWLAGVAGADKSFSKNPILGNPTL
FT                   NRLGLHVARVQLAGRMAERRRARLGALIDPADRAAFDRDGIVIKRDFLDPEAFRALKEE
FT                   VFGRSFPARELRQGQAVQRMVPLGRDNLPGLPQLAALTRNPTLRGLTYYAASRAGEPVY
FT                   YLQTVVAEPDGPNDPQTALHADTFHATTKGWFFLHDVAEEDGPFVYVPGSHCATPERLA
FT                   WEREQSIAARSAANSHHAAGSFRIREEELGALGYGKPVRVAVPANTLVIADTFGFHARA
FT                   PSLRASTRVTVHTYIRRNPFLPWTGLDPKALPGLRGRELSLYLGFQDLKRRLTGHGASW
FT                   RRVGPVAIDAPAQI"
FT   gene            complement(422934..423974)
FT                   /locus_tag="Mnod_8687"
FT   CDS_pept        complement(422934..423974)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8687"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: met:M446_0015
FT                   phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8687"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62751"
FT                   /db_xref="GOA:B8IWG1"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG1"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACL62751.1"
FT                   /translation="MITMLSRVLLAPIHAAQILTGAKSFRTNPILGSARLNRRGLHVWR
FT                   VNTASALTEWRRRRLEHLVSAEDRRQLDEQGYVETRDFLSPEHFAELVREVTSVALPAK
FT                   QFREGNAITRRVPLTPANLRHLPACRRLLALPEFQGRLRYVASFDVEPEVYIQTIFSQL
FT                   DGPAADPQLDLHMDTFHPTMKAWLFLHDVPADEGPFTYVRGSASRTKRRLAWERRRSIE
FT                   ACDPAKAVGGAFRIRPDELPRLGLSEPTQFAVPGNTLVVGDTCGFHARGATVRPGIRIE
FT                   IYAANRRNPFLPFVGLDLWSAPLLKRRKIALFWAALALWERLGLGRSQWRNGGQVRAGD
FT                   PVLSEP"
FT   gene            complement(424114..425094)
FT                   /locus_tag="Mnod_8688"
FT   CDS_pept        complement(424114..425094)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8688"
FT                   /product="Phytanoyl-CoA dioxygenase"
FT                   /note="PFAM: Phytanoyl-CoA dioxygenase; KEGG: swi:Swit_3963
FT                   phytanoyl-CoA dioxygenase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8688"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62752"
FT                   /db_xref="GOA:B8IWG2"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG2"
FT                   /inference="protein motif:PFAM:PF05721"
FT                   /protein_id="ACL62752.1"
FT                   /translation="MRSLVHVATAPLWPLQLATAAKSFEHNPLIGSRQLNRWGLHAKRV
FT                   ELAARLAAARRARLASRVSGEDRAAFDRDGFVIKRRFLPDDAFARLRDEVQAYRGPIRE
FT                   KAEGRTVLRKVTIGSKLLDQLPSLKQVCGSETWQGLIRYVGSRDSEPSMFLQAVLQQAS
FT                   DGEDDPQTVLHADTFHPTVKAWLFLTDVEEDSGPFTYVRGSHRLTPQRLEWERRMSLTA
FT                   VSSADFETRQGSFRISEAELEDLGFQMPIPIAVPANTLVVADTFGFHARGRSARPSTRV
FT                   EVWGIGQRNPFLPWTSLDRAVGALSSIGRTGNDWEVRTGISIFDE"
FT   gene            425455..426762
FT                   /locus_tag="Mnod_8689"
FT   CDS_pept        425455..426762
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8689"
FT                   /product="glycosyl transferase group 1"
FT                   /note="PFAM: glycosyl transferase group 1; KEGG:
FT                   met:M446_5069 glycosyl transferase group 1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8689"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62753"
FT                   /db_xref="GOA:B8IC11"
FT                   /db_xref="InterPro:IPR001296"
FT                   /db_xref="UniProtKB/TrEMBL:B8IC11"
FT                   /inference="protein motif:PFAM:PF00534"
FT                   /protein_id="ACL62753.1"
FT                   /translation="MGRPGFLLDQSCMTDRPVVLDITRLVLRLAHASPTGIDRVDLAYA
FT                   RHYLGQEAPRFGLITTPFGPKLLDRGEASAIVEAVASGWVEGSTAEADPVYRALALRLG
FT                   TSVAPAPLAPPPPRRRRIQAAIRWRVARAPGIGGLPRGALYLHTSHLRLDRPRRFDWLY
FT                   ERCDVRPVFFVHDIIPIEYPEYGGDGEAVRHAVRMRTVSRHAAAVVVNSADVGSRFSAY
FT                   LAARRLHVPPVTIGPLGIEPAFSDRTGPALTPDRPTFIACGTIQPVKNHYGLLTLWREL
FT                   DARHGPRTPRLVIAGRRGWKSRNVIDLLDRCPAVRRHVVEVAGLSTAGLVRLMRGATAL
FT                   LMPSFAEGYGLPMVEAAAAGLPVVASDIPVHREVAEAFAAFIHPLDGLGWMRVVEELMA
FT                   THSPLRRTLAERLVGVAPPTWDDHFARVDPMLADLA"
FT   gene            427241..427714
FT                   /locus_tag="Mnod_8690"
FT   CDS_pept        427241..427714
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8690"
FT                   /product="putative integrase"
FT                   /note="KEGG: bxe:Bxe_C0793 putative integrase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8690"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62754"
FT                   /db_xref="InterPro:IPR009061"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG4"
FT                   /inference="similar to AA sequence:KEGG:Bxe_C0793"
FT                   /protein_id="ACL62754.1"
FT                   /translation="MLAIHPNARTTPAVRAEIARSPEPSGVLAQRFGVSTETIRKWRKR
FT                   GPADCQDRSARPHKLPWKASAAERAVVCALRRATGFPLDDLTFIVSHFLPHLNRDAVYR
FT                   ILKAAGLNRLTPADRTRKPHSAFKEDEVGFVHLDVKHLPKLQDRDGITRKRSL"
FT   gene            427742..428228
FT                   /pseudo
FT                   /locus_tag="Mnod_8691"
FT   gene            complement(428382..429404)
FT                   /locus_tag="Mnod_8692"
FT   CDS_pept        complement(428382..429404)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8692"
FT                   /product="Lytic transglycosylase catalytic"
FT                   /note="PFAM: Sporulation domain protein; Lytic
FT                   transglycosylase catalytic; KEGG: met:M446_5561 lytic
FT                   transglycosylase catalytic"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8692"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62755"
FT                   /db_xref="GOA:B8IWG5"
FT                   /db_xref="InterPro:IPR007730"
FT                   /db_xref="InterPro:IPR008258"
FT                   /db_xref="InterPro:IPR023346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG5"
FT                   /inference="protein motif:PFAM:PF01464"
FT                   /protein_id="ACL62755.1"
FT                   /translation="MTEKLARTLLTSVVGASLVAPAAQTAPGTAATETVEQALCRIVES
FT                   SARAQGLPVSFLTRLIWRESSFRVGAVSAAGAQGVAQFMPGTARERGLADPFDPEQAIP
FT                   HAAHLLADLRKRFGNLGLAAAAYNGGPARVASWIAGSGSLPAETRAYVYAVTGRPAEEW
FT                   RPATAGQRQAAVTEGRSSAFTGKGGREDAASEPAEAHTAKPAAGPAGHMAAYQRAEAAP
FT                   NCLQVTAALRLPSRLERPTPPVIDRVIVPPAPPPWGPWGVQLAGNFSKAQALESFARAR
FT                   STYAQVIGQARPMIIGTRLLNRGSGAFYRVRIPAQNREQADALCTKIRVAGGACVVLKT
FT                   "
FT   sig_peptide     complement(429327..429404)
FT                   /locus_tag="Mnod_8692"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.999) with cleavage site probability 0.891 at
FT                   residue 26"
FT   gene            complement(429541..429632)
FT                   /pseudo
FT                   /locus_tag="Mnod_8693"
FT   gene            complement(429695..430054)
FT                   /locus_tag="Mnod_8694"
FT   CDS_pept        complement(429695..430054)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8694"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8694"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62756"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62756.1"
FT                   /translation="MNAGAFAFATGPSKPVSHRQTILARRTHSVVVSRPEPPRQVALVR
FT                   RTHPVVASRPVPPRWAVLTRRTYAIGGIDDVDPWTIRLHPWAGDIDCSSPKTVDVRRGL
FT                   CPFMSARNPDLGDDE"
FT   gene            430107..430860
FT                   /pseudo
FT                   /locus_tag="Mnod_8695"
FT   gene            431316..432263
FT                   /locus_tag="Mnod_8696"
FT   CDS_pept        431316..432263
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8696"
FT                   /product="transposase IS116/IS110/IS902 family protein"
FT                   /note="PFAM: transposase IS111A/IS1328/IS1533; transposase
FT                   IS116/IS110/IS902 family protein; KEGG: hne:HNE_3446
FT                   ISHne3, transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8696"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62757"
FT                   /db_xref="GOA:B8IFU8"
FT                   /db_xref="InterPro:IPR002525"
FT                   /db_xref="InterPro:IPR003346"
FT                   /db_xref="UniProtKB/TrEMBL:B8IFU8"
FT                   /inference="protein motif:PFAM:PF02371"
FT                   /protein_id="ACL62757.1"
FT                   /translation="MDEHRTIFVGIDVSKDRLDVHLRPSDEALHVPRDAKGLDTLARRL
FT                   GRLPVALVVLEATGGFEASVAAALAAVGLPLCIVNPRQIRDFARAMGRLAKTDTLDAEV
FT                   IALFAERIRPPARPLPEPERSHFAELVSRRRQIIGMIGMETNRRDQAVDKQLIRRVDRH
FT                   IAFLERELVELDRDIDRAIKASPVWCETEALLKSVPGIGDVTARTLLAQLPELGTIGRH
FT                   QLAALVGIAPINRDSGLMRGRRSIAGGRTSVRGVLYMAALTAIRRGSPFRPFYERLTQR
FT                   GRPRKVALVAVMRKLLVTLNAIVRERTPWRPLAA"
FT   gene            complement(432516..432755)
FT                   /locus_tag="Mnod_8697"
FT   CDS_pept        complement(432516..432755)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8697"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8697"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62758"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62758.1"
FT                   /translation="MLAVKIWKDGQKPPDPGNAVMVVEHDYQGFTPRYEVILTKDGTVH
FT                   TGIVFKTIIEDAVEAAGEDAERPGIDTTVYLKPI"
FT   gene            432978..433211
FT                   /locus_tag="Mnod_8698"
FT   CDS_pept        432978..433211
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8698"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8698"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62759"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWG9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62759.1"
FT                   /translation="MGCDNPRALSQRRGRPGGCNGSARGLWAPVTRGGAPKELAEALHR
FT                   LPRAERDAVNRTVGELEVAAYERAFDRIGTAA"
FT   gene            433855..434055
FT                   /locus_tag="Mnod_8699"
FT   CDS_pept        433855..434055
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8699"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_5910 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8699"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62760"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH0"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_5910"
FT                   /protein_id="ACL62760.1"
FT                   /translation="MADPLSQARVKKLREARKALGERETNVWVPAHIQAAIDRAVEAGQ
FT                   FPNRRLAIIHALEQTFAERDM"
FT   gene            434243..435388
FT                   /locus_tag="Mnod_8700"
FT   CDS_pept        434243..435388
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8700"
FT                   /product="replication protein C"
FT                   /note="PFAM: replication protein C; KEGG: mrd:Mrad2831_5911
FT                   replication protein C"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8700"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62761"
FT                   /db_xref="InterPro:IPR005090"
FT                   /db_xref="InterPro:IPR021760"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH1"
FT                   /inference="protein motif:PFAM:PF03428"
FT                   /protein_id="ACL62761.1"
FT                   /translation="MVQTGSRPLTRAALAGRRRALDDGRTVTRRELSASAREAAKALSL
FT                   RPALRLVLSELVAAWGEQAWSRLIVWPSNEYLVSRTGLSERAVRYALRDLVALELMTPK
FT                   DSANGKRYAIRAPDGAIVDAFGFDLTPLYARRGEWATAIKARAEELERRRRAFDLLTIH
FT                   QRAVAEALRALASRYPETPIADLAEVRASLEASSPSRRGSGDPTFVLEAWVELRQMVEE
FT                   RFYAAGNDGKPCRHNETNNGSPSESWSKSSPGTVGAVRYIERPTVGLQPSLVMEACPVV
FT                   RDLVSGEIREEHDILDAGRQLRASIGAHQSAWVEACKALGPHQAALLVLIVAQLHDDDV
FT                   SSGQNRIRNPGGYFRRLVRLAAEDRYSPEAELLAMRRRRLT"
FT   gene            435822..436135
FT                   /pseudo
FT                   /locus_tag="Mnod_8701"
FT   gene            436306..437016
FT                   /locus_tag="Mnod_8702"
FT   CDS_pept        436306..437016
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8702"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: fre:Franean1_0729 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8702"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62762"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62762.1"
FT                   /translation="MVRRPPRRDRRARDDDHPGRPGRGRSRDRRPFRPDRRGEGSTGST
FT                   AAEGHLQALGVVAAGADRNGDPAGGRHLAALVRWAKAGRWCGPSQPSAAAAEVFAALTE
FT                   YGHGPPAVARSLGAILRPGKPRPWCVTVSPAPARTSRASAPTLDQPHLPRHHARSCPAG
FT                   SRLDGRRRRTQPVTPQRSRAAPVRPRAHGGQARPLYQARGLHRDRWCRHPRAVRRCGPG
FT                   APGRPATCCGSRWR"
FT   gene            438396..439607
FT                   /locus_tag="Mnod_8703"
FT   CDS_pept        438396..439607
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8703"
FT                   /product="plasmid partitioning protein RepA"
FT                   /note="TIGRFAM: plasmid partitioning protein RepA; PFAM:
FT                   regulatory protein MerR; Cobyrinic acid ac-diamide
FT                   synthase; KEGG: ret:RHE_PF00571 plasmid partitioning
FT                   protein RepAf1"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8703"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62763"
FT                   /db_xref="InterPro:IPR017818"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH3"
FT                   /inference="protein motif:TFAM:TIGR03453"
FT                   /protein_id="ACL62763.1"
FT                   /translation="MDMSVPARDGEAFSFHETILQQGELISDKLNMLRLEHYPPNAMKG
FT                   LRPFSLAEVAYFLGVTQSNVKKLHLEGKGPTPATSPSGRRSYTAAQMLELRHYLDRHGR
FT                   AEVKQYVPHRRPGEKIQVVSVINFKGGSGKTTTAAHLAQHLALTGHRVLAIDLDPQASL
FT                   SALHGIQPELDKVPSIYDALRYDTARKPISEVIQPTNFPGLDVIPANLELQEYEYDTPL
FT                   EASNNNPEGKLFFTRITNALKEVDERYDVVVIDCPPQLGYLTLTALTASTSVIITIHPQ
FT                   MLDVMSMAQFLLMLGGILKSITDAGAAVNLKWFRYLVTRYEPTDGPQAQMVGFMHVLFP
FT                   KQMLKNQMLKSTAISDAGITNQSLYEVERGQMIRSTYDRALESMNAVNEEITSLIHQTW
FT                   GRRV"
FT   gene            439662..440600
FT                   /locus_tag="Mnod_8704"
FT   CDS_pept        439662..440600
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8704"
FT                   /product="plasmid partitioning protein RepB"
FT                   /note="TIGRFAM: parB-like partition protein; plasmid
FT                   partitioning protein RepB; PFAM: ParB domain protein
FT                   nuclease; RepB plasmid partition; KEGG: rle:pRL90002
FT                   putative replication protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8704"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62764"
FT                   /db_xref="GOA:B8IWH4"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR011111"
FT                   /db_xref="InterPro:IPR017819"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR037972"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH4"
FT                   /inference="protein motif:TFAM:TIGR03454"
FT                   /protein_id="ACL62764.1"
FT                   /translation="MRKNLLANVLDTPSEPRTDYARRGASRSMRMSIDEMAENAKRMID
FT                   GEVIVSLDPSLIDASFVSDRLTDDEVEFAQLKAAIEAHGQATPILVRPIENGRYMVVFG
FT                   HRRLRAARELGRPVKAVVRQLEEIAHILAQGQENTARANLSFIEKALFAQKLLAMGQSK
FT                   ATIKSALTLDDTLLSRMLSVVETIPPPVLEAIGAARTVGRDRWEELKKLLAHPAKAALA
FT                   AEVIQSDVFLSKEGAERFTHLCAQVKSGRRAARKPAEPERWSGEGIQARFRKSGKTFSL
FT                   SLSSADAGEFGAYLAAQLGQLYDAFKKEKAR"
FT   gene            440887..441352
FT                   /pseudo
FT                   /locus_tag="Mnod_8705"
FT   gene            441471..441926
FT                   /pseudo
FT                   /locus_tag="Mnod_8706"
FT   gene            complement(442173..442781)
FT                   /locus_tag="Mnod_8707"
FT   CDS_pept        complement(442173..442781)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8707"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: hypothetical protein; K03138 transcription
FT                   initiation factor TFIIF alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8707"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62765"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62765.1"
FT                   /translation="MSRPTRSGTPRPSSGSSSAPASTGPGHPGPCRAVLVLPPHRAGRP
FT                   LRARRRDRGRRPRRSAHPAAPDHRHGDRCGPGRSRGFCTGPGAQHRSRPDHRHARPLLR
FT                   QRPPSPTTGACSSQRPSSISGGRCAAWCDRVSRADGHVRDTGVRAGLEACRLCVQVRDA
FT                   GRSPETFLESTLKDCRFGLVIQPFDPCSTAGDPASETSS"
FT   gene            complement(442889..443488)
FT                   /pseudo
FT                   /locus_tag="Mnod_8708"
FT   gene            443494..444135
FT                   /locus_tag="Mnod_8709"
FT   CDS_pept        443494..444135
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8709"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: nmu:Nmul_A1277 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8709"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62766"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62766.1"
FT                   /translation="MSSRTPRPGAAHPDHCAPGLGSRLSFATPSVRSSPDYCSFIDTDV
FT                   AYSSLPATFRSYLETTLGLSSTFPTSIFAATQTNSVTVTASAGAQLTGINFTDGAGGAL
FT                   TGDPATDDSGLDTVDGKSILLVADGADTVIGKYGSDDNGSLDAIAFVIRKTDVFNTDKT
FT                   SDQVTFHLVTYVPIFHGHSADPDGHRGLRVQFRRRRPNDVLGHEFRFRRL"
FT   gene            444424..444750
FT                   /locus_tag="Mnod_8710"
FT   CDS_pept        444424..444750
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8710"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_3363 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8710"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62767"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH7"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62767.1"
FT                   /translation="MLKVGTADLWGVNMSEFLPSRVEEPMSNHLFARSDRAIEEARRLC
FT                   ENTLRIRALAQQTTLASCAIREEVEAYRQEVVTDWLARRRLQALAPMPDTIIRPRAREA
FT                   LRGA"
FT   gene            complement(444872..445411)
FT                   /locus_tag="Mnod_8711"
FT   CDS_pept        complement(444872..445411)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8711"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: rsq:Rsph17025_3315 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8711"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62768"
FT                   /db_xref="GOA:B8IWH8"
FT                   /db_xref="InterPro:IPR018719"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH8"
FT                   /inference="similar to AA sequence:KEGG:Rsph17025_3315"
FT                   /protein_id="ACL62768.1"
FT                   /translation="MDGSGSRHSRGPTAAAILFGLGLGGFFDGSVRHQILHGPHMLTSA
FT                   GYPADRVGNLKANTLGDGLFHASTSLVTWAGLFILWRDARQNHIRWSGLLLPGGILMGF
FT                   GIFNLVEGTVDHHLRGPHQVNQTVPRETWIYWDGGFLLWGAAMLIGGWAMLRQGQASTR
FT                   AKAASKPLWTAKITSD"
FT   gene            445868..446260
FT                   /locus_tag="Mnod_8712"
FT   CDS_pept        445868..446260
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8712"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5550 putative PAS/PAC sensor protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8712"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62769"
FT                   /db_xref="InterPro:IPR000014"
FT                   /db_xref="InterPro:IPR035965"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWH9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62769.1"
FT                   /translation="MEFSRFTDIVQIASADAVVAAGQDSIIRLENPGAVGIFGYSEAEV
FT                   VGHSLDIVTLERPGVSRRESFHLTMTTRESRYGEGAHLPVPDLCKGRRQISLEVRTTSK
FT                   PPWGLLGGTGRNCTGRPATLSAESTR"
FT   gene            446257..447534
FT                   /locus_tag="Mnod_8713"
FT   CDS_pept        446257..447534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8713"
FT                   /product="formyl-CoA transferase"
FT                   /note="TIGRFAM: formyl-CoA transferase; PFAM: L-carnitine
FT                   dehydratase/bile acid-inducible protein F; KEGG:
FT                   met:M446_2571 formyl-CoA transferase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8713"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62770"
FT                   /db_xref="GOA:B8IWI0"
FT                   /db_xref="InterPro:IPR003673"
FT                   /db_xref="InterPro:IPR017659"
FT                   /db_xref="InterPro:IPR023606"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI0"
FT                   /inference="protein motif:TFAM:TIGR03253"
FT                   /protein_id="ACL62770.1"
FT                   /translation="MTKALEGVRILDFTHVQSGPTCTQLLAWFGADVIKIERPGVGDIT
FT                   RTQLQDVPDADSLYFTMLNSNKRSITLDTKNRTGMEVLEDLVRACDVLVENFAPGALAR
FT                   MGLTWERIQTLNPRMIVASVKGFGPGPYEECKVYENVAQCAGGAASTTGFRDGLPLVTG
FT                   AQIGDSGTGLHLALGIVTALYQRTRTGRGQRVDCAMQDGVLNLCRVKLRDQQRLAHGPL
FT                   KEYSQYGEGIPFGDAVPRAGNDSGGGQPGRILKCKGWETDPNAYLYFITQAPVWEKICD
FT                   VIGEPDWKTHPDYAKPAARLPRLNQIFDRIEHWTMTKTKFEAMEILNRYDIPCGPILSM
FT                   KELAEEPSLRATGTVVEVEHPVRGPYLTVGNPIKLSDSPTEVKRSPLLGEHTDEVLRDV
FT                   LKYTDKEIVEISSSGAIGVVRMAAAE"
FT   gene            447703..449871
FT                   /locus_tag="Mnod_8714"
FT   CDS_pept        447703..449871
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8714"
FT                   /product="CoA-binding domain protein"
FT                   /note="PFAM: CoA-binding domain protein; KEGG:
FT                   met:M446_1525 CoA-binding domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8714"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62771"
FT                   /db_xref="GOA:B8IWI1"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI1"
FT                   /inference="protein motif:PFAM:PF02629"
FT                   /protein_id="ACL62771.1"
FT                   /translation="MALVARKHPTPHVYANGHAEVRAILDRVKAESRDSLTAPEGRLVC
FT                   DAYGIPVPKEAVATSAEAAVQAAEEMGFPVVLKIVSPDILHKTEAGGVIVGVSSAQAVA
FT                   DGYKTILANAKRYKADARIDGVQIQQMLKGGTEVIIGAVTDGSFGKLVAFGLGGILVEA
FT                   LKDITFRLAPATREDALSMLDGIQAAEMLKGVRGSEPVDRAALVDVIVKVSQLVTDFPE
FT                   ISELDLNPVFASARGATAADVRIVMDFSEKPKSQTRSQDEIVAGMNRIMRPETVAVIGA
FT                   SAEDGKIGNSVMKNLISGGYKGTIYPIHPKADTILGLKAYRSVRDVPGPIDVAVFAIPA
FT                   QFVAAALTECGEKGVAGAVLIPSGFAETGNEAGQQEIQEIGRRYNIRLMGPNIYGFYYM
FT                   AKNLCATFCTPFDVQGQAALSSQSGGIGMAIIGFSRSTKMGVSAIVGLGNKSDIDEDDL
FT                   LAFFEQDDSTKVIAQHCEDLKDGRSFAEVARRVSKKKPVIVLKAGRTSAGAKAASSHTG
FT                   ALAGNDKIYEDVFKQCGVIRARSLRQLLEFARGVPVLPTPKGENVVIITGAGGSGVLLS
FT                   DAVVDNGLSLMTMPEDLDAAFRKFIPPFGAAGNPVDITGGEPPVTYKNTIRLGLEDERI
FT                   HALILGYWHTIITPPMVFAKNVVDVRDEMRAKGIEKPIVASLAGDVQVEEASQYLYDHG
FT                   IPSYPYSTELPVEVLGAKYRWARGAGLL"
FT   gene            450025..450793
FT                   /pseudo
FT                   /locus_tag="Mnod_8715"
FT   gene            450817..451029
FT                   /locus_tag="Mnod_8716"
FT   CDS_pept        450817..451029
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8716"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_0730 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8716"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62772"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI2"
FT                   /inference="similar to AA sequence:KEGG:M446_0730"
FT                   /protein_id="ACL62772.1"
FT                   /translation="MQKLVYNIREGRKGWDVYVSHTGKPVVLNGRPQTGLPLETAARLA
FT                   ASLEIMDFLHAESARWVITDRPIIH"
FT   gene            complement(451339..453840)
FT                   /locus_tag="Mnod_8717"
FT   CDS_pept        complement(451339..453840)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8717"
FT                   /product="D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase"
FT                   /EC_number="4.1.2.9"
FT                   /note="PFAM: D-xylulose 5-phosphate/D-fructose 6-phosphate
FT                   phosphoketolase; KEGG: met:M446_3572 phosphoketolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8717"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62773"
FT                   /db_xref="GOA:B8IWI3"
FT                   /db_xref="InterPro:IPR005593"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR018969"
FT                   /db_xref="InterPro:IPR018970"
FT                   /db_xref="InterPro:IPR019789"
FT                   /db_xref="InterPro:IPR019790"
FT                   /db_xref="InterPro:IPR023962"
FT                   /db_xref="InterPro:IPR029061"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI3"
FT                   /inference="protein motif:PFAM:PF03894"
FT                   /protein_id="ACL62773.1"
FT                   /translation="MTVLTGSPRNDAHPAQPDARDDFVPGPLGPQELVGLDAYWRAANY
FT                   LSVGQIYLLDNPLLREPLAPAHVKPRLLGHWGTTPGLNFIYAHLNRVIRRRDLDMIAVW
FT                   GPGHGAPGLVANAYLEGTYSEVYPDVAPDAEGMRRLFRQFSFPGGIPSHASPELPGSIH
FT                   EGGELGYSLAHAFGAALDNPDLIVACVVGDGEAETGALAASWHSAKFLDPRTDGTVLPI
FT                   LHLNGYKIANPTILARMPGAELTSLLVGYGYDPIVVAGEETAPMHQAMAAALDRALDRI
FT                   AQIRREAGCERPRWPMIVLRSPKGWTGPKVVGGLPVEGTWRSHQVPVAAMRDNPEHLAI
FT                   LERWMRSYHPETLFDAAGRLMPDLAALAPAGERRLSANPQANGGRHAQPLRRPPIAAHA
FT                   VAVEAPGAATAEATRVLGAYLRDVVTLNAASRNFRIMGPDETASNRLDAVLSVTNRVWQ
FT                   EEILPGDDHLARSGRVMEILSEQLCEGWLEGYLLTGRHGLFASYEAFIHVVDSMVSQHA
FT                   KWLKSSRALPWRRPVPSLNLLLSSHVWRQDHNGFSHQDPGFIDFIANKRGDTARVYLPP
FT                   DANCLLWVMNHCLGTHDRINVVVAGKQPAPQWLALDAALRHCEAGIGVWDWASSEGEGE
FT                   PDVVMACAGDVPTMETLAAVDWLRRVVPDLRVRVVNVVDLMTLPSPDLHPHGLDDATFD
FT                   GLFTRDRPVVFAYHGYPWLIHRLTYRRTNHANLHVHGFMEEGTTTTPFDMAVMNRLDRH
FT                   HLAIAALRRVPRLGARADRAERMLQERLAVHRAHVCRTGEDLPEIRDWRWPQPGMVKPD
FT                   EAGARATMGRTGGSTKPAGSP"
FT   gene            complement(453950..454792)
FT                   /locus_tag="Mnod_8718"
FT   CDS_pept        complement(453950..454792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8718"
FT                   /product="UspA domain protein"
FT                   /note="PFAM: UspA domain protein; KEGG: met:M446_3571 UspA
FT                   domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8718"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62774"
FT                   /db_xref="InterPro:IPR006016"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI4"
FT                   /inference="protein motif:PFAM:PF00582"
FT                   /protein_id="ACL62774.1"
FT                   /translation="MIASIKSVLIGVTEAIGTQEPSAALAYGFSLALQAEAHVTVHAMT
FT                   VDIVVPNAWISGFAASLVAAENRRLRSLAAAAAERARADASAAGLRCTTRARHLTANEL
FT                   FGSLAAQARIHDVTVLDAEPNFVAARRGLIEDLILYCGRPLLVVPPAAEAFTAERIVVA
FT                   WDGSAPAARAVGDALPFLRGAREVHVVTVTGEKDLSETVPGAELGPYLARHGVPVTVVD
FT                   LPMEEGSVAETLRRHAILSRADLMVAGGFVHARLREMVLGGVTEALLTACPVPLLLSH"
FT   gene            455109..457517
FT                   /locus_tag="Mnod_8719"
FT   CDS_pept        455109..457517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8719"
FT                   /product="heavy metal translocating P-type ATPase"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; cadmium-translocating P-type
FT                   ATPase; heavy metal translocating P-type ATPase; PFAM:
FT                   Haloacid dehalogenase domain protein hydrolase; E1-E2
FT                   ATPase-associated domain protein; Hemerythrin HHE cation
FT                   binding domain protein; KEGG: bph:Bphy_6248 heavy metal
FT                   translocating P-type ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8719"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62775"
FT                   /db_xref="GOA:B8IWI5"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR012312"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR027256"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI5"
FT                   /inference="protein motif:TFAM:TIGR01525"
FT                   /protein_id="ACL62775.1"
FT                   /translation="MPLDLRLEEVMRGRSGIIRQAEPTPVMAEHKRILDLALLAFALAG
FT                   LAAGLVARGLHQDDWAAWLFLAGTVPVLVAVLADSAASLLRREVGLDIIALVSIGGALL
FT                   LHEYVAAAVIGLMLSGGRALEDFADARARREMSALLARVPRTANLYEAEQLKAVPLESV
FT                   RAGDRLLVRAGETVPVDGIVSGGTAVLDEAALTGESLPVTRARSERLRSGSINAGAPFD
FT                   MAATSSAADSTFAGIVRLVQAAQEAKAPSARLADRAAFVFTPLAIALAGAAWAWSGDPV
FT                   RGLAVLVVATPCPLILAVPVAIVSGLSRCAGRGVLVKGGGALEQLARLRTLYLDKTGTL
FT                   TGGQARVVAVETETGVASDEVLRVAASLDQLSQHVIAEAVVAAARRRGLELCLPTNVEE
FT                   EPGAGLTGNLEGRCVSVGSYAYVSARAGQSDWSGRFLRRMGYEGATGVFVAAEGRMLGA
FT                   ILLADEIRADSARALRLLRRAGIGRVVMLTGDRHDAAERIGSALGVDEVRAEQQPQDKL
FT                   AAIAEAKTQGICAMVGDGVNDAPALAAADIGIAMGARGSGASSEAASVVLLVDRLDRLA
FT                   DALAIAQGARRIALRSVWIGMGLSIAAMVVAALGLLPPVAGALLQEAIDVAAIFNALRV
FT                   LRVRIPGRPQVSLPLAEVTRLKEEHERLIGPLARLRAVADQLATLPPDEAAVALREVEN
FT                   LVRERLLRHEREDDLQLYPRIERALGGDDPIAAMHRTHREVQELGSVLTRMVGELPPEG
FT                   IDLPALNDFRRVLYGLDAILRLHFAQEDELYHGLASTEAVRPESQAAPA"
FT   gene            457649..460531
FT                   /locus_tag="Mnod_8720"
FT   CDS_pept        457649..460531
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8720"
FT                   /product="ATPase, P-type (transporting), HAD superfamily,
FT                   subfamily IC"
FT                   /note="TIGRFAM: ATPase, P-type (transporting), HAD
FT                   superfamily, subfamily IC; PFAM: cation transporting ATPase
FT                   domain protein; Haloacid dehalogenase domain protein
FT                   hydrolase; E1-E2 ATPase-associated domain protein; KEGG:
FT                   mma:MM_1461 cation-transporting ATPase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8720"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62776"
FT                   /db_xref="GOA:B8IWI6"
FT                   /db_xref="InterPro:IPR001757"
FT                   /db_xref="InterPro:IPR004014"
FT                   /db_xref="InterPro:IPR006068"
FT                   /db_xref="InterPro:IPR008250"
FT                   /db_xref="InterPro:IPR018303"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR023298"
FT                   /db_xref="InterPro:IPR023299"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI6"
FT                   /inference="protein motif:TFAM:TIGR01494"
FT                   /protein_id="ACL62776.1"
FT                   /translation="MTEIWSPEARTEYLEQQPAEPYRLGTEEVLTVLCVDKGAGLSRRE
FT                   ARSRLERCGKNELRAEEPVPAWRKFLAQFTDVLVVLLLVAAVVSAGLWLYERDAALPYE
FT                   AIAIFAIVLLNAVMGYCQQARAEQAIAALRQMSAAQARVIRDAVHQTVPAAELVPGDII
FT                   LLEEGDTVPADARLIQSTALQTAEAALTGESLPVRKDTATVTGEVELGDRHNMIYSGTA
FT                   VTYGRGLAAVTATGMRTEMGRIAGMLRAAQDETTPLQTELTRVGKLLGLVVIAIAVVMI
FT                   AAILFVEDIQGVSALFDVLILGVALAVAAVPEGLPAIVTAALSLGVQRMAQKKAIVRHL
FT                   AAVETLGSAEVIATDKTGTLTKNEMTVRAVATASGHVTVSGIGYAPVGQLTRDDGGDLD
FT                   ELLRSEVECALFAAEQANNAALQEHDGRWIVQGDPTEGALIVAARKAGLEAAALGNRFV
FT                   RIAEIPFSSERKLMSTVHSDAEHQEHVFIATKGAPDVLLARCSHEFVGRHPRALTEERR
FT                   NEILATNEELAGKALRTLAVASRSLPKDNFGSSAPDDAVEQDLVFLGLIGMIDPPREEA
FT                   REAVARARAAGIRPIMITGDHPRTASAIAVELGIMADTRAVTGAQLEGMSDEALDHAVR
FT                   DVSVYARVNPEHKLRIVQALQRNGLTVAMTGDGVNDAPALKAADIGVAMGMTGTDVSKE
FT                   AADMVLADDNFATIVAAVEEGRGIFSNIRKFLRYLLSSNIGEVMTMFFGVVLIEALGLS
FT                   GASGDKVVLPLLATQILWINFVTDGAPALALGVDPVDPAVMRRPPRPREEGVLTPRTWA
FT                   GIIFVGVVTAVGTLFVLDASLPGGLVEGSGTLRYAQTMAFTTLVLFQLFNVFNARSDEG
FT                   SAFEGLDRNAWLWGAIALALLLQIAVIYIPFLQKAFSTVSLSVCDWLFCTAVASSVLLL
FT                   RELSKVVTRAMDRRHSCIPDRLRGAGSMNS"
FT   gene            460724..461452
FT                   /locus_tag="Mnod_8721"
FT   CDS_pept        460724..461452
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8721"
FT                   /product="HAD-superfamily hydrolase, subfamily IA, variant
FT                   3"
FT                   /note="TIGRFAM: HAD-superfamily hydrolase, subfamily IA,
FT                   variant 3; PFAM: Haloacid dehalogenase domain protein
FT                   hydrolase; KEGG: met:M446_2868 HAD family hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8721"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62777"
FT                   /db_xref="GOA:B8IWI7"
FT                   /db_xref="InterPro:IPR006439"
FT                   /db_xref="InterPro:IPR023198"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI7"
FT                   /inference="protein motif:TFAM:TIGR01509"
FT                   /protein_id="ACL62777.1"
FT                   /translation="MTSSKTKPDAVDRACIFDVDGVLLASPHERAWREALRGFADPSRF
FT                   TTALYQAYVAGKPRLDGAFAGLTALGLPDAQRLAAAYGEAKQRCLDRIIAAEGVAAFPD
FT                   ALRFVRALTERGWRLAAASSSKNAERMMRLVLLHEGRTLLDAFVVTVCGRDLRHGKPDP
FT                   EIFLLAAAELQVGPMRCIVFEDAPAGIQAARAGHMTAIGVARLGDAAGLWAAGAHRVVA
FT                   SLDELCIDDLVLHQPSGEAA"
FT   gene            461449..463737
FT                   /locus_tag="Mnod_8722"
FT   CDS_pept        461449..463737
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8722"
FT                   /product="glycoside hydrolase family 65 central catalytic"
FT                   /EC_number="2.4.1.230"
FT                   /note="PFAM: glycoside hydrolase family 65 domain protein;
FT                   glycoside hydrolase family 65 central catalytic; KEGG:
FT                   met:M446_2869 kojibiose phosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8722"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62778"
FT                   /db_xref="GOA:B8IWI8"
FT                   /db_xref="InterPro:IPR005194"
FT                   /db_xref="InterPro:IPR005195"
FT                   /db_xref="InterPro:IPR005196"
FT                   /db_xref="InterPro:IPR008928"
FT                   /db_xref="InterPro:IPR011013"
FT                   /db_xref="InterPro:IPR012341"
FT                   /db_xref="InterPro:IPR017045"
FT                   /db_xref="InterPro:IPR037018"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI8"
FT                   /inference="protein motif:PFAM:PF03632"
FT                   /protein_id="ACL62778.1"
FT                   /translation="MIVSGTTAQALVPTADPSWLLRETGYELLRESTFETRFAISNGFL
FT                   GVRGGLATHLGACRAIPPRTYVAGLFDTPTPDSAVPELVPAADWLQVRILLPDGPLMRC
FT                   PNRSSRALTLDMRRGTLFTEARQTCNAPLDVRLRTLRLVSLDLRAIGMQLIELEIENGV
FT                   SDLTLEASFGPTDFELAPERADLDLKAWRTWRSGRSLAIAAAASLQVDGTERQPTARGD
FT                   LSWSWSWTASPGQVVSFQRIIAVTRHHSVDVHSGARARKELAAARTLGWQGLIARHEAA
FT                   WAGRWHCSDVRVEGDPAAQAALRFAIFHLNGAVNPSDPQVSVAARALTGDDYRGHVFWD
FT                   TEIFLLPFYTLTWPEAARTLLMYRFRTLDAARAKAAAMGWRGALYAWESADIGDEVTPK
FT                   QTVGPDRKILDILCGSQEQHISADVAYAVWQYWRATEDETFLREAGAEIILETARFWAA
FT                   RAEPEADGLRHIRGIIGPDEYHEAVDDNAFTNMMARWNIERGLDVAALLQELWPETWDG
FT                   LSERLGLDEPELIQWREAAQTIVTGFDPATGLFEQFAGFSALEEIDLAAYSGRSVPMDV
FT                   VLGRERTQLTQVIKQADVVALLALLPEVFAGRAAETNFDHYEPRCGHGSSLSRAMHGIA
FT                   AARLGRSETALQYFRQSAAIDLADTHVAISGGIHIAALGGVWLIAIFGIAGLSLRPDGL
FT                   AFDPQLPEAWRSLEFRLHWRGRHLIVTIDPAARVFRVALETGSGMPVYVRGSRYLVSAD
FT                   EALAVPLDP"
FT   gene            complement(463734..463859)
FT                   /locus_tag="Mnod_8723"
FT   CDS_pept        complement(463734..463859)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8723"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8723"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62779"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWI9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62779.1"
FT                   /translation="MRLHAWRWKGAFPGVGQHEPARPVSLPDIHHDAVFADPYNL"
FT   gene            complement(463978..464166)
FT                   /locus_tag="Mnod_8724"
FT   CDS_pept        complement(463978..464166)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8724"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8724"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62780"
FT                   /db_xref="GOA:B8IWJ0"
FT                   /db_xref="InterPro:IPR005530"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62780.1"
FT                   /translation="MTNDRTQARLLPSIVRLSLGALLIISPWVWGYAQQRMPAASAILS
FT                   GTIIARLGLSGNSRLRE"
FT   gene            complement(465025..466023)
FT                   /locus_tag="Mnod_8725"
FT   CDS_pept        complement(465025..466023)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8725"
FT                   /product="alpha/beta hydrolase fold protein"
FT                   /note="PFAM: alpha/beta hydrolase fold; KEGG: met:M446_1905
FT                   alpha/beta hydrolase fold"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8725"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62781"
FT                   /db_xref="GOA:B8IWJ1"
FT                   /db_xref="InterPro:IPR000073"
FT                   /db_xref="InterPro:IPR000639"
FT                   /db_xref="InterPro:IPR006311"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ1"
FT                   /inference="protein motif:PFAM:PF00561"
FT                   /protein_id="ACL62781.1"
FT                   /translation="MHTDSTPITKPHTNRRKWLAPALIGSAAALGASALYAVAKAREAE
FT                   RRHPPVGRFMTVDGVCLHYMERGRGEPLVLIHGNGTLIQDFLVSGIVEELAKRHRVILI
FT                   DRPGYGYSARPRALWTPRAHATLFQKALERLGVSQAVVLGHSWGSLVAVALALQAPQLV
FT                   RSLVLASGYYYPTLRADVAVFSPPAIPVLGDALRYTVSPLLSRLILPGLIKAMFAPADV
FT                   PERFDEQMPKELMLRPSQLRAAAEDAALMTPVTIELREHYRDLKLPVVIITGADDQIAD
FT                   VARQSERLHRELPHSEFIVVPGQGHMIHHLAPDQVVNAVERASARFYAKAA"
FT   sig_peptide     complement(465910..466023)
FT                   /locus_tag="Mnod_8725"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.582 at
FT                   residue 38"
FT   gene            complement(466146..466358)
FT                   /locus_tag="Mnod_8726"
FT   CDS_pept        complement(466146..466358)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8726"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_4647 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8726"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62782"
FT                   /db_xref="InterPro:IPR021327"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ2"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_4647"
FT                   /protein_id="ACL62782.1"
FT                   /translation="MEAPDEITPEQIRERAYDLWERNHRPEGFEMQFWLMAERELKAER
FT                   DRKQARVRADAAKSPPTAPAVHGRE"
FT   gene            466533..467972
FT                   /locus_tag="Mnod_8727"
FT   CDS_pept        466533..467972
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8727"
FT                   /product="transposase IS4 family protein"
FT                   /note="PFAM: transposase IS4 family protein; KEGG:
FT                   mpo:Mpop_3824 transposase IS4 family protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8727"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62783"
FT                   /db_xref="InterPro:IPR008490"
FT                   /db_xref="InterPro:IPR025668"
FT                   /db_xref="UniProtKB/TrEMBL:B8IW98"
FT                   /inference="protein motif:PFAM:PF01609"
FT                   /protein_id="ACL62783.1"
FT                   /translation="MTRFIAGEDRQQVTLLPDCLDDYVAADNPVRLAEAFVDELDLAAL
FT                   GCAGAVPEATGRPAYDPATLLKLYLYGYLNRIPSSRRLERESPRNLELIWLTGRLMPDF
FT                   KTLADFRKNNGPAIQATCAQFVVLCRRLNLFSKAIVAVDGSKFKAVNNRDKNFTVAKLE
FT                   ARVAQVEASVARYLAALDRADREPSDVAEARTARLTEKIAALREQMQDLQAMRQRVEEA
FT                   PDQQVALTDPDARSLATRGKGTGLVGYNVQAAVDVEHHLIVAHAVTNVGSDRAQLAPMG
FT                   VLAQEATGCEPITVLADRGYLNGDQVLVCEGTGVLPCVPKTLTSGNVKRGLFTGQDFIY
FT                   DAQKDHYTCPAGQHLTKAPARSDRRDEIDHYRNRTACPACALKPRCTTEAARRIKRWVH
FT                   EGVLDAMQARLDGMPDAMKVRRQTVEHPFGTLKAWMGATHFLTRTLAKVRTEMSLQVLA
FT                   YNMKRMIQIFGVGALITAIRA"
FT   gene            complement(468205..469119)
FT                   /locus_tag="Mnod_8728"
FT   CDS_pept        complement(468205..469119)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8728"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: rec:RHECIAT_CH0001302 putative
FT                   transcriptional regulator protein, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8728"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62784"
FT                   /db_xref="GOA:B8IWJ4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ4"
FT                   /inference="protein motif:PFAM:PF03466"
FT                   /protein_id="ACL62784.1"
FT                   /translation="MDRLTAAQVFVETVERGSATAAADALGMSRAMASRHLGALEDWTG
FT                   TRLLHRTTRRLSLTLAGERVLELSREMVRLAANLHAVAGEGDSPNGLLRIAAATILSEE
FT                   QLTPLLADFLRAHPRLSIDLRASDRPVDLVEDRIDVAIRIGNQLDLGCVARKLGECRSV
FT                   LCASPRYLDERGTPLQPSELHAHACLTYTNFGAAEWTLQAGGESVTVKANGPFRTNEAL
FT                   ALRRAALAGLGIAMLPDFAVVGHLASGALRVVLPAWRPPPHPIHALYLSRVHLPAAARA
FT                   FIDYLARRLLQEGAGTAGQGRAG"
FT   gene            469211..469876
FT                   /locus_tag="Mnod_8729"
FT   CDS_pept        469211..469876
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8729"
FT                   /product="putative DsbA-like thioredoxin protein"
FT                   /note="KEGG: rec:RHECIAT_CH0001301 putative DsbA-like
FT                   thioredoxin protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8729"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62785"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ5"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0001301"
FT                   /protein_id="ACL62785.1"
FT                   /translation="MSDLELRYYFDPLCGWCYASAEALAALAERHGSQLRMMPVGLFFE
FT                   PRPVSAIADHAWRNDQRIGGLTGQPFSEAYHRNVLQAPDGVFTSGPLTLALAALGETDA
FT                   ALEPRFLHAAQRARYVEGRDTSQVAEVVPVAIAVATEAGLKLDPDGLGARLRNDAALAE
FT                   RVADRITAAQAEMHGLPGGGVPQLLVRVGGKAHAVSGQTLYAGRDAILAAVEQASLAS"
FT   gene            469909..470517
FT                   /locus_tag="Mnod_8730"
FT   CDS_pept        469909..470517
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8730"
FT                   /product="putative NAD-dependent epimerase/dehydratase
FT                   protein"
FT                   /note="KEGG: rec:RHECIAT_CH0001300 putative NAD-dependent
FT                   epimerase/dehydratase protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8730"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62786"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ6"
FT                   /inference="similar to AA sequence:KEGG:RHECIAT_CH0001300"
FT                   /protein_id="ACL62786.1"
FT                   /translation="MKIALIGASGNAGSRILAELSRRGHQVTAIARDTSKIPTAPGVTA
FT                   AAVDIADVAKLSAILRGNDAVISAVHFSASDPDKLIAAVEGAGVRRYLVVGGAGSLEVA
FT                   PGQLLVNTPDFPAQYRDEALGGVAFLERLRRNDTLEWTFLSPSALFTAGERTGRFRLGT
FT                   DQLLTNENGSIISFEDYAIALADEIEQPRHVRQRFTVGY"
FT   gene            complement(470845..472125)
FT                   /locus_tag="Mnod_8731"
FT   CDS_pept        complement(470845..472125)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8731"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_5531 transposase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8731"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62787"
FT                   /db_xref="InterPro:IPR004291"
FT                   /db_xref="InterPro:IPR024474"
FT                   /db_xref="UniProtKB/TrEMBL:B8I9Z6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62787.1"
FT                   /translation="MGRSELERLSKQELIELVLRLQRPEKTSRTSSKPPSTDRKERREQ
FT                   AKPGGAKPGHEGHSRTLSPDPDEIVAHRPGHCPCCGGVLAPDLPAEIVSVCEQIDLPAV
FT                   APMVTQHQRLAVRCPACGTRVVAPVPQAARGTPFGPRLHAVAVYLKTFQALSYERLQAA
FT                   LSDLFGLTLSQGGLMNLLRRAQRQFRADREAAVSALRRAAVVASDETGVRIEGSNSYHW
FT                   VFRSDAAVVHHAASTRAAAVVHAMMDGHRPSVWLSDRYTAQQGHGEHHQTCLAHLARDV
FT                   AYAVEVSDDPVPLRLQLWLGSVFSLAERVTDLAASTLSAKRRALDRQLSAILAAPSRCD
FT                   LTRALQAKIGRARDQLLVFLDHPGRVAVTNNACERALRPAVVQRKVTNGYRAMWAAAGE
FT                   ADVRTVVDTARLSGAGTFATILNIIRA"
FT   gene            complement(472232..472792)
FT                   /locus_tag="Mnod_8732"
FT   CDS_pept        complement(472232..472792)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8732"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8732"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62788"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62788.1"
FT                   /translation="MIEARFEPRYELEELEDFAARQSPVMHRRAPEARKALPKLDDNPF
FT                   TRVAAQFGLKMPMDINARLAAMTYQGAGSDSIHATQLEVSAALINRGHSIDEATEILLT
FT                   ATKAAAGDYGARWNWTREERAIRKHPEVLEQEAEEAMDEADEGDDAHESIETAEERAEA
FT                   AEAAREQRQGGPRCTASRQSARR"
FT   gene            472945..474042
FT                   /locus_tag="Mnod_8733"
FT   CDS_pept        472945..474042
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8733"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: LOC100024744; similar to PH domain
FT                   leucine-rich repeat-containing protein phosphatase (PH
FT                   domain leucine-rich repeat protein phosphatase) (Pleckstrin
FT                   homology domain-containing family E protein 1)
FT                   (Suprachiasmatic nucleus -TRUNCATED-"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8733"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62789"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWJ9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62789.1"
FT                   /translation="MIGRVLGAGIAACAGVGVLGTAHAQSPTPEQMAAMIQTLQARVEA
FT                   LEERSRRDRAEAQAARAELRAMRRARGAAVTSAEPTRVVVSKSSEAVLAPATVAPEPVN
FT                   GFAGPYAAFLAGYGFGPDAKPAPQPFGVPGTLSQNTSRLSALSDARVGAALGYNRTFGD
FT                   LLIGAEGRVRAAFGQTTATVSSTAPSRPLPFVFATSCCGPNAAVPTSFGNFALSQNVIS
FT                   SAVLNRIVSGDAAVRAGLIWDDWLFYGRFGAGADVLRSVTTRDNRGTVTCVDPTVSVAT
FT                   TPGGARSSSVVGCGVVSTGQVIKLSDALVSPYAVVGLGIERNFGPVFARVEGNLYINLP
FT                   PSLVAQTTSSTSYTTEIMGAVGYRF"
FT   sig_peptide     472945..473019
FT                   /locus_tag="Mnod_8733"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 1.000 at
FT                   residue 25"
FT   gene            474261..474803
FT                   /locus_tag="Mnod_8734"
FT   CDS_pept        474261..474803
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8734"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8734"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62790"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62790.1"
FT                   /translation="MKLKATLLTVFIGMTSSVSAQYSIRDDGWTLKHDGLKLTASANFG
FT                   DDAMSLSMMEISCGADGFHIGFSLRPKSLGDADFKKIRSAQIELRTRDQTFNTSGSIIG
FT                   ETILVGSSKNFEEKEFLELLRRLYDLRSVAITVEIKDGHTISGLWLLNPWNPKLGGYDA
FT                   SNAFGRMTSMCPTMLRR"
FT   sig_peptide     474261..474323
FT                   /locus_tag="Mnod_8734"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 1.000) with cleavage site probability 0.918 at
FT                   residue 21"
FT   gene            complement(474911..475510)
FT                   /locus_tag="Mnod_8735"
FT   CDS_pept        complement(474911..475510)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8735"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_3357 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8735"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62791"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62791.1"
FT                   /translation="MNVRVARGGNCRQRAVIDLQGCDLSIAPLRILGTPCAYLECRPDL
FT                   PRRRSFARPLPGPGRHHCRRQRDFVADNPGFGALKTLPPEHWQKVVASLEARLRMKGIA
FT                   PPPRSAGAAPPFAAIVKRYATAAGLDASSFGAHSLRAATSPRPRSVAPTWPASWTRAGT
FT                   AIRGPWWATFGGLERSPPSWRPVRRKGAHEIKTLEP"
FT   gene            complement(475628..475834)
FT                   /locus_tag="Mnod_8736"
FT   CDS_pept        complement(475628..475834)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8736"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_6420 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8736"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62792"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK2"
FT                   /inference="similar to AA sequence:KEGG:M446_6420"
FT                   /protein_id="ACL62792.1"
FT                   /translation="MPDQQPFDIVAEFNALLFEAGSIWDVIDRRQGNKVTLTLLTEHEA
FT                   RVICEEWNRQEGRERFKVVKRAA"
FT   gene            476607..476864
FT                   /locus_tag="Mnod_8737"
FT   CDS_pept        476607..476864
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8737"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_3973 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8737"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62793"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK3"
FT                   /inference="similar to AA sequence:KEGG:M446_3973"
FT                   /protein_id="ACL62793.1"
FT                   /translation="MPDHPTISTLIVRNVVTFDQLDAAVEAYLSDPTSGPREIGNGVTI
FT                   DIAAAVQAYSTAKGLAAEQSFEESTRRLLVRTSMLLARPT"
FT   gene            477293..477457
FT                   /locus_tag="Mnod_8738"
FT   CDS_pept        477293..477457
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8738"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8738"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62794"
FT                   /db_xref="GOA:B8IWK4"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK4"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62794.1"
FT                   /translation="MILYHHLREQGFSRAGAISLIVVNLTLLVIGAYFAILDGTGTIEA
FT                   LEQLRSRLN"
FT   gene            477813..478160
FT                   /locus_tag="Mnod_8739"
FT   CDS_pept        477813..478160
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8739"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8739"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62795"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62795.1"
FT                   /translation="MPRANVINDTNFTSPSNVTDYILGPDAHLNVLTGTQFHAVGQGQI
FT                   TTDEGFQATVNFILHDNPSFNTLNAVAHTDVGVLHFNSSSYQHTDQLTGPAASLFDIDP
FT                   SEYLSGSPTPY"
FT   gene            complement(478717..478902)
FT                   /locus_tag="Mnod_8740"
FT   CDS_pept        complement(478717..478902)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8740"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62796"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK6"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62796.1"
FT                   /translation="MSLASTRRAKLSERRPAQGESGHRASLAAYKLLSVPPADRSLTPQ
FT                   ELIAMARAARARTSWH"
FT   gene            complement(479042..479197)
FT                   /locus_tag="Mnod_8741"
FT   CDS_pept        complement(479042..479197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8741"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: met:M446_1538 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8741"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62797"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK7"
FT                   /inference="similar to AA sequence:KEGG:M446_1538"
FT                   /protein_id="ACL62797.1"
FT                   /translation="MTALVLLSLVAAAAVNASLVLGVADRLTPKASASTLVASNENEIL
FT                   TAKLAA"
FT   sig_peptide     complement(479144..479197)
FT                   /locus_tag="Mnod_8741"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.558 at
FT                   residue 18"
FT   gene            479434..479655
FT                   /locus_tag="Mnod_8742"
FT   CDS_pept        479434..479655
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8742"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: mrd:Mrad2831_4176 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8742"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62798"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK8"
FT                   /inference="similar to AA sequence:KEGG:Mrad2831_4176"
FT                   /protein_id="ACL62798.1"
FT                   /translation="MAEEFGSPLPRDWRDAADTAAHNLGFGRDLTGLPAEHWQRVLAAV
FT                   EARMRMKGVDLPENWRERLTRQVGRENP"
FT   gene            479678..480013
FT                   /locus_tag="Mnod_8743"
FT   CDS_pept        479678..480013
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8743"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_3358 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8743"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62799"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWK9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62799.1"
FT                   /translation="MPPPDPLAVSPGLIGHYVNWALELAAQHRAQPSVDIAASVDTYLA
FT                   EVRARARALPSKIQGAWFLSAVRTQVRLQIPRDPKVLAAIASDVSEARRLDTLTLIVDR
FT                   LVERADA"
FT   gene            480112..480709
FT                   /pseudo
FT                   /locus_tag="Mnod_8744"
FT   gene            complement(481006..481185)
FT                   /locus_tag="Mnod_8745"
FT   CDS_pept        complement(481006..481185)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8745"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8745"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62800"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62800.1"
FT                   /translation="MADRAGTTWLHTTRTAPAAMILMMFSMARSPFAVVDDHSLKQTSK
FT                   AEPLQNDYVEYCYA"
FT   sig_peptide     complement(481084..481185)
FT                   /locus_tag="Mnod_8745"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.979) with cleavage site probability 0.964 at
FT                   residue 34"
FT   gene            481921..482553
FT                   /locus_tag="Mnod_8746"
FT   CDS_pept        481921..482553
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8746"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_6989 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8746"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62801"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL1"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62801.1"
FT                   /translation="MGGTGSGRWGGRPTVESGLTLNLGKLLRDGFCQPGQSRAGSLVWT
FT                   NSRTGTPVGSIGYEAHLGTEPGWMRLHYTTTRWNGEKQRADYWVKLTTTAQPFGGRRWW
FT                   FICPHTGARVTKLHLPNGASTFASRQAYRLGYRSQRETPTDRAISRAFKLRDRLGAKDG
FT                   IGDYIDKPKGMHWATFEREMAKVGAAEATVTALSWQLLKKLNPRLEP"
FT   gene            482837..482913
FT                   /locus_tag="Mnod_R0096"
FT                   /note="tRNA-Arg5"
FT   tRNA            482837..482913
FT                   /locus_tag="Mnod_R0096"
FT                   /product="tRNA-Arg"
FT   gene            complement(482967..483197)
FT                   /locus_tag="Mnod_8747"
FT   CDS_pept        complement(482967..483197)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8747"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8747"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62802"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL2"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62802.1"
FT                   /translation="MAGSKSSSSDRQEARAVDYVKTSQEAEAALEKRAAEIKAKKASRR
FT                   SDAPETDDSPKRQGDKLEHARDAAAGSGKRK"
FT   gene            complement(483298..483453)
FT                   /locus_tag="Mnod_8748"
FT   CDS_pept        complement(483298..483453)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8748"
FT                   /product="resolvase domain-containing protein"
FT                   /note="KEGG: met:M446_1482 resolvase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8748"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62803"
FT                   /db_xref="GOA:B8IWL3"
FT                   /db_xref="InterPro:IPR011109"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL3"
FT                   /inference="similar to AA sequence:KEGG:M446_1482"
FT                   /protein_id="ACL62803.1"
FT                   /translation="MTHKSAIAYVRASGASSFRQIAAGLNQRGIQTAQGGTWTAMQVKW
FT                   VLERAR"
FT   gene            complement(483487..484269)
FT                   /locus_tag="Mnod_8749"
FT   CDS_pept        complement(483487..484269)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8749"
FT                   /product="putative dienelactone hydrolase"
FT                   /note="KEGG: scl:sce5974 putative dienelactone hydrolase"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8749"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62804"
FT                   /db_xref="GOA:B8IWL4"
FT                   /db_xref="InterPro:IPR002925"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL4"
FT                   /inference="similar to AA sequence:KEGG:sce5974"
FT                   /protein_id="ACL62804.1"
FT                   /translation="MPTLPDFTTFAFTHAGRERTIYRKGEGPPVLIMHEVPGISAEVVR
FT                   FARRVVDAGFTVFMPRLFGPVGVKTTPVNRVAELLRICISREFQVLAENRSSPIADWLR
FT                   ALARHIHDEMDGRGIGVVGMCVTGNFALTLTLDPWVLAPVMGHPSLPLPITRAKAAAVH
FT                   VTPETFANARRRTTEEGLKVLGVRFHGDMLFCRAARFETLRRELGDGFEGIELPAASAK
FT                   PQFEPPHSVLTIGLIDREGEPTHEAVERVLRFLSERLH"
FT   gene            complement(484282..484416)
FT                   /pseudo
FT                   /locus_tag="Mnod_8750"
FT   gene            484423..484668
FT                   /pseudo
FT                   /locus_tag="Mnod_8751"
FT   gene            complement(484996..485142)
FT                   /locus_tag="Mnod_8752"
FT   CDS_pept        complement(484996..485142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8752"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8752"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62805"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL5"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62805.1"
FT                   /translation="MEMAFVRSAPTGGGAFFFGSQMALTGLRRGNPRPYTWSRFAMLSP
FT                   GQQ"
FT   gene            complement(485308..485835)
FT                   /locus_tag="Mnod_8753"
FT   CDS_pept        complement(485308..485835)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8753"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: HMG-I and HMG-Y DNA-binding domain protein;
FT                   ROSMUCR transcriptional regulator; KEGG: met:M446_1153 MucR
FT                   family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8753"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62806"
FT                   /db_xref="GOA:B8IWL6"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL6"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL62806.1"
FT                   /translation="MGEEAKSITLKPETETIGLTANIVSAYVSNNVVPAAELPELIAIV
FT                   DRALDELSKPATPVVEEVLKPTAAQIRKSITPDHLISFIDGKPYKSMKRHLTKNGLTPA
FT                   EYRQQYGLPANYPMVAPNYAAQRSELAKSLGLGQMRRQRAAEKRADTDAKVSAPAEPKK
FT                   GRGRPKKAAASE"
FT   gene            complement(486187..486618)
FT                   /locus_tag="Mnod_8754"
FT   CDS_pept        complement(486187..486618)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8754"
FT                   /product="transcriptional regulator, MucR family"
FT                   /note="PFAM: ROSMUCR transcriptional regulator; KEGG:
FT                   met:M446_6739 MucR family transcriptional regulator"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8754"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62807"
FT                   /db_xref="GOA:B8IWL7"
FT                   /db_xref="InterPro:IPR008807"
FT                   /db_xref="InterPro:IPR041920"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL7"
FT                   /inference="protein motif:PFAM:PF05443"
FT                   /protein_id="ACL62807.1"
FT                   /translation="MSEETAAGHIELVSDIVSAYVSKNSVPPSELPALIQSVYQSLGAL
FT                   GRPAEPEPVKLTPPVPIKKTVTPDHIISLEDGKPYKSLKRHLTTRGLTPQQYRVKWSLP
FT                   PDYPMVAANYAAQRSELAKSIGLGRSRQQAARPRRTASK"
FT   gene            complement(486740..487189)
FT                   /locus_tag="Mnod_8755"
FT   CDS_pept        complement(486740..487189)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8755"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_4723 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8755"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62808"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL8"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62808.1"
FT                   /translation="MTAAAEADFRCLIQAPAGGKLHNTARPYRAAMPITNAPTDPAGLV
FT                   QEWSRGLASLSAGQPPCPGFKPDEWIETLTNARRFVEDFGLQAAELGWDPLTLFGVGPT
FT                   TGAIRADFCQRCHMLHDRSEHQRRRRFTLLRRKAMGDLFHGPYSL"
FT   gene            complement(487284..487430)
FT                   /locus_tag="Mnod_8756"
FT   CDS_pept        complement(487284..487430)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8756"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: met:M446_2890 resolvase domain-containing
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8756"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62809"
FT                   /db_xref="GOA:B8IWL9"
FT                   /db_xref="InterPro:IPR036162"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWL9"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62809.1"
FT                   /translation="MEMMRTIDDLRRQNVHFRSVTEQFDSDTAHGRFALQTRCTISSLR
FT                   MVQ"
FT   gene            complement(487553..487693)
FT                   /locus_tag="Mnod_8757"
FT   CDS_pept        complement(487553..487693)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Mnod_8757"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Mnod_8757"
FT                   /db_xref="EnsemblGenomes-Tr:ACL62810"
FT                   /db_xref="UniProtKB/TrEMBL:B8IWM0"
FT                   /inference="ab initio prediction:Prodigal:1.4"
FT                   /protein_id="ACL62810.1"
FT                   /translation="MGRLVFALLLVLVSTWAGAETVYPGEFKKLTIIRPGSTGDVSVMS
FT                   V"
FT   sig_peptide     complement(487634..487693)
FT                   /locus_tag="Mnod_8757"
FT                   /note="Signal predicted by SignalP 3.0 HMM (Signal peptide
FT                   probability 0.993) with cleavage site probability 0.813 at
FT                   residue 20"
XX
SQ   Sequence 487734 BP; 83667 A; 160278 C; 161056 G; 82733 T; 0 other;
     cgcacacact tgcgacgaac cgcgcgattg atcgatgcgc ctatgtcggt tattgtggcg        60
     gccaagatat cacaaaagga tgtcggcttc gctccagccc aaaaatcaga ggaggcaacc       120
     atgaaatcac gattgcttgc ttccgcaccg tcaggcgtcg ccctagcctt gtttgccgcc       180
     tgccccgtct cagcccaaga aggatgcaag atgagttggg aagcttcagc ggccaactcg       240
     acgtacacca aacaacaagt cttggatgtc ggggacgtgc ccggtcatca gctccgtatc       300
     tacgagctgc accgcacctt tccgagcgac aaacccaact gcgaaggtct gaagcgtgtc       360
     gagcagtggt ctcgcggact taccgactac accgacggca acggatcgct gtcagggtat       420
     acagtcacca tcctggagaa tggcgataag atatttggca aggtttccgg gaccagccag       480
     accacgacca atagcgatgg atcgaaaacg agcaccttta cgggcgtcgt tacgtatacg       540
     ggcggcacgg gcaagtacca gcgcgtcagg ggtatccagc gggacatcat cgccttcgac       600
     ctggaaaaga acttcaatca gcagcgagcc gaggccgagt attggttcga gaagtagcgg       660
     ccagcggcag ctgcgctacc gcctggtcgg tggttcgcaa gctcagtttg ccgcgatctc       720
     cggccataca gcgatccaat agacacggct tgcctatcgc tgaggccttg ggtgatccct       780
     cccgccgccg tcaacatcgc gccatcggcc tcggtcggag ttcgccgatc atctccaaca       840
     tacggtgaag acgcgggcgt atccgacgag catgtcagga tagtgccacg cgagcatatt       900
     cctgacagta gttttcctga cacggtttcc tgacatccgc caccgcgccg cgctctcgcg       960
     tcaactgcgt cagccgaggc ggtttccggc atgtccagaa aacggtcgga tactgttggc      1020
     gaattcgggt ggctcttcgg ccgggcgtct ggcgcggcca ttgcacaggc gtgaggccgg      1080
     tcccgtcacg ggctccgcgg cgggcctgat cggaattcgc caacagtatc cggtcgtttt      1140
     cctgacagtc agaggctgtc tgccggttgc cgctcaatct tctggaatgc gccacgagtg      1200
     ctagtgccgg cactggctcg tcgttcgtca gcgatgtgcc tccccggcgg tcaccggtcg      1260
     cagtggggct ggtccctgca cgccgaaatg atcggcgagc tgagcccccg tgtagctctc      1320
     ggtgaagctg tcgggcttct ccggtagcat cgtggcgttc caggcacgcc aggacgcttc      1380
     catccgggcg aaatcctccg gccggcgcgc cttgaggttg gcccgctcca gcggatcagc      1440
     gacgacgtcg aacaggaagg tgttgtcgcg gatcttgagg tacttgaggt cgccctcgcg      1500
     cagtgccgcc tgggcgttgg cccggtagcg ccagtagaag ctgcgcgggc gctcggccgc      1560
     ctccccggtg aggatcggca ggaggtcaat gccgtccggc gggtagaccg ggtcggggct      1620
     cgcgcccgcg gcggcgagca gggtcggcag ccagtccatc gtgatcatcg gctgggccga      1680
     aacgacgccc gccggcagcc gccgcggcca cgacacgatc gccgggatgc gcaggccgcc      1740
     ctccagcagc tcagtcttgc gcccagtgaa gggccacgtg tcggagaagc gctcgccgcc      1800
     gttgtcgctc gtgaacacca cgatggtgtc ctgcgcaatc ccgtgctgct ccagggcatc      1860
     gagcacgcga ccgatctggg catccatctc ggcgacgatg cggtgataag tggcctgggt      1920
     gccgccgtca aagtggcgca ggttgctccc ggcgatgcgc cgcgactcgg cctcatcctc      1980
     gggcgtctcc cacggccagt gcggcgcgtt gaagtgcagg ctcaggaaga acgggcgccc      2040
     ggcgcggacg gccgtcccga tggtttccac ggcccggcgc ccgatgagat gagtggcgta      2100
     gccgacctcc tcgacgcgca cgtcgccgtc ccagaggtct ggcttgtcgt ccgtcccacg      2160
     gtggctgaag tagtcgatgg tgccgccgcg aaagccccag aaggtgtcgt agccccgctg      2220
     cagcggcccg aacttggcca cgctgccgag gtgccacttg ccgacaaggg ccgtccggta      2280
     gccggcccgg cgcagcaggc ccggcagggt cgggtgctcg gcgggcaggc cgccggtgaa      2340
     gcgggtcgtg accggctcct ccaggccgac cggcaggcgg tactggtagc gtccagtgat      2400
     cagcgccgtg cgggtcgccg agcacaccgc cgagttggcg tagccttgcg tgaaccgcac      2460
     gccccgggcg gcgatccggt cgatgtgcgg cgtcttgagg tcgggacgcc cgtagcagcc      2520
     gacatcggca tagccgaggt cgtccgccat gatgaacacg atgttgggcg ggccggccgc      2580
     ccacgcctcg ctcggtccag tcagcgctga cgcggccgcc cccgcagccg cactcccgag      2640
     cacgtgtctg cgcgtgacac ccctacgctc catcatcgca ctcagtccgt cttaataaga      2700
     gagcttaata agagagaata agcgggcggt tccggtgttc taggctgacc ccgagatcat      2760
     gccgctcgat gcaggcgact ctagccgtgc ctcagcaccg cgaggacggc gtgaatgatg      2820
     gtcgcgccgc cgatcggtgc gatgaacacg agcagcgcgt tcacggcgat gagccacagg      2880
     aacacccgct cctggcgctg cgtgagtcgg ggctcgcggg ggggctccca gggtggtttc      2940
     catcctccct cgacgtacat cggcgtcctc aactcggtct caatccccac gatcgagcgg      3000
     ccggagacag tcatgctagc gcagggtgat gcgcctccgc catgggtcga acacggccga      3060
     aacgttccgt ccgcttcggt aggcgtcgtt gccagggctg cccttccgct cccggtcaaa      3120
     ttcggacttt aaggcaagca cggcccaacg tcacagacgg gtcgaggctg tgtgaaaacg      3180
     gctgccgccc gggagcttgt agaacgatct cctcggcatc aaatgatggc gaagggcgag      3240
     atcacatata tttctacacg ccggccatct tggagaagat tttactatgc catccaggcg      3300
     atgcgccgtt ttcacacgac ctctttgaat tgtgagaagg cgggcttggg gctggttcca      3360
     gaagccgcgc ttatgcgaac gggaaacgat cagcgtattt acccacgccc gtgacagcgg      3420
     gggttaggcg ccgagagtct tgaggatcgt gccgaaaagg tgccagcacc cgacagacgg      3480
     gctgtgtcga cgaccgtgcg cacgtcggcc tcgccttcgg ccgcccacat cgcccgatag      3540
     ccgttcgtca ccttccgctg caccaccgcc gggcgcaggg cccgcttaca gccgttgttt      3600
     gtgaccgcga cctggccggg atgggcgagg aagaccagaa gctggtcgcg cgcacggccg      3660
     atcttggcct gcaaggctcg cgtcaggtcg cagcggcttg ggacggccag gatctcggcc      3720
     agccgccgct ccagcgtccg gcgcttggcc gccaaggttg aagcggcgag atccgtgacg      3780
     cgctccgcca agctgaacac ggatcccagc cacagctgca ggcgcagcgg cacgggatcc      3840
     tcgctggcct cgaccgcata agcgatgtcg cgcaccagat gcgccaggca ggttgggtgg      3900
     cgcacgccat ggccttgctg cgccgtggag cggtccgaca gccacaccgc gggccggtgc      3960
     ccgtccatca tctctcggat gacgcaggcc acccgcgtcg gggcggcgtg atggaccacc      4020
     gcatcagccg agtggaagcc ccaatggtag ctgttcgtgc cctcgatgcg cacgccagtc      4080
     tcgtctgagg cgacgaccgc agcccggcgc agcgccgaca cggccgccgc gcggccgggc      4140
     cggaaccgcc cttgcgcgcg gcggagcaga ttcatcaggc cgccctggct gagcgtcagc      4200
     ccgaacaggt ccgccaacag ggcctgtagc cgctcgtagg acagcgcctg gaaggtcttc      4260
     aggtagacag ccaccgcgtg caggcgcggg ccaaacgggg tgccgcgcgc ggcctgcggc      4320
     accggagcga ggacccgtgc accacaggcg agacagcgca cggccagttg ctggtgttgg      4380
     gtgacgactg gcgcgacctc gggcagctcg atccgctcgg acaagctgac gatctcggcc      4440
     ggaaggtccg gagccaacac gcctccaccg caggagcagt gacccgggcg atgcgcgacc      4500
     acctcatccg ggatctggct gctcacccga ctgtgcccct cgtgacccgg cttggcgccg      4560
     ccaggtttgg cctgctcgcg ccgctccttg cgatcggtcg agggcggcgt ggaggaggtg      4620
     cgcgaggtct tgtctgggcg ctgcagccgc agcaccagct cgatcagctc cgccttgctc      4680
     aggcgctcaa gctcgcggcg gcccatccca cgagggaagc agcgaaatcc accccgcgca      4740
     agcggcgtgg gtaattaccg atcagcagct gtgatcaggg gcgaaggtcc gctgtccagt      4800
     gacgagcggc cattccgacg gcaccggacg aaggtctgca agtggcgcgt tgccgataga      4860
     ccagcgcccc tacccctccg aacagcagcg tggcgcatct gacgagttcc tcacctcagg      4920
     agttcgtcat gaccaaaacc tcaaccgtcg agaccagccc tcgcgtgcct tggaaccgtg      4980
     gccgtcttgt cggtcccaag ccgccgctca agcccaagaa catctgggcc ctgcgcaccc      5040
     gcctacagct tgccaaccgc acgcgcgatc tcgccctctt ccacctcgcc gtggacagca      5100
     agctgcgcgg ttgcgatctc gtgcagttgc gcgtgactga tgttcacctc ggcgatgcgg      5160
     tccgactgcg aaccaccgtc gctcagcaga agaccggccg gcccgtgccg ttcgagatca      5220
     ccgagccaac gcgcgaggcc ctgacgacgt ggctggccaa tcgcaatctg agagcaggcc      5280
     attggctgtt tccgagccgc agccggcgag gtgagcacct taccacacgc tagtacagcc      5340
     gactggtgga ccgctgggtg gccctgatag gtcttgatcc gtcggcctac ggcacgcaca      5400
     gcttgcgtcg gacgaaggtg gcgctggtct acaagcgaag gggcagcatc agggcctgcc      5460
     agcttctgct tgggcatacg aagctggaga gcacggtgcg gtatctcggc atagaagtgg      5520
     atgatgcact gatcctgtcc gagcagaccg agatctgagg cgaccgtcgc ggtgggtaat      5580
     gccgccgcgc tccgagagcg tggcggttaa acggctctga atgacccctc gcggacgcgg      5640
     acccatgcgt cgcgcaccca gccgatgcct ctccctgcca gcgtaatgac cgctagcaat      5700
     ccagcgagac ggaggcgcaa ccccggcact ctgaacccgt tagcgatctg ccaacggttg      5760
     gcgttagggt tgcaatcctc ccgcgaggag cgcacaggcg gtttcgccgg cccacaggcg      5820
     ccggctccat ccacggacat ccctcatgtc aagcgacagt cgacagaccg tgccgccccg      5880
     ggctcaggca agaggctgat cgctcagctc tcctgcactg gcctgttggc ggccggtcgc      5940
     acggagagct ccatgaccaa gttcatcacc aaccggttcg aggcgctggc tgcctggatc      6000
     tcggacaatc tcggcagccc ctacgccttc atgatcgcct ccgcgaccgt gatcgtgtgg      6060
     gccctctccg ggccgtactt cggcttctcg gatacctggc agctcgtgat caacaccagc      6120
     acgaccatca tcaccttcct gatggtgttc ctgctccaga acacgggcaa ccgcaccatc      6180
     aacgagatgg aggagcgcct gcgcgagatg gagcaggtga accgcgagat cctgcacgag      6240
     ctgcgccggc agcagggctt caagccggac atccgcgaag tggcttgagc agagggcctg      6300
     ggctacctgt cgcgtcttgc gacggacgag cctgctctcc ccaaaatggc gggtgccgcc      6360
     gtgcgggaaa ctgtgctcct ctgctgaggt cttctaacct gagatcgaac ctccagcccg      6420
     cccggtcttg ccgcggcggg tttctcttgc tccacgtcca ggccctcgcc gaacagcatc      6480
     gctcgtctcg cgtttcagca acgcatcgag atcgggaggg taaggtcacg cgccggaagc      6540
     ttcgccacgt ggcatcttcc atgcagcgta ccggatggtc gcgaactgga agaacaggaa      6600
     cgccagcgtc gcctgctggg cgatcctcat ctcctccggc tcgccgtcgc cttgttgtag      6660
     atcagctcgc aggactggcc tgtctggtcg aggcgggtct cggtccacat gagctgtatc      6720
     gtgatcaggc cggggacgtg ggtgacctca tagccgccga tcttgtgaac aggcccggag      6780
     tcggtggacc aggtcttctc cacgccctcc tcctccacct ggacatcgcc gtgtccggcg      6840
     gcatggccgc gggtcttcgt gcccggtcgc gagaaggtga agttgaaggt gaagcggcga      6900
     ggtgcgcgga tcgggatcag ctcgatcagg cggtgtgcat cggagatggc aaaggtcggc      6960
     tcatccgcga cgagccgatc aaggatcgca ttcgcttcga gacgctcggc aagggtcatc      7020
     tgggcggtca cggcgcactc tctccatgag cgaccgcggc aaggctaatc cgatgaggcg      7080
     gcaggctcga cggggaagaa gccgcctatg gtcatgacgg cgatgtggta tcagggggaa      7140
     gtgaggacgg cggtgggcta gaccgccgcc ctcggtttca cagagccctt accagatcag      7200
     cgggaaggcg gtgtggagat agaccctcca gccgccttcc ttcatgcagg gccccggtct      7260
     ggcagatcct tcgagcgagg tggagaccgc ggtgcgcttc gctggtgagc cgaaggcggg      7320
     tggatgcacg cggaggtcat tccgagactc cgtgtgtgac gagtggggcg tagcatgtcc      7380
     ttaatcagca tcacccgcct acgggtacgc tcgatccgct tcctaccagc gttcgccctc      7440
     cacgtgctgc gctctcgcaa tcaggtccgt catgcgccgg gcttccaggg tggctcgcta      7500
     ttgctcgact gggggtgggc cttctggacc atgacggcct gggacaccga ggagaacatg      7560
     cgccgctaca tgaccactgg cgcgcatcgc atcgtgatgc cttacctgct cgactggtgc      7620
     gatgaggcgt ccgttgtgca ttggacacaa ccggagacca ccctgccatc ctgggccgag      7680
     gctgaccggc ggatgcgtga gagcgggcga ccgtccaagg tgcgtaaccc cagtccccaa      7740
     cacgcgacgc tgacctatcg aggaccgcgc ttcacaaggg gtggacctat caggccagcc      7800
     gcctgctcga actgagacgt cccaccccgc acgaaactaa tttcgcacct caggcgattt      7860
     cgccccccaa gagccggtag acgctcgccc gcccgatctt catgcgcttc gcgatcgcgg      7920
     ccggacccag cccctccgcc ttgagcaccc ggacctgcgc cgcgtcgatc gagggcggcc      7980
     ggcccttgta gatcccctcg gccttggcga tggcctccag ctggcgctct cggcggaggt      8040
     tgtcctacag cggtccggcc ctgatcgcct gccaggcaca atcgtctggc ttggaggggc      8100
     aagggcaggg agggggcgcc tacgcgcgac ccggaagacc ggctttagct cgtaaccggc      8160
     cgttcgcccc cagctgctag tggtccaaat ctgacgcttg gtacccactc aggagggccg      8220
     ctcagggtgg agagtgggcc tcagtaacct cacaccaagc ggacgttcga gccgcgaacg      8280
     acgtctcgca tccgcgtcgt cgttcagaag ctgcgcctgc gacgcctgcc atgtggagcc      8340
     aaccggacgt ggtctgagcc gacgggctga gcgctctcac cctccggccg cgagcgcgac      8400
     cgcatcggcg cccgcggaga ggcgcatggg caggtcagac cgcggagagt tgcacgaggt      8460
     cgggcgagga gcgcagccga cgcatcgtca tccgcgccgg gccgcctcga tcgccgcgac      8520
     gtcgatcttg cgcatggtca tcatggccgt gaaggcgcgt ttcgccgcct cgccgccggc      8580
     cgccatcgcg gcggtgagca cgcgcggcgt gatctgccac gagatgcccc agcgatcctt      8640
     gcaccagccg caggcgcttt cctgtccgcc gttgccgacg atcgcgttcc acagacgatc      8700
     cgtctccgct tggtcgtccg tggcgatctg gaacgagaag gcctcgttgt gctggaagac      8760
     gggcccgccg ttcaggccga tgcacgggat gccagccacc gtgaactcga ccgtcagcac      8820
     gtcgcccgcc tttcccgacg ggtagtcggc cggcgcccgg tggacggccc ccatcgcgct      8880
     ctctgggaaa gtctcgacgt agaagcgggc ggcagcctcg gcgtctttgt cgtaccagag      8940
     gcagatcgtg ttcttggcga ccatggtggc tcctccctcg cgctgccggc gaccgggcat      9000
     cgccttcgac ccgcatggat gctgtaacag catgagatga acgatagacg aagatggccc      9060
     cgccgccggc ttctgccggg cggacgaggc catctccacg tcggcctctg ttgatccggg      9120
     tcgttgcccg gccgcctcgg gttctgcctc ccagccccga agtcatgaag gcagcatgca      9180
     gggcaatctt gaaccgtcag ctaagaagcg cggtgaacgt ccaggccagg aaccttgacg      9240
     aagccttgcc gacctctcgg ccctactctg aggccgcagc cttgcgcggc cggccgcggc      9300
     ccttcttcag ccccgcaggc ccacgtgctg aacctcgtcc atgatctcga ccagaagggc      9360
     gcctcgctgc gcatcctcga tccggagctg acgacgggcg gcgaggtcgg ccggatcgtg      9420
     gtgaccgtgc tgggcatggt ggcggagatg gagcgcaagt tcatcctgga gcggcagcgg      9480
     gctgggatcg aggcggcgaa ggcggccggc atctatgcgg ggaagggaag ggcgaagacc      9540
     gtgcccgacg cggagatccg ccggcgccat gcggccggga cgggcccgac ggccattgct      9600
     cgccagcgcg ggatctcgcg cacgagcgtc taccgcgcgc tccgaatggc ggtggccgcg      9660
     ccgacccgcg cgaaggtgta gaccatcagg ccgatcaggg cgcggtcccg caggccgatc      9720
     ggcgtgctgg tgtcgatggc atctaggatc gcgcgcgcct cctccggcgt gaggaccggg      9780
     gttttgcccc gcttcacgac gtgcttcggc cccggacggc ggtggccggg ttgaacggca      9840
     acaccccgcc ggtcgccagc aagtcgaaca ccatggggat tgccgcgagg cgctgtttga      9900
     ccgtgggcgc gctgtggctg cgccccagct cctccacgta ggcggcaaca tggatcgagc      9960
     tgacggcggt gatcgacggc aggctgtggt gcccaaccga gtgcagaact cgcccaccgc     10020
     cttggcgtag gcgccacgag tgttggggtt gcggatctgc gccgtaaaga actcagggaa     10080
     gcggtaggcg gcgcgatcgc ccgccgctgt gaccaggaca ggggcgggga gggcgtgcag     10140
     ggtggcgagc tggttcatgc tgcgccctcc ccagttatga tgcgctgaca aacgcgctca     10200
     gccgcagcaa ccgcctgctc catctgctca gctaactggt caggcgcgtt aggatcgcct     10260
     gcccccatcc aaatgtcggc ttcgcaccta tcccgtagcg cttggttgcg ctgccgaccc     10320
     tcaccggacc catcgaccaa ccgcatgagt gtgccagctg atacctgcac gcggaccaga     10380
     atttcatgca ccgcttgaaa tgccgcatca atctcggcac caagcatcgc cttgctccga     10440
     tatcggcggc tcatcattcc tgaaaggaat tcgctgtttc tcctgatgct cgcaagcggt     10500
     acgaagtatg tatttctgtt ctgtgcttgc cattccgtct cgcctggctc cggcgtccgc     10560
     tcctcccatt cattactaag agcgcccgaa tttctgatct cctgaagcac ggcggtcatt     10620
     tggtaaaaat cagaaaggac cgtctcagcc agttcgacac cgcgcttatg atcgtttaga     10680
     tctcggtcgt atctgaattt acgctcagca agatccttat caaactcgga cttacgctct     10740
     gccaaggtcc ggtccgctgt cagcctctcc ctatgagtgg caagcgtggt tgcccggttc     10800
     accacaaagc caaccgtcga aacaatgcct gaaacggctg ctgccactac tgccggaccg     10860
     atccaatcca tagctcctcc atatagatga tagttagaag aacgctacta aaacatagca     10920
     tacagcaatt tatatgaact tttgatagcg ggaatcgata caaaagctat acctacacca     10980
     tacagcacga atgccggccg caggaacggc gagccttgca cgataggcga gcacccagcg     11040
     gttgatggtg gagtggtcga cagtcaggtc gcgctccagc agcatctcct cgatgtcgcg     11100
     gtcgctgagg gcgtcgcgca gggaccagga gacggcctgc acgatcagcg tcgcctcgaa     11160
     gtgccggccc ttgaagtcgc cgcgggcctg gcgcttcagc gtgagggcga gggcggtgag     11220
     gatcatgggc cgcctccggg atggaagcgg caagctgggc gggtatgccg gggtcagttc     11280
     cgactgaggg cgaaatgaca cccgagcgca tatgcgtcaa tgcagggaag gggttgcgcg     11340
     actgtagttc ttagactaca ataacctcgt gattgagtta aagcagacgg ccaccttcgc     11400
     caaatgggaa tcccgcctcc gggacaagcg agccagaacc attatcgcgg cgcgattgat     11460
     gcggctggcc gaaggcttgc cgggcgacgt ggagccggta ggcgaaggcg ttagcgaact     11520
     gcggattcac tacggccccg gatatcgcgt ctacttccag cagcgcggaa atctcctgat     11580
     cgtgttgcta tgcggcgggg acaagggatc gcaagcccgc gacattgccg ccgccaagaa     11640
     actcgccaaa gaatggagtt cacaagatgc ctgaaaaact gaccacttac gaccctgccg     11700
     ccgcactggt ggacgatgag gagatcgccg ctttcatggc cgatgccttt gaaactggcg     11760
     atgcggccta tgtcgccaag gcgcttggcg tcgtcgcccg cgccaaaggc atgaccgaaa     11820
     tatcccgcaa aaccgggcta tcccgtgaac agctttaccg ttcgttcagc gagcacggaa     11880
     acccgaccct caagaccacg cttgcggtga tgcgcgccct gggcgttgac ataacggcca     11940
     aagcccgtgc agcacagtga ccttgcctct ggctcctgat catcgtccca tttgaactga     12000
     aggctatttg agaaaaaaat cgatccttac agatcaaggc tttacgcgta tgaaccctac     12060
     gagggttcaa ttgggacagt gagaatagcc ttcgggtgtc atttcgccct cagccggaac     12120
     cgaccccaaa gtcgtaatta cccacggggt gcgcgcgagc gcggcgtgac ccacaagcga     12180
     ggccgctaga gggagttcgc cgcgcctctt gccgggaggc gatttggctg attccctcgt     12240
     gggatgggcc gcagcgagct ggaacgcctg agcaagcagg agctgatcga gctggtgctg     12300
     cggctgcagc gccccgagaa gacctcgcgc acctcgtcca agccgccctc gaccgaccgc     12360
     aaggagcggc gcgagcaggc caagcccggc ggcgccaagc cgggtcacga gggacatagc     12420
     cgaacgctca gccccgatcc cgacgagatc gtcgctcacc gcccgggtca ctgcccctgc     12480
     tgcggaggtg ttctggctcc ggatctgccg gccgagatcg tcagcgtgtg cgagcagatc     12540
     gacttgcccg cggtggcacc gatggtcacc cagcatcaac ggctcgccgt ccgctgcccg     12600
     gcttgtggca cgcgcgtcgt cgctccagtg ccgcaggccg cacgcggcac gccgttcggc     12660
     ccgcgcctgc acgcggtggc ggtgtatctg aagaccttcc aggctctgtc ctacgagcgg     12720
     ctgcaggccg cgttgtcgga cctgttcggg ctcaccttga gccagggcgg gctgatgaac     12780
     ctgctgcgtc gggcccagag gcagttccgt gccgatcgcg aagctgcggt ctcggcgctg     12840
     cgccgggccg cggtagtcgc ctcggatgag accggcgtgc gcatcgaggg cagcaactcg     12900
     tatcattggg tgttccgctc ggacgcagcg gtcgttcatc acgcggcctc gacgcgggcc     12960
     gccgcggtgg tgcacgcgat gatggacgga caccggccgt ccgtgtggct gtcggaccgc     13020
     tacaccgccc agcagggcca cggtgagcat caccagacct gcctggcgca tttggcccgt     13080
     gacgtcgcct acgcggtcga ggtcagcgac gaccccgtgc cgctgcgcct acaactctgg     13140
     ctgggaagcg tgttcagcct ggccgagcgc gtcaccgacc tggccgcctc gacgctctcg     13200
     gccaagcgcc gggccctgga tcggcagctg tccgccatcc tcgctgcacc aagccgctgc     13260
     gatctgaccc gcgctctgca agccaagatc ggccgagccc gcgaccagct cctggtcttc     13320
     ctcgaccatc ccggccgcgt ggcggtcacc aacaacgctt gcgagcgcgc gctgcgcccg     13380
     gcagtggtgc agcggaaggt gacgaacggc tatcgggcca tgtgggcggc cgcgggtgag     13440
     gcggacgtgc gcaccgtcgt cgacacggcc cgcctctcgg gggccggcac cttcgccact     13500
     atcctcaaca tcatccgcgc ctgatcctac cgccacgggc gtgggtaatt acccaaagtc     13560
     ggcgtgtcga tcgggcgttt cttgaagcgc ctgatcgaca ctagaacagc gcatgatcgc     13620
     ccgtcgccgg tgatcgcaac ggtgacgggt acccgatgcg gatcctcgtt ctcggtggat     13680
     acggcctcat cggcacggcc gtcatcctgc ggctgctcag cgccgggcat tccgtgatcg     13740
     cgctcggccg gtccgccgtg gcggctcgcc gccgctttcc ggaagtctcc tggatcgaga     13800
     cggacatcgc cggcctgagc ggggcggaga gctggcgacc gctcatcgcc gactgtgatg     13860
     ccgtcgtgaa ctgcgcgggc gcgcttcagg acggagcccg cgacgacctg cacgcggtgc     13920
     agtcgaccgc aatgcaggcg ctcttcctgg cctgtgaagc cgccgggatc cgcagggtcg     13980
     tgcagatctc cgccgtcggc gcatcgccga gcgcgacaac tgcgttcatg cgcacccagg     14040
     cggaggcaga tggcactctc tcccggctcg atctcgattg gacgatcctg cggcctgggc     14100
     tcgtcctcgc cccggccgct tacggcggga cggcgctgtt gcgggcgctc gcctccatcc     14160
     cggtcgtgct ccaccgcatg tggtgcgatg ggagtgcgtt ccgcttcggt caggagccgg     14220
     ccgtgacggc ggccgcttga gagagacacc ctggcaggag ccggcgagcc tgcctctgcc     14280
     ggagtgagcc ggatcgttcc cgcggggacg aggggcgagg tgatcgcgat gagagtccag     14340
     aaccggtcgg cgcaagcagg gcttgtcgca aactcgggtg cgagccgcag aaggggctcg     14400
     gctaccccgc tttcacgctt tgttcgcgac gggaagtccg aagcaatgcg caagcagctg     14460
     gttctgctcg cgcacggtcc acgcgcctga aaacccgaag cccgtgcgca gccacagcat     14520
     cgccgctaag ccctggatcg tgcgccgggc cgtggtgaag gagcggaacc cgcctacccg     14580
     cggcatcggc cgcttcaccc ggaagtgatc gctctcaatc ccctgctgca ggggcttggt     14640
     gacgtggtgg gtgggcgtgc gaggcagcag gccctccttg cggctctcgg cgatcgccgg     14700
     cgggtaagga ccggccccat cggtgccgat ccggtccgga gcgagcaacg gctgatcctg     14760
     cagcatcgtg cggaagaagc gcttggccgc atcgagatcg cgctgggcca tgagcaggaa     14820
     gtcgaccggc tcgccgggct tgtcgatggc ccggtccagg gagcgccact ggccgcggat     14880
     cttgatgtcc gtttcgtcga cgcgcacgga tccgcaatgc ggcttgcgga acatgctcag     14940
     ccgacgctcg atggcaggcg cgtcggcaag caccccgcgg ttgagggtgg agtggtccac     15000
     ctccaagcca cgctccagca gcatatcctc gatctcgcgg tcgctgaggg cgtagcgcag     15060
     ggactaggag acggcctgca cgatgagggt ggcctcgaag tgccggcccc tgaagtcacc     15120
     gcgggcctgt cgcttcagct tgagggcgag ggcgttgagg atcatgggcc ggctccgggg     15180
     tggaggcggc aagccgggcg ggtatgccta acggctggtg aacgtcatcg cgtttgcgac     15240
     aggcccaccg caagcctcgc ctgaggcgaa gtgatgttgc ccggcacacg acctcgatga     15300
     gacataagtt gtatttataa ctattaaaat taagatgcat tttcctaatg atagaatcac     15360
     ggttagacgg cgtaagtgga ttgacgttca gagctccgtg ccgtagggcg aagccaacgt     15420
     ggccattgcc gaaaatttgt gaacacgact gtgaagaccg tcaatattag cattgtcgtt     15480
     acggcagcct ggtcgatagc atcagtggcc tcgtgggcgg ttctgggacc gcaggcagtg     15540
     gctgcgcagg ccgcagctga cgcctccccg gagattcagc ttgaggagat ctctgtcgct     15600
     gggagcggcg gcgtgcccct gaagaccgag ggctatctgg cacgcaacag cgtgagcgcg     15660
     acccgcaccg acacgccgct gcgcgaggtg ccgcaggccg tcgtgccggt gccgcggcag     15720
     gttctggagg atgcggcggc gacgcggatc gacacggccc tcgacctcgc cggtgtcggc     15780
     cgctcgaaca acttcgcggg cctcggcctc accgagttca ccatccgggg cttcgccacc     15840
     ggcgagtatt accgcaacgg cttcccgatc aatcgcggct accccaactc gcccgacatc     15900
     gtgtccatcg agcggatcga ggtgctgaag gggccctcag ccttcctata cggacgaggc     15960
     gatccgggcg gcaccttcaa catcgtcacc aggcagccga ccgccgagcg ctccttcgcc     16020
     ctcggcacgc agtacggcag cgacaacgcc aagcgcagca ccttcgacgc caccggcgcc     16080
     ctcgacgagg gcggcacggt gctcgcccgc ctcaccggcg cggtggagga caacggcagc     16140
     ttccgcgact tcgtccacag cgaccgctac tacctcgccc ccgtcatcgc ctggaagccg     16200
     agtgccgaca ccacgatgac gctggaaggc gagttcatca gcgccgggca gatcttcgac     16260
     cgtggcatcg tgccgttccg cggcgacctg cgggcggtgc cgcgcacccg ctacatcggc     16320
     gagccgggcc tgccgccgtt ccgcaacgac aacgcgctgg gccagctgcg cgtcgagcac     16380
     cggttcaact cggactgggt gctgagcgcg ggcacgcagg tgctggccgg caacatcgcc     16440
     ggtgaggccg tccagaccgt tgggttcctc ggcgacggcc gcctgctccg gcgcaccctc     16500
     gaccggcgcg agctgacctg gtccgacctc gacctgcaga tcaacctcgc gggcaagttc     16560
     gagaccggct tcctgcgcca cactctcctc gtcggcctcg agcacgaccg cctccgctat     16620
     cgcgaggaca tcacgcgctc gaacttcaac accaatccct tcgtccttga cctgttcgcg     16680
     ccccgctacg gccaggcttt gcccgccctc acggtgccga gcagcaacct cctgcagaac     16740
     acgacgagct acgccggcta cgtccaggac cagatcgacc tcacgcccaa gctccacgcc     16800
     ctgctggggg tgcgcgtcga ggacatcgcc ctcgacacga ccaactacat caacggcgtg     16860
     agcacgaagc tgcagggcac ggcggcgacg ccgcgcttcg gcctggtcta cgacctgtcc     16920
     gacatcgcct cggtctatgg cagctacgcc cagtcgttcc ggccgaatac cggcgccgac     16980
     cggtccggcc ggcccttccc gttccagcag gccgagagct acgagaccgg cgtcaagctc     17040
     agcctgctcg acgggcggct cgacgcgacc gcggccttct tcgacatccg gcgcaccaac     17100
     cagctcgtca ccgatccggt cgaccagaac ttcagcgtcg cgaccggcgc ggcgcgcagc     17160
     cgcggcttcg acctcacggt cgccggcttc ttggccccgg gctggcgggt gatcggcacc     17220
     tacgccttcg tcgatgccgc gatcacccgc gactcgacgc tcccggtcgg cacccgcctc     17280
     gccaacatcc cgcagaacag cttcgcgctg cagagcgtct acgagttcca gagcggaccc     17340
     ctgcgcggcc tcggcctcgg tggcggcgtc acctacgtcg actcccgtgt cgctgggacg     17400
     gccctgtcga ccttcacgat gccggcctat accctcgcca acctcatctc ctactactgg     17460
     atcacgccgg aggtgcgggt gtacctgaac gtcgacaacc tgttcgacga gcgctacttc     17520
     gaccgctcgt tccagaaccg ctacgcgacg ccaggccagc cgcgcacgat catgggcggg     17580
     gtcgccgccc ggttctgaca ggggccggcg ggccggatct ccaatcggag ggaacactcc     17640
     ggcctgtggc gcgatcggca ttccgatagg tcgagcttaa ctctggaacc agctaagctc     17700
     cccggggagc agggatgccg atccggccgg agcaccgctt cttctacccc atcgactggc     17760
     cccagctctc caacgcaatc cgcttccgcc gggcgcgggg ccggtgcgag gcgtgcgctc     17820
     gcccgcacct ttagcgggta ttccacctcg gtgacggtcg ctggtggggg cggcaaggac     17880
     gccctgtcgt cctggctgga gtcgacctcc tggcagagct tcagcgcgat ctcggacctc     17940
     gacacggcca aatggctgtc cgagcgctgc ggctcgttca cccagaacgt ggtgtcctac     18000
     agccagcagg cgcgcgcggg cgggggcaag ggcggcggct cggtcagcct gtcggcctcg     18060
     accaatctgc agaagcggcc gctgatcttt cccgacgaga tcatgtcggc gatgcggcgc     18120
     gacgagcagc tgctgttcgt ggccgggatc gcgccgatcc gctgcggccg gccgatctat     18180
     ttccggcgtc cggagatggt gaggctgtgc gcgcagaacc gcttcgcggc gcgcgcctcg     18240
     ggggtggatg cagggccggc cacggccggg gcaagcgggg cgaatgccgc gaccggcagc     18300
     ccggcctgaa gccccggaac gccgccccgg gcggcaacgc ccgcgcgggg gatcggggtg     18360
     gcatgccgcc ccgatccccc ctctcaacct tgtcgcgttt cgcgtcgtat cgcccccacc     18420
     ttcccgggag gatcaggccg cccgtgggcg gccttctccg gtcagcaggc tgaccggagg     18480
     tccgcgagct gcgcgcgcgc cgtgcgaagg tcgcgctcga tctgacggcg ctcggcgggg     18540
     cagaggacgg aggccagctc ggcccggagt tcctcaacgt gagcctggag ggcgagacgg     18600
     gcggcggcgg gagcggaggc gaggcgcggc atcgggtggg gtccctggtg cgctcgggac     18660
     cgtcccgggc gcgatggcga cctcagaacg ggcctcggcg ccgcctgcac cccgaagggg     18720
     ccgcagcgca gcggaggagc cgccctgcgg cttgcgggcg gcgccgaggc cggtttcctg     18780
     tcgctgatcg tgcccgggac ggtccgacgg cgccggagag ggcacgggcc gcgcatggcc     18840
     ggcggtgcca aagggggcgc gggcggcacc tggcgcggag gtggccggaa ggggcgtgcg     18900
     ggccggaccg ctcccgccac ggtcccggac gatgcacggg ctcggcgggg gacggaacac     18960
     gcggtcgcgc gttgcgcgag ggatcgtaac cccgccggag gccgaaaccc gtttacgggg     19020
     ttcggggagc cgccgcaggc ggcgagtaga gcccggtccc gcagggacgc gcccagctcc     19080
     tgcccggctc gatgtgcgct cggaggtttc gcggccgaac cccgccttgc tctcggacac     19140
     gcagacgtag aggtaggaaa cgacatcacc ggaattggtt gcatgttgat cagccatcgc     19200
     ccttgtcgtt tctggatcat tatgctgagc ttggccctga agcggggacg atctcgaatg     19260
     tagccggccg gaaccgcccg tctttcccaa cgctggttgc gcctacctgt tcgatcgcga     19320
     tgggcaacga tgggaggtga gcttcggccg ccaattcctg cctcgctatc gcgagttccg     19380
     cgagcgcccc acggttctcc tcgacagttt ccgagagccg agcagatgat gaaacacaat     19440
     ctatccatca gcctcttcgc tgcggctgca ctcgtcgcta ccttatcctt tgcgcacgcc     19500
     ctggataatg gcttcgatca tgtgcgcgcc ggaccccttc gctacaagat tccgaagagt     19560
     ttcaaggcag ataacacgtc tggaactgaa ctatttctta taattagcct tccagattgg     19620
     ggcccgccgg aaaagcatcg gcccggctgg gagttcgccg cgcacattct cgtcacctct     19680
     cgacctgctc cgattggggt tatttatgac tatcagtggg atggaacacc ggtaggaagt     19740
     caaacaactt ggacgaaaat caaacgtatc taccggattg agccgggcct cacggtccaa     19800
     gaaatgggtt cttccgcact ttgcgtggaa cggtcgcggt gacgcgggaa gcgcaggctg     19860
     attcacgagg cggatgatcc tgtcctcatc cctgccgggc tgcacgatcg agcgggtctt     19920
     tcgccacacc gatcaccttg tcgtcatcgc ccatggccgc cgttgtcatg gtcgatgtcc     19980
     gacctgtggc acgcccagtt ccgccgttca cagccgctat gatcgccgtc cggccgatct     20040
     gccgagcatg ggccagcctg tgacgctgcg cctgcgtatc cgacgcttct actgccatca     20100
     tcccgcttgc cgccgccgca cgttcgccga gcctcttccg cggctgatac cgccgcgagc     20160
     gcgccggacc cgccgcctcg ctcaggccca gacccggatc gggcttgcag tcggcggcga     20220
     ggccggcgcg cgcctgaccg gccacctggg gatgcaaacc agccccgaca cgatcctgcg     20280
     cctcgtgcac cgcctcccgt tgccgagagc gaacgcgccg cgcgccgtgg gcatcgacga     20340
     ctgggccatc cgcaaaggtc ggagctacgg cacgcttctc gtcgacctcg aacggcgatg     20400
     cccgatcgac ctgctgcccg accgctcagg ggcgaccgtt gccgcatggc tgcgtcgcca     20460
     tcccagcatc cagatcgtcg cccgcgaccg ctcgaccgag tacgcccgag cggccaccgc     20520
     gggcgcgccg gccgccctcc aggtcgccga ccgatggcac ctgctcctca acctgcgcca     20580
     ggttctcgaa cgctggcttg gccgcgtcca tggccggctg cgacagctcc ctcctcttgc     20640
     gagtggtgac ggacgacagc caggggagcg cccgcgcgcc tatcgccgca gcgcagccga     20700
     gattgccgtc agcctcgaca gccgcgcccg ccggctggcg gcctatgagg acgtgcgccg     20760
     acgccatctc gctggcgaga ccctcctggc gatcggccgc gccacgggtc tggcgcgagc     20820
     gaccgtgcgc aagtacgccc aggccgagag cttcccggag cgcgcgatcc gcagacccaa     20880
     tccctctcgc ctcgatccct acctcgccca tctggagcag cgcatggccg agggctgcga     20940
     gaacgctatg gcgctctggc gcgagatccg ccgccagggc ttcgcgggaa cccatcggca     21000
     ggtgcaccgc ttcgtcgccg agcggcgcac ggctcgcaaa tggctgtcgc agcccgcctc     21060
     gacgagcact gaggcgatca gaccctcacc catcgcctca cccaagcaac tggcctggat     21120
     cctggtgcag cccctcgcga cactgcagcc ccgcgccgcg gctgacctcg cccgcatccg     21180
     gcaggatcct gaagccgcac ggatcgccga tctggcgcgg cggttcacga tgctcgtgcg     21240
     tgcctgtggc ctgggcggcg accggccggc ggaccctgcc agcgagctcg acagatggct     21300
     gctcgaaacc cggaactgcg gtgtcgctgc gctggagacc ttcgcggccg gtttggcgca     21360
     ggatggggcg gccgttcggg cggcgctgac gacgtcctgg agcaatgctc aggcggaagg     21420
     gcagatcagt cggctgaaga tgctcaagcg caccatgtac ggtcgcgcca gcttcgcact     21480
     cctccgtagc cgcatcctca tcgctgcctg atccacgcaa agtgcggaag aaccaagaaa     21540
     tggggtctgg ttttgacatc gtggtccccg atcaagatcg caagtcgatg ccgattggcg     21600
     ttctcgaatg cagccggcca gaaccgcccg tctttcccaa cgctggttgt gcctaccggt     21660
     tcgatcgcga tgggcaacgc tggcaagtca gcttcggccg ccaattcctg cctcgctatc     21720
     gcgagttccg cgagcgcgca acagcccttc ttgatagctt ccgcgagcaa taggtctctc     21780
     agcgacttct ctgacccaaa ctcaaatcga tgaactgtct gccatcgcca gcagcggcca     21840
     aagcggggcg agggtggcct attacaccaa gctcgcagaa tttggcgtga catatggcag     21900
     cctcgctcta ggagtggtgc tcgaggacca gctcagcggc cgcgtcgcaa atgcctactt     21960
     catggcggtt gcgggcccga gaaggcgtct atgtcgagcc ctggcaatgg gcggctatcg     22020
     gcgacgcctt aatgcatcga gatctcgctg cccggcgagc tagcgctcag attgatgcag     22080
     acggcagtat ctattacccg gacctcggct acggcgtcat tcgagactat cacgaattcg     22140
     ccttccgcaa tctcgggggt acggttccgg acgggcaggg cgtcacgatt gaggcttgga     22200
     ccgcttacgc ccctatcgag gtcttgggca cgagcacatg ggagagaatg ctagcggact     22260
     cattggtcga gcagcttggg gtcggcgcgg gcgttgctgc gcagatggtc gttgccacct     22320
     ggacccccct gatgtcggga atgtcgtttg agaagcagcc cttagcggag cgctggctgg     22380
     atacgctttg gcaggcgcga tccgcgccct tcgcagaggg atcgccactc gccttcccga     22440
     cggaagtgga gaatgcctac attgtcatgg gcacccgtgg tgacgatacg ctgagggcca     22500
     acgaggaggc agcacaaggc cgagatatca tgcttctcgg cttgaatggg aatgacacga     22560
     tcaccgcggc ccaatcggga ggatatgtcg acgccggcgc tggagatgac ctcatcatcg     22620
     gccagggctc taatgcgaaa gtcgacggcg gatcaggttt tgatagccta cagctcaatg     22680
     ctcccgatgc aacatcgaag gcttatattt ttattgatga cgcttattac gataagttct     22740
     ccggcggatc atactatttt actacaagac cacactcaac gacatccggc atcgaaggtg     22800
     agcgatttgc acgcatcgaa acccttgcag ggacatccgg cgatgacagg tttttggttt     22860
     acactttatc gacacaggtt ctgccaaata taaccttgga tgccggcccc gggatagacg     22920
     agatctcact agaatttttg ggcgatcttc ctgtagtggt tgatcttctg caaacccgca     22980
     attcagcaga aatcctagga gtcactgatc ccggtagtat cacattcaac ctgagcaatt     23040
     ttgagaatgt gaccaccggt aaagggaatg acattgtctt tggaagcaac tcggacaatg     23100
     caatatccgt tggggatgga cgtaacgagg cgcatggccg cgacgggaat gataggcttt     23160
     ctggcggaaa aggcatcgac cgattgtatg gcgaccgagg aaaagacgaa atattaggcc     23220
     atgatggcaa tgatctcctc gacggtggag acaatgacga caaattatac ggaatggaag     23280
     gcgacgacat acttcaggga gggagcggca atgatttcct gaccggcggc tctggtaaag     23340
     atcttctgga cggcggcgca ggcgataacg aactgtttgc gtatgaagcg gagggtggcg     23400
     ataccctccg gggggcgctg gaaacgaccg gcttcatgca tcaggcggca acaatcttct     23460
     tgaaggtgga gatggtatag acgttctcca agtctggtcg ggaaacaaca cacttcgagg     23520
     aggggcagga gacgacaact tgattggagg atcagggaat gatgtgctcg acggtggccc     23580
     tggcaatgat cgactatggg gcacatcagg tgctgatctg ttcgttttga gcccaggaca     23640
     ggattttatt tatgatttcg ccttaggtca agaccgattg gttggctcca ggggcatttt     23700
     ttcggagacg ggaaacatct ttgaagtatt actgacacac gataaaggaa gtacagtaat     23760
     tagttttggt cgcctgcaag attttcagca ttacaatgat cttggtcttt tatgggcgta     23820
     aggagttgag gcccggggtg gtgcggtagg atgggacgtc tgcggagaga ggactgtgcc     23880
     ggggggctgc cgtttgttct cattatgttc taacatcgcc ccgcacgcga gtcacgcagg     23940
     aggggcggag catggggcag ggacgaggca tcggcggcgc gcgggtcacc tgcctcgctc     24000
     aatacttctc aacagcggat ctcataggtg acgtcgaacg tcctttcgcc ctcatagccg     24060
     agaaggtgct cgccgtggat gcttattaag cgccgatatc cgacagtttt gtcatgtaat     24120
     ttcggcgatg attttctgga tctagatcgc taaccagtat gatctttaat cgactttgtg     24180
     gcttccggaa cgagccggcg cctaagcgcc ggcccgcacg ccccgctgca ccggaatgcc     24240
     cttggcgcga gccttgtcgg cgaggttgtc gctgatgccg ccgcccggga aatggacgac     24300
     cccgatcggc atcgcctcca gcagcgcgtc gttgcgccgg aagggggcgg ccttgccgtg     24360
     cttcgtccag tcgggacgga acgccacctg cggcacctgg cggctgtcgg cccacttcgc     24420
     cgcgatcagc tccgctccct tcgggctgcc gccgtgcagc agcaccatgc cggggtgctt     24480
     cgccttcacc cggtcgagca ccacccagat ccgttccacg tcctgatagt cctggccgcc     24540
     ggtgaaggcg atccgcggcc ccggcggcac caggatctcg gtctcggcct tgcgcttggc     24600
     cgcgaggaag tcccggctgt cgatcatcgc cgccgtcatg gtgcggtggt tgacctgcga     24660
     gccggagcgg gggcgccaga gcgagccggt gtggacgcga tagacctcgg ccgcggcgtc     24720
     gcgggcgaac tcgaaggcgt tgcgccgctc cgtcaggctg agccccagcg cgatcagccg     24780
     ttccagctcg accgagcgga cctcgctgcc gtcctgctcg ccctgggact ggcgctgcgc     24840
     cagctcgttg tcgtcgagct tgcggtcgag ctgttcggcc cgccggtgga agaggttgac     24900
     gaagccccag agcaggtccg aggcatcgtc ctcgaggcgg gtgccggcga agacgtcggc     24960
     cagggcgttc atggcgccga gcatcgcgct ctcgactgcc tcgggctccg gcagcgggcg     25020
     cggatcggcg tcctgctcga aggggcggta gtggtgcgtc agcagctcct ccagcaggtg     25080
     gccgccctga ccggcgccat ggtgatccgt gaaggaggaa acgggggagt cgagcatggg     25140
     agcgccttcg ggtccgggaa gccgcgaccg ccgcggcctt catggcgact cctcaccggg     25200
     tcagggtggc gcgcgcaccc ggagggccgg agcggagcgg aggacagccg caggctgttg     25260
     cgcgcgacaa ccgacccggt atcggtcgcc ctctgaagaa ggccgctgcg cgggctctcc     25320
     gggccgcggg gcctgcccgt cgatcagccc tcacgctcct ctctccgatc ggctcagacc     25380
     accgcgtcag gctcgatggc ctcgaggcgg aggaagtgca tcgcatcctg ctccgcgagc     25440
     tggggcgcga gatggagcgc caggccgccc gggccgcgcg ccatcaggtc ggtgttgaag     25500
     tcatcggccg ccggcacgag ctcccatacc tcggggacgc cggcggcctc ggcccgggct     25560
     cgcagggtcg tgtaggcgcg cacgccctcc ggatcgccgt cgcgggcgac atagaggcgc     25620
     cgcaggccgg gaggaaggac gagggcggcg aggtggttgg ccgagagggc cgccgccgct     25680
     gagatcgccg gcatcacggc gtgcaccgat agcgtggtct ccagcccctc gccggccacc     25740
     agcgtgtccg gcacggcgcc ggggaaccgg accccgtggc cgagctggtg gccgagagag     25800
     cgccgcgggt cggccagcgc cgccttgccg cgcccgtccg gagcaagcca agtgcgggcg     25860
     acgccggtga ccgtgccgtg caggtcggtg acggcggcca gcagggctgg atgctgctgg     25920
     gatggctcgt cgtccgagac acgatggtag cagcgcggat ggtagcgcag ggcgggcagg     25980
     ccgatggcgc gggcgagccc acgcccggcg aggtaggtgg ctgcgggcgt gccggccacg     26040
     gatcgcccgg accggaacag gcgccgggca gcctccaccg tgtcacgcgt cgcaagcgcc     26100
     ggtccgccct ggcctgaggc ctccggccgg gcgggcctcg gcaggcgcag gaattcgcgc     26160
     gcctcctcca gggtctcgcg ccagtcgtcg tggccgcggt tgagccggat caggtcgagg     26220
     aggtcgccgt actcgccgct cgcggcatcg acccatcggc cgcgcgcgcc cttgccggag     26280
     ctggggccgg tcaggcgcac gtacagggac gagccggcgc tgttgttcac atcgccgacg     26340
     agccagtagc ggccctgccg gcggccattg gagaggtagt gacggcagac cacctcggcg     26400
     atctcgccga gacggcgcgc gagctcggct gccggatgcg acggcatgga agtctccggg     26460
     tgcgaaagga cgaagccagg ctgccgtaga gatacaccgg atgagcggaa gccgggccag     26520
     gagcatggcg aggatagttg gcccatcctt tgggtcacgg gctggctctg aagggtgcgc     26580
     ctcggggagc ggccgtctcg ccaccttccc caaggttcat ccttcgcccg ctgccctctt     26640
     gctttcgaac atcggcgcgc acccgcacgg ttcgcgctcg aagacctgtc cggccgtcga     26700
     gaacaggagc cgaaggtctt gacggttacg actgccaagc cccatctgac ctctttcacc     26760
     gggaggatca gggtggtcaa tcaggtcgcg cagcagccgg atgaagcgat cgtccggacg     26820
     gccacaatcg tgatggccta cgtgtccaac aacagtctcc gacccgccga gctgccggac     26880
     ctgatcgcct ccgttcatgc ggcgatcggt aggggccggg cacctgagcc cgccgagccg     26940
     cagacgcccc gggcgacgcc ggcgcagatc cgccgctcga tctcgcatga ggcgctgatc     27000
     agcttcgagg acagcaagcc ctacaagtcg ctcaggcggc acctgacgac gcgcggcctg     27060
     acacccgagc aataccgcgc gaaatggggc ctgccgcccg actacccgat ggtggcggcg     27120
     gcctattcgg aagagcgctc cgcactcgca cgggcggccg gcctcggccg caagcgggcc     27180
     gcggtcaggc cgcccgcccg gtgatgccgg cagcccgcgg ctccgcgtga ggccgtgtta     27240
     tgcggcccga acgtcggttt gcgagaaatc gttgcctttg aagaggagcg gttctcccgt     27300
     cagggcggca agcgcatagg aaaagcagtc gccgaagttc agcccggcgg aatggcggcc     27360
     cttgccgtaa cgccgccagg cgcgccgagc ccgatcagcg tgttccggct cgaccgcaac     27420
     gatctcgacc tcggccttgt gcagccacag atcgagctcg ctcccgccgg cttcgccgag     27480
     gcgggtttcc agcaccatgg cagcctcgag aaccgtggcg gccgagatca gacgcacagg     27540
     gtcgtcggcg atcttgcgtt cgaagccggc cgcctccggc tcatcgagcg cgattgcgac     27600
     gatggcggat gtgtcgatga ccatcagcct ggcaatccgt tctcgtcata gccgaggatc     27660
     tcgtcggcgc tgcgggggtc gaggacaggg agggtgctcc accggcgacg gcaggcggcc     27720
     agatcttcga gcagcgccgc cttgcgcgcg tcggagccga cgcggcgcag gcgctcctcc     27780
     agcgctttcc gggtggcgac cgtgatggtt tctcctgtgc gttcagccag cgttcgcgcc     27840
     aaccgctcgg tttccgggtc tttgatgctc agtgccatgg caaggctccc aggttcctaa     27900
     gtttctattt tctacctaca tagcacggcg agcctcgcat tccatgacac cggcagaagg     27960
     ccggagcttc cagccctcgg ctccttgcga gctcgtgcct attcggcggc gacggcgtag     28020
     gagccccggt cgccaacctc cggatcagtc ccgtcctcgg cggccaggaa cgccggcaac     28080
     gcctccggcc gggcctccgg ctcggaggct gcggtccccc tctcatgatc catgtccgct     28140
     gcgggcaggg cgccgcggtc gagccccggc gtgcgcagcg gctgcggcag ccagccggac     28200
     cccgccagga gccgctccgc ctcccgcgcc atgtcggcct tcttcaggtg atcgatgagc     28260
     tgggccgcct gctcgccccg ggcctcccgc accgcgctca ggatgcggct cttcgtgacc     28320
     ttgccgaaaa agttggccgc cgtcggctcc cagtgccgcg ccatggcgag ccccaccagc     28380
     tcggcgacgc ggtggccatg cgcgatggcc gccggccgac tgtcgtgggg aagctgcatg     28440
     gcattgacgc tcaggcccgc gcagagcgcg aacaggctgg cgcgcgagtc ggcgtcgaga     28500
     cccagcagga aatcccacag cgccgccgat tggcgcggca actggccggc ccagagatcc     28560
     cgccggctct ggagcgcagt ggccgggccg aacgtcgcca ggccctcgac cgaacggtcc     28620
     gggctcgtgc tgcgggtcgt gatctccagg cacgagtcgc ccgagagatg gaacacccgc     28680
     agcaccatcg cgtgcagcac ggcgaggaag gcggcatcgg ggtcatccgc cagcgcctcg     28740
     cgcagcgcca gcgtgcgata ggtggtcagc tccatcatgt gccgctcggt gagtggacgg     28800
     tccgtctcgg cctcgtcagg ctcgggggcc ggttcagtcc cctgcggagc gcctccgatc     28860
     gtgaacacca cgcactgcac cgcgggcgtc tcgccctccg gaacgccagc ggcgtcgccc     28920
     tccggggccg ccgggctctc gatcggcagg tcgccgaggc gcacgtagcc ccgctcgatc     28980
     cgcagttcgc cgtcgtggtc caggctgacg aacgcgccgg cgatcgcgat gtccgcgggg     29040
     gcatagcgga acgcccgggc gtcgaaggcc tcgatcgccc gctccagctc ggccaggcgc     29100
     gcgtcgacct cctccggcag gtcgccgtcg ccggcatgct gctgctcgag gtcatcgtac     29160
     tccgcgcgca gcgcgtcgcg ggcggctgtc tcctcgtcgg tgagcaccgg ctcgggaaag     29220
     acgcggctca ggccgttctt gtgcccgtag gggaagtgca gggcgacctc gacccacttc     29280
     catccctccg cccgcacctc ggccgccagg agctggagct tctccgtggc gaggcggtcg     29340
     aggagcgccg ggtccttgaa ccagccctcg ccctcctcgg agaacaggtc ccggatgacg     29400
     ctgccgccgg ccgcctcata cgcctccgtg cccacgaact gcgcccgggg gtcgctgctg     29460
     ggcacctgct cgcgggtgag catctggcgg atcgtgtagg ccggagcggg atagcgctgc     29520
     tgccggatcg cgtcccacac ctgttcctgc tgcgcgtggt cgggcgacac cgtgaaggcc     29580
     atgagctgct gcagcgtcat ctcctcggcc gcgtaggcgg ccaggagcgt ctcgctgacc     29640
     gaggcgagct tgaggcgctg cttcacaatg gtgaccgtga cgaagaagcg ggcggcgacg     29700
     tcctcctcgc tcaggccggc ctcgatcagg gccttgaagg cccggaactg atcgaggggg     29760
     tggagctgct cgcgcatggc gttctcggcc agcgagtcct cttcggccga gatcgcgctg     29820
     ccgggctcgc gcacgatgca gggcaccggg gcggtcttgg tcatgcgccg ggtcttcacc     29880
     agccgctcca gggcccggaa gcggcggccg ccggcgggca cctcgaacag gctggtctcg     29940
     gcgccatcag cgtcgaggac ggggcgcacg cacagggact ggagcaggcc gcgatgggcg     30000
     atgtcctcgg cgagctgctc gatggtctgg ccgtggctga tgcgccggac gttggcctgg     30060
     ctgagcacca gcttgtcgaa ggggatggtg cgggcggacg cgagggtgat cttcttgctg     30120
     gcagccatgt cgggatctcc gcgacgggcg gccgggagcc tctctcccga tccctcatcc     30180
     ccgtcgtgac ctccccagcc ctcctctccc tcttgctgcc caccggctgc catgggctgg     30240
     aatcacctga cgcaacggcc tattatcgcc atggggcggt acgcgccgcc ctggggcgtg     30300
     gaaaccccga gcacaccggc ttggtgcccg ccggcttggg caccggattc cttgaccatg     30360
     cggtcgggga gcctgcgacg catgtccagg cgctccggtg ctaaaggtcg tagggaccgg     30420
     gtgtgctcgg ttttccaact ccccgactag ggatggtctt cggctcgttt gcgggggcgc     30480
     accgcagaca cgagcttccc ggggaggcga tctgtgtgcg gctcgattga tcacaatacg     30540
     gtttggtcgc gcgagtgccg cccgaacctg actggagcac catacccccg cccaggttag     30600
     gctggacgcg ccatgtggct gaggcgacgc gcgcgccgct gggcctgcgt gcgggctcgg     30660
     gcccggatca tgcagggccg ctacggggcc gaagcctatt acgtggcgcg ggatcgcgcg     30720
     cgccggccgc acggacagcg ggtgtggttc tggacgcgcg tcgcgatcga gctggctcgt     30780
     tggcagggac gtgagatcgg cgtcagcgcc agcgatcggt ggcggtaggc gccccgttcc     30840
     gggagcccat ccgagggtcg caacgcaatg ccagcctcct gtttggcttg gattttcgat     30900
     gggagttcac atggcaagca gcattgaatt cttgctgaag cagctctggg tcttgaatga     30960
     acaggacggc atccagcaat cgatgagacg atgctctcac acgatggatg ggatcgccac     31020
     gtttgatcca tcgaaaaaga tcaaactcag ccccatgctc agggagaggt ttcgatgtgc     31080
     ttacgaatgg gaaaatgcag cgattggcca aacctggctg gggttggaca aagttgcgat     31140
     cgcatccgat gatacacaaa taagaaagca ctatgatctt cgtgttcaaa attggacaca     31200
     cgcccctccc gcaatgacta ccccgtcgcg aaccgccatc tacggcatca atacggagag     31260
     gcgcgaggca acttatttgg cttggccagc cgaagacgaa gagccgatca tttgcgccct     31320
     ttacggtggt caattcgata tcttcaagaa cttgaagaga tatctcgaat ttctagccgg     31380
     agaccgctgc catgacgaca gtgaggaaat ccttccgcac gtcccgctgt cagtcgacga     31440
     ggtcgtgacg aaggcccgtg aggacggagg cctcgagcgc tgagaatacc ggtcgctgag     31500
     gctgacgaga cccccgtgct caacgctcgc agcgcaccat gcgcacctgg tgccgacgga     31560
     tcagctcggc cagcgttcgt aggacgaccc gcatgaagac cggactgaac agtccggagt     31620
     tcaatccgat cgagcgtgcc ttcgccaagc tgaaggccct cctgagcaag gcggccgaac     31680
     actccttcaa cggattgcgc caagccatcc tgcgcatctt cgatgccttc acgcctgccg     31740
     aatgctccaa ctactacgcc ggagcaggat attacgcaaa ataagctgaa aatgccctaa     31800
     ggtcggtggg ccagggtgcg ctgcccggaa gcggacctct tgaacgcgtg ctgagggtgg     31860
     gagtgcgcct cgattgtcgg cacgggacgc ggtcgtgcgt ccttggtcaa agacgcacgc     31920
     aagccggaga agctcatggc cgacctcgtt ctccacacct tcgattgggt tcccgagatg     31980
     cctcggggct atgtgcgtga cctgcgggtg cgttgggctc tggaagaggc cggtttgccg     32040
     tatcgcgtcg agagtgtgcc gttcggaaag cggggcgccg agcacttcgc gcaccagccc     32100
     ttcggccagg tgccgtggct gaccgatgga gacctctcga ccttcgagag cggcgcgatc     32160
     ctggttcatc tcggcgagcg cagcgaggcc ctgatgcctg ccgatccccg tggccgcagc     32220
     gaagttctgg agtgggtgtt cgcggcgctc aactcagtcg agatggcgag cctgccctgg     32280
     tccattgtcc agttctccgg cgacacaggc gatacgccgg gatggacgcc tctcaatcaa     32340
     ttcctcaacg ctcgacttca gcacatggag ccggtgctgg ccggacgcga atgggtggcc     32400
     cggggggtct tttccgtagc cgacatcctc atggccgacg tgctgcgcct cgtggaccgc     32460
     tttgaggggc tggcgggttt tcccagctgt cgcgcctacg tcgcgcgcgc gacggcgcgt     32520
     ccggccttcc tgaaggcgca tgcggaccag atggcgcatt ttgctgcggc agactgaacg     32580
     gctttggacg tccgctcagg gtcgttcttt cccagcggct gggctggttt gtgttcgatc     32640
     gcacgctgtc ggcggcggag cgccgttggg cgttcgaagt gcggcgcgtg ttcgccaagc     32700
     gcatcggtca cgagatcagg ctcgataccg caactcgcat gctcatgcgg gacgacggca     32760
     ccaagcggct acgaggggtg acgagtgacc acgggagatg atttgcgacg agcggcgtta     32820
     gcgctggagg gcactgtcga gagcccgcat ttcgaccgtg ccgcgttcaa ggtcgcccgc     32880
     atctatgtga cgttggcggc ggatggccgc acagccaatt tcaagttcag cccggacgag     32940
     caggagttca aatgcctcct ggcccccgac gccttcagcc ccgtgccgaa tgcctggggc     33000
     aagcagggat ggacgactgg ccgtttgtcc gcgctgagcg aggaggagct tgtcagcgcg     33060
     ctcaagacgg cctgggcgca cgcgctgccg aaaaagccga accgtcgccg ccgttgaggt     33120
     tgccgtcagt agttggcgac atcggttcga ggacgacggt gcaggtcttt ccgagaaccg     33180
     ggtccttcgc cgcttgccaa gcgaaggaag cccggacgcc ggccggcccc tggatcgggg     33240
     tcttcggccg gggcaggaag acgctgtgaa gcgtggatag gagcgatttg tcggcgtcga     33300
     tcgatcaggc gcacgcgcga ggtcaggaaa aggatgcccg cgccgagatt gccacggaag     33360
     acgagttcgt tggccggggc cgtcttgggg ccgcccccga ccgtgcgccg cccgatccgg     33420
     cggaacgccg cgtcgaaggt cgccgggtgg aacagccacg gcggccggtg cgggtcgaag     33480
     cgcccgacgg cgatctggtg cagaagcccg gcgagatagg gcggatcgcc tggatagcgg     33540
     caggtccgcc atagggcacg aattgtgcgc cggagcgcgg tgtcgagcgc gaacaggcgg     33600
     gcccgggcct gccgccagcc ggcggtccgc tggcgacggc gctcgcgctc ggcctcggcc     33660
     caccagacgg cgcggcaggc catctcggcg gcgacgtcgt gctggctagc cgcgatcgcg     33720
     tcggcaaaga gcggcagcgc ctcgagttcc aggcgctgct tgcgcaggaa cgctgcgcgc     33780
     ttgcacgacg tctcacgata gggctccggt cggggtacgc ggcggaagcg catcaggcgg     33840
     cctccgcctc agccgacgcg ggcgactccg catcgagcag gcggccaagc agccaatcgg     33900
     ccgccttgct ggcgtgggag gcggcccgca cgatggcgcg gtcgtcctcg cgcaggacct     33960
     caagccacgc cccaatgtag tcggcgtggc gcacggtcgg gacgatgccg aggctcgcgc     34020
     agacgaaagc cgccgagatc tcggccacga gttcctcgcg ggcgtagcag gcgccgccac     34080
     gcggcccctt catctcgcgg ttcaagcgcg aggcgtggcc ggtggcgtgg gagagctcgt     34140
     gcgcggcggt gcggtggaag ttgatcggct cgtggaaggc ctcgggcggg ggcagtacga     34200
     tcacgtcgtc ggctggccga tagaaggaca tgtggccgcc gatgcggatg gtcacgccgg     34260
     aggcctccat cagggcacga aagcgcggga ggatgaggtc ctcgcgcggc ggcgcgggga     34320
     cgagcatctc cgtaggcagg ccgtcgcact gggcgacatt gaagacggtg aagcgcttca     34380
     ggaacgcgat ctggcgggcc tgatcgccgt cgcggtcggc acgctggcgc tcgtcttccg     34440
     gggtgaagcg gtcggcatag accacggtgg tgccgtgttc gccacggcgc acgcagccgc     34500
     cgaggctgag cgcctggcgg aaggtgagcc agcgctgggt cgcgtagccg ttctcgatcg     34560
     cagcggccca gagcagcatg acgttgatgc cactgtaagc tcgggtcgag gcggcgttgc     34620
     gaggcatggt caccgcggcg gtgccggggc cggtgctcca gggctggacc cagggcacgc     34680
     agccggcttc gagctgagcg atgatcttgt ccgtgatctc ccggtagagg ctggcgcgct     34740
     cggtgcgggt gctgcgcgcg ggcgaggaag ctcgggccat cggcgggctt tcgcgacggg     34800
     tgccggagcc tctctccgac cgtccacccc gtccgaagcc ccctgccgtc ctcttcctcc     34860
     cgaggctggc tcctgggact gagcgctccc ggcgagacga tcgccggccg cggcacgctt     34920
     ggcttaaccc tggggagcta aggtgggccc ccgatcaggc ctcgggccga ggagcaggga     34980
     tgccgatccg gcccgagcac cggttcttct accccatcga ctggccgcag ctctccgccg     35040
     tgatccggtt ccgccgcgcg ggcgggcggt gcgagtcctg cggccggccc cacctgcagc     35100
     aggtcttcca tctcagcgac ggacgctggt gggatggcga gatcggagcg tggcgggacg     35160
     gctcggggcg gcggctgcgc ggccggccga aggtcgagga tctgctcggg agggtgcgca     35220
     cgacgcgggt ggtgctggcg acggcgcacc gggatcacga tccctcgaac aatgcggatg     35280
     ccaacctcgc ggccttctgc cagcgctgcc acataagacg tcgcggcgtg agcgcaagaa     35340
     ggtcgagatg ttgtttgccc acctcaagcg cctcttgaag ctggatcggc tccggctgcg     35400
     gggtccgaac ggagcccgcg acgagttcca cctcgccgca gctgctcaga acctgaggaa     35460
     gctcgccaag ctcgtcccgg tcccgcagcc gagcccggct tgatcggcgg gaggcactcc     35520
     gtgccccacg agggtcgctc ctcgcagcca ccgctgatcc agcctgcccg cgagttttgc     35580
     aacgaaatcg gcgcgaagca gccgctggct cggtgaccgc aggcatcgat attgttggaa     35640
     aagaccctga cgcccttcgg ctcctctaca ggtagtggca actgcagcgc accggcccaa     35700
     cctgttttat gctggcgcac aagagcgagc cccaaacgga gtttttcaac aatatccatc     35760
     gaaagcggat caaaactcac caacagcatc cggccatttt taggcgggac aggtggtaca     35820
     ggtggtactc gaaggggaaa tccacggaat aagtggtact gggccgggta caaggtgaga     35880
     caggcccctc gccagcaacc tggcggtatc acactgtccc accccaggta ccacctaaac     35940
     ctgcttgtct tcgctctgca gtaccgcctg taccccttgt accactctta cgacccctga     36000
     gggctgaagg gcgagccgaa ggcaaaccgg gcttcccggt cgtactgcac cgcttccaag     36060
     cgaatgcggg ccgaacgcct gcgggcgcca cgcccggcgg tcgtgcagcg gaaggtgacg     36120
     aacggctacc gagcgatgtg ggcggctcgg ggagaggcgg acgtgcgcac cgtcgtagcg     36180
     accgtcaccc tcaagaccaa ggcgagcccc ttcgccatcc tgctcaccac caacagcggc     36240
     taacaaccac ccgaaccaca acccaaaggc gtggcacact ctttgccgca ccaaatcacc     36300
     tctcgagtaa atgcctacag agtattgggc cgtgcggcat cctagctgca gcatccgggt     36360
     tgatggcggc gaagataccg gtcggccttg ctcatcgtaa gcatcttacg gaataacaat     36420
     cctcgatgtt ccacttctaa aatttctgat gctgggctgc ggatgccgcg gccgctgcaa     36480
     attgctaggc ggctgaatgg atcgggcgac gccgttgttg ttgccgtctc agataccagt     36540
     tgcaatgatc agtccggacc gcttgagctt ggcatcgatg gccttcagcc gcgcatcgcg     36600
     ctcagcccag atccgccggg tttgctcctg cttctttagc tggagtgcgg tctgggcagc     36660
     cgtaaggaca tcagccccaa ttgaaaccga tgccagcttg acggtcggtg ggcgtgaggg     36720
     aggaaggacg atccttgcct gtgctgagcg gcgttcagcc ggccgcgagc tgttgccagc     36780
     gccagcgtcg gcaatcgagc gcgttgcctt ggtcgtctca cgtggtctgt gcggttcaac     36840
     agatgcagct tgaggtaagg aggaagggct tggctttcga ggttgagcgg ctgccgcaga     36900
     ggccgaggtg ggcccgggtt cggttggtgg tgcaatctcg ccagccaggg gcgagccgat     36960
     gagggccaag tgcgcccgcg cccttcggca gtactcaacc gagagcggcg tcatccgctc     37020
     ctcgccatgg ccagctcgat acttcatcag cgcccggcac agatcgccgc ccgcgagacg     37080
     ccacgcccga gccaaatagg ccaccccata gcgcacattc gtcgtgggtt cggccaaatc     37140
     ggcatcggtt cctcggtagc ccagcatggc ggcagtctgc ggccggacct gcattagccc     37200
     aacctcgccg acaccgccga tggcgttcgg gttgtaggct gtctcgacct gcgcgacggc     37260
     atcagcgacg gccggcggca gcccctgccg gatggcctcc tgtgtgagca tgtcgaggta     37320
     ggcgctgcgg cccttgttgt aaatcgtcgg caggccaacc aagcccacga tcgtcggcgg     37380
     tagcggcaga tttgggaatc cgtcattcgc agattccgct tgtgcgctgg tggccacgca     37440
     aacgcaagca agtcctacag cggcggccac agagatcctg cgagccgtta caagtgctcc     37500
     ccccacgatc ctgacctccc ttcagtccgt gaaggtcacg ctagccacaa ataaggcagc     37560
     acgaagaagc agcggtcagt tctgtgggat tgccgccgga gcaaaagggt tagcacagaa     37620
     atgtatccgt cgtctctcag gtcctcaccg caatcctgtt tcaggccgag ctggagcgga     37680
     actgaccgat gttggaagcg ctatcctgca ccgggcagta cgggtggtac tcgaagggga     37740
     aatccaggaa gcaggtggta cgggagcggg tacagagcgg tactaaccta agggaaaaac     37800
     ttgtttgtct tactttatag gttaccctgt accacccgct tcctagattt ctccttcgag     37860
     tacgacctgt atcgcttgta ccgcctgtac caccagtgag ggtggacagc gtgacatcgg     37920
     aagcacatca cagcgaatta tgctgtatcc gatccaggcg acttagtgtg ggtaattgcg     37980
     gtttggttgc tcataagggg ctcctgtccg agacggggtg gccccacgat cttcagacag     38040
     gccccgctgg gccgaccatc tcatcggcat tgctggccac ccctactgcg gaagcggttt     38100
     agctcagtag cgcatctcgc cccttcagcg ccatgtcact tcgcgccacg ggagactcga     38160
     ctgaagtgca aggtgtggcg gagcccctca cgtccaggca gatggacgcg cgataaatcg     38220
     actgtattgc cggagtgcca agctcgacta tttcggtctt agcccattgc cgtaagccag     38280
     ggcggtccat cctcctcgta tctcaattta catccgcaca gcttcgctca ggaacctcag     38340
     ctgttcccag gtgttgacgg tgcgcctgtt gggacttcgc tgcctgggta gcctgagttt     38400
     gcaactcttt tggacaggca gtgcgcagat gcaatggagg cagctatgcg tgccatcatg     38460
     tttgcgcttc ttgtcatttt cgtagcagag aacggtacgg tagcagctgc tgcgaatcaa     38520
     agctcaacgt atagtaagaa attcatagcg ttctttttcg aaataagaag atataacgat     38580
     atcagctcgg aaatcacaga agaagtcatc aaagattccg atgacgcgca cgtgtcgcag     38640
     aaaacaaaca gagccgcatc tgcctttgac gtatgcgata tggatgattt caacaatttt     38700
     aaacgccata tatcgtcgag agataatcga tacatcaggg agttcaatct agccgggaat     38760
     cctgatgaca cctcctatat tggtgcttct gtcgtttacg tgaagcaact attaatcaat     38820
     ataaataagc tcgcacggaa aagaagttac aagattggtg ctgcaattgc ttatcttcaa     38880
     ctcgataccg aaggtgtcgt tctggaagct cgtgtgattg actttttggg agatacaacg     38940
     atcatcagag aggtatacgg ggttgtaact ccaggaagga agctgggcga gccgccgtac     39000
     tttgtagata aagataatct gaaatttata gttcccgtcg ttttcgagcg atgatgtttt     39060
     tgctgccgaa gacaagtgga cacgactagc ggctgatccg caacatattc ttcctgctgt     39120
     cgtcgaatat tgcctcgtta ctttcgtcgg agggatgatg tgaggtttgg cgatcatctc     39180
     cggtctataa tgtttaccga cagacgtgcc gcgtcctcca gctgctactg acgaacgcgt     39240
     tcgctacgcc gctgtcatcg aaggttgagg ctgacccttt gcggaagatg ggggcgtccg     39300
     cttccgggta tgctggttgc catggcccaa acgactgacc ttcgccgaaa gccacctgtc     39360
     tgctagcagg cggcagcaca tccaagcaga cctttctcag gtgaccgagc atgaagttgc     39420
     ctgctacata accacggatc tcggcggacc cggtggcaca tcgcccttgt tgatccggta     39480
     ctcgccggac tggccagaac cggaatccct gacagcactc aaccggcggc gggctgccgg     39540
     gtcagaggaa tgtccatgtg aagcgttcac cgttccgggc gacagtgccg gcggacgtgc     39600
     ccgcgcagtg cgaactgaac cagatcaggc ggcgctcggc ggcaaggtcg agcatgcgga     39660
     gtcgggaccg gcgcgcttcc tccggggcct cgcagaacat cgagcaccag tccgggcgcg     39720
     cgacctgcac cgggtggtgc agaacgtcgc ccgcgaacag cgcctcccgg ccatccgaac     39780
     gcagcaggat cgacatgtgg tccgggctgt gccccggcgt cggcacgtag gtgaagtcgg     39840
     cgagcgactc gcccccttcc ggcggtacga actccgtccg ccccgccgcg accaccggca     39900
     gcacgctgtc ggcgaacatg tcgtggttcg gccgtgcgcg gccttcgggc gacatgaaca     39960
     gctcatagcc ccggtgcggc atcaacgtgc gcgcgttcgg gaaggtgggc acccagcccc     40020
     cgtcgcccgg gacggtgttc cagccgacat gatcggtgtg cagatgggtc agaaggacat     40080
     gggtgacgtc ctccggccgc gcgcccgcgg tcgccaagcg gtcgagccag ggcgtgtcga     40140
     ggtggtcgaa cagcttcgag gcgcgcgttt tcccgttgcc gatgccggcg tcgaccagca     40200
     cggtcaggcc gccaatccgg accagccagg aatggacaga cacggtgagt tgtccgcccg     40260
     ctgcatcgac gggcgacgat ccgaccgggt ccggccgctc gagggcggga tcgtagtccg     40320
     gcaggagctt gcccgcggga aattcggctg tgatctcgga aatcctggtc acggtggcat     40380
     ggccgatccg atagaccaca ggcacttcgt tcgtcgtcac ggtttcctcc ctcctcggtt     40440
     ccgccgcggt cacaccctca cgcccagggg tcgcctgccc gcaaacgcgc ggccagcgcc     40500
     agggcgcagg cgtcgagcac ggcctcgccc ttggccgcgc tggctcgccg cgcatcgccg     40560
     gcgacgccgc cgcgtgagac ttcctgccac ccgcgcacac gcttgagcgt cggcatcaga     40620
     gagtcggcaa tgtcgaagcc tggcccgtgt gcctcggcca ggcgcgtcgc gtcgacgaga     40680
     tcggagtcca gcgccatcat catcgaggtc tccgcctcgc aggcgtgcat cacgttgccc     40740
     tggtcctcaa ggatgccgga caccgcgtct gcggcttcca tgaagtaggt ggccgtcgcg     40800
     atgggggcgt ccaactcgcg cgtcagttcg acggcgagcg aagacaaggc ggtgatgttg     40860
     ccgccgtggc tgttgacgag cacgaccttc cggaagcccg ccgccaggat cgaccggcac     40920
     aggtcgcgca gcagggcgtg gtaggtggcg agcgacaggg tgaaggtacc gccgaaagcg     40980
     acgtggtggt cggccaagcc gcaccacaca gtcggcgcga ccacgatcgg gcgatccggc     41040
     gcgacgagtt cagccgtgcg ccggcagacg gcggtgccga ggaagtcgtc gacgccggtc     41100
     ggcaggtgcg gcccgtgctg ctcggtcgag gccaccggga gcagcacgat cgcatcgcgg     41160
     cgggcgaggt cgttgagcgc ttcggcggag aggcggttcc aggcaacctc ggggggcgcc     41220
     atctcggtcg atacggtcat ggtggcctcc aagtcaggcg gtggcgatgc gggttgatgc     41280
     cggcgaggca ggtgaagtcg atggagccgc ctcgtgcgcc ccactggtcc ccgcgttggc     41340
     agccacgcag gcacgatacg ggtgcaggcc cgagaaggcg gccagcgcgg cgaggatcgc     41400
     caggctcggc gcccccaccg ccatcgcccg ccacagcagt gcctcatcgc cgaatgcccg     41460
     gtcggtcagc agggcgaaca ccgtggggcc gagcgagagg ccgatgccgt tgaacacgaa     41520
     caggtagacc gccgaggcgg tgccgcgcat ccgcgccggg gcgagttcct gcacaccggt     41580
     cgagccggtg gtcgatatca ccgcggtgaa gaagatcatg ccacccgcca gcaggagcgc     41640
     gagggccggc gttgcggcct gtgggaaggc ggcagcgaat ggaagcgcgc acagggccgc     41700
     gatgcccgtg acccgcagac gcgcgtcggt ccgccccgct cgcagcatcc ggtcggaggt     41760
     caccccgccg gcaaggacgc ccagcgcgcc ggccgcgacg gtgacgcagc cgaaccacag     41820
     ccccccctgc gcgatcggca gcccgtaggt gcggcgcagg aactccggta cccatgcacc     41880
     ggtgccgtag aacagcatgg ccagcagcgt gctcgccgcg tgctgggtcg caaaggcgcg     41940
     ccagtgccgg cggtagtgtg cgacgacctg gggcaggtcg ggcgcgtcgg aggtcggctt     42000
     cccttggccc ttggcgacgc cggaccgcct tggctcgtag agcgagagca cgaacgggat     42060
     cacgagcagc ccgggcggac cgatcagcag gaacacgaac tgccacgtgc gcaccgagcc     42120
     gatcagcggc acgtccacga ccgtgagccc ctcgaaggcg tgcacgatcc cgctgcctgc     42180
     cacgagcgcg agcccggtgc cgacataggc cgagacggcg aagacggcga aggcgagccc     42240
     acgccggtgc ggggggaacc agtcgccgag cagcgacacg accacgggcg tgccggtcgc     42300
     ttcgccgatg ccgacgccgg agcgggcgag cgcgagttgc gggaacgagc gcacgaagcc     42360
     gcacaggaag gtgcagccgc accacagcgc gaggcccgcc gacagcaatg cgggccggga     42420
     gactcggtcg acgaggcggc cgatcggcaa tccggcgacc gcgtaggcca gcgcgaagcc     42480
     gagcccgatg acgaggctga cctcggtgtc gctcatgccg aggtcggcct tgatcggggc     42540
     gatgagcagg ctcagcgcct gccggtcgac gaacgagaag atctgaacga cgaacaggac     42600
     ggcgaccccg taccaagcca cactggggcg aggcatggcg ggcgagacgt cgaccgcggc     42660
     gggaagcgga tcgggacgtt gggtgagcat ggcattctcc cggatcgggg cctgccgtgc     42720
     ccggaacgtt agccggcagg gcggacccgt tggggtgatc ttcatagatt gactttacag     42780
     taaagtaaag tagggatggc ggcatggcac ggcgcggcgc aacggttcgg gacgatgagc     42840
     atgcggggag cggcggcgag ggcgccggca cttcgatcgc aatcctagat gcggcgcggc     42900
     gcttgttcct cgacgccggc tacgagggcg tgagcctcga gcaggtcggc cgcgcggcgg     42960
     gggtgtcgcg ccagacggtg tacaaccagt tcggaagcaa ggacgcggtg ttccggtcgg     43020
     tagtcgatcg ccactgggag acggtccgga cagaggtggc ggtgatgttg ccgtccccgt     43080
     cggccgagcc ggccgaaccg gccgagatcc tgcacggctt cgcgcgggcg ctgctgcgct     43140
     tcgtccaggg aacggaccag atcgccttca cgcgcctcgt catcgcggaa tcgcgccatc     43200
     agccctggat cgctgaggcc ttctaccggg cgggcaaggc gccgctcgtg gcggcgttcg     43260
     cgggcgtcct gtcggaactg acgaaccggc gcctgctttg ctgcccccac ccggaactcg     43320
     cggcacggca attcatgggc ctcgtccagg aattcgtgat ctggccgcac gtcatgaggg     43380
     tcggcggttt ggcggagatc cccgacgacg acaccgtcgt ggaggaggcc gtcaggacct     43440
     tcctggcccg ctacgcggcc catccgcctg gatagccctc agcctcctcc gctatcctgc     43500
     aaccgaacag acctgtccgg acgattgcaa tgggtggatt tcgttgcaaa actcgcgggc     43560
     aggctggatc agcggtggct gcgaggagcg accctcgtgg ggcacggagt gcctcccgcc     43620
     gatcaagccg ggctcggctg cgggaccggg acgagcttgg cgagcttcct caggttctga     43680
     gcagctgcgg cgaggtggaa ctcgtcgcgg gctccgttcg gaccccgcag ccggagccga     43740
     tccagcttca agaggcgctt gaggtgggca aacaacatct cgaccttctt gcgctcacgc     43800
     cgcgacgtct tgccctcgtc agatcgcgcg atgtcgcgcg ccatgtcccg cgccccctcg     43860
     gagatcgagc gtgggatctt gcgcaccgga ccgtttgggc agcatcgcgc cttcaacggg     43920
     cacgccatgc agtcgaacgt gctcgcccga tccaagagcg tcgccccgcc gttgacccgg     43980
     ctgcccggcg tggtcagcat cgtacccgcc gggcagcggt agacatcgcc gggctggtcg     44040
     tagctgaagt cggcgcgcga gaaggtgcca tccgtgcgct ccgacttgtc gaacacgctg     44100
     atgtgcggcg cgatgccctg ctcggagacg agccagccca gcatctcggc cgagccagag     44160
     ccgctgtcgc cggcaagccg ggccggatag aggccgaagc tcgcgcgcga ccgctcgagc     44220
     atgcgcttgg cggccgtgac ctcggcctgc cggatggcgg tggttgcctc gacatcaacg     44280
     atgatcgcag ggtcgcggtc gatcaggtca ttggccgtgt cggcgaagaa ggccagcccg     44340
     ccatgggcac cggtccagcg ggcggccgga tcagcgggtg agaggaactt gggcggcact     44400
     ggtgtggcag ccccgaaggc cgccgcgtcg agcacggcca ggtactcctg agcggcccgg     44460
     ctcacggcct cgggcggcag gccggcggat ccctcgacgc ccttctgccg actggcgtcg     44520
     gcctggatca ggcggccatc caccgcaaag ccttccccgc ccacgagtcc ttccgcgatg     44580
     cagcgggcca acacgcgcgc gaacaggcgg cgcaggaggt cgctgtcgcg gaagcggccg     44640
     tggcggttct tggagaaggt ggaatggtcg ggcacgcgcc cgtccaggcc gagccggcag     44700
     aaccaacgct aggcgaggtt gaggtggacc tcgtcgccga gccggcgctc ggagcggatg     44760
     ccacggccgt agccgatgat cagcatgcgg atcatcaact cggggtcgac agaagcgcgg     44820
     cccgtcgagg cgtagaaggg agagaggtcc tggcgcagtc cggtcaggtc gacgaagcgg     44880
     tcgatggcgc gcagcagatg gtcggctggg acgtgggtat cgagcgagaa ctcgtagaac     44940
     agggcacctt gctcgacttg ccgcggtccc atcatctgct tcaatccccg tctctcaacg     45000
     ggagtgaatc accccaaaac tgccggcgca acagccgagt tttcaacaga atccgccact     45060
     tgcagacctt cagtgagtgc cgtcgaaatg gccgctcgac acccgagagc ggacctgtcg     45120
     aaacccttcg actcgcacct gccgatcctc atctcattcg cataagcgcg gcgtatggaa     45180
     cctaaaaggg agcctctgac ccgttccggg acttggccgc ggtcactgaa cgtccgacag     45240
     gctacgcaac gggagacagc agctcaacac cttgcattgc gtcaacggct cggcagagcc     45300
     tcaatgaccg atcactcaag cccatcccct ggttcctgag cggggtcatc aagaaaattt     45360
     gccggcgaga cagagtcgaa aacacgaacg ctaccaagtg ccattgatca ccagttaccg     45420
     atttgtattg aacaagctga caggccgaac cttctaacgt ggatggcaat cctaccatcc     45480
     gtgatgccga ggcttgtaaa atgccttccg gtgcgcgcgg ctgcggcgct gaggcgtccc     45540
     tggattggcg ccctcagcgt cgcgttaaat tagcaaccgc aatctatatg ccgcccatgc     45600
     agagatactt gatctccaga tagtcctcga tgccgtaatg cgagccctcg cggccgagcc     45660
     cgctctcctt gacgcccccg aacggcgcca cctcggtcga gatgatcccc tcgttgatgc     45720
     ccacaatgcc gtattcgagc gcctcggcca cccgccacac ccggccgatg tcgcggccgt     45780
     agaagtacga ggccagcccg aactcggtgt cgttcgccag tgccaccgcc tcctcctcgg     45840
     tgcggaaccg gaacagcggc gccaccggcc cgaacgtctc ctcccggaag atcttcatcg     45900
     cgggggtcgt cccgctcagc accgtcggct cgtagaagct gccgcccagc gcgtggcgcc     45960
     gcccgcccgt gaggagccgc gcccctttgt cgagggcgtc cctgatgtgc tcctcgacct     46020
     tcaccaccgc ctgggcgtcg atcagcggcc cgatcaccgt gccggccgca aagccgtcgc     46080
     ccacccgcat ggcctgcacg gcgctcgcca ggcgctccgc gaaggcatcg tagatgccgt     46140
     cctgcaccag gatgcggttg gcgcacacgc aggtctggcc ggcgttgcgg tacttcgagg     46200
     cgatcgcgcc cttcaccgcg agatcgaggt ccgcatcgtc gaagacgatg aacggcgcat     46260
     tcccgcccag ctccatcgag gtcttcttga tggtcttggc gcactgcgca agcagttcgc     46320
     ggccgatctc ggtcgagccg gtgaaggaga gcttgcgcac gatcgggctg gcggtcatcg     46380
     ccccgccgat cgcctgggcc gagccggtca ggcaggagag cacccccggg gggatcccgg     46440
     cctgctgcgc cagcgcgcac agcgccagcg ccgagaacgg cgtctggctt gcgggcttga     46500
     gcaccatggt gcagccggcg gccagcgccg gtccggcctt gcgggtgatc atggcggccg     46560
     ggaagttcca gggcgtgatc gccgcgcaga cgccgatcgg ctgcttgagc acgacgatcc     46620
     gcttgtccgg cccgtgggcc gggatgacgt cgccgtagac gcgcttggcc tcctcggcga     46680
     accactcgat gaaggcggcc gcgtaggcga tctcgccgcg gctctcgggc agcggcttgc     46740
     cctgctcggc ggtcatgatg gcggcgagat cgtcctggtt ctccaggatc aggctgaacc     46800
     agcggcgcag gatcgcggcg cgctccttgg cggtgcgccc ccgccagtcg ggcagcgccg     46860
     cctgggctgc ggcgatggcg cgctccgttt cggcggcgcc catcctgggc accgttccga     46920
     ggacctggcc cgtggccggg ttgtcgaccg cgatggtctc gccgctgtcg gcatccacga     46980
     aggccccgtc gatataggcc tgggttcgga gcagatcggg ccgcttgagg gagagcaagc     47040
     gatcctcaac ggtcatcgtg gtcatgggcg cctccaagag tgtcgcgtcg cgcaagtccg     47100
     aagggcagca ggttcgagcg gtattccttc acgtcggaac ggatcgccac tctaaacctt     47160
     tgattgctgc atcgtctgcg acgaaccggg attcacttcg tcggaaaatg gctctagccg     47220
     gtcggctcgg ctgcgccggc tttgtgttgg agctcctcaa cgaggacgcg catgttctcg     47280
     gcataatcga ccgggaccgc cacgagatgg accccgcccg ccgcgaaggc ggcttcgagc     47340
     gtcgggatca ggtccttcac cgcggtgatc cgatgcccgg ttgcgccgta ggaattggcg     47400
     taggcgacga agtccgggtt gccgaaggtc atgccgtaat cggcgaaagc gtcgaccgcc     47460
     tgcttccagc ggatcatccc gtaggccgaa tcatcgagga tgagcaccac gaggtcgagt     47520
     ttcagccgga ccgcggtctc gagctcctgc gagttcatca tgaatccgcc atcgccgcac     47580
     accgccatca ccctccggcc cggattcagg agcttcgcca tcatggcgga ggggagcccc     47640
     gcgcccatcg tggcgagcgc gttgtcgaga agcaacgtgt tggcgacgtg cgtgcgatag     47700
     ttgcgggcaa accagatctt gtacatgccg ttgtcgaggc agacgatgcc gtcctccggc     47760
     atcaccgcac gaacgtcatg cacgaggcgc tgcggcgtca ccgggaagcg atcctcctcg     47820
     gcccggtcat tgatgcgctc caggatcgag cggcgcaggt cgagcatgcc gggatccgga     47880
     tcgagccgcc cgccgagccg gtcggcgagc gccgtcacgg tcgaaccgat atcgcccacc     47940
     acctcggcat ccgggtgaaa tacctgctcg acgctcgccg agacgtagcc gatgtggatg     48000
     accttggggc cgcccgcgac ctgccccatc aggaagggag gcttctccac cgtgtcgtgc     48060
     ccgatcgaga tgatcaggtc cgcccggtcg atcgcctgat gcacgtagtc ccgctcggag     48120
     agcgccgcgg tgccgagata gagattcgag ccgcccgtga ccgcgccctt gcccatctgg     48180
     gtgttgaaga aggggatgcg cgtccgccgc acgaaatcgg agagcgcctc gaccagccgc     48240
     ggccggttgc cggctgcgcc aatcatgatc agcgggcgtt gcgcactcag gatcatcgca     48300
     gccgcgcgct caatggcggc ggacgccgcc accggccggt cgatcgggtg cgagggcacc     48360
     atcgcgacgt cggccgtctc ggccgcgatg tcctcgggca gttcgaggtg gaccgggccg     48420
     gggcgctcct cggtggcgac ccggaaggcg tcgcgcacga gggtcgggat tgaggccgcc     48480
     gagacgatct ggcgggtcat cttggtgatc gggcgcatcg ccccgatgat gtcgacgatc     48540
     tggaagcggg cctggcgggc gctcaggatc ggcttctggc cggtgatcat cagcatcggc     48600
     atggcgccga gatgcgcgta ggccgctcct gtcgtgaagt tcagggcgcc tgggccaagg     48660
     gtcgagaggc agacgcccgg ccgacccgtc aggcgtccat gggtggcggc catgaaggcc     48720
     gcggcctgct cgtgacgggt gagaaccagc tcgatccggg aggtgcgcag actctcgacg     48780
     acatcgaggt tctcctcgcc cggaatgccg aagatccggt cgacgccttc gttctcgagg     48840
     gcctggacca ggaggtcaga tcccttccgc atgagaattt cctccctttc ctgccgaggg     48900
     cgatgaggcg atcgcttgcg cagccctgac ggcgtcgagc ctgctcgtcg gatcgcttgg     48960
     cccttctgtc tcaggcgttt cggatgacca gtttcagcga ccaggccagc aatgtcgagg     49020
     cgaacaggat ggcggccatg ccaagcatgc cggcgtcgaa cgatcccgtc gcatccttga     49080
     ggaagccaac cagatagggg ccgacgaagc cgccgaacgc acccaccgag ttgatgaagg     49140
     ccagccctcc ggcggcggcc gccccggtca ggaaaccttg cgggatcgtg tagaacacgg     49200
     tgcgggcgga gatggtgccg atcagcgcga gcgtcagaca ggcgacggct gggatgagcg     49260
     acgagaacac gaccgagagg gcgaggccaa gggcgccgca tatcagcgcg gtcataaggt     49320
     tgtagatctt gcgcccggcg gcatcgacga gccgcgccca ggccagcatg ccgatcgttg     49380
     cgaacaggta ggggatcgcc gtgacccagc cgatctgcat cgtgctcagg ccgtggttct     49440
     tgaggatcag cggcagccag atgccgatgc cgtaggagcc gatggtgaac gcgaaggtga     49500
     tcccagtgag catgaggact cggatgtcct tcatggcggc ccacagatcc ttcttcggct     49560
     tctcatgctt gtcggcggcg agttcggcga tcagcgcagc ccgctcgccc tcggtgagcc     49620
     aggtcgcgtc cttgggcgtg tcggcgagga gccacaggca ggcaagaccg agcaggcagg     49680
     ccgggaggcc ttcgatcagg aacatccact gccatcctcc aagccctagg atgccgtcca     49740
     tgccgaggag ggccgccgag atcgggctgc cgaggagcga cgacaggggc gtcgaggcca     49800
     tgaacagcgc caacacctgc gtgcggtacc gggccgggaa ccagatcgag atgtaccaga     49860
     tgacgcccgg gaagaagccg gcctcgaata cgccaagcag gaaccgaatg acgtagaagc     49920
     tcatcggccc gaccgcgaag gccgtcgccg ccgcagcgag cccccaggtg atcatgatcc     49980
     gggcgagcca gagccgcgcg ccgaagcggt acatggcgat gttgctcggc acttcgagca     50040
     ggcagtagct gaagaagagg atacccgcgc cccagccgaa ctgcgcagcc gtgagtccga     50100
     tcgcctggtt catctgcagg gcggcgaacc cgacgctggt ccggtcgaga tagttgaaca     50160
     ggtaggcgag gcccaggatc ggaaccaggc gccaagtatt cttgcgaatg gcgctcgcca     50220
     gctgacgctc atgcgtctcc ggcagaatgc ctccgtcggc cgccgcagcg acgatcatcg     50280
     tatcctccct caacagactg ccagcattcg ggcttgggcc gacttgcttc gcgccgagcc     50340
     tttgggcgtg ccggacgctt ggattggcag cctgttctgt gtcatgcaga ccgggccggg     50400
     gtccaatcgc taattttcag cgaacaataa ccgggaggaa ttcatggacc tgcgcgatct     50460
     ggcgtatttc gaggtgatcg cggatctggg tcatctcgga cgggcggccg agcgcctcgg     50520
     ccggacgcag ccggccctga cgaagtgcat ccagcgcctg gaggcgtccg tcggggccga     50580
     gctgttcgcg cgctccagcc gcggcctcgc gctcacgcag gtcggcgagg tgctgctcgc     50640
     ccgggcgcgg aggatgcgga ccgccatgga cgaggcgctc cgcgaggtga gcgatttcgc     50700
     ggccggggcg gccgggcacg tccgaatcgg gaccggcgcc acgatggcgg agtacctgct     50760
     gccgcaggtc tgccgggccc tgatcgccgc ggcgcctgcc gtcacggtcg agctgcagat     50820
     cgggatgagc ggcgtactgc ggacggccct gcgcgacaat cagctcgatc tcatcatcgg     50880
     gcccgtcctg gcgagcgacc acgacgagtt cgcgcacgtg accttcggga ccgacgacgt     50940
     ggtggtggtg gccgcccggg gccatcccct gtgcggccga cccttgagca tcgaggatct     51000
     ggtgaagtgg aagtgggtgc tgcccgcgaa gagcgtcgcc atgcgccagt ggctggacac     51060
     ggtcttccag gcccacggcc tgcccggacc ggcggtccag atcgagacga actcgatcac     51120
     gatgctgccc cggctgatcg gcgagaccga cctcctgagc ttcacctcga cgcgcaacct     51180
     gctgccggac cggctcggcg gccggctgga acggctcggc ctggacgcca ccacgatgcg     51240
     ccgcccgctc ggctgcgtgt accgccgcga gggctatctt tcgccagcgg ccctgcgcgt     51300
     ggtgacgctg cttcagacgc aagggagcat gctgctctcg cccgatccga gcccttcctc     51360
     ggcccgggcc gcggctcagg acggcagggt gacggcgtag acgcgggtgg ccgtcccgct     51420
     gaacaaagcc atgcgctcgt cgctgctggc ccccgccgtc aggcgcttga aggcgttcca     51480
     gacagtgccg tagccgtagg agcctttgtc gaccgggaag ttgctctcga acatgcaacg     51540
     cgtcgcgccg aaggcttcga tgcaggtctc aatgtagggg cgccacgtct cggcgaggtg     51600
     ctgagacgtc ggcggcatcc ggcccgtctc aaagccgaag ccgttcatgc gcatgccgag     51660
     gccgccgagc ttcacggaga cgttcggaca ctgggcgagt gcgcggatcg accgtgacca     51720
     cgccgcgaag atctcctgcc gccgccccgc ataggcgccg atgccgagga tgccgccgca     51780
     atgatcgagt acgatcgtcg tgtcgggaaa ggttcttgcc agatcggtca gctcgtcgag     51840
     ctgaggatgg aagagccacg cgtcgaagct gagaccgagc ggcgcgagcc gggcgaagcc     51900
     ggcccggaag gccgtatccg acagcaaacc cggaggcccc gcactcagcg ggttcatcag     51960
     ggtcgcatcg gtgtcccaga ccgtgatgtg gcggatgccg cggaagcgcc cgttccccgc     52020
     gcggagatga gcttccagga cctccgcgac ggcgtccccg agccgaaggt cggcatgccc     52080
     gacgatgccc gcgcacaggc gcactgggcc gtactgcccg ctcgccgcca tggcagcgac     52140
     gccattggcg aactcggttt ccccaaccac gcgcatcggg cccgagtcat cggctcgata     52200
     catcgcttgc gcctgcatga agacgctcgc ctgaacggcg tgcccactcc cgccgatgtc     52260
     agcgaggtat tcgtcgaaga ggtagcgcca gccgggccgg tcccacagat ggtggtgcgc     52320
     gtcgatgatc ggcagctcgg gctccagcgg ctcctcatgg cctgtggcca gccagtccgg     52380
     gcggacaggc aggtagttgg cggatcttcg ctcaatcatc ggagccctct gcgcctctcg     52440
     ccagctgggg cggcactcac ggatcagccg ggaaaatccc gcggcgccgg gcctgtgtag     52500
     ctgtagggca cgctcggcgg catcggcccc ttgatgcgcc cgccctgtcg ggtctgctcc     52560
     caggcatggg ccaggatgcc gaccgagcgc gacaggatga acaggccgcg accgagcggc     52620
     ggtgagaagc ccagctccgc gtagatcacc gcggtcgcgc cgtcgatgtt catcggaatg     52680
     gggcggccct tgcggcgctg aagcaacgcc tcgacggtgc ggccgatctc ggcgaaccgc     52740
     ccgctcacca cgcccctctc ccgggccgcc tccaccagcc ccagcagccg cggagcccgc     52800
     ggatcgaccg ggtggaagcg atggccgaac ccggacacga tcttcccatg ggccgccata     52860
     aacgcatcga cgccggcctc gaccgcctgc tccaacggta aaccggcgtc gagatgccgc     52920
     gcgatatcgg cgtagagctc catgcactgc tcgccagccc cgccgtggac gtcgtccagc     52980
     acgttgatcg ccgaggccat cgcgccattg agcggcaggc cgcaggtcac ggccatccgg     53040
     ctgatcgcga tcgagggcgc ctgcgggccg tgatcgaccg ccgcgacgag cgccgcttcg     53100
     agcagagcgc tttcgttgag cgacggcaga ctgccgcgca gcatcagcca gatcatctgc     53160
     ggaaagctga ccgccccgat cagctgctcg atcgggtagc cgcggaaccg gatcacgccc     53220
     ggcttcatgt cgatgatctc ggtcgaccac caggttctcg ccgcgtccag aagggcggcc     53280
     ggatccttgt cagccatcgt cggtctccgt gtgggggctg tctcagctgc tcgacgtctc     53340
     ggcgcgcacc ttgatctcgg ggagctttgc cgagggtgcg acggtcgggc ggttatcaga     53400
     ggtgatcgtt ccctgctcgc gcagggccgc aatgtcgttc gcgccgtagc cgagttccgc     53460
     gagccagcgt tcggtgtcct ggccgagccg cggcggggga gcgggaacgg gataggcctc     53520
     atcgagcagg aagcccggcc gggtgacccg catcggctga gcgtctttca ccgtctccgg     53580
     cagcgtctcg acgaagcggc gtccgaccac ctgctcctcg cgcaggatct ccggcacgcc     53640
     gagcacgcag cccgccggga tgccgctggc gttgaacagc gcctcccatt cctttgctgg     53700
     gcgggcctgc agggccgtgt tcagctccgc cgagagcacc gcccggttgc gcttgcgcgc     53760
     ttggcgctcg gcgaagcgcg gatcggtctt gaggtcgggc cgcccgacga ggtcgcagag     53820
     ggcctcatac tgcttctgct cgttggccgc gacgttgaga gggccgctcg cggtctggaa     53880
     agtgcccgaa ggtgcggccg tgaagttctc gttgcccatc ggttgcggat cgacgttggc     53940
     gttgaggtgg ttcgacacca cccagcccat cgccgcgagc gtcgcttcga gcagcgacac     54000
     gtcgatgcgc cggccccgcc cggtggtgcg ctgctcaacg agggcggacg agatcgcgaa     54060
     ggcggcggtg atgccggcga tcgtgtcgga gatcgggaag ccggtgcgca gcggtgccgt     54120
     cgcggcgtcg ccggtcacgc tcatagcgcc cgacaggccc tggacgatct ggtcgtaggc     54180
     cgggcggccc tgccagggcc cgctctggcc gaagcccgag atggcgcagt agacgagccg     54240
     cgggttgcgt tccgacagca cgtcgtagcc gagcccgagc cgctccatca ccttcggccg     54300
     gaagttttcc agcaccacgt cggctttctc gactaagcgc aggaagatct ccttgccagc     54360
     cttcgccttg aagtcgatgg cgaccgactg cttgccggca ttcaccgcca cgaaggagag     54420
     gcccatcagg cgctcggcca tggccggatc ggccccgagc cggcgggcga gatcgccgcc     54480
     tttcgggttc tcgaccttga tgacctccgc gccgaggcgc gcgagatggt agccacagaa     54540
     cgggccggcg agcacgttgg ataaatcaag gacgcgaacg cccgcgaggg gaagagtcat     54600
     ggcggatgtc caatcgacgg tgtgacagtt gaggcgggcg cggcttattc aagcttcagt     54660
     aaagtccgag ccaacgccag taggttgctg cgcagagcgc gtagacgagg caggcgagcg     54720
     cgcagatcac gatgccgact ttcggaaagt cgctgaccct caggcgcccg gttccatgca     54780
     cgatgatgct gggcagcgtg ttgtagaaca tcagcagcgg gtagccgccg atgatcatgc     54840
     cggccggcag agcgagcgcc accgcgtcga tctgcgccgt gccggccatg cctaagatga     54900
     tcggcagcag ggccgtcgcc atcgcggtcg tgccgacgaa gacgacgtgc aggtactgga     54960
     cgatgaacat caccacgacg atgaccacaa gggtggaggc gcccccaagg ccgagcccgt     55020
     ggaagatcgc gttcgcgagc cacgccgccg cgccggtctt cagaagaatg tcgccgagcg     55080
     agatgccgcc accggccacg agcaggactt gccaggacac gcccttgttg gcgtcctccc     55140
     aggtgatgac cccgaagccg ggcaggaaca ggaggacgac gccggcgagg cacacgacgg     55200
     tggtgtcgaa ctgcgtgaag gtctgggtcg cccacagcag ggtgacgagg ctgaacacca     55260
     ggaaggtgcg ccactcggcg gccgacatcc ggccgagccc tgccaagttc gtacggatgg     55320
     tgccgtcgat gtccgcctgg gccggatcga catcgacggg gaagaccttc tggatcagtg     55380
     cccaggtcgc gaaggtcatg aggagcgccg gcgggaagcc gtagaggagc cactcggcgt     55440
     aggagatcgt gtggccgctc gccttggcga cgaactccac ggtcacgggg ttggggacgg     55500
     tcgcggtcag gatgccggcc ccgatcgtgg cgttcgtcat cgtgagggtg aggagcaggt     55560
     tcaccgcgaa cgtggagcgg ccggtggcgc cgtagagtgc caggatgctc aggcactcgg     55620
     gcagcaggat cgcggtccgg gccgtcgagg aagggaccag aaaggccagc acgatgttga     55680
     cgaggcagac cccgagggtg atgcgcctcg gcgccgaccc gatcgctgag aggatcaagt     55740
     aggtgatgcg ctcggccaag cgggtcttga ccatggcggt ggcgaggatg aacgcgccga     55800
     cgatcaagta ggcagaggag gaggagaagc cttctagcgc gccgcgcacg ctcgtgatgc     55860
     cggacagggc ggcggcgggt acgatgagga ggcttgtgac ggcgagtggg atcgcctccg     55920
     tcagatagag ggcgaagatg cctccgaaga gcgccaaggc cttgtggccg gcgactgaaa     55980
     gaccgtcggg tgtcggagcg agccagatcg cgaccgcagc gagcagcgcg atcggaacgc     56040
     cgatccgttt cagagccgca tcgagaccgt gttgactgct ctgcttgtca gtgcggacgg     56100
     gcaatgccgc ctgatgcccg aggctggaca tcgttcctcc aaggtgcgcg tttcctggaa     56160
     cctcgacgca gccatcatcg agtcctcttg atgcaggact tcgatggcag aaatgccacg     56220
     ccgggacttc gttggtttat cggctaagct tgtacagatc ggaggcgtgg gcctgagcac     56280
     tttcgtgcct gcccggggcc atctcggtta tcggattcat gggccgttct gcggcccggg     56340
     tccaatcgct aattttcagc aagcgatgac tggcaggaat gaggagaagc cgcgcttgca     56400
     ggcggccacc gcgaacctga acgcgtgtcg aaggacaaag acctgaaatc gcgtcaggtg     56460
     cggatgtccg gaggttggga cctcaatggc agcttgtggc gcattccgga agattgcgcc     56520
     gcattcggat catggcctct gcctgcgccc agaaaaagac ggtttttcag acacttaaac     56580
     ctgtaaggat tgcatgtcag gaaatcaaaa tagcgctcct cgcataggtg cggtgtatgg     56640
     agggtggccc tccccaacgg gggagggccg aggccgcctt acccgagcag gtggctcagc     56700
     tcgatcacga tgatcgtgac ctccaggaca atggcaatca gcttgagcgt aagaatgaag     56760
     ctcatgggtg tctcgcttgg tgtcggcgcg cgaaccctgg aggcagcggc tcggccgcgc     56820
     cggaaatggc agggaacgat ggaaccgccg gggggcggtg aagcgagcgc cggcccgaag     56880
     gggcgctgca agcgacgagg ccaagcggtg agcactgtct ggctcgatcg gcggacgccc     56940
     tgggaaggaa ggaaccgcgc cgatcaggag gggccctcgg tgccccgttg atcccaaatc     57000
     agtgacttcc tcaacttaac gagaaagtca agactctgat cgaaggggca cgaagcccct     57060
     tccggtcggc ctgagctatg tgtgatagca tccagatcca gaaagatttc agcctcctcg     57120
     acggcaacga agattgatga ggcgtcacgg taacgagtga tttgaagccc acctcggacc     57180
     gagggtgcgc tcaccacagg ctcgctggtc caaggtcctg ggaaatggga aagccgacct     57240
     tcattggctc ggttctacga ccgagtgtga cccaaagcag tcgtcagttc cggctccttg     57300
     gctaggtggg cgttgcgacc tttccatggc gttgcttgtc ggcctcaccc gacccggccg     57360
     gtccggctcc ggttccaacg cctggaggct ggtggctcca ctcacccgaa aaaaatcttc     57420
     gacgagctgt cgatcgcctc gtcttctgtt cgtcgtagca gcagggagat cggtgcggcc     57480
     tcggcgtcat aggagacaag acgatgcgcg tgatggtttt ggtgaaggcg acgaaagata     57540
     gcgaagcggg catcatgccc tcgtcagagc ttcttgaggc catgggcaag tacaatgagg     57600
     aactggtcaa cgccggcatc atgctggcgg gcgagggtct gaagccctcg gctcagggca     57660
     aacgcgtggc cttcgacggc ccgagccgca ccgtcaccga tgggcccttc gccgagaccc     57720
     gcgagctggt cgccggcttc tggctgtggg aggtcaggga catggctgag gcagtcgagt     57780
     gggtgaagcg ctgccctaac ccgatgccgg gcccaagcga gatcgagatc cgcccggtcg     57840
     tcgaggctgc cgacttcggc gatgccttta cgccggagct cgccgagcag gaagaccggc     57900
     ttcgcgacag gatggccggc cgctgaggcc cgctgtccgc catgacttgc ctcgcccctc     57960
     gctcctcccg tgaacgggaa gcgtggcggc ggccgacacc catcaagcaa tcgagacggt     58020
     cttccggatc gagcaggtca ggctcatcgc gggtctggcc cgcatgattc gggacggggc     58080
     cggtcgcaaa ctcgggaaca ggccgcagca gtgactacgc tgccccgctt tcacgctttg     58140
     tttgcaacgg gaagtccgaa gcaggaggcg agccgctggt tctgctcgca cacggtccac     58200
     gcccccgcga acccgaagcc cttgcgcagc caccgcatgg cctcgaagcc ctggatcgtg     58260
     cgccgcgcag tggcgaaggg ctggaaaccc ccgacccacg gcatcggcct tttcatccgg     58320
     aaatggtcgc cctcgctccc ttgctgcagg ggcttggtca cggagtgcgt gggcgtgcgg     58380
     ggtagcaggc ccgcctcgcg gctctcggcg agggccggcg ggtcgggacc agccccatcc     58440
     gtgccgatcc ggtcaggagc gagaagcggc tgatcctgca gcatcgtgcg gaagaaccgc     58500
     ttggcggcgt ccagatcgcg gtgggcgggg aggaggaagt cgaccggctc gccgtgctta     58560
     tcgatggccc gatccaggga gcgccactgg ccgcggatcc ggatggaggt ctcgtcgacg     58620
     cgcaccggcc cgcggtgcgg cttgcggaat tggcgcagcc ggcgctcgat cgagggcgcg     58680
     tcggcgagca cccagcgatt gatcgtggag tggtcgacag tcaggtcgcg ctccagcagc     58740
     atctcctcga tgtcccggtc gctcagggcg tcgcgcaggg accaggagac ggtctggacg     58800
     atcagcatgg cctcgaagtg ccgactcgtg aagtcgccgc gggcctggcg cttcagcttg     58860
     agcgcgaggg cggtgaggat catgggccgg ctcccgggat ggaggcggca agctgggtag     58920
     gtatgcctaa cggctggtga atgtcatccc gtttgcgaca ggcccgccga cacggcgcaa     58980
     acaacagcag ccttcaggat atcgtgcctc gaccgatcga acgttctcat tgttcacctc     59040
     cctatctttg tcgagttttt tggcccagcg ttggcgcatc gtggtgctgc gctgagccga     59100
     tcgggcgtcc tccgcggaat ggcggctctc gacggacttc attcgtttcg gttcccgctg     59160
     cctcgtgtcc cgcgctgcct ccgaacggct cagaacccgt agagcgtggc cggattcgag     59220
     acgaggatcc gggcttgcag cttgggatcc ggagcccagt ccgccagcag atccagcagg     59280
     atggcgtcgt cgggcttcgc atcgacaggc gacgtgggat gcggccagtc gctcccccag     59340
     acgagccgct cgggggcgaa cttgacgtag gcgcgtgcga gccggcttcg gtcggcatag     59400
     ctgggcgggc cgaccttgga gaggatgtat gcaccggtca gcttcaccca ggcaccgcgg     59460
     gtttcgatca ggttcgcgat cacgcgaaag gcggggtggt cggggccggc cggctccgga     59520
     agatgaccca tgtggtcgaa caccacaggg acaggcaggc gctccagcac gtcccgcaac     59580
     tcgacgatct tttcgccctc ggacacgagc tggatgtgcc agcccagctc cgcgatcttg     59640
     cgggcgaccg gctccatgtc gtccatggat gcgccgcccg ggagccgcgt gccgaaccgc     59700
     acgccccgga tgccggcctc atgcaggcgt tgcagttcgg ccgaggtgac ggtcgcatcg     59760
     agcatcgcaa tgccgcgcgc gctgtcgccg aaggctctga ccgactcgac gagcagccga     59820
     ttgtcgatcc cgtaggtcga cggttgcacg acgacgttgc gcgtgaggcc cagtcggcgc     59880
     tgcaactgcc ggtaatcttc ggcgctggca tcggggggcc gcagggtcgc gctcggggat     59940
     gggggaaagc gcgcgtcgta gatgtggtgg tggcaatcgg tcgcgttcag gggaatcgtg     60000
     atcgaggggc gttccgttcc cgcggaccag cgcaccgctt gagccgaggc tcgacgcgtg     60060
     ccggcgccca gcgcgacccc ggccacgagg agcgcgaggt gatcgcgccg cgtcgtcaac     60120
     ttggtcatga ggcgcttccg ttcaggtgtg cgagaacaat tcctgaccag gagcaggcat     60180
     gcgcgccgtc aggatgctcc cagtctggga ctcggtgatg aagagggtcg cgtgatccgg     60240
     cccgccatag gcgatgttgg tggtcgagat gccggccggg gacttcacgc gcaggatcgg     60300
     ttcggcgacc ggagacaggc gccagatcga gccgaagccg gtatgggcga cgacgaggca     60360
     tccttcggca tcgagcgcga tgccgtccgg acctcccatc ccgccgtgga gttgcgagaa     60420
     gacgccgact ttcgacacga gcccgctcgt cccgagcggg atgcgccaga tctgctgcgc     60480
     ccgcgtcacg gcgacgaaga gattcgtcat ggcgctgtca atcacgatgc cgttcggact     60540
     cggcaccgtg tcgatgaggc aggtcagttc gccggacggg cgaaggcgat agacgcgacc     60600
     ggtcgggtcc tgcaggcccg tctggccctg gtccgtgaag tagaggtcgc cgttctgggc     60660
     gaaggtgaga tcgttgacgc ctcggaaccc ttccgaaccg gcagtctcca ggaagggcgt     60720
     caccgacccg gcctcgggat cgagcagcat gatcccgcgc ttgtagcagg tgatgaagat     60780
     gcgtccgtcg cgatggattt tcagcccgtt cggccagccg tcatattccg cgacgagttc     60840
     ccatgtccca ttcggatcga tgcggaagat gcgaccgaac gggatgtcgg tcacgtagag     60900
     ccggccggcg cggtcgaaga ccggcccctc caaaaaggag tcgatcgcgt gtccgccacg     60960
     gttcgcggtc gcccacgcgg tcggcctggg tttgcggaac cggtccggca gccgcgtgaa     61020
     tatctcggcc gtcacggtcg gtgggggagc gaagaacgac atcgcacgtc ctcgagggat     61080
     gatgggatcc gcactcggtg gtccggacgg aatggcatgg ccgggcgctt cgacgaccgc     61140
     cgcgccaggc aggtcgctgg cttgacgtca ggccagagct gcggccgcgc gtgcgtcgcg     61200
     ggcgtgcgcg cggctgatca tgaggacgca gacggcggcg gccgcatcaa gcgccgcgac     61260
     aggaagcatg ccgagtgcga agctccccgt cgcttccttc acgaggccga cgatgttcac     61320
     catgaggccg cccccgatga ggttcgcgat cgcgttgatc cccgcgaggc ccgccgccaa     61380
     agtcccggcc gacaaccacc ccgccgacag ggcccagaat ggccccttga aggcgtaagc     61440
     gccgacgagc gcgcaggaca cggcgacaat cgttgtcacg atgccgcccg acaggttcag     61500
     gtacgacaag ccgaaagccg cgagcatcag cgggatcgcc gtatgccacg tacgctcgcc     61560
     gctgcgatcc gaccggcggc cccacaggat catcagaatt gtggcgaggc cgtacgggat     61620
     cgcgttgacg aacccggtct gaaggttggt cagtccgaac gacttgatga tctgcggctg     61680
     ccataccgag agcacgctgc cggtggcgga cgctcccgca cagaccagcg ccatggtcac     61740
     gaagtacctg ttgcgcgcga gttgccacag cgagatgtgg ccgatgggct tcttgcgtgc     61800
     cgcctcgtcg gcgagacgcc cgacgagcca ttcgcgctgc gcgtcgctga gccagacggc     61860
     gtcccggggc ttgtccgtca gcaggaacag gcagcagatt ccgaggagca cggtcggaag     61920
     cccctccaga acaaacagcc attgccagcc cttgagccca agaactccgt cgagttcgag     61980
     cagcgacacg gagagcggcg agcccaggaa ggtcgcgagc gggatcgaga ccgtgaacgt     62040
     cgcgaggatg cgcgcccgat actcgttcgg cagccaatag gtcaggtaga ggatggcgcc     62100
     cgggaaaaag ccggcctcgg ccgcccccag gatgaaccgc atcgcgtaga gcgagtatgg     62160
     cccgatcacc agggccatgc ccatcgtcac caagccccag gtgatcatga tcctggcgat     62220
     ccaccgacga gcgccgacgc gttgcagcgc gagattgctc ggcacctcga ccaggaagta     62280
     ggagacgaag aacaggctcg ccgcgaagcc gaacatcgca ggcgtgagcc cgagatcctt     62340
     gttcatctgc agcgcagcga agccgacatt gaccctgtcg agcagggcga agaagtagca     62400
     gaccatcagg aacggcacga ggcgaagaat cacccggcgc atggtcgctt tttcgaggga     62460
     ctgcggcgct tgttcaggga cgctcacgtc ctgtcctccc atggtcttcc tggatacggc     62520
     tcgcgcgatg caggtcgccg tctctgtgcc ttcggctttc ctgccgtccg cgggcggatc     62580
     agatcccttc gcagcccgcg tcccggaggg cgcgctcaac ccacgaccgg tccacggtgc     62640
     cggccttgat ggccgccatc gtcttggcct cgtcctgctg cttcttgttg gctgcggcga     62700
     agacggcttc cgtttgatcg aagggcacgc acacgatccc gtcgtcgtcg ccgacgatga     62760
     ggtcgcctgg ctggatcacc atcccgtcca gggcgatcgt ggcattgatt tcgccgggcc     62820
     cgttcttgta ggggccgcga tgcgtgatgc cggccgcgaa caccggcaga gaatttgcgc     62880
     ggatccaccc gtgatcgcgg acggcaccgt tcacgatcac gcccgcgacc ccgatctgct     62940
     gcgcatgggc gagcatgagc tcacccatga tcgcgttcgt caggtcacca cctgcatcaa     63000
     cgacgaggac gtcgcccgcg ctggcgcggt tcagggccgc gtgcaccatc aggttgtcgc     63060
     ccgggcgctg cttgatggtg agcgcggcgc cggccagcac gccccccgca tggagcggcc     63120
     tgaggcgggg cccgccatgg accatgcggt tcatggagtc gctgatattc gcgaccgcga     63180
     tggccttgaa cttctcgacc gtggcctcgt cgaccttgcg ggtgcgggga tggatcttga     63240
     acccgatgga catggctgct ttctgaacag tgaaacggag tgaggggcga gggacggtca     63300
     ggccggctcg gatcgcttca ggccggcctt gagctccatg gcgtcgagcg cctcctggta     63360
     ggtccgcggc acgacgccct tgaagtgatc cttgaggccg aggctctcct tccagcgcag     63420
     cctcttcgcg acggcacggg ccatgatcgg ctccaccccg gcgtcctgaa cggcgtcggc     63480
     cgacatctcg agttcctcgg cgcggcgctt ggcgtgaatg gctccggacg gagtcaagct     63540
     ctgcacggta tccatccagg ggcgcgccag cgtcttggag gcggaggcga gcacgatctc     63600
     gtcgatccca tattggcggg ccgcgagcag catctcgtcc gtcagcgcct cgatgccctt     63660
     gatgaggacg gagcggagaa tcttgatccc ggacgccgtc ccgagcaccg gacccatgaa     63720
     ctcgatctgc atgccccagg gcacgagcag gtcacgcacg cgctcgccgg cgggtccgct     63780
     cgacagcatc cgcatggagt agccgtgaag cggcgtcccc tcgatcgagc cgtcaccgag     63840
     aagcgcaccg ctcgccgcca gcttgtcggc gacgcttctc ttgatcttcg gggtggcgga     63900
     cgcgaaatcg aggaaggtgt gccggttcgt caggacgggt gcgaacgcgt ccgcgctctc     63960
     cagcgaggac gcgccgggcg tcacgctgaa gatcaggtcg ctcgcatccg cgagctccgc     64020
     gttcgaccgc accagggtga cgccggcgtc ccgcgccctg ctctggatga ggtcggcgta     64080
     aggaccgtcg aaggcgtatt tgtcgtagca ggcaatggat tcgagaccgg ctccgcgcag     64140
     ccccgctccg agggtgctgc cgatctcgcc gtacccgacg aggcccagcc tgaactgctt     64200
     gcggtctgcc atgacgtgct ccttgtcctc aatgtgatcg gatcagcgcc gcgcttcggc     64260
     cgggctgcgc ttcgcggcgg ccacaacctc ggcgccggcc gccacgtgag cgtgaaggat     64320
     ctcgacggga tgcggcagcc ggacgccgtc gatgagcttg gcctgcaggc ggcaggaata     64380
     accgtcggcg acgagtcggc ccgaccggcc cttctcggct acgggcgccg cccagctgag     64440
     gccgtagatg cgctcggaca tcgcccggtg ctccgcctca tggccgaagg tgccggccat     64500
     cccgcagcag ccggacggca gcgtcgagag gccgagcccg aaagccgcga agacggttga     64560
     ccacgccgcc acggcgggcg gcgcggtcgc ccgctcggtg cagtgcggga gcagccagta     64620
     ggtctctctg tcgggcgttc gcggcgcgcg ttcgagacgg ccggtgagcc attcctggac     64680
     gagctggacg cgcggcacgt cgcgcccggg aagagcctgc gggtactccg accggtaggt     64740
     gagcgtcatg gacggatcga ggccgatgag cgcgacgccg gtcgcggcaa ggcggccgag     64800
     gtcggtcgcg ctcgccgacg cgcgccgctc gaaccggccc aggaagccgt gaacgtgcag     64860
     cggtttgccg ttgggccgat agggcgcgag ccagggccgg actccgatcc cgatcaggag     64920
     atcgagcagg gcgagcagga cgggcgtctc gtagtagctc gtgaatgcgt cctgcacgac     64980
     gacgacgctc atcaggcgct cggaggcgga cagcttcgcc aagacctccg cattggcgag     65040
     cgccacgcct cgacgctcga tctcccgccc gaggttcagc ccggacagcc tcggtgtgtg     65100
     gacgagcccg atcgcgtcgg cgaggccgag tgatgtcgcg cgattgacga gcctcggcgc     65160
     cttggccagc cagggcacca gcgcctccag cgaagcgacg acgtggtggc gcaagggccg     65220
     caggtaacgg ccgtgataca gctcgaggaa cttcgcccgg aagctcggga cgtccacctt     65280
     gatggggcac tggcccgtgc aggatttgca ggccaggcag cccgccatgg cctcgtgcac     65340
     ctcgtgggag aagtcgtcct cccgccggcg aagcgttgcg acgaggcggc ccgggaaggc     65400
     gagccagccc ggccgcgcgc gcagccggat tgcctcgacg agagggtcgc agccctccgc     65460
     ggcgagccgg cgcagccatt cgcgcatgag ctgggcgcgc cccttcgggg agtgccggcg     65520
     ctcgcgcgtg cccttccagg aggggcacat ggcgtcgtcc ggatcccagt tgaaacaggc     65580
     tccgttgccg ttgcagtgga gcgcctcgtc gtagccggcc cgcactcccg gcgggatcgc     65640
     gcggtcgcgc tggcccttgg tcggcacgcc gtcgacggta agcagtgtgc cgccctccgg     65700
     cacggcgatc ttgcccgggt tgaactggtg acgcggatcg aaggcggcct ttacggattg     65760
     cagcaccggg tagagcgggc cgaagaaccg gggcgagaac tcggaccgca cacccttgcc     65820
     gtgctcgccc cagaggagcc cgccgtagcg ctgcgtcagc gcgacgacgt cctccgtgac     65880
     ctcgcggatc agggcctcgg cgcccggcgc cttcatgtcg atcgcaggcc gcacgtgcag     65940
     cacgcccgcg tccacgtggc cgaacatccc gtaatcgaga ccgcgccgat cgagcgctgc     66000
     ccggaactcc gcgatgaagt cggcgaggtt ctcgggcggg accgcggtgt cctcgacgaa     66060
     ggcgatcggc cgcttgtcgc ccttcatgcc gcccaggagt ccgaccgact tcttgcgcat     66120
     gtcccagatg cgatcgacgt ccatctcccc ccgcgccacc gtgtagccgc gccgccctcc     66180
     gacaggaccg gccgcgtcca gcgccgccgt gaggcgtccc accgcctcct cgacctcggc     66240
     gccgctgttg ccgacgaact cgatgagatt gacgccgtgc gcccgctccc cgccgttttc     66300
     ggggaagaag gatgcgacgc cttcccagat gagatcgcct tgggcgagcg ccagcaccgt     66360
     ggagtcgacc gtctcgatcg acgccgcccc gaaggatacg agcgcctgcg cgtcgcggag     66420
     cgctgcgtcg aagctgccgt agcggagatt gaccagcgcc gcatggctcg gcagcggcag     66480
     gacgttgagc gtcgcctccg ccagaaatcc gagcgttccc tccgagccac acaggacggc     66540
     gttgaggtcg aaccgtccgt ccgcgcgtcg gatgtgggcg aggtcgtatc ccgtgagaca     66600
     gcggttgaga ggcggaaacc gctcagtgat gagtgccgcg ttctcgcgct ggagcctgtc     66660
     cacgtcgcgg tggatgatgc ccacacggtc ggatcgcgct tggatggctg caagttcggc     66720
     ctcatcgagg gggcctgagt gccaaaccgt tccgtcagac aggacggtcg tcagttcgag     66780
     cacgtggtca cgcgtcttgc cgtagagaca ggagccctgg ccgcaggcgt cggtcgagat     66840
     catgccgccg atcgtggcgc ggttggaggt cgagagctcg ggcgcgaaga agagcccgaa     66900
     aggcttgagc gccgcgttga gctggtcctt gacgacgcct gcctcgaccc gcgccgtgcg     66960
     gcgttccgga tcgatcgcca cgatgcggtt catgtgccgc gacaggtcga cgacgagccc     67020
     gtccgtgagg gactggccgt tggtaccggt cccgccgccg cgcggcgcga tccgaacctc     67080
     tgtgaagcgc tcttctccga ggagcgtcgc gatgcgcacg aggtcgtcga ggccgcgcgg     67140
     aaaggcgatg gcctgcggcg tgagctggta gatcgaattg tccgtcgccg cgacggttcg     67200
     atcggccgcg cccaccgaca ggtcgcccgc gaagccccgc gcccgcaact cggcgcagaa     67260
     gaccgcgtag accgacagcg tgacgggttc gggcgagagg cgcgggatca tggcgtcagg     67320
     ccgggatcgc ggttgcgaca tcgtcccgcc ggacgaggcg accgaagacg accatcagcg     67380
     ttgcgccaaa caggagggag cagccgaccg cgacgagcgg cgccgtgaac ccgcccgaga     67440
     ggtcgcgaac gaagccgatc atgtaaggcc cgacaaagcc gcccaggttg ccgatggaga     67500
     cgatcatcgc gatcccgccc gccgccgcgc ggccggtgag aaagctcgac gggacggccc     67560
     agaaggtcgc cacgaaggag ttgatgccga cgaccgcgat gcagagggcg acgatcgtga     67620
     ggagcggcga tgaggtgaag gcgctggcca ccagggcggc cgagccgacg aacagcgaga     67680
     tggcggggta gatcgttcga tcgctgcccc ggtccgacat ccggccccac accaccatcg     67740
     cgattgcccc gcagaggtag gggatcgccg tgacgaaccc gacgacggac gtggcgaggc     67800
     cgagttgctt gatgatctga ggcagccaga ggccgatgcc gagtgacccg atgatggcac     67860
     agaagttgat ggtcgcgagc gtcagcaccc gccagttccg aagagcctga gccagcgtga     67920
     ggttgtgctt cttctcgatg gcggccttct ccgacgcgag ccgggagacg aggaagtcgc     67980
     gctctggggc ggacagccag gcagccttct cgggcttgtc ggtcaggacg aggaggcagg     68040
     cgacgccgag gatcaccgca ggcgcagcct caagaacgag gagccactgc catcccttga     68100
     gaccgaagcc ctcgagctgg accaaagcgc ccgagatcgg cgacccgacg atgttcgcga     68160
     ccgggatccc cagcaggaac agagccgtcg ccctggcccg aacggcggag gggaaccaca     68220
     tgctcaagta aagaaataca ccagggacga agcctgcctc gccgaggccg agcaggaacc     68280
     gcgcgatgcc gaactgaacc gggcctgtca caaatgcagt cgcggccgag acaagccccc     68340
     aggtgatcat gatccgtgcg atccaaagcc gggccccgac ccgcatcatg atcaggttgc     68400
     tcgggatctc ggcgacgaag tagccgaaga agaacaggcc cgctccgacg ccgaaagccg     68460
     tcgcgctgag gtcgatgtcc ttgttcatcg tgagcgcggc gaagccgaca ttcacgcgat     68520
     ccaggtagct gacgacgtag cagatgaaga ggaacggcag aatgcgccgc agcatcttgc     68580
     ggtagagcgc gtgctcgtcg accgccgccg tctgagcgaa tgccggctcc gccgggcgcc     68640
     cccatgccat gacgctctct ccctggtgaa ttttgcaacg gcgtttcatt ttgcgtacat     68700
     ggcatggttg cgcaggtcaa gcgtccacgg agcgttcggg ggatacctcg ccttggagct     68760
     gcctaagcga gcgcctgcaa aggtgatcag ggttcgggtt cccgaggcgg acaagttgac     68820
     caacaaagcg tcgcaatcat cgagctggcg gtccagcgct ttacggacga tccagatcgc     68880
     gccacgaagc ctgtgcattg atgcgaagca cgcccgggac ctgtcaccgc atgccacaag     68940
     acagttatgc ttcggaatgt cgcatgcggg ctgcgctctg acgggacgcg cgcgtcaggc     69000
     cgagaccgct tcaagccttg tctcaggtct cttcccggcc cggtcgcatc gtttggtgac     69060
     acgggaaagc gcgtttaaag gtttcccttg gtgagccatc cgaactgtga gcggacgaga     69120
     aacgaatgcc gaaagaggct cgaaagaggc ccaagcttga gggcgttgcc tcggccgaga     69180
     gggtgttgac ggttttgact gcttttcgac ggggcgacga cgcactcgaa ttatcggaac     69240
     tcgcccgccg cacatcgctc gttaaaagca ccatcatgcg gctgtgcatc tcgcttgaga     69300
     agttcgacct aattgaacgc ctggatgatg gacggtatcg cctgggggtt gaggccgctc     69360
     gcatcggctc cgtttatcag caatcctttg cgttggagga acgcgttgtc cccgttctgg     69420
     agcgcctcgc cgctgagtca ctcgagacgg cgtcgtttta tattcgtcgc ggaaatcaga     69480
     ggctctgctt gttccgagca gattcgccgt acccgctccg catgaatgtt cggccgggcg     69540
     acatgcggcc gatggataac tcggccattg cgcaggtgtt atctattttc ggagaccgaa     69600
     tgctgccaaa gcagaacgat gtaaagcttc ctatctatac gtcaggtgtc accgatccgc     69660
     atgttgcatc ccttgcaatg ccgatcttcg gcaccgaaag acggctcatc ggagcactcg     69720
     cgttgtcagg tccttcgtcg cgtctcacag ctgagcaggc cagcgtttta gagccgcggt     69780
     tacgggacgc ggccgagcgt ctctcatccg aattgggcgc acaactttga acaataatac     69840
     ttctgtaggg cctgtcgcaa acgcgctgac gttcagcagc cgttaggcat acccgtccaa     69900
     cttgccgcct ccatcccgga agcggcccat gatcctcacc gccctcgcgc tcaagctgaa     69960
     gcgccaggcc cgcggcgact tcacgagtcg gcacttcgag gccatgctga tcgtccaggc     70020
     cgtctcctgg tccctgcacg acgcccagag cgaccgggac atcgcggaga tgctgctgga     70080
     gcgcgacctg actgtcgacc actccacgat caatcgctgg gtgctcgccg acgcgccctc     70140
     gatcgagcgc cggctgcgcc aattgagccg gctggcacaa ctcccacgac ctcgtcgtgc     70200
     ccgacaccat cagcctgctg cggctgccct cctgcgcgcc ggaactcaac ccagtcgaga     70260
     acgtctggca gttcctacgc gacaactggc aaggcggtca gatcttcgcc tcctatgggc     70320
     tggacgagcg cggggtcaca ttccgctgga aggatgaccg cgtccgggcc ggggcgaggg     70380
     gccgggagtg gatcaagagc ctgacgctgt cggccgacga gttcatccgc cggttcctgc     70440
     tgcacgtcct ggccgacgga ttccaccgga tccgccacga cggcttgttc gccagcagga     70500
     cgcgggctgc ttcccctgca aaatccgggc gctgctcgct ccagaggcgc ctctcgatcc     70560
     ggtcaagccc gagcctgccc gcgccgcgcc ggctccaccc ggtcagactt ccagcgcagc     70620
     gcctcgacca gcacggcaag agcctgggcg ggttgccggc ggctcggata gtagatgtga     70680
     tagccggaaa acggctcgca ccagtcctcc agcacccgaa caagcgcccc ggtgtccaga     70740
     tgggcctgca ctccgtcctc ggggagatag gcgatcccga acccgtcgag cgcagccagc     70800
     aggatcagcg tcacggtgtt gaacacgagc tggccctcga cccacaccct gagctcgcgc     70860
     ccgtccttct cgaactccca ggcatagagc ccgccacgcg ttggcagccg caggttgatg     70920
     cagtcgtgaa tggtcaggtc ctccggacgc tccggctttg agcgaccggc aaaataggcg     70980
     ggcgcggcga cggcggccat gcgcacgtcc ggcccgatcc gcaccgcggt catgtccttg     71040
     gctaccgtgc ccccgtagcg cacgcccgcg tcgaagcgct cggcgacaat gtcggtcagg     71100
     ccgtagtcga cggcaatctc caccttgatg tccgggtatt ccggcaagac ccgcttcagg     71160
     gtcggccaga gcaccgtgtt cgcagcatgc tcggtggccg tgatgcggac ggtgccggcg     71220
     ggcttgcccc ggagctccgc cagcatggcg agccccgcct cgatctccgc gaaccgcggc     71280
     cccaccgcct tgaggaggcg ctccccggct tcggtcggcg cgacgctccg ggtggtccgc     71340
     gtgagcagcc ggacccccaa gcgcgcctca aggccgcgga cggtctggct gagtgccggc     71400
     tgcgacaccc cgagctgcgc agcggcccgg gtgaagctgc ccgtgcgcgc gacggcgatg     71460
     aaggcgaaca ggtcgttcag gctctcgcgc aacattcata aggctcgctc ataaccccat     71520
     gtgcatcccg gcatctaatc cgggtcgggg ccaagggcta gcttgactcg cgagcatccc     71580
     ccgcaaacgc ggcgaggcgg ggacacccat cgggacggag cggcaccatg gagatcaagc     71640
     gcctcggctc gcagccctcg ggcaagggcc cgcaggagtg gttcaccggc acggtccgcg     71700
     tcgaccccct gttcggctcg tccgagccgg cccgcacgag cggcgccctc gtcaccttcg     71760
     agcccggcgc ccgcacggct tggcacaccc acccgctcgg ccagacgctc atcgtcaccg     71820
     ccggctgcgg ctgggtccag cgcgagggcg gccccatcga ggagatccgc cccggggatg     71880
     tggtctggtt cgagccgggc gagaagcact ggcacggcgc cactgcgacc atcgcgatga     71940
     gccacatcgc catccaggag gcgctcaacg gcagccccgt cgagtggatg gagaaggccc     72000
     gcgacgacca atacgcgtcc cccgtcgccc cagcaagcgg gcagcactga ccatgccgac     72060
     cgccctcgca cccatcactc actgagaagg aagaaaccga tgagcgtgac gtattcgttc     72120
     gaaggacagg tggccctggt gacgggtgcc gccatgggca tggggctggc gacggccaag     72180
     gcgttcgccg aggcaggcgc ggcagtcgtc ctgtccgaca ccaacgcgga cgccctgaag     72240
     tccgccaccg aggggttgaa ggcggcgggc catcgggtgc tcggcgtccg gtgcgacgtc     72300
     gcgaacgagg ccgaggttgc ctccatgatc gagcggacgg tcgagacgtt cggccggctg     72360
     gatgcagcct tcaacaatgc cggtatccag atcccgcccg ccgacatcgt cgacgtgccc     72420
     agcgaggatt acgagcgcgt gatggcggtc aacctgcgcg gcgtgtggaa ctgcatgaag     72480
     cacgagttgc gccagatgca ggcgcagggc agcggcgcca tcgtcaactg ctcgtcgatc     72540
     ggcggcctga aagggttgga gttcctcgcc gcctatcacg gcacgaagca cggcgtgatc     72600
     gggctgacca agtgcgcggc gcttgagaac gcggcacggg gcatccgcgt caatgcggtc     72660
     tgcccgggca ccatcgacac gccgatggtg gccgcgatgg tgacggagcg gcccgaggcc     72720
     atggcggaga tcatcaagaa gcagcccatc gggcggctcg ggcggcccga ggaggtcgcg     72780
     tccgcagtgc tctggctctg cagcgatgcg tcgagcttcg tgctcggcgt tgccctgtcc     72840
     gtcgacggcg gcttcgccgc gcactgatgg gccgtcccat gcgacgcggc atgtggacgg     72900
     cgacgcttct cacgacgacg gcgctcgtcg tcctggctgc tcaggccggg ctccacggcg     72960
     agcccgggcc ggaccggcgg ccgtcctcac ccacgagcca gagagggcat gcgatggaga     73020
     gcgttcgaat tctgctggcc ggcgagagcg tcaccgcgac cctggaggac ggcgaggcgg     73080
     cccgcgcctt caaggcgctc ctgcccctga cgttgagcct gacggattac aacgcgaccg     73140
     agaagatcag cgatctcccc aagcggctgc cgacccaggg cgcgccggcg ggcttcgatc     73200
     cggaacccgg cgacctcgcc tattatgcgc cctggggaaa cctggcggtc ttctacaagg     73260
     acttcggcta ctcccggggg ctcgtccgcc taggcaagct gagccgcatc cccgaagcgt     73320
     tccgtggtcc gggtccggta accgtgacca tcgaagccgt cacgtcccgc gagtgagccg     73380
     gcagcgatga tcggacaggt gatgtgcgcg acgcccggcc cgcggcggct ggcccgacgg     73440
     gcagccctgg ggctcatcgt tctgaccggc gtcgccggcc tcgctccggc gggccgtacg     73500
     caacccggcg aggtgccgcg cgcactggcc tacgacgcgc agacgcgcgg ggccgtgccg     73560
     atcccgccgg ccgagcgcgg gcttcagacg gtggtggccg agccctggtt caaggtgtcc     73620
     gacgagggtg tgcccctgga ggggccggcc ttcgaccgga acggcaacct gctcttcacc     73680
     gacgcgggca gcggacgcgt gttccgcctc gcgccggaca ggcgcctctc cactgtcgtg     73740
     cccgcgaaca ctctcgggct cggcggtctc gcggttcata aggacgggcg catcttcgcc     73800
     gccgggacgg gcggcttccg gcacggctcc gtcgtcgtcg tctagcccga cggctcgggg     73860
     ttgcggacgg tcgtgccgcc ggaggcgggc tacgtgccga acgacctggt gttcgacgcc     73920
     cggggcggct tctacttcac cgacttccgg ggcacctcca ccgatccgca gggcggcgtc     73980
     tactacgtct cgccggacct caagacggtc acgcccgtcc tgccgcacct cgcgatggcg     74040
     aacggcgtcg cgctgagccc ggacggcaag acgctctggg tgacggagtt cagccggaac     74100
     ctcctgcatc gggtcgagct ggcggatgcg accactccca caccgttcgg gacggcggtc     74160
     gcctaccact tcaccggctc cgcgccggac tcgatgcgcg ccgacgccga cggcaacctc     74220
     tacgtcgcca tgtacggcca gggtcgcgtg ctggcgttca accgcaacgg catccccatc     74280
     gggcaggtgc tgctgccggg gcgcgacgag ggccacaacc tgcgctccac cagcatggcc     74340
     ctcaagcccg ggaccgacga cctcttcaac atcacgaacg acagagaggg cgggcagggc     74400
     tcgacggtct tccacgccag ggcattcgcg aaggccctgc ctctctactc gcaccagtaa     74460
     cggtcggatc gtccggacct gtcgggcggc gtccgcctcg gagccccaca cccccacgat     74520
     tcccgcgaag gagaacagcc catgaccaca atccagaacg acggctttgc cggcaaggtc     74580
     gccttcgtga ccggcgcgac gagcggcatc gggcgcgcca cggccctggc cttcgcccgg     74640
     gcgggtgcga gcgtggcgct cgcggacgtg tcgcaggagg gcagccgcga agcggcccgc     74700
     atcatcgagg aggcgggcgg gcgcgtcctc gccgtccggt gcgacgtgag caaggccgag     74760
     gacgtgaagg cggcgctcga caggacggtc gagacgttcg gggggctcga cttcgccttc     74820
     aacaacgccg gggtcgagca gccggtcatg gcggccgccg acatcgcgga cgaggatttc     74880
     gaccgcatcg tcgcggtcaa cctgcgcggc gtgttcctgt gcatgaagca ccagatcccc     74940
     ctgatgctgc gcggcggggg tggcgccatc gtgaacacct cctcgggcgc cggggtgaag     75000
     ggcttcgccg gccaggccgc gtacaccgcg accaagcatg gggtgatcgg gatgaccaag     75060
     tgcgcggccc tcgactacgc gaaggagaac atccgggtga acgccatctg ccccggcatc     75120
     atcgacaccc cgatgatgca gcgtttcacg ggtgggaccc ccgagggcgt ggcgcgggtg     75180
     gtcgcgcagg agccggtcgg ccgcatgggc aagcccgagg agatcgccgc cgcggtcctc     75240
     tacctgtgct cggccccggc cgccttcgtg accggacacg ccatggtggt cgacggcggc     75300
     cagacggtgg gctgacgccg ggcccggtca gccccgatgg cgcaatgcct cgaccagaac     75360
     cgtgaaggcc ggggcagcct ggcggcggct cggatagtat agatggtagc cggggaaggg     75420
     ctcgcaccaa tcctccaaca cccgcaccag ccgcccctcc gcaacctgcg cctgcacctg     75480
     gtcctcgggc aggtacgcca gcccgagccc ggccagggcc gcgttccgga tcagatgcag     75540
     gctggtgaac acgagctggc cctcgacccg tacggcgagc tcccgccccg ctcgtccgaa     75600
     ctcccaggga tagaacccgc cgcgcgtcgg acggcgcagg ttgatgcacc tttgggcggt     75660
     caggtcctcc ggctgcttgg gcttgggccg gccctggaag taggcgggcg cgccgaccac     75720
     ggcgatgcgc atgggcggcc cgatccgcac cgcgaccatg tccttctcga cgtgctcgcc     75780
     gatgcgcacg cccgcgtcga agcgctcggc cacgatgttc gtcaggctct gctcggtgac     75840
     gacctcgacg gtgatgtccg ggtaatccgg cagcagccgc tccagggccg gccacaggac     75900
     cgtctctgcc gcatgctcgg gcgccgtgat gcggacggtg ccggccggcg tctcccgaag     75960
     ctccgtcaac gccgagagct cgacctcgat ctgctcgaac tgggggccca cgatgcgcag     76020
     caggcgctcg ccggcctcgg tcggcgacac gctgcgcgtg gagcggttca gcaactggag     76080
     cccgagccgc gcctcaagcc cgttcatggc gtggctcaag gccgactggg tgacgcccag     76140
     acgagccgcg gcgcgggtga agctcccctc ctgggccacg gtggtgaagg agagcaggtc     76200
     cgtcaggttc tcccgcgcca ttcataacct ccgctcataa gcctaagtga attcgagcgc     76260
     ctaatccagt tgtccgaagg gctctagctt cctcgtcaag gaaggcgaga ccgaccgcgc     76320
     agctcgtcgg gtcgcgacgc cccatcggcg atgacgaccc cgtcgccgcg aacggtccgg     76380
     aggacgatat ggacggttcc aacgcgttcg aactgaaccg gagagacttg atggtcggag     76440
     catccgccac cgcggccctt ggtgccatgc ccttggccgc gggcgccaag cccgccggca     76500
     ccgaaaggcc caacctggca aaggtcgtgt tcacggtgaa cggcgagcag cgcgaactcg     76560
     aactcgacat ccgaaccagc ctgctcgacg ccgtgcgcga gcacctgcac ctgaccggct     76620
     ccaagaaggg ctgcgaccac ggccagtgcg gtgcctgcac catgatcgtc gacgggcggc     76680
     gcatcaatgc ctgcctgacg ctcgccgtca tgcaccaggg cagcgaggtc accaccatcg     76740
     agggactcgg ccagccggag aacctgcatc cgatgcaggc cgccttcatc aagcacgacg     76800
     gctaccagtg cggctactgc acgccgggcc agatctgctc gggcgtcgca gtgctcgccg     76860
     agatcaaggc cggcatcccg agccacgtca ccgccgacct caccgccacc cccgaggtga     76920
     cggagaccga gatccgcgag cgcatgagcg gcaacatctg ccgctgtggc gcctactcca     76980
     acatcgtcgc ggccatgacc gaggtcgccg ggaggcaggc atgaggtcct tcacctacga     77040
     gcgcccgagc acgccggccg aggccgcggc ggccgtcgcc cgcacgccgg gcgcgaagtt     77100
     catcgccggc ggcacgaacc tgctcgacct gatgaagctg cagatcgaga cgccgaccca     77160
     cctcgtcgac gtgaacgggc tttccctcga ccgcatcgag ccgacgccgg aggggggctt     77220
     gcgcatcggc gcgctcatgc gcaacaccga cctcgccgcc gacccgcggg tgcgcaagga     77280
     ttacgcggtg ctgagccggg cgctgctcgc gggcgcctcg gggcagctgc gcaacaaggc     77340
     caccaccgcc ggcaatctga tgcagcggac ccgctgcccg tacttctacg ataccgccca     77400
     gccctgcaac aaacggcagc cgggctcggg ctgctccgcc ctcgacgggg tcagccggca     77460
     gctcgcggtg atcgggggca gtgacgcctg catcgccacg aaccccagcg acatggcggt     77520
     cgccatgcgg gttctcgacg cgacggtcga gaccgtcgac gccaagggcg ctgagcggac     77580
     gatcccgatg gccgagttcc accgcctgcc cggcgacacg cccgaggtcg atacgaccct     77640
     gaagccgggc gagctcatca ccgcggtgac gctgcccaag cccctcggcg gggcgcaggt     77700
     ctaccgcaag gtgcgcgacc gcgcttctta tgccttcgcg ttggtctcgg tcgccgccgt     77760
     ggtgcagccg gacggcacgg gccgcgtcgc cttcggcggc ttagcacaca agccctggcg     77820
     ggtagaggcc gccgaggccg acctgccgcg cggggcgaag gcagtggccg ccaggctcct     77880
     cgacggagcc aagcccaccc acgacaacgc gttcaagctg aagctcgccg agcggactct     77940
     cggcgcggcg ctcaagcaag cgagggcctg agccatgaag ttcgacaccc ccgcgggcac     78000
     caaccccatc gaccagctca aggtcgtggg ccgcgctacc gaccgcatcg acggcaagta     78060
     caagaccacc ggcacggcgc cctacgccta cgagcgccac gacgtcgtgc cgaaccaggc     78120
     ctacggctac gtgctcggca ctggcatcgc caagggccgc gtccgtgcga tgcacgtcga     78180
     ggaggcccgg caggcgcccg gcgtcctcgc cgtcgtcacg acgctcgaca cgcctcggct     78240
     cgggcgcggc atgttgaacg cggcctacct gttcggggga ccggaggttc agcattacca     78300
     ccaggcgatc gccgtcgtgg tggcggagac cttcgagcag gcccgggcgg cggcgttcct     78360
     catccgggtc gactacgcgc cggaggtcgg ccgcttcgac ctggccgcgg agacgccgtc     78420
     cgcgccgccg gtcgggggcg acagcgggga gggcagcggc agcagcggca aggagcgcgt     78480
     cggcgacttc gacggcgcct tcgcgcaggc tcccgtcacg ctcgacgaga cctacaccac     78540
     cgccgacgag agccacgcca tgatggagcc gcatgcgacc atcgcggcct gggagggcga     78600
     caagctcacg ctctggacct ccaaccagat gatcgcctgg gccaagggta gcatcgccaa     78660
     gatccttggc atcccgaagc agaacgtccg ggtcgactcg ccctatgtcg gcggcggttt     78720
     cgggggcaag ctcttcgtgc gcgcagatgc ggtgctcgcc gcactgggcg cgaaggcggc     78780
     gcaacgcccg gtcaaggtgg cgctgacgcg tccgctcatc cccaacaaca ccacgcaccg     78840
     acccgccacc atccagcgca tccgcatcgg cgcgacgaag gacggcacca tcaccgccat     78900
     cgcgcacgag agcacgtcgg gcaacctgcc ggacggcagc cccgagacgg cggtggacca     78960
     gaccaagctc ctctacgccg gcgccaatcg cctcactgcc ctgcggctcg cccatctcga     79020
     ccttcccgag ggcaacgcca tgcgcgcgcc cggcgaggca ccgggcatga tggcgctgga     79080
     aatcgccata gacgagatgg cggagaagct ggggctggat ccggtggagt tccgcatccg     79140
     caacgacacc caggtcgatc cgaaccagcc ggggcgccgc ttctcccatc gcgacctcgt     79200
     cggctgcctc aggctcggtg ccgagcggtt cggctgggcc aagcgcaacc cgattcctgg     79260
     acaggctcgt gacgggcagt ggcttgtcgg catcggaatg gcggccggct tccgcaacaa     79320
     tctcctgggc aagtccggcg cgcgcgtccg gctcgacgca ggcgggactg tgacggtcga     79380
     gaccgacatg accgacatcg gcactggcag ctacaccatc atcgcccaga ccgcggcgga     79440
     gatgatgggc gtgccgctcg acacggtcgt cgtccggctc ggcgattccg acttcccggc     79500
     ttcggccggc tccggcggcc aatggggcgc caacaactcg accgccgggg tctatgcggc     79560
     ctgtgtgcag ctgcgcgaag cggtggcgca gcggctcggc atcaactcgg ccgacgccgt     79620
     cttcgcggac ggccaggtcc gctcgggcaa tcgcgtcgtg ccgctcggcg aggcggcgag     79680
     ggcgggcgaa ctcaccgccg aggacgccat cgagtacggc gacctctcca agaagcagca     79740
     gcaatcgacc ttcgctggcc atttcgtgga ggtgggcgtc gatgtcgaca ccgcggaggt     79800
     gcgggtgcgg cgcatgctgg cggtctgcgc ggctgggcgc atcctcaacc cgaaatcggc     79860
     ccgcagtcag gtcatcggcg ggatgaccat gggcgtcggc gcggcgctga tggagaaact     79920
     ctcggtcgac aggcgccgcg gcttcttcgt caaccacgac ctcgccggct acgaggtgcc     79980
     ggtgcatgcc gacatccccc accaggaggt gatcttcctc gacgaggtcg atccgatgtc     80040
     gtccccgatg aaggccaagg gggtgggcga gctcggcctg tgcggggtgg gcgctgctgt     80100
     ggcgaacgcg gtctacaacg ccacgggcgt gcgggtgcgg gattatccca tcaccgtcga     80160
     caagctcctc gaccgcatgc cggacgcggc gtgaggcgcg agggagatcc ggccatgcgc     80220
     gccatgaccg cgttggcgac gtcgctcctt ctcgtggccg cggctgccgc tgtggccgcg     80280
     gagggaacgg tgacggtcca gcgaagcggc tcccagccct ctgctaaggg ggccgccgga     80340
     cagttcacgg gttccgtgcg cgtcgacccg ctgctcaggg aggcgccccc gttgcgaatg     80400
     tcgggggccc tcgtcacctt cgagccgggg gctcgcacgg cgtggcacac ccacccactt     80460
     gggcagaccc tgatcgtcac cgccggggcg ggccgggtcc agcaatgggg cggcccgatc     80520
     caggagatcc agcccggcga cgtggtgcgc atcccgcccg gcgtgaagca ctggcatggg     80580
     gccgcggcca ctgccggcat gagccacatc gccattgcgg aggcgctcga cggcaaggtg     80640
     gtcgactgga tggagcacgt caccgacacg cagtaccgcg gcgagtgagc cagccgccgc     80700
     ggaccggacc gagaaaggaa gctgtcgtct catgcgcccc aagatcatct gccacatggt     80760
     gagctccatc gacgggcgcc tccatcccag ccgcttcacg gtcccggcgg ccggcgtgga     80820
     cggcgaccgt ctgcggcggc actacgacga ggtcgcggct cgcttcgggg cccaaggctg     80880
     gatggtcggg cgcaagacca tgcaggagat cgcgaagggc gcggcacgga caccggccgg     80940
     cgctggcgtc tcctcgcgtg agccgttcgt cggcaaccgc aagggccgcg acctcgccgt     81000
     ggccatcgac ccccacggca gggtccacta cgggcaggat cacgtcctcg gcgaccacgt     81060
     cgtcgccgtg ctctcggagg cggtgtccga cgcctacctc gccgaactgc gggaggacgg     81120
     cgtgtcctac ctgttcgcgg gtccggacgg caccgacctc cgccgcgcga tggacgccct     81180
     cggccagacc ttcggggtgg agaccatcct gttgcagggt ggtgcgagca tcaacggcgc     81240
     cttcctgaag caacggctca tcgacgagat cagcctgctc atccaaccgg ccatcgacgg     81300
     cttggccggg gtgccgagca tcttcggata cgaggggagc gccgatgagc ggccgggtgc     81360
     tgggcaggcg cttcgccacc tgcacaccga gacgcttgag ggcggcatgg tctggttgcg     81420
     ctaccgcgtc gaggacgcac cggctttggg gtgaggatat cgacgttcgg cagcgcgtgc     81480
     ggcgggcgcg ctccccaatc ggccacgtct aagcatgtcc ctcgatcgcc cctcccggcg     81540
     cgggatcggc tgcgatcctg cgcgtgatcg ccctgttgct cgccggcccg cgcgtctacg     81600
     agacctggat tcggacctcg atcactaccg gccgtgggtc gtgcgcctct ctcaggcgcc     81660
     gcaggatcgg ccgggcgcct cgccgggtcc gggtcgccgt tgctgcgtta ccttagagta     81720
     gagggccgcc gccatgccgg gccatcacat catcgccgac ctcgacgaag ccgatctgca     81780
     catcgcaatg gcgagcggcg gatcagcgag ctcgttgccc aaactcaggg cgcagcgcag     81840
     ggaccagaag acggcctgga cgatcagggc ggcctcgaag tggcggccct tgaagtcgcc     81900
     atgggcttgg cgcttcagct tgagggcgag ggcggtgagg atcatggccg gctccggggc     81960
     ggaggcggca agctgggcgg gtatgcctaa cggctggtga acgtcaccgc gtttgcgaca     82020
     ggcccccttc ggctggatcg ccggccgggg ggccgcttcg gcgctccgcg agcagaccga     82080
     gcagccgacc gcgggtgagc cggcggcgct cagtccgact ggtacatcct gatccgcgtc     82140
     ttgaaggagg cgcggatatg ggcgcgggcg gcctcctccg cgccatcgcg gtcatgcacc     82200
     cggatccgcg ccacgatggc cgcgtgctcg tcgacggctg gctccgcgcg gcccggctcg     82260
     gcgagggtgg tgccggcaag caggaccagg gacaggcgca tgttctccag catgccctgc     82320
     aggaagcggt tgcgggcgca ggcgtggatc tgccgatgga agagccggtt ggtccgcgcg     82380
     aggattctcg gatcgtgggt cagcgtgcgg tcgcgggcga ccatctcttc cagcacgtcg     82440
     atctcggtgt cgctggcgtg ggtggctgcg aggcgagccg ccatgccttc gagcacctcc     82500
     cgcaggtcat agagctcggt cacctgcgcg tatccgagct tggtgagcgt ggcgccgcgg     82560
     tgcggctcgt gcgtgacgag cccatgggat tcgagccgcg ccagcgcctc gcggatcggc     82620
     gtccggctga tcgcgaagcg ctcggccagc tccgcctccc gcagggattc ggacagggtc     82680
     gcggaggcgg ttgacgctat gcggcagggc gtcggatcag gccacgattg aatccggcct     82740
     gaccccggtg cctcgaacgc gtggtgccct atttcgtgtt caacaaggcc gacctgaggc     82800
     tcaaatgaaa cgcgctctga tcatttttgc tgctccgctc ctgatgaccg caggaacatc     82860
     atgtgcgtat gcaaaagatc cttggaagaa atactataag caagagatga aacaggagaa     82920
     agagttctat aaggcccgcc gcaaaagcga gaaggcttgg cacaaatatc acaagaagta     82980
     cggttacgat tggtaggacc gcaccatatc aggcggatcg gccagacgag aagagcccgc     83040
     cacggcagga ccgggcgggc tgagaagggc accattggga ggagtgccag acaaccacgc     83100
     cggccggcgc ggcgccttaa cctgggctac cagcttcagc cctatcgttg cggccgtcac     83160
     gctgcccttc gatccccagc cagctaggca gggtgccgtg accagcggac ggacaaagac     83220
     ctgtcggtcc ggccgctgca cgcaagacag gcccgccacg gcaagatcta tcccgtcctg     83280
     agcccgcagc cgtgcagcga cggccagcag acctgcgcga tcgagccacc ctgccatctc     83340
     gggatcgtcc agttcctggg cacgcacgct caggctggcg aaccgccgca gcaggtactg     83400
     cacgtcgtca ttgatcagca ggctcggcgg tggcgcggct tccgcggccg gcgatgcggc     83460
     atgcccgacg aagcgcaggt gtgaggtctc gggcatgctg gccgccccgc caaatcaggc     83520
     tggtagagcc ttgctaccct gcactgcgcc cctggagatg caacctccaa cccgcttgtg     83580
     gaccgccgca ctgcccccta atgttaaaac atcagttaga acggaggggc tgccatgctt     83640
     gcgctcaagc tgacggcgat cggcaattcg gtgggcgtca tcctgccgaa ggaggcgctg     83700
     agccgtctca aactcgacaa gggcgatacc gtgtatctca ccgagacgcc ggacggctat     83760
     cggatcacgc cctataacga ggaattcgag acacagatga aagccgcccg cgagatcatg     83820
     cggcagaacc gtgacgttct tcgcgagctt gccaagtaat tggcaagtaa tgccgatctg     83880
     gatcatcaaa gaggtcgtcc tcgccgttca cgacgagcaa ctggcggagc acggcggttc     83940
     ctcgggcgtg cgggacgagg gcgccctcga ttccgctttg gcacggcctc agaacaaaga     84000
     ggcttacggc tgcaccgaca tcatggaact cgcggcagcc tatgctttcg gtgtggcgcg     84060
     caatcatccg ttcatcgacg gaaacaagcg gacatcattc gtagtgacct tgctgtttct     84120
     gcatatgaac ggatttgttc tgacagcacc gcagtccgac cgggtgacga catggctgtc     84180
     gatcgcggcc ggcgagatgg acgaggccgc catcgcggca tggctgcgcg cgaacacgcg     84240
     gccgatctag ggtctggact cgatcagatc gaaggcctcg ggttggggga aagcgaacca     84300
     tcatggtcag gcagcctgtc ggttgcatga gacccgcgat cagcataggt tgcgtgaatg     84360
     gaccttgacc ccctcttcaa agcgctggcc gatccgacgc gtcgccgtct gctggacgag     84420
     ctcgcactgc gggacggtca gacgctgttc gagttgcacg cccgcttggt tagatgccgt     84480
     aatgggcctg ccgccagggt gtagcgaggc ggggcggcag gcccattacg gcatctagga     84540
     gcccgtccga gtaagtacct cgacggcggc gctttgggat gattcactcg gctcatggcc     84600
     aaggtgtttc gctcctggga cgtcgatcag ggctggctgc tgccaccctc gctgcatgag     84660
     ttcgtgccgc ccgggcacat ggcgcacttc gtgcgcgata cggtgcgcga ggcgctcgac     84720
     ctctcagcca ttctcgacac ctacaccgag gagcgcggct acccgcccta ccatcccggc     84780
     atgatggtgg ccctgctcct ctacggctac agccgcggtc tgtactcgtc gcgtcagctc     84840
     gcccgcgcct gcgaggagcg ggttgacttc atggccgtga ccggcctgaa ccggcccgac     84900
     ttccgcacca tcgctgactt ccgcaagcgg catctgacgg cgctctcgga cctgttcgtg     84960
     caggtgctgc ggctgtgccg ggcggccggg ctggtcggct ttgcccacgt ggcggtggac     85020
     ggcaccaagc tgaaggccaa cgcctcgcgc cacaaggcga tgagctacgg ccggatgaag     85080
     gcggccgagt cgacgctggc cgccgaggtc gaggcttggc tggatcaagc gcgcgaggcc     85140
     gacgcggcgg aggatcgggc tcatgggacc gaccatcgtg gcgacgagac accggcctgg     85200
     atggccgaca agcagcggcg gctggagacg atccgcgccg ccaaggccgc gttggaggca     85260
     gaggctgccg atccgcccga tccggaggac gaggacgggc cgggggcctc gtcgggcatg     85320
     cgctggcaag gtcggccctt gcggggcgag gacggcggtc cgcccgaccg ggcgcagcgc     85380
     aacttcaccg acccggacag ccgcatcctg cccacgcgcg acgggttcgt gcagggctac     85440
     aacggccaga ttgcggttga tgcggcccat caggtgatcg tcgcgcatcg gctcgtgacg     85500
     aaccccgccg actcgcgcgc tctcgtgccg ctcgtcgacg gcgtctgcac ccatctcggg     85560
     cgcaagccgc gggaggtctc cggagatgcc ggctttgcca ccgaggcgaa cctggccgcg     85620
     ctgcaggagc gacggatcac agcctatctc gctccgggcc gtgcccgtca cggcgaggcg     85680
     gatgcagcag gtcgccggag gctgacgaag atgcccctga tgagcgcgat ggccgtccgc     85740
     ctgaagcggg ctgggcgccg gagccgttac cgtctcagga agcaggtcgt cgagccggtg     85800
     ttcgggcaga tcaagcaggc cagaggcttc cgacagttcc tgctacgtgg gctcgatcag     85860
     gtccgcggcg agtgggcgat gatctgcacc gcccataacc tcctgaagct ggcgcaggcc     85920
     gcgcgctgag cctgtggcgc aggagccatc cgcccagatc tcaaccttag agtccgttgg     85980
     gaaagggtgg ccaagagaaa atgcgggatg atagagcatg tctgctcgtc tcgaatggat     86040
     gaatggcccc tccttggtct ggaccgctgc aaatcggccg cgctatgatc gtcgcagcca     86100
     gagatacccg agtgatatga cgaacgacga gtggctcacc ctggagccac tgcttcctgt     86160
     cgcggagggg atcgggcggc cccggaccta tcctattcgg gacatcatga acggcatccg     86220
     ctacgtgcag cggtacggca ttccctggga tgccatgcca aaggatctgc cgcccgccag     86280
     tctctgctac gattactggc ggttgctcac cgatggcggc cacatggacc ggatcaacca     86340
     tcatctcgtg atgagggatc gtgagaagtc cgggaaagaa gccagtccaa cgctggcgat     86400
     tgtggatgcc caggcggtga agtgtgacgc cccgcaaggc gagcgcgggt acgatgcggc     86460
     gaaacaagtg ctggggcgca agcggcatct ggcggtcgac agcgacggac gcctgcttgc     86520
     ggtgatgatc actccggcca acgttcagga tcaagagggc gggatcccgc tcgtcaagcg     86580
     cttggttcgt ctctgtccct ggatcaagac aatcgtggtg gacggtgggt acaaggcccg     86640
     tttcattgag gcggttcagg ctggcacgag ccgtgtcgtg gaagtggtcg tacggccgca     86700
     atttgggaag ggctttgtgc ttctgccgaa acgatggcgg attgagcaaa gcatcggcgc     86760
     tctcacggtg tcgcgccgtc tcaagctgga ttacgatacg ctgcttcaca tctcggcggc     86820
     ggctatgctt ttcgcctcta taactcggct tctcgcgtca atcactatga aatgaccctt     86880
     tcccaacgga ctcttagtcc caacgcatca aaccgttact cggacgggct cctagctgtc     86940
     gcagacgaac gcgatagaca tcgaagaagc ggtagcggcg cgcctcgatg gccagcagca     87000
     tcacaaggag catggcgaac aggagcaccc catgatgggc agtagggctt gagagcgaga     87060
     ccgacagcat ggcgcgataa ccgtgatcgc ccagttcgtg gtgcggtcga tgcggtcgcg     87120
     ccagccggtt gtgcggccca tttcagctcg atagtagtga gcaacaaccg tgctgacttc     87180
     tgttgaggta ctaggaagtg ggagttgggc ggcgacagga tgggtgtcct gcgaagtatt     87240
     agagagttaa cctatgccca tggtgattct cctgataagt aattggatta gcggtacgcc     87300
     tccgtgtctg ggtgggtcga gagcctggag cgcgaccgcg accggctggt gcgcctcgag     87360
     gatcaggtgc ggatcgcgac ggacctgctg cgggagatcc gccaggagat ccgggcgccg     87420
     cgccgctgac ctgctgcgcc agggggcttg tcacgttggg ccagtatagg ccgttgcggc     87480
     ccaaaacggc gccgccccgg cccggtaagt cgttgaaatt gcacgaaccg ctgcggctcg     87540
     gctcgccagt agaggcaagt aaccaagccc aacgtgacaa gcccgtggcg accacctcct     87600
     cgtcagcgtg cacggcctga tggccgccct ccagcatgcg ccgcttccag gagaacaaca     87660
     gtccagagga acccgccttc cagactggca atgaagtact gtagctgatc gtctccggaa     87720
     agctccaggc gccgaccaat cggctgccgg ctcacgcgtc cccccggccc gagtagaccg     87780
     cgcaggtaga acggggccca gcgtcggcgg gtcttgcgac tcattacggc gaggaagggc     87840
     gccagccacg tatcgagatc ctgagcgtga gggtcggcat cggacatcgc gacctcccgt     87900
     ggcagcctga ctcggaaggg aaacgcacaa cacctcccaa gcgcccaggt agtactagag     87960
     ccgtggccgt ttcggttgaa acggccacgg ctcttcagtc tttgattttt ccgctccctt     88020
     gcgccgaacc ggcctccact tcggcggcgg gggggctcca gcaccccgat cttccgaaat     88080
     aaggccaagt ttaaatcgag gaaaaatatt tcacaatgtc aacccaatat gcgaggctat     88140
     cgataaatca gaactatttc ttatatatga aagcttccga caggctcaag tgtttctgct     88200
     aagtctcaac tgatgccttg gcgccgctcc cgaccgcttg tacactcagt gcctaagtgg     88260
     cggcaggcat cctgccgctc ggcttcgctc cctttggcct atctgacggc ctgaggcgag     88320
     cgagagttct cggaggagga gtaaatgaga gccatcgaga acgaaaacgg aggcatcttc     88380
     ctgaacgggc tatgcgtcgc ctgcggtgtc atcctctccc tgatgccatg gtaccttgag     88440
     ctcggcagcg ggacctatgc cgcgcggaat gcatggatct gcgggggcct gatcgccatc     88500
     gttgggctga tggctatcag cctgtcctac gactgggaag agtacctcaa tctcgctatc     88560
     ggcctttggg tggccgtcgc cccgtgggtg ctcggctttg cggcggtcac gcatgccatg     88620
     tggacccatg ttgtggttgg ggtcactgtg gctgccctgg ccgggctgga gctctggcgt     88680
     ctttaccagg tcccaacggc gcgttccgta tgacccccgc catccgagcg atccgttcgg     88740
     gcgcgctgca tccaccgcct cgggcaacat ggcttgggcg cggaaaggaa gaatggtcaa     88800
     tctcagccag ctggccgccg gtctcttttc gtcgcggcag ccgaggccta ccgcatgcgc     88860
     gtcgtcggca ttgtcctcag cggctatgga aatgacggcg ccgaggattt gcgcgtcatg     88920
     ccgggcgtgg cgctcacgta ctggtacgag ctactggtac gagccggagc tgctttgaag     88980
     ctatgccaca caacagggtg gaggcttttt gcacattcag accggcatat gagcagaccg     89040
     gcatatgaga cggttcgtct cccctcgggc gagcattcgg ccaaggacta ttgttggata     89100
     agaaacttca attttcctgg atacggccgg aggggccatg ctccggctat ggatgtctgg     89160
     gctatgaatg tctggggctg cccaaagcgt ccggcgacgc tcatcaggtc ggcggcgagg     89220
     atttcatagg tctcttggca tctcacttca gtcgattgac ctcaacatct ccaccaaggt     89280
     cagataagct gatacgagat ttataacgac gaaaacgcca catgtctgag ggatttctga     89340
     aacttctata tcgatcgaaa gagactttca atgttcagtc ttgcgcctca ttccgcctca     89400
     agttggctta agaacctgaa cgtgctgagc aagaccacgg agtactttcc gggggtcctt     89460
     tttagcgtca caataggcat ggctgcgacc tttgtatcgg gtgcctatgg tggaccgacc     89520
     gttctcttcg cgttgctcct gggaatggcg tttaacttca tctcgaccga gtctcgactc     89580
     gcgcccggcg tagtcttctc agcacgcaca atcttgcgaa ttggtgtggc tgccctgggc     89640
     gctcggatca cagccgagca agtattgggt cttggctggt cgacgcttgt cggcgtagcg     89700
     gcggctgttg cgctcacaat cgggtttggc atggcggccg ccaggctgct tggcctcaag     89760
     actcaattcg gcgttctcac cgcaggtgcg gtggcgatct gcggcgcgtc tgcagcggca     89820
     gctattgctg ccgtgctgcc gcggcatgaa atgcatgaac gcgatactgt cttcaccatt     89880
     atcgctgtta cgacgttgag tactatcgct atggtcgtct atccagtagt cagccgaatg     89940
     tttcactttt cgcatgccga tgcaggcgtg tttctcggcg gaactatcca cgatgtggcg     90000
     caagtagttg gcgctggtta cagtgtctca cctgaaactg gggacatagc cacgataatt     90060
     aaacttcttc gtgttgctct tcttgttcca gctgttcttt ccatatcgat actcaccagt     90120
     cggattcagg ctggagctgg gccggctgca aaacctccag cgctcgtacc gagttttctt     90180
     gttgcattta tcgtaattgt gatactcaat agcttccact ttattccgcc gatcgttcaa     90240
     tccactctca gcgatctgtc tcggtggtgc atagtaatcg cgattgcggc gctcggcgcc     90300
     aagacctcgc tcgccgcact cgctcaagtt ggccatcgtg cgatggccct gatggtagcg     90360
     gagacggctt tcatcgcgct gttcgtgctg gtgttggtgc atgtgggata agggacatgc     90420
     gctttgggag cgaagcgaaa aggcttttta ggcattcagg catctctccg tttgcagcat     90480
     ggcggttacg caggaatagc cgtaacggcc gtgctcggac gccagcgcaa tgatggcgcc     90540
     tgacgccaga atcctggcca cagcgctcca agtaattgga gacgccaacg agatccccca     90600
     ccgagacggc taagtctgct ggcaggttaa cgaccgcctc cgagatccga tagcactccg     90660
     tccgtgttct ccttctcgga gagcgtttca ttgagaaggc actccgcttt gctctgtcca     90720
     agctgcttgg ccgaagcgat cagcgtgccg tagcgcgtga tttcgtactg ctcaacagcc     90780
     tccgcggcag caatgaggca tgcgctacac ggcttcatcg tgcacccggc cgggacgaag     90840
     ggcagtatgg ggtgtgagcg tgaccgcgtt cgcccgcaag atgcgcagca cccgcgtggc     90900
     gttcacggcc gcgccccggg cgcgcggcac ccggttcagg agtgcagtga tccagcgata     90960
     gccgtagctc aggcactcga ccacgagctg gcggatggtg ggcaggagcg ccgcgtcctc     91020
     cggcttgcgg cagggactgc gtggctgggc cggcctgcgc acacgctcga tcaggctgga     91080
     gcgagcaacc ccgagcgtgt cagcgacggc cttcatcggg aagcgcccat tggagcgctc     91140
     caggacggca gcaacaacgc tggttttttt tacccgggcg gcatcgagtg cctccttaag     91200
     cacttcgact tccatcgtct tgcggccgag caggcgctcc aggtcacgcg cgccgctcaa     91260
     gctccggacg cggctggcac ggactgcgtc cttgtcggcc gccaccgact cgtgcccacc     91320
     ctcgatcatg cggcgttttc agcggaacag gtggttgggc gagatcccgg tctgccgagc     91380
     aaccagcgat actgaggacc cgggctgcat cgtctgttcg accaagcgca ccttctcagc     91440
     cgtgctccag cattgacggc gctggaagaa cgtgagcacc ccgacgcagg accggcgggg     91500
     ccgttcggat cggaagccat agtcgtatcc ataggccgat gcctatgcca tatcgagcta     91560
     tgctgcctgt ccgctcgaaa aagggtgcgg tgcacgtaca aagctcagca cgtgtttatc     91620
     gcggccgaag aggcagtcag cgtgccaccg gcgctcgaag ctaggcatat tttggctatc     91680
     gttcaataaa tactctgaat tatctatgcc caaccgaata agccatactg tagcgttggt     91740
     gaggtcaagg ttcgcctgga acgttgagca tctttacgga ccgagctggc cttcccgagg     91800
     tttacgtaca cccttgctgt tgaccagccc gggtatcacg acctggtgct tccatgttac     91860
     atgcagaacg gggctggtga tgtttttgcg tcaattcgaa tatctgctcg cggtggccga     91920
     cgaagagcat ttcgggcgag ctgccgatcg ctgccatgtc actcagccga ccctctcggt     91980
     cgccatcaag cacctggaat cggaacttgg cgtgcagatt tttgtgcgag ggagaggcca     92040
     ccggcttcac ggactgacgc cagacggcga gttgatcatc aaatgggctc gcaaggtggt     92100
     aaccctttgc gaggggatgc gcgccgagat tgcggccaag catggcaact ctcctagtcg     92160
     cctacgagtg ggggtgacac cctcgatgtc gccagtcttg cctgttctgc tccagctcgt     92220
     tcgcgcggag catccagaga taatcacgga tgtgcattgc atcaacaatg aagttattag     92280
     aacggggttg agcaaattac ttctcgatgt ggctttcact tatctcgatg atgacgaagt     92340
     tggtcgctat aagacgttga agatttgcac cgagaagctc agccttttag tgccagatgt     92400
     ggcggagttt gctgatcaga ccagtatttc atggcatgag gcggccaaga tgccactcgc     92460
     gctgctgcga ccaaatttgc acgagcgcca ctttatcgac ggagtgtttg caagtgtagg     92520
     ctgtcaccca atggtccgag ccgaatcagg gtccattatg cacctgatgt ttcaggtaca     92580
     attcggcgga ttgtgcacga ttataccaga acattttacc cttatgccag gtctgcaccg     92640
     cggaacgaaa gcgcttcagc ttattgatcc cgtggtgagc cgggaggtcg gcttgctctg     92700
     ggccgaggat gaggtcatga ctcctctggc taatctgcta gtcagcgcca tgaaagacct     92760
     taacaagcga ggtggtctgg aaacgatcct catgaatatt ggattggagc cttgtttccg     92820
     gggtcagcgg gatgcccacg ctccgtcgat cggggcgccg tttctggcct cgccggagtg     92880
     cgacttagca actgcccgta gcaaaccacc aagtgatgaa atagtttggc tgtgatagaa     92940
     tgtggccagg gacgcgcgtc aggttgtgac cggattgaca tccgtagcgc cttttcaagc     93000
     ggccgatgtc gcgtagggcc gcatccggtg cggctgggtg gggaaccacg ttgcagcgga     93060
     gtccggcatc tcaccacgta tggagatgca cacctctaat aacctcctcg gtttccaaca     93120
     ctcgtccaac caggtcaacg acctagtgca ctgacgcatt cagaggattc acctcggccg     93180
     tgagccgtgc gagtctgaag gcatggctca gaccgtctgt gtgatcccga gtgacgccga     93240
     tctggcgcgc ctgtcggcca tcgtcaatga ccgcgctcgt cccctcaagc acctccagtg     93300
     cgcccacatc atcctgctct cggccgagcg cttggctgtc ctggaggttg cccagcgggc     93360
     gggcgtcagc cgacccgccg tctggcgctg gcagcaacgc tacgccgagg agggcgtaga     93420
     cggcctcttg cgcgacaaga cccgcccgcc cggcaagccg ccccactcca ccgacacggt     93480
     cgccgaggtt ctggcgctga cctgctccga accgcccggc gcggtcaccc actggaccgg     93540
     ccgcgccgtc gctgacacgg tcgggatctc actgcgctcc gtccagcgca tctgggacgc     93600
     gcatcgcctg cagccgcacc gggtgcgcag cttcaagcgc tcctccgatc ccgccttcgc     93660
     cgagaaggtg gaggacattg tcggcctgga catggacccg ccgcgccatg cggtcgtgct     93720
     ctcgctggac gagacgtccc agatccaggc gctggaacgc acccgcccca gccgagctgt     93780
     gaagccgggt cggcccgaga cccagaccca cgacgatcac cggcacggca cgaccacgct     93840
     gtttgcagcc ctcaacgtcc tggagggcac cgtgatcggc cgctgtatgc agcggcatcg     93900
     ccatgacgag ttcctgcgct tcctcaacac catcgaggcg gcggtgccag gaggcgaagc     93960
     tgatccacgt gatcctggac aactatgcta cccacaagca cccgaaagtg cgcgcttggc     94020
     tggcgcggca tccgcgttgg accttccact tcttcccgac ctctggctcg tggataatgc     94080
     tgttgagggc ttcttctcgg ctctcaccca gcgacggctc aggcgtggca gcttcagcgg     94140
     gatcgtggat ctccaggcgg cgatcaaccg ctccatcgcc gagcacaacg acaggccgaa     94200
     gcctttcgtc tggaccaagc cggccgcggc catcttcgac gccgtcaacc gcaatgctgc     94260
     accatctgtt tgagtcagtg cactagcgag tttcgcgacc accagttggg aggtttttgg     94320
     aggtgtccag atggcactcc gaggactgtc ggtccgcgga gtgtttcaat ttctccggtt     94380
     actccgcggc gattgaggag gcggcgagcg gcaccacccg ggtggcgcag aacttgaatt     94440
     ccgggatctt gcccagcggg tcgagcgccg ggttggtgag cagattcgcg gccgcctccg     94500
     cgtagcagaa cggcatgaac accatgccct ccggcacgtc ccggtcggag cgcaccgtca     94560
     cctccaccgc gccgcgccgg gtctccagcc ggatccggtc gcccggaccc acccccaagc     94620
     ggccgagttc gcgcggggcc aggaaggcca ccgcctcggg ctcgagcgcg tcgagcacgc     94680
     ccgcgcgccg cgtcatcgag cccgtgtgcc aatgctccag cacgcggccc gtcgagagca     94740
     ccatcgggaa ctcgctgtcg ggcacctcgt ccggcggcac gatcgcggcc ggcacgatct     94800
     tggcccgccc gctctcggtc gggaagccgg cgtagaagat gatctcgttc ccgggctcgt     94860
     ccggggcatc gaccgggtag gtcaccgccc cctcgcgctc cagccgctcc caggtgatgt     94920
     tcttgagcga cggcatcacc cgcgtcatct cggcaaagac gtcggccggg ccgcgatagt     94980
     cccaggccag gcccatgcgg cgcgccagct cctggatgat ccaccagtcc tggcgcgcct     95040
     cgcccggcgg gggcaccacc gggcgggcca tctgcacccg ccggtcggta ttggtgaagg     95100
     tgccggcctt ctcggcgaag gccgaggccg gcagcaccac gtcggcgtgg aaggcggtct     95160
     cggtcaggaa cagatcctgc accacgaggt ggtcgagccg cgccagggcg ccgcgggcgt     95220
     ggttgaggtc gggatccgac atcgccggat tctcgccctc gacatacagg ccgcggatct     95280
     caccggcatg gatcgccttc atgatctcga ccacggtcag gccctgctgg ggatcgaggg     95340
     actggcccca gaaggtctcg aacagctccc gcaccgcctt cttctcgacc gactggtagt     95400
     cgggatagac catcgggatc aggccggcgt cggaggcgcc ctggacgttg ttctggccgc     95460
     gcagcgggtg caggccggtg ccgggccggc cgatctggcc ggtggtgagc gccagcgcga     95520
     tcaggcagcg ggaattgtcc gtgccgtgca catgctggct cacccccatg ccccagaaga     95580
     tgatcgaggc ccgcgagcgg gcgtagagcc gcgccacctc gcgcagggtc tcggccggga     95640
     tgccgcagac gggggccatc cgctcgggcg tgaattcgcg gatgcgctcc ttcagcgcgt     95700
     cgaagttctc ggtgtagccg gcgatgtact gctggtcggt gagcccctcc gccacgatca     95760
     cgttcagcat cgcgttcagc atcgccacgt cggtgccggg cttgaaggcg aggtggcgat     95820
     gggcatggcg cgacagcacc tgccggcgcg gatccatgat gatgagcttg gcgccccgct     95880
     ccttcacggc attcttgatg aaggtggcgg cgaccgggtg gttcacggtc gggttcgccc     95940
     cgatgatgac gatcacctcc gcgtcgaggg cggccgagaa cggggccgag acggcgcccg     96000
     agttcagccc ctccatcagc gccgccaccg aggaggcgtg gcagagccgg gtgcagtggt     96060
     cgacgttgtt gctgccgaag ccgagccgga ccagcttctg gaacaggtag gcttcctcgt     96120
     tcgagccctt ggccgagccg aagccggcga gcgcgtggcg cccgtgcgcc tcgcggatcc     96180
     gccgcaggcc gcccgccgcg cgctccagcg cctcctccca ggtcgcctcg cggaaatgcg     96240
     tccagggatt ggccggatcg acctggtcgt tggcgtcctt cgggacgttg tcgaggcgga     96300
     tcagcggcct cgtcagccgg tggggatggt ggacgtagtc gaagccgaag cgccccttga     96360
     cgcagagccg gttgtggttg gccgggccgt caatgccctc ggcgtagacg atgcggtcgt     96420
     ccttgacctt gtaggagacc tggcagccga cgccgcaata ggggcagagc gaatcgaccg     96480
     cgcggtccgg atagaccacg cgctcctgcg cctcgttgag gtaggcggcc ggcatcagcg     96540
     cgccggtcgg gcaggcctgg acgcactcgc cgcaggccac gcaggtcgac tggcccatcg     96600
     ggtcgtcgaa gtcgaacacc accttggcgt cggcattgcg gtaggccatg ccgatcacgt     96660
     cgttgacctg gacctcgcgg caggcgcgga cgcagaggtt gcactggatg caggcatcga     96720
     ggttcacccg catggccgga tggctcgcat ccggctgcca gcgcgcctcg gacgggaagc     96780
     ggctctgcgt caccccgacg ccatcggcct gggcccagaa atgcgagtcc gggtcgtgcg     96840
     aggtcgcgcg ctccggctgg tcggcgacga ggagctccat caccatggcg cgggccttca     96900
     cggcccggtc gctctgggtc ttcaccttca tgccgacggc cggcacgcgc ttgcaggagg     96960
     cggcgagcac gcgctcgccc tcgatctcca ccatgcaggc gcggcaattg ccgtccggcc     97020
     ggtagcccgg cgcgggcttg tggcagagat gcgggatggg attgccgagg cgctgggcca     97080
     cggcccacag cgtctcgccg gggcgcgcct cgaccggctc cccgtcgagt tcgaacacca     97140
     cgcccgggat gcccgccggc atctcgcgca gggacagggt gccgctgggc gccggcccgg     97200
     cctggccgcc ggccttggtg ccctgcgaag aggcgccgcc cgcctgcggc cggccccctg     97260
     agccgccggc atcctgcggg gcggacgggc cggtcacgag cgggtcgctg ccggccggat     97320
     tgctgttctg ggtgccgctg ctcatggtgt cgcttccgct gccgaacccg caatccctac     97380
     tcggccgcca cgggccgcgg ggtcgggaag aggtccggga aatatttgat gaggctggtg     97440
     acgggattcg cggccgcctg ccccaagccg cagatcgagg cgtcgcgcat gcattgcgag     97500
     agctcgccga ggaggtcggt gtcccagacc ccctgctcca tcagccggcg cgccttgcgg     97560
     gtgccgaccc ggcagggcgt gcattggccg caggattcgt cctcgaagaa ccgcatcagg     97620
     ttgagggcgg cgccccgcag atcgtcctgg tccgagagca ccaccaccgc ggccgagccg     97680
     atgaagcagc cgtatttctc gagcgtgccg aaatcgagcg ggatgtcgtc catggcggcc     97740
     ggcaggatgc cgcccgaggc gccccccggc aggtaggccg cgaagcggtg gcccgcggcc     97800
     atgccgccgc agaactcgtc gatgagctcg cggatggtga ggccggccgg cgcgagcttc     97860
     acgccgggcg cggccacccg gcccgagacc gagtaggagc gcagcccggt gcggccgttg     97920
     cggccgtggc tcttccacca ggcggccccc ttctcgatca ggtcgcgcac ccagtagagg     97980
     gtctcgacgt tgttgatcag cgtcgggcgc ccgaacaggc cgacctggaa cgggaaaggc     98040
     ggcttgtggc gcggcagccc gcgcttgccc tcgaggctct cgatcatcga ggattcctcg     98100
     ccgcagatat aggccccggc cccgcggcgc aggtggatgc gcgggccgcc cggcgggagc     98160
     ttggcgagct cgcgggccag gatcgcgcgg gcgatcgggt actcgtcgcg gatgtagagg     98220
     tagatctccg cggcctcgac cacatgggcg ccgatcagcg tgccttcgag gaagcggtgc     98280
     ggatcggtgt tgaggtagag ctggtccttg aaggtgccgg gctcgccctc gtcgccgttg     98340
     accgccatca gccgcggccc cggctcgccg cgcaccgagc gccatttgcg cccggtcggg     98400
     aagcccgccc cgccgagccc cttcagcgcc ccatcgtcga ggatggcgag caccgcctcg     98460
     accgtcagct cgccggcgcg caggcgctcc agggtgcggt agccgcccgc cgcccggtag     98520
     gcgtcgtagt ccacgtagtc ggggatgtgc gggtgggtgt cgccggccgc gaccgccgcc     98580
     ttcacgcgct cgggcgtggc ccggggcagg aagttgtggc cgacctccgc cgccggggcg     98640
     tgatcgcaga ggccgacgca gggcgcgcgc acgacgcgca ccggcccgcc gatctcggcc     98700
     tgcagggtgg cgagcagcgc ctcggccccg tgcatcgcgc aggtgagact gtcgcagacg     98760
     cgcaccgtca gggccggaac cgccgcctcg ccctccttca ccacgtcgaa atgggcatag     98820
     aaggtggcgg tctcgaacac ctccgcgaag gcgagcccca tctcgtcggc gagcgccgcg     98880
     agatggggag cgctgatctg gccataggtg tcctggatga ggtgaaggtg ctcgatcagg     98940
     aggtcgcggc ggcgcggcgc ctcgccgagc agggcggcga tctccgcctt ggcgcgcggg     99000
     tcgacctggc gccccttcgg cacgggcctg gcccgctcgc ggccccgtcc gggatgttcg     99060
     aagcgctgta cgcgcgacac gtcgtgctcc ccaatgcaag cgacacggct gctctaactt     99120
     ctcacgtaat aacaccgccg cagcatcgcc cagtcccagc atcgcgtcgg tggcggccct     99180
     tggctcccgc ccaataggaa cccgcgtctt tgcttatccg acagcccgcg actgtggcgc     99240
     aggaatcatc gcgaccggtt acctcgcgtt cgaaagaggg gcgggatcag ccactgatta     99300
     gcagtgactt ctatgcgtca ggcctccttc agaaactgcg ccacgcgatc ctcgccgccg     99360
     tgggccggga tttgcgagac cggaaggacc gattcccccg caccagcggc cgaaccacct     99420
     tggccgcgcc ggatgtaaaa gaacggctcc ggcaactctg ccctgccggt cctaaagccg     99480
     agaatgcgat ctccactcgc gcccgcctca aggctcagat cgtcaggacg taccgtgaca     99540
     gtttgcttct gctccggttg cgacttgtcg attgttcgtg caatcaccga ggccgcgttc     99600
     gagaaccacg ccgtgagcac gcgcaattcg ttctcgtacg cctctggtga gaattcgact     99660
     gcgtctccgg acatcaaacc agagacatcg tacggcagcg cctttgagaa ccgctcgcga     99720
     tccatcccgc gatgaagcag ctcaacgagg agccatgctt cgacatgtgc tggtgaatgc     99780
     tcctcaacat gaagcggatg gctcaccgct tcgccgcctt ctcggaactg taagaccagt     99840
     tctggcaaac gtaactcaag gtcaagatcc cgcccgagag ggtgagttgt gatcgcgtta     99900
     cgagcattat gccattctag cgttggcatg gcgccgttgc cctgcgaacc atagctccgc     99960
     tcaatccgag cgagccattg gacaaggctg tgcacctgat ggcgtgcctc ctccagccgc    100020
     cgtggatcgt gtgcagttgc aacgggccaa ttttccggga ccatcctcat ccctccctag    100080
     ccattcgggg gttcgtcaca tttcttgcgc agggctgctc cgcggagcgt ctgttcaggc    100140
     gcccaatccg aggccgagga cccggttcgc gttccgccaa agggctgcat caagagcatc    100200
     cggcgagagg ccgagtgcca tgaagtcgtc gactccctgc ttcatggggc ggaacgggaa    100260
     ggaactcccg aacaggaact ggtctttcat gaagccgttg gcagcttcaa tgtagagccg    100320
     tccgcccggc gagaaagtgt acatgtcagg cgagacgtag acgttttcgt tgcggaaagc    100380
     aactgtgata atggcgtcga tgtgcgggta aaacccatgt gagcagatga taggtaactt    100440
     tgggaaagtc ttagcaatcc ggtccaccgc gaacggatca ttgagacgca ggtctggggt    100500
     ggtcggccct gacatcacga agactggcac accgagctcc tggcacagct cgtagagcgg    100560
     catcaggcgc tcgtcatccg cgcgcattgg actcccgtag aaaccggcat cgaggttaat    100620
     gcccttcatg ccgagctctg acacggcgcg acgtgcttcc gccacagctt tctcgcgacc    100680
     gaggtcggtt gggtcgaccg aagcgatgcc gatcaggcgc ttcgggttat ggcgcgcgac    100740
     cgcggcgaga tcgtcgttgc tgatccgaac cccgggaacg ctgcgggcga ccatcacggc    100800
     ggcagtgatg ccagccgcat ccatctcccc aacaaagccc tcgacgcttt gaccccgggc    100860
     gaagtggtcg atttccttag ttcctacccg gcggttgagc cagcgcacga cgccgtattc    100920
     gggcgtgtca ggtgtggctc cgaagaaggg atgcaggaag gagggccggc tccgcatgtc    100980
     cacgataggt ttcgccattg actttactcc tcagcgttga tgagagccaa cgagcggagc    101040
     acgtgcgtgc gcgctcaccg ccggcccgat tccctttatt cagtctgagc taaacctggc    101100
     cggatgccac actcaccggg aaaaatgccg ggcccaaaag gcccggcttt cgagtgggca    101160
     gccccggagg agaagggcgc acaagtccaa cgtcagtgag atcccgcctc atggagttcg    101220
     agcacctggt cgtcctcgtt cttgaggacg tgatcaacct cggtttggtc gagcgtctca    101280
     ggcccgagca gatacgcggc caaggcgaac agcagaacga cacaagagta cttcatggcg    101340
     tcgcccatgc cgcccggcgt caagctggcg agccagccga tcgcaatcgg agcaaaaatg    101400
     gacggaaacc gaccgagcgc cactgaccag ccgtagccag acccgcggat ctccgttggg    101460
     aagagttccg ccacatgcac catgccgatg gcccaagaac ctccaatgcc accaaacgcc    101520
     aagactccac agatgacgaa cagcggaatc gaggttgtcg agaacatcac ccacagagag    101580
     ccggctagaa caagcaatgt gatagcgcca gctcgcttgc ggccgatgta atcagagagg    101640
     tggccgcaaa agatagaaaa accaaacatc gagagattga acaggccgag cgtggcaacg    101700
     gcgaccgtgg tgctcatttt cagggtcgag accatgaacg gcactgcaaa caccgtctca    101760
     gcatagtaga ttcctgcgag agaggtgtag atcagggctc cccacatcac gttgcgccgc    101820
     agcctcgggc tagttttaag tgatgtaaag aaagaggccc gctttagctt cgccttcttc    101880
     aagcgctcta tcgttgctgt gtagctcggg ctttcctcca actgcatccg aacgaacaga    101940
     ataaggatcg caggcaagat cgcgaggaag tacattgcgc gccagccaag ccactcgaga    102000
     atgagtgcag aaacaatcgc tgcgtacacc accccaaggg catagcccgc gaacatgagg    102060
     cctgcaccta agccacgctt cttgctatcc catgattcca cgacataggg gacgccgacc    102120
     gtcagttctc ccccgccgcc gagcccggtg aggaagcggc cgatcgcaaa ctggacaggg    102180
     gtgacggcaa gcccggttag cgcagtgacg ctgccatagg cgaaaatcga aaagccaagc    102240
     gttacttttc taccgaagcg atcgcccagc atgccgaaca cgcaactgcc cagcatgtat    102300
     ccgacgatga agatcgatcc gattgctccc attgtcttca catcgacgcc gaattctaca    102360
     gcgatgagcc cgagggtcat gccgtagatg ttgattgcgt aagcgtcgaa gaggtagccg    102420
     agagtggccg ccagcgtgat gacgttgcga gccttcttcg tgatattagg cttgtccggg    102480
     tcgtgaaggt cgatcaactc agccgagccg ggtggctggc tcgggggttt tgcgctgctc    102540
     cttagggata gcatgatact gtttcctcct gcttcgattc ttgggtttca agtatctcaa    102600
     gtatccatgc ggtgtttttt tatttgatac cgtcttgcac caggcaccag cgcgttagtt    102660
     gcaccagcgc gttagatgtt agctattaca ctttttctaa tatattatct tcaaatatcc    102720
     tcaaatatgg ctatgattgc gtccgtacta gttctgtcgt tttgctcttt tgctctctat    102780
     tgtcagattt tgagcccatg tgttgttgtg tgccgagatg tccttgagac gcttggcggg    102840
     actctctcgc ctttgctcaa ggggctgtcg tgctgtggcg ccttcatccg cttccgctca    102900
     gagccgtaaa acggactgag ttgaggattg cctctccgga agcgatagaa ccagttacgc    102960
     ttcccgttgc gccgcatcac gcactcgaat aggcacagtg gcccgaaacc gtatctcagg    103020
     ctaattcttt tttgatagct aacgatagtt ggcgtctata agaacctgag tgatgcgctg    103080
     cccgcagtgc gcgcgcccaa tgtctgagtg atgcgctgcc cgcagtgcgc gcgcccaatg    103140
     tgggtgtaag cttggcgagc ataagacacg gttgtgagct gggaccgggc tgatcagaaa    103200
     tcggcacact cggttggctt gagcactgcc gcccagctgg cgagcattgg tcgcccagct    103260
     ggcactttgc cgttatcact ggaggagcag agatgctgac cgccgcacgg ttggcgatgc    103320
     tgccgccgat cgagtgctgc tggcccaagc ggggtgacgt cgcaggatcg gcgctgcacg    103380
     attatggcga tccggtctac cggtttgctt gagcaggagt gtgcccgcaa ggtggatcat    103440
     agacgggatc ctgtacgatg cccgccactt ggtcacgagg ctccgccgta atatcgcaaa    103500
     aacaccaagg agttaaacgg ctaagatcaa cttggcgcac aagctaatca gagcggcgca    103560
     ggctatggta gaataagaaa tatcaattat ccaaagcaca acagaaggac catgtttcag    103620
     catgacgatg cccgggctgc tcgcggtacc cggcagcctt cagcggatca gcggtcctaa    103680
     cgccaacacg gccgccctct agctccgctt gacgttgtcc agcccgcgca tcacggccca    103740
     atgcctgcgc cttgatcact gctgaggtcc gcggaaaacc agggctccgc agtgctcaat    103800
     ccgcagagga cacccagaac ccgaggagga gcgtgaatgc ccgcgagaaa ctaccagcaa    103860
     tggaccgcaa atccacccct gcagacgggt gagtggatcg acagccgact ctacaccgat    103920
     caagagatct tcgaggaaga gctggagaag atcttcaagc atacctgggt ccccgtctgt    103980
     cacgagtccg agctgccgaa gccctacgac ttccgcacca ccagcatcgc caatgaaccg    104040
     attgtcgtct gccgcggtcc cgacaacgtc gtacgtgcct tcctcaatgt ctgcccgcat    104100
     cgtggcatga tcatcgagcg tcgtccctcc ggcagcttct acgaggcctc ggcttcgggc    104160
     aatccgaagc ggatgacctg catgttccat gcctggcagt tcgacctgaa gggcaactgc    104220
     gtctacgtca gccgcgagaa ggagggctac caggaccgcc tcagcaagga ggatgtcggg    104280
     ctgcggcgac tgcgctgcga ggtgaagttc ggcggtttcg tctgggtgag cctggacgac    104340
     aatcccgttc ccctggagga ttgggcgggt gccccattcg aatgcctgcg caagacgctc    104400
     gatgcggagc ctctcgaggt cttccactac cacaaggcta tcgtcgacac gaactacaag    104460
     ctctggcacg atacgaactg tgaattctat cacgacttca tgcactacca caatcgtgtc    104520
     accggcttta acgacgcgta cttcgccaga aagaacgaag cctttgaaca cggtcatatc    104580
     gtggtcggca ccttcgaggt gaactacgat caatacgaag gcttcgagag ccgcgccgga    104640
     ctatcattcc cgtatctgcc gccgaaccag tggtacatga tcgatctgtt ccccggcatg    104700
     aacttcaacc tccggggctc ggctctgcgc tgcgacgttg tcacgccact cggtccgaac    104760
     aagacgatga tcgagttccg cggtctgggg ctcaagagcg acacgaagga ggagcgtcag    104820
     acccgcatca atcaccacaa ttcgatctgg ggtccgttcg gccgcaacct gcacgaggac    104880
     ctgatcggcg tgcaggggca aggcaccacg atgcgacccg gctccgaacc gcgccgcatt    104940
     ctgcacggac gccacgagaa tcagaccatc cacgacgaga acggtatgcg ccactactac    105000
     gacgagtggg gccggtggat gaaccgtttg ccgcgcgacc cgtcgaaacc ctacgcgccg    105060
     ccggctgtcg cggccgagta gagcacgccg cgagcttacc tgacggggct ccccgccccg    105120
     tcagactccg cccggcagcg cgcgacggaa ccgatctcgg tcaatgcggc ctgagacgat    105180
     ctcgattccg aagcgcattc gagcaatcag gatccggtcc atacacgcca gccttgaaat    105240
     gaaccggagg ataaagggag gaagaggcaa tgggaacctc gatgttgacc ggcagcgaca    105300
     cagcacgggc cggttcgtac ctcgaccagc ggcagacgct tgcccgcgat gcgatttacc    105360
     aggcgagcct gcttctggat gatcagcgct ggaatgactg gcttgcactc tgcgcagagg    105420
     acttcaccta cgacatcaag tcgtggagtc cagagatcaa ctacgatatg acctatttgc    105480
     acgcctcgcg caaggatctt gacagtctga tccgcctgct gcccaagcac aacactgacc    105540
     attcgccgct gacccgccac accagtgtct acacggtcga gatctcccct gacgggacaa    105600
     cggctcagac ggtctcctcg gttgtgatct tccaacacat gcttgacggc acgaactctc    105660
     acatcgacgc gggcgagagc cggctgttcc tggtcggcaa gtactatgac cagcttcggt    105720
     tcgacgatgc aggcgtgaag ttcgtctcgc gcgaggtcag gctgctcaac cgccgcctcg    105780
     acaaaggctc ccactggcca ctctaggcca ctctatgagg ccgtcgccag cgagtgcaaa    105840
     ggtgatcccg ccgccttctt ggcggccaat cttgttcaga acgaaggggc gcgtgcggat    105900
     acggagcgaa gccccacacc tacaatcggc gggcacgtac aagcggaagc ggaggtttta    105960
     tgggctggag gtatttatgc gaagcggctg aggttgccga gaactcgctg aagctcgtcg    106020
     atgccgacgg cgtccgcatc gtcgtggcga attatggtgg cggattccgg gctattccac    106080
     cggtctgtcc ccacatggag gagccactcg aggaatcggg tgtcatcgcc aattgcgtcc    106140
     tgacctgcac caaacacctg tgggcgtggg acttgcgcag cctcgacatg gtcggcgagg    106200
     ccgagaagcc gctcaagacc tatgaggtta agcaggaggg cggacgcctt ctggctctcg    106260
     tcgacgagga gctaacctac gactttgagg aagacaccgg cgatgacgac gacgactttt    106320
     tcaaatgact caggcccggt ggtcagccag ttcgagtcct tgccgcgctc tgatacgaat    106380
     gatcgggacg accagagccg ccgttggaac gtagaagttc aatcgaaatc gggcacactc    106440
     gcctttacct gcgagccgaa tgagaacttg ctttacgcag ggttgcgaca gggtctgacg    106500
     cttccatatg agtgcgccac cggaacctgc ggcacttgcc gtgcccgggt cgcttccggg    106560
     agcgttgctg tcgggtggga agccgcgccc ggccataaag ggctcaagcg cgacaagggc    106620
     gacatcctga tgtgccagac acggccgcaa agtgattgcg tgctgcgtgt gccggcccac    106680
     gtccacacct ccccgcggca cgccgttccg cgacaccaca gcgccgtgat tgactgcgtc    106740
     cggcacctga ctcaggacgt gatccacttt gagatctcac tgaacgaccc catgagcttc    106800
     gatgccggcc agttcgtcgt cctgcgcgcg cctcacctgc agggaatgcg ggcatactca    106860
     atggtgaact tcgcgacgga aacccgtcgc ctcgagcttg tgatcaaacg caagcccggc    106920
     ggcggcttcg gaaactggat tttcgaagca tcacgggaag gacagaccgt tgatgtgttc    106980
     ggcccgctcg gccgagcgac atttcatcct gaggaaaatt acgatctgct gatgattgcc    107040
     ggcggctccg gcattgctgg catgatgtca attctttcac gggcagtgca ggaggattac    107100
     ttcagcagcc acaagggtta cgtgttcttc ggagtgcgta cgctggacga tagcttttac    107160
     ttggcagatt tcagcgaaca cgttgcggct gcgaatggaa atctggaagt caccctggcc    107220
     atatcggacg aggcggtggc ttctcctgtt catcccggcc atcctcatgt ccgagtcgtt    107280
     gaggggttgg tccacgaggt ctgcgcgcgt gcgatgaagg ggcgttacga caacgtcatg    107340
     agctacatcg ccggaccgcc gcctatggtc gacggcgcgc tccgaaccct catcatcgag    107400
     ggccgcatga cgccggatcg gatccggtac gacaagttcg gctgaggtgg ttctttggac    107460
     gctgcggcga gtatgacggc cacgcttctt agcctcgggc tagtgagcgg tctcatgatc    107520
     ggctgcgtgg ggattggcgg ggtcatctta gtgcctgtca tgacccttgg gattggcatc    107580
     ccaatcggca ccgcaatcgc ggcggcaatg gcaggctacg ttctgactgg cctctctgga    107640
     acgctggtct ttggtcggaa tggctcaata cgctggacac tcgcactcag cctgtgtctt    107700
     ggtgcagcac caggagctct gctcggcgcc tgggccagcg gcgccataaa tgcgcatatt    107760
     attgagatgc tcattgcggc gctcgccatt atgtcgggcc tgtacaatct tcgtggcaac    107820
     agcgtggtcg atacaccccc gttggccctt ggtacgcttg gctttgtcgc catgggagcc    107880
     tgcgtcggcc tgttgtcggc agtgacaggt accggcgggc cggtgatcct ggttcccttg    107940
     ctgctgacat ttggctatcc ggtgctcacg gcggttgggc ttggccaagc gatccagctg    108000
     cctgtcgccg cccttgcgac cctaggcgcc tacgccttcg gttctctcga catctacctc    108060
     agcgtacttc tctcgatcgg cctagccgtg ggcagtacag ttggcgctgg ggttgctcac    108120
     catgttccgc gcgccactct gcggacaata gccgcctccg tgcttattgc gaccggggcc    108180
     ttcatcatat ttcggctagt gatctgacca tatccaggga gcgtacgtta tcccatcctg    108240
     acgctactca attggccaga gtcacagcca aaccaagcag aaaggataga agatgcccat    108300
     cgaatatcaa cccaatctaa taacagttgc agaccgcgat ttttgaatga caaacggaaa    108360
     tctaaaatag gcgcatccgc aggagttatg catttcatca agtatgggct cttacagtcc    108420
     atttgacctc aaagaacgtt gttgaatttt ggtcgcgcca ggagagggct ctatgtcaaa    108480
     tctagtcgct ccgtcagctt cctcagtaac tcttcgctcc agggcgcgcg aacggcgtca    108540
     gattggagga agtcctttgc ttgacaggcg agagctcttg agacgcgccg ggctaggcgc    108600
     cgttgtgttt agcggcacca cgctcgtatc gccgctgcgc gggctagcgg acgaactggc    108660
     gcggctgccg ttcggcaacg gcgagcgccc gctcgtcgcc tatccgggca agcgcccgct    108720
     cttggagatg accagccggc cgccgcagct cgagaccccc ttcggcatct tcgacgaggg    108780
     cgtgatcacc cccaacgacg ccttcttcgt gcgctaccac ctcgccgacc tcccgaccgc    108840
     catcgacccc gacagcttcc gcctggaggt cacgggccat gtcgagaccc cgctctcgct    108900
     ctcgctggcc gagctgcggg cgctgccggg cagcgaggtc gtcgcggtca accagtgctc    108960
     gggcaattcg cgcggcttcg tcgcgccgcg ggtcgccggc ggccagctcg ccaacggcgc    109020
     catgggcaat gcccgctggg ccggcgtgcc gctgcgcagc gtgctcgaca aggccggcct    109080
     gcgccgcggc gccgtgcagg tcgccttcga gggcctcgac gggccggtgc tcccggccac    109140
     acccgactac gccaaggcgc tcgacctcga ccacgcccgc gacggcgagg tgctgctggc    109200
     ctatgcgatg aacggcgcgg agctgccctg gctcaacggc tatcccttgc gcctggtggt    109260
     gccgggctat tacggcacct actgggtcaa gcacctgaac cgcatcacgg tgctcgatca    109320
     gccgttcgag agcttctgga tgaagtcggc ctaccggatt ccggccaatg cgtgcgcctg    109380
     cacggagccg ggccaggcgc ccacggccac ggtgccgatc gggcgctaca acgtccgctc    109440
     cttcgtcacc aacctcgccg acggggcgcg ggtgcccgcg ggcgagaccc tgttgcgcgg    109500
     catcgccttc gacggcggct ccggcgtgac ggaggtcgcg gtctcgaccg atgacggccg    109560
     cacctggagg cgggcggcgc tcggtgagga tctcgggcgc tactccttcc ggccctggag    109620
     cctgcgggtc gatctggcgc cgggggcgca tgcgatccgg gtgcgcgcga cgaaccggat    109680
     cgggcagacg cagccgctcg accctctgtg gaacccggcc ggctacatgc gcaacgtcgt    109740
     cgagaccacc cgggtgcagg cggcgtgaga gaggcgatga tgacgaagcg attcctgacc    109800
     gccgccgcgg ccgcgggcct gctcgccgga ggcgcggcgt tggccgggcc gcgcacctac    109860
     gcgctgcccg agccaacggc gcagctgaag gagccgaggg acaaggcgca cgcagccggg    109920
     tacgaggcca cgcaggccaa ctgcctgacc tgccactcgg tcgactacat cgccatacag    109980
     ccgcccggga aaggccgagc cttctgggac gccgaggtga ccaagatgat caaggtctac    110040
     ggcgccccga tcagcgaggc cgacgccaag gtcatcgccg cctacctggc cgcggtgtat    110100
     taacatcggc ctttcgggaa gacggcacgc gattgagtga gatttccgct gcgcgcccga    110160
     gcgctttttc gtacatagcc gccggaaaag gctccggaga gggcaccaat gcgtgtatca    110220
     ggcttagatg cgcccagtac ttgctacaat gcagcagggg aaattaggcc taatcgaccg    110280
     tttgcaagag gaggccgggg cggtgtcggg taagcgctgc catcaggcca cggctctgag    110340
     ggcttgtgcg cgcgggtagg cccaaggccg caactcgtca atgcggccgt tcggatgtaa    110400
     gcgtcttcct caggccacat ccctgagcgt gggcgtgacc gggtaggccc agggcagcag    110460
     ctcgtcgatg cggctgttgg gatggccctc gatgatgcgg gtgatcacgt cggcaagata    110520
     ggcctgcggt ccgacgcccg tgagcttgca ggtctcgatc agcgaggcga tcaccgccca    110580
     gtgcgcggcc ccgccatccg agccggcgaa gagagcattc tttctcgtca gggccagggg    110640
     acggatcgcg cgctcgacca cgttggtgtc gagttcgacc cgcccgtcat cgaggaacag    110700
     gctcaggcca gcccagcggc tcagcgcgta gcggatcgct tcggccagct tgctcttctg    110760
     gctgatgagg gcgagcttct cccgcagcca gggctctagg gcctccagga tgggacggct    110820
     gcgcgcctga cgtgcggtgc ggcgctcctc ggcaggacgg ccgcggatct cggcctcgat    110880
     ccggtaaagg cccgcgatgc gcgtgagcac ctcggccgcg atcggcccat caagatcgta    110940
     gaacgcccgc cgtacatggc tccagcagta ggcgagccgg acctcgcctt gcctggccag    111000
     cgccttgtag ccgtcatagc catcgacctg cagcacgccc cggaagccgg caagatgcgc    111060
     gatgggctgc ttggccgtgc ggtcgggtgc gtagacgtag gcaacgcccg gcggatcggt    111120
     gccgccccag ggccggtcgt cgcgggcata cgcccagagc tggcctgtct tggtgcggcc    111180
     gcgtccggga tcgagcaccg gcgcgctggt ctcgtcggca aacagcttgc ccgaagcctt    111240
     cagcctcccc agcagccgcg cgtggaccgg ccgcagcagg aacgcagcac ggccgaccca    111300
     atccgcgagc gtcgagcggt cgagagctat gccctgacgc gcgaagatct gtgcctgacg    111360
     atagagtggc aggtggtcgg cgtacttggc gacgagcacg tgcgcgacga ggtcgtcggt    111420
     gggcaacccg ccctcgatca gccgcgccgg cgcggacgcc tgcagcacaa tagcctcgca    111480
     ggcacggcac gcgtaacgcg ggcgccggat cacaatgacc cggacttggg ccggtacgat    111540
     gtcgaggcgc tcggacacgt cctcgccgat ccggtgcagg ctgcccgagc agcaggggca    111600
     gacggggctc tcgatgtcga ccacgcgctc gacgcgcggc agatgggcgg gcagggcccc    111660
     gcgattgttg cgccggcgcg ctgtacgctc ggccctcacc gccggcgcgg tttcctcggc    111720
     cgcaagaccc tcggcttcga cctgctcggc ctcctccagc ccgagcagga gctggtcctc    111780
     gggcaggctc tcggcgcgac ggccgaagcg atgacgctgc atcgccttga tgatctggcg    111840
     cagccgctcg ttctcggccc gctcctcggc gagcagcgcc ttgagcgtct cgggatcgtc    111900
     gggcgagggt gaagcaggcg cagccacaaa gcggattaga tcagatcact cagccactta    111960
     ccagtacgac gtcccctcgc gccgttcttt ttgctcagcc tgccaccgct ggcgcgctca    112020
     cctgacgagc ctcgtggaca cgcttccagt ccagcccttc gagcagggcc gagagctgcg    112080
     cagccgtgag gcgcacgacg ccgtcctgag ccttcggcca gcagaattga ccgtcctcca    112140
     gacgcttggc cgcgagaacc accccgctcc catcccagaa caaaagcttg gtccgatctg    112200
     cccgcttcga gcggaacaca tagaccgtgc cggagaacgg atccgctccc atcgcctcgc    112260
     gcaccagcgc ggccagcccg tcgatacctt tgcggaagtc caccggccgc gtcgccagca    112320
     tcacgcgcac tgtcccagcc ggcccgatca tgccgagacc ttcagcgccc ggatcaccgc    112380
     cgcaatctga gcctcgctcg cctccccgcc gatgcggacc gtggcgccag ctacttcgac    112440
     ctcaatgccg tgacagccgt ggcgccaacg cggcttgggg ctcgtctctg cacacgccgg    112500
     ctcctgcggt tccgagatca gcacggccgg cacgaaccgc agctcggcct gctgatcatc    112560
     catcgccgct tggcgcgcca agcgccgcca cgtgaacagc tgcgaggcgc tcaggccatg    112620
     ccggcgcgct accgcgctga tcgaggtgtt cggcgcctcg ctctcggcga caatggccgc    112680
     cttctcatcc tccgaccacg tccgccgccg gccggccccg gtgaacagct ccaggcgccg    112740
     gaccggctcc gacatagcca tacgctctga catcgacata ggacggagct cctgacccgc    112800
     tccgtatccc atgctcagcc gagctcccga aaggtgcctc caaaacgacg cttacgtgag    112860
     ggccagagaa agcggccctt ctccaatctt ttcgcgtaga gcgatagccc gagaccgtga    112920
     tgccagagac atttgatcag atcaccgcgc cggccgcgga acacggagag atccccggcg    112980
     tgcggatcgc gcccgagcgc ctcctgcccc tgcaggcaga ggccgttcat gccgcggcgc    113040
     atgtcggtgt ggccgctggc gatccagacc cggacgcccg aggggaccgg gatcatcgcc    113100
     cctccaacac agccagcacg cgggccggcg cctcggcctc cacgctggca tcgacgacga    113160
     tgcgccggcc tttgcccagc acgatcacca tgcggctcga agtcgacgat gatcgggagg    113220
     tctcggcccg ctctctggtg ggctccggcg cgggcacgac caccgccggc acgaaggtcg    113280
     gcgttactgc cggggccgac cggctcgccg cgaaggcacg ccgccaggtc aggagcagcg    113340
     agcgcgagat gccgtagcga cgtgcggtgg cggagaccaa gcgcggcctc tgcaggctct    113400
     cccgcaccac cttgagcttc tcgtcctccg accagcagcg acgccggccg gtctcaacaa    113460
     tctcgaggcg cctgaggcgc gcactgtgcg tatgactgtc catacgcact gttctcaacg    113520
     gccgatcatc tgccccgcaa ggcggtcctc tgcggaggga tacgtaacga ccaggcgctc    113580
     gcgcagatta acagacaacg ctgaccgcat ggcagccccc ttgcgaaagc cgcgcatcga    113640
     tcagaaccag gccggaccga ctacccgtcc cgactcagac cgctcgggca ccgctctagt    113700
     ccgacaggcc gccacgaaga cagcccgccg gatcaaatta ggctgcgttg agaaggcaat    113760
     tcagcggatt cgatgccttc ctgctcccgt agctttgtca ctagcttaga agccgctgcg    113820
     tcatcagtga cttcagcata ccagagtcgc cgcagtgccg gtttggttgc cttaggactg    113880
     attctcccga cgttgctgac gccggcaaga ttcttgatat ggtcgcggat ctcgtcctgc    113940
     actttctctg gtgtatgcgc gccaaatttg aacattacac ttttcattga tctaccgccc    114000
     tgcttgaagt agcctggaca gatttatccg gcctgtaccg tagtccacac tgaagtcgct    114060
     tccattcata gcgggtacct tatcagcgga ctccatcagc gcttgcctga cttgcgcagg    114120
     cgtcggcttt tcgttggcag cgataccctt ggcgatgaaa agggcagcgc accccgtgac    114180
     atgtggtgcc gccatcgaag ttccatccca ggcatcataa ttaatctccc ggcgcacagg    114240
     cacccccagc tttggccgcc tgtcggagcc gaacacgact ccaaaagccg tttgaccggg    114300
     gtaggcgggg agcgtcgacc agattgcctt gccaggtgct gccaccgaga tgtgattacc    114360
     gctgtttgaa aacatggtga cccgatcgtc cagtccggta gcgccaaccg cgatgatacc    114420
     agggattgct gctggatagg acgttgggct gccacaaacc cgcggctccg cttcccagat    114480
     ggctccatca accagcacga ctgggcacgt gcctcgggat tagaaaagtc aacgatcacc    114540
     gaagctatga gtaaagacgg tgtcgttcgg attgcattcc tccgccccca ggactcacga    114600
     aagggtattg gtcacgtcgt cttaatcaat aacggcaaga cgctagagtc gcatggtggg    114660
     gtcggcccgg actctcgcga ctggacgggg gcaaactggc aggcgaaggc tttcgtctat    114720
     gtccttgcgc gcaaggccca ggtcaccgca gtgggagcgg agcctatggc ggcgcagcca    114780
     attttggctg atgttcaggt cgtgggggca ccggccgtca tcgggcgcag cgacgcgatc    114840
     acgactggtc gaataatgtc aaacgtgttc acaacagctt ctctgccaga acatcacgac    114900
     gcgctcctaa tcgtcaacat gcggcaggag acgatgcagg tcgcccccgc aatggcaatg    114960
     gctgcaatgc caccacctcc cgagacagag ggcttgagtg cgctttcatt cttcgaacgg    115020
     gctgggcagg taaagagaat tgtgccgctg cgccggagcg agcaagcggg caatgctcct    115080
     ctacgaatgg cagccgcctc agcgttgatg ttcgcagcac aaccccccga aaatactgac    115140
     gcagcagctg ctgtgcgctt catcgagatg aagcgcgagc aagacaccca gcaactccac    115200
     actgccctcg ccgccgatcc aaatgttctc tcggtttccc gtgtgcctgt ccgttatctc    115260
     acggcacgca ggacctcccg cactcggctc gccggaggag gcattggcat cgaggcggca    115320
     ccgccaaccg gatcggtttt gtgggatctc gagaagatcc ggtggcaaga ggcccgtcgt    115380
     gctgaaggct ttatggaagc tggcaatgtg cgggtagccg tcttcgatac gggtattgac    115440
     gatgggcata ccgagctaaa aattgaccaa tactattggc gtcaccccga ccttacaaga    115500
     ccggtgtcaa accgagacat cattggacac ggcactcacg tctccgggat aattgcggca    115560
     ctgatcggcc gcggcgtgtc agttcaaggt atatgcgact gcaaacttga tgtttggaaa    115620
     atttttgatg acgaaccaac atatgcgccg ggtcaaggcg cctttgtata ctacgtgaac    115680
     ccgattatgt atcgccgtgc cttggcggac tgtgtcgaaa atccgccgga cgtgctcaat    115740
     cttagcattg gtggacccgc cgctccggat gctacggaga gagacttgtt tgaccaactc    115800
     attgaggcag gcgttacaat ctgcgccgcg atgggtaacg aacggcagta tggcaaggcg    115860
     aacggcttct ctcacgaagc cgctgcaatc gacctgcgtg aagtcgcgcc ccggcacggc    115920
     ttcgagaaat ggtacctttt taccaagtcc ataggtgacg cgcggatgcg cgtttcggca    115980
     ggcatcaaga aattcctacg cccgagaaat gtcgagattg atggccccga tcgctgcaaa    116040
     ggttggactg tcgagcgagg cgtcatctga tgctccagga gcaccgaggt tggcgagaaa    116100
     ccgggctgtc tcaaaatctg cggtctcgtt cgtgtcactg ttacctggag cacccgggtc    116160
     atcctcgtcc gcagctattc ctgattcttc gaacgcgacg aagcttagtc cggctccagc    116220
     accgctgaac gcaacggctg gagttaccgc agtcgcagcc gcctcttcgc aatagggcag    116280
     aaggcgcata acgtctcggg cgtattgttg cgcctttggg ccagagccgt tgtaggcccg    116340
     gacggcgtct tggatatcgc ccgtgatctg caccttcttg gtgagttcag aaacggcacg    116400
     gttgacgcac tctttgaaat tgtaccactt cctttctctg aagaaacctt cgtccgtccg    116460
     aacatattgc aggtcgtact ggaatatgtc atagcccttg tagactatgg acgctgggtt    116520
     gaggccgcgg gccatccgcg ctttgttcgt ctcccctata aggagatccg taaaagcctc    116580
     gccgtaggat agccggaact gcgctgtgtt cgtaggaaat gcgcttcgcg gtgcaccggc    116640
     aacatcgccg ctcgcgtcat aaacgcaaag cccaaggatc tcggtcgccg gcctatgtgg    116700
     ggtgagcggc agccagtaca tgccggcctc cctacacgca atggcgcata gtagtggcac    116760
     agtgaacgga gtcgacctaa cagcatccgc cagatcggac cggaaattgg ctatcatcca    116820
     gcgcgtgaca ccctgcgcga cgtcctgttc ggtatgcgcc cttgttgcca tcataccagc    116880
     ttcggctatc tcgttctcac cccggagatc gtcaatcatg gccccatgct cctccttgtg    116940
     atgaccttag cttggctgat cgcagtcact ccaggtggtc gcgcaatgcg cccgtttcgc    117000
     ttacattctg gaatggatgc gagccgatcg caccgggtag ttgtgtcttt tcatactatt    117060
     tcagcttgac ggcgcgcagc ccccccacaa tgacctcaga ggcaacgcca gctaggaaca    117120
     atcccgcata gtcggaaaga cctccggatc cgaaggtttc tgctgttcca gatccaccat    117180
     attgctgcaa tacaaagacg atagtaagcg cggccagcgt tagaactaca ataacaggca    117240
     acatccaatc ataaatatct tgaagcggaa ctggagacac gcctgcgacc catctcagaa    117300
     agcaaagttg gcgtccaatt tgctttgcag tattttggct ggcgacggaa ctaaacgtgg    117360
     agccggttgc catgccgaga ctgctccttg cagcatctac gtccgtttcc aacttataga    117420
     cctcaggttg cagcgatgca gcatcgccgg tgcgagcagc aaggcgtctt cgcagactgt    117480
     ccaaccgtat ttgcaatggc gcgcgctggg cggggtcggt gacgccctcg aggtttcgat    117540
     caatatcgtt gagccagtcg agcagctgta gccgcgcaat caccttagga tcgtagacaa    117600
     gttgcgaaaa acgtccgagc acgatcccgc aaagggccgt gagcagtgcc cagaacgcag    117660
     aggcgcggat tcggaattct actggcactc tcaatacagc tttgcccgac gttgtaaggc    117720
     ttaactaccc cgtgtagagg ccggcgcgaa gacctctgtt tggaagtttc aactggagag    117780
     ccactgtctg acccggctga agttctatcc gctgaggcat tgagagcagg ctggtgtcgc    117840
     cgagcgccac agcaggtccg ttggtaggca taaactcagg ggtaattgtg agcaattgcg    117900
     gaccatcatt aataatggga atcacagcga cattatctcg gacgacactt ggagcgaaaa    117960
     cgcccgatag ccaacatctc gaaagtagac agtcggcacc gattaaacga ataatatttg    118020
     ttgaattaag cagcttcaaa gcagattttt catcggcatg agcagtgttt acaagcaatc    118080
     ctagaaagag agtaaaaatt tgaaaaaaac ttctcctctt gccaaagtat gggtgggcgc    118140
     ccatcttcct gaaaagatgt cctttactga ataagcggtg ggactcggga tctgggcgta    118200
     tcatgctcac ctcccacctc accatagaag cgtgaaattg cgaagattgc aaccctggcg    118260
     agattatgga tggctggagc tcttgatagt ggctgcggcg gggcttgtcg cagactcgga    118320
     ggcgagccgc ggaaggggcc taatggtccc gctttcatgc aggaggcgag ccgctggttc    118380
     tgctcgcaca cggtccatgt gcccgcgaac ccgaagtcct tgcgcagcca cagcatggcc    118440
     gcgaagccct ggaccgtgcg ccgggccgtg gtgaacgagc ggaagtcacc cacccgcggc    118500
     atcggccgct tgacccggaa gtggtcgctc gcgatccctt gctgcagggg cttggtgaca    118560
     tggtgagtgg gcgcgtgggg cagcaggccg tcctcccggc tcgcggcgag ggccggcggg    118620
     ttgggaggcg atgggcaccg gaacggcgcg gtccgcgacc gctcgcaggt tttcaacccg    118680
     aagacggaga cctggacgaa gcggaacgcc gacaccggcc gcttcatgga cggaaagaag    118740
     gacggcaccc ccttcaaggg cgtgcgcaag gagcgctgag gcgctcaagg cgggctcgtc    118800
     gcgtgatggg ctcgcaacct catgccctca cgtaaggcgg atcatggcca aaaacatcgt    118860
     ggtcttctcg gacggcacgg ggcaggacgg cggcgtccgc cccgagcagc gcgtcagcaa    118920
     cgtctacaag atgtatcggg tctgcaaggt cgggcctgag agcggcatcg atccggcgga    118980
     gcaggtcgcg ttctacgatc cggggctggg caccgacatc ggcgccacgg ccctgacggc    119040
     gcccgtcagg ttcgtgcaga agatggccgc ctccgtctcg gggcggggca ttaccacgaa    119100
     catcgccgac tgctaccgct tcatcatcga ccattacgag ccgggtgacc gcatctacct    119160
     gatcggcttc agccgcggcg cctacacggt ccggtgcgtg gcgaacctcc tcatgtactg    119220
     cggtgtgccg accaagggcg ccggcggtcc gctgctgcgc ttctgcaaga tgacacggga    119280
     catcgcgcgc gaggccgtcg agacggtgtt ggagcatggt gctggccacc cccggaagga    119340
     cttcgatgcg gagcggcacg aactcgcccg acggtttcgg gccaagtacg gctcggacca    119400
     tgacgacggc gacgggaagt ccaacgtcga gccttacttc atcggcacct tcgacacggt    119460
     cgctgccttg ggggtcgccg gcccgaagcg caccctgatc aaggctggct tggcagcggc    119520
     ggtggtcatc ccactggcca ttgtcatcgc ggtgacgtca gccgtggtcg gaggcatctc    119580
     gtacctgttc gacggtccct tctggcaggc cgacctgatc acctccggcg tcctcgtcgt    119640
     cgcgtcggcg gcggtcgcct tcgcggtgcg acggcacctc gtggccgcga agaccaagac    119700
     catcaccgat tggccgtcgc ccggcgagaa gaggagccac gtcgcggagt ggaagggcga    119760
     gaacttcgac cgcctgctca gcgcccaggt cggctacgcc cgcgccgcca tcgccatcga    119820
     cgagcggcgc aaggacttcg accgcgtgaa atggggtccg accgagaccc cgccgccgcg    119880
     ggcgcccggc gcgcccgacc aattccggca gttctggttt gcgggcaacc actccgacat    119940
     cggcggcagc tacgacgaga ccgagtcccg cctgtccgac atcgcgctca agtggatgct    120000
     ggagcaggcc gtcggcatcc cggatggcct caaggtggat ggtatgccga cgatggcgga    120060
     tcccatgcat cccgtcgagg tgatgcagat cccgcggctg cggctgcatc cctccgcagc    120120
     cggcgtgcag cactgcgagg tcgccggcat gcgcgacgcc atcgaagagc gcatgtcggc    120180
     ctcgtgggtg cctggctggg tgcggcgctg ggcgcagggc aagacctggg agaccaagga    120240
     ccgggagatc aggcccgacg cgacggtgca cccgagcgtc gacgaacgct ttgcccttcc    120300
     cgctgtcgtg cagtgcgacg gtcttgcctc ctaccgaccg gccccgctgg cgaaccacgt    120360
     ccggttcaag gaccgttacg ggcctcagcc gaaacccacc gcgtgaacca gtcggacagg    120420
     gctgatggaa gatttcacct cgcttgagga ccaagtccgg gagtgcttcg gacgcgtggt    120480
     ctatacgcac aagacgcatg aatagatggc cgacaactgc agcaacacgc tgcgacgcct    120540
     gaagctggcc cagatcgcgc tctcggcgct cacgtcgtcc ggggtgcgtc gagcatcttc    120600
     gtcgacaggc ccgagttgaa gatcggagcc gctttcctgt cgttctttac cgtctggatt    120660
     ttgagctaca tgaagggctt cgatccgggc ggtacggcgc agaagcaatt acccaggggg    120720
     tggcgcatgg ctccggggcg agggaggcgg cgggccggat gcgcttgccg agaggcgggc    120780
     gagctaattc cctgccggta tgggacgatc cgagcttgag cgacgccggc aggcggttgc    120840
     tggcatccga gagaagtacg gtctctcgga gcgccacgcc tgtcggatcg tcggtcagca    120900
     ccggggcacg caccgctacg tgcccaccgt gccggccgac gaggatgcgc tgacctgcgc    120960
     catcatcgcc ctggcgtccg agtacgggcg ctatggctac cgccgcgtga ccgcgctgct    121020
     gcaggcagcc gggtggcagg tgggcaagga tcgggtgcag cggatctggc gtcgcgaggg    121080
     gctgaaggtc ccgcagaaac accggccgcg tggacggctg tggctgaagg gcggattgga    121140
     cttgctccgg attagtggag agcggtttgg ctggcgctgc gcctttcgaa ctgggcaggg    121200
     ctgacgtaat ccagcgccga gtggcggcgt accgggttgt acaacctctc accacaagac    121260
     ccatagtacc ggcgcgggcg acgaggtcgt cgtggtctac gcgtggcacc cgtgggccgg    121320
     gcgcgccgtc tgcgtccacg aggtgatcga gcgcacgacc ggcgcggcgg cgcgctgctc    121380
     gctcgcggac gcgcccatcg tccgccctca ggaactcccg gtctggatgc tcgatcccgt    121440
     tgcgtgccgc acgatgcagg cgacggcgca gccggtcgcg gccatgtccg cgctgatgag    121500
     cttgcacgcc ctcctcgccg ctgcgacggg cggccagcac cgcgccccga gccgagcccg    121560
     gctagcatcg cccgagtccc cgggagatcg tcatgcctca tcctccgcgc cgaccgcgcc    121620
     ggtcggaccc gcaactcgaa ctcggtttaa cgagcgggcc atcgaccccg acagcgccgc    121680
     cggcctgagg cgacctgccg gaggcgaccc agcagaccct cacccgtctc ctgacccacc    121740
     tgctcgtcgc gcacgcccgc ggcgccgatc cgcagccggg cgcccgagcc ggaggcagcc    121800
     ccgatgagcg ctgagaagat cggcccgcag caccgggccc gcaaagccgt gctctacgtc    121860
     cgccagtcct cggcgcatca ggtccagcac aaccgtgaga gccaggcgct gcagtacgcc    121920
     atgcgcgagc ggcttgcggg gctcggcttt gctgagatcg aggtgatcga cgaggacctc    121980
     ggctgctcgg ccgccggcgg gacgccccgc gccggcttcg agcgcatggt cgccgaggtg    122040
     tgcctgggca aggtcggcgc ggtcgccgcc cgtgaggtct cgcgctttgc ccgcaacagc    122100
     cgcgactggc agcagctcgt ggagatgtgc cgcgtcgtcg ataccctgct tgttgatcag    122160
     gagacgatct acgcgcctcg cctcggcaac gaccgcctgc tcctggggct caagggcagc    122220
     ctcaacgagt acgagctcga ccttctgcgc cagcgctcgc tggcggcgcg ctacgagaag    122280
     gcccaccgcg gcgagctcgt ggtcgcggcc cccgtgggct tcatcaaggt cggagcccgg    122340
     ctcgagatgg atcctgatcg gcgcgtgcag gcggcgatcc ggcttgccat cgacaaggtg    122400
     gccgaactcg gcagcgtgcg tcaggcgctg ctctggttcc tggagcacgg gctcgatctg    122460
     ccgacccgcg tcaacgccgg tccggtcgtc tggcgccgcc cccgctactc gacgcttcgc    122520
     gcgttcattg ccaatcccgc ctatggcggc gcctacgcct acggtcgcag ccgcgtcacc    122580
     gccagctacg acgcggccgg agccaaggcg cgggcgcggc gcacgcctcg ttcggaatgg    122640
     ctggcgttga agcctggcgc gcatgaaggt tacgtggcgt gggagcgggc ggaggcgatc    122700
     cgggcgatgg tgagcgagaa cgtcccggca agttcccgcg gcgcgcccaa gctcggcgcg    122760
     gcgctgctct cggggctgcg gccgctgcgg gcgcaagctg aacgtgcagt acacgggggc    122820
     caagggacag atcccgcgct acgcctgcgt gcgcgggcgg atcgactacg gcgagccgaa    122880
     ctgcatcgcc tttgggggcc tgcgcgtcga cgacgtggtg gagtcagcgc tcctgtctgt    122940
     cgtgcagccg gccgcggttg aggcggcgcg agcggccgag gcacaggcga acacgcggcg    123000
     cgacgaggcc cgcgcggcca tggtgcgcga cctggaggcg gcacgcttcg cggccgaccg    123060
     cgccttccgg cagtacgatg ccgctgatcc cgagaaccgc ctggtgaccg gcgaactcga    123120
     ggcgcgttgg aaccgggctc tggcccgagt gggcgcttgc gaggcgcgca tcgccgagca    123180
     cgaagcggcc actccgcggc ccgccctcgc tcctgcggcg ctcgagacgc tggccgcgga    123240
     cctgcgcggt atctggtcgg caccgacaac ggatgcccgg ctcaagaagc ggatcgtgcg    123300
     cactgtcctc cacgaggccg ttgctgacct cgacgaggcg cgggccgaga tcgtgctgac    123360
     gctgcactgg gtgggcggcg cccacaccga gcaccgcctg ccacgccgcc ggcgcggcca    123420
     gcgcaccagc acgcccgccg acgtggttga ggccgtgcgc gcgctggcgc tgatcgcgcg    123480
     tgacgacgtg atcgcgggcg tgctcaatcg caacggcgtg aggacagggc acggcaaccg    123540
     cttcacgcgc gagcgcgtca cggcgctgcg ctcgcactac cgcattccgg tgttccgcgc    123600
     gggcgcagag ggagaggagc cctggctgaa cctgagccag gcagccgccc tcgtcggggt    123660
     ggccgcgcgc acgcttcgtc tggcggcgga acggggcgag gtcgatgcgg tgcatcctct    123720
     cgcagacgga ccctgggtgt tcagccgagc cgctctcgac agcccggccg cccgggccct    123780
     cgcgcagggg acgctgaacc gcagcaaaca ccccgcggta ccggatccgg cgcagcaaag    123840
     cctcttcgca tcaacagcat agcgagatgt gcgttctgat gagcaattgt agaagccgtc    123900
     gatgtaacga gccagggcct cgctcgcctc ggctcgggtg tggaacacgg tgcgccagac    123960
     caactcgctt ttcagcgtct tgaagaagct ctcggccatg gcgttgtcgt aacagttccc    124020
     cttgcctgac atcgagatca gaatgccgtt ctttttgagt tcggcctggt actcggtcga    124080
     gaaatattgg ctgctgcgat ctgaatgatg gatcaggccg cctgatggtc cgcgaacagc    124140
     aaaagctcgt cgcagtgccg tgagcgccaa ctctttgtgg agccggtcgc tggccgccca    124200
     accgaccacg cgccgcgcga acagatcgat gacaacagcg aggtacaacc agccctccct    124260
     tgtccagagg taggagatgt cggccgccca cttctcgtcc ggacgcgcgg ccgtgaagtc    124320
     cagctcgagc aggttgggcg cgaccgggaa ggcgtgctgg ctgtcggtgg tgtgccgaaa    124380
     gcggcgcggc tggcgagcac gcaacccgtt ttcccgcatc agccgcgcag tgcggcggcg    124440
     gccgacgctc agcccctggt cctgaagctc gcgcgtcatc cgcgggctgc cgtaggtctc    124500
     attggaaagc gcgaaggccg agcggacgtg cgccagcagc acgaggtcct cgcgctggcg    124560
     ccgacaggca ggacggctcc tccaggcgaa gtagctgctc tggctggcgt tcctcgcagg    124620
     acacgccacc cgccggcctg ttcctgaact cgccccacga ccttgaggcg cactacgctc    124680
     acaccgacac gatctactgg gtcggctaca aggctcacct gaccgagacc tgcgacgacg    124740
     accgcccgca tctcatcacg cacgtctaga caagccccgc gcccgccgcc gatcaccgga    124800
     tgatcacgcc ggctcacgag gccttggccg ataaggacct gctcccggcc cagcacctcg    124860
     tcgacactgg ctacaccgat gccgggctgc tgatcgaagc ccggcagcgc ttcggggtcg    124920
     acctgatcgg ccccgtcagg cgcgacgtgc gctggcgggc tcaggccgga ggtcgcttcg    124980
     ccatcgcggc gttccggatc gattggacgg ccgagcgggt gacctgcccg cggggcgtcc    125040
     aaagctccag ctggtcacca gctctcgaca gccgcgggac accgggcatc acggtgaagt    125100
     tctctcgacg cgactgccag ccctgcccgg atcgcgtcga ttgcgccggt ccgagcgcga    125160
     cgcgccggct gatgtcgctg cgcccgcagg cgcgtcacga ggcgctcgcc caggcgcgcc    125220
     agcgccagga cacggccgcg ttcgcccacc tctacgccca gcgtgccggc atcgaggcca    125280
     cgctttcgct ggcggtccgc cgcttaggcc tgcgccgggc gcgctatgcc ggcttggcca    125340
     aggtttgatt gcagcatatc gcaacggccg ccgcgctgaa cctcaccgca tcgtccgctg    125400
     gatcctgggc gaaccgatcg ccccgacccg ccgcagtcat ttcggccgcc tgctcgcgcc    125460
     cgctgcagcc ggctgacttc gccagcggta tcaaactcgg cgatgaacca gtttcgcggg    125520
     tcaggaccag cctccggcgc atgaacgccg agacgaggcc acttcgcgat ggcgcgttca    125580
     aagctcgctg caattgcgaa cgtcccatta atcagtgtgt cgcacgccag gttcaaaatg    125640
     gagttgcgcc aggaccggcg atgcgttcgg gcgtggcggc ggcgcgtcac ccggcggaga    125700
     ggcgcaagcg tcggctggcg agcaacggat ccggattttc aatgcgtgtt caacggagac    125760
     ggggatggca aaggacccta tcggcgaggc gaagcccaat tgtgtgttgg tgctgcaggg    125820
     cgggggcgcg cttggcgcct accatatcgg cgcctatcag gctctttcag aaggcggctt    125880
     cgagccggac tggttctctg gcatttcgat cggggcgatc aatgccgcgg tactcgccgg    125940
     caaccagccg gccgaccgcc ttgccaagct tgaggcgctc tggcacgcga tctcctggcc    126000
     ggaggtgctc gtgccgctca agcagctgcc gctcgagatt tggcacaaca atctcagcaa    126060
     cgcggccgcg ctgatgttcg gccagcctgc cttcttcacg ccgcggccgg tcagtccctt    126120
     tgtcgccccg cctggcaatc cctcgactgt gagcttctac gacactgcgc cattgcggga    126180
     aacgctcaga gaccttgcgg acttcgacct catcaattca gccaaggtcc ggctgacgct    126240
     cggggcaacc gatgtcgcga ccggcgacat ggtcttcttc gacaacacca aggagggccc    126300
     gttcggccct gagcatgtga tggcttcggg ctcgctgccg ccaggctttc cggcgaccaa    126360
     ggtgggagac cgctactatt gggacggagg ttgtgtctcc aacaccccgc ttgaggccat    126420
     cctggaagac cagcccaagg gccacacggt cgtgttcatg atcgacctct ggggtgccgc    126480
     cgggcagtta ccggggacga tcaacgacgt gttctggcgc gcgaagcaaa tccaatatgc    126540
     cagccgcacc tggacccagg tcgacgcggt cgcctccaag gtcaatcttc gccacgccgt    126600
     tcgccttctg cggaaacaga gtatcgccga ggtcgacaag gccgtgccgg acgacctcta    126660
     catcgacgag acccgtcgcc ttgacatcgt gcatatcacc tatcaaccag gcaaggacca    126720
     gattcctaac tccgatgcag agttctcccg ctcgtcgatc gcggaacgcc gcgctgcggg    126780
     ctacgccgac atgcgttctg ccctcgaagc ccagccctgg aagcacgtcg agaaacccgc    126840
     ccaccttgcc gcaatcgtgc accgcgtaag gcacggcaag gtaatgacgg ataccgaacc    126900
     gaacctacat ggggccgaga ttggtgccca ggtcacgccg gcgaggaagg tggcgaacga    126960
     gtaacccctg acccgcgcct gaaggccctc ggttcgtcgg gcgtcgtcgc ctctagcgga    127020
     tcatgaattt tggtgcgggg ccctgtcgca aacgcggtga cgttcaccag ccgttgggca    127080
     tacccgccca gcttgccggc tccgctccgg agccggccca tgatcctcgc cgccctcgcc    127140
     ctcacgctga agcgccaagc ccgcggcgac ttcaaggctc ggcactcgca tgttgcgcaa    127200
     gccgccctgc gggtccgggc gcgtcaacga aacctctgag gaccgctgcg tcaagcctgt    127260
     tctattgagt gctggtcgtc atcgtcccgg tcccccctcg tgttggcatt ccggggtgcc    127320
     gaggtggagc tccgcgcggc gagggtgccc tcgccaacct cgtatccggc gggacggtgt    127380
     ccgcgccacg atccctcatt cgggtcggag gagctccgag gcgagcggcg ccactctcca    127440
     gcatcggcgc tgtcaggcag cccatgcttc gtcccggccg ccgctccctc ggtcccaccg    127500
     agccagttcc gcccggcggg tctggcccga tccgtcgatc cgcattcgcc ggggctccgc    127560
     cggcccgttt ccctcccacc gtgccgctct ggggattccc accgtcaggc cggcttcagc    127620
     tccatcccct ctgcggcccg gcgccgtcct ggaggtatcg ccagagcgcg atcccatgag    127680
     cgcgtcggcc tgaggggcga gctgctgctg agagctcttc tgccggagcc ccggcacctg    127740
     ggcggcgacg acccagctgc gggcgctgac ctcaacaacg aggatcagcg tgcggtcgta    127800
     gtccaggcta tggctggcgg tgaggtgggt ctggtgggtc atggtagcgc tcccgggatt    127860
     ggcggcgcgt agcctgccga ggcggtaacc ggtccccgta ggatctatat tcgggtccgc    127920
     ggccagtggc ggtacctctg cccgactgcg ccatctccgc cgacacgggc tgggagcccc    127980
     gcgccgtcta cgatcatctg gaatggctga tgcccggcaa tgtgctgccg ttcccggtcc    128040
     atatcgtttc ggccgggaat atccgcgacc aactcatgcg ggcgggcgag ggcaatcgct    128100
     gcgcctcgat cccggccttc gccaagtccg tcacgccggc cggcgcggag gttccggtgc    128160
     tcgatgagga tgacgaaggg cagcttgtcg aggccgcaac ccgtcgcacc acgaccgaga    128220
     ccgtctccat cggcatgatc cagagacaat gcaccaccga cctcaagatc gtcccgatcc    128280
     gtcggaaggt gcgcgaactc gccggtctca cgcgaaagcg ctcgctggcg tttcccgtcg    128340
     tggaagcctg gattggcatt tcgaccgacg agatcatctg cgccaagccg agcttcgagg    128400
     catgacaggt caagcggttc ccacttatcg agagacggat gagtcggcgc gattgccttc    128460
     cctggctgcg ccggcacggc tatcccgacc cgccgaaaag cgcctgcatc ggttgcccgt    128520
     ttcacgacaa tgcccgctgg cggcatatgg gcgatcgcga cgctgaggca tggaccgacg    128580
     ccgttgaggt caccgggcgc ttcgcaccgg cctgcgcagc atacgcggcg aggtcttcct    128640
     gcaccgctct tgcgttccgc tcgatcaggc cgatctctcg acggccgccg atcacagcca    128700
     actcgacctc tggccgaacg aatgcgaggg gaggggcggc ctctgacggg ctggcattcg    128760
     tcattcaaat gcattacatt gcgacaaggg aggtgaccat gcctgcaaac gcactcgttc    128820
     agacacgcat cgacgctgac gtccgggatc gcgcatcggc ggtgctcgag aacatgggcc    128880
     ttacggtctc ggatgcggtg cgcattctgc tcacccggac cgccaatgag ggtgcgctcc    128940
     ccctcgagct ggtcacgaac agcgaggcgc acgacgcctg gttccgggcc aaggtccttg    129000
     aggcgctgga cgacacccgg cccgacgttc ctgacgatca ggctgaggcg catttcgcgc    129060
     agcggcgcgc tgcggcccgg cgcagggccg gcgaactgaa atcgtgaagc tcgtctggtc    129120
     ggccttcgcg ctttcggatc gcggcggcat cttcacgcat atcgaggccg acaaccaatc    129180
     gacggggcac aagctgacgc agcggcactc ttagcaactc ctcccggtag cttcccaccg    129240
     tccctgtatg ctggatgagc aggtctacac gacggctctt agccagcagt tcgtccgcga    129300
     aggttgtgag ataatcgatc cgagaagatc ccagccatat gctccgagag gctgtataga    129360
     atgactccag ctttgttgat tttcgcggca gttgcgcccg cagtcaccat catgcgcagc    129420
     gtgttctcga tgaggtcgtg cgctaaatcc ggtttggctc taagtctttc catcaattca    129480
     tctaatggaa gtggccggac gtcggcgcct cacaaaagat tgagtgctgc ggtccggatg    129540
     tctagatatg gagccggatc gatcttggaa cggcgtaagc tatagttgag cagaacattt    129600
     gttgtgagac gcccaggata ctcggcaacg cgcacagtat atggatcggc cttaagttcc    129660
     tcagtggtga ccactgggat ccagagccac aggtctccgt cccgatcgct gataatgccg    129720
     cctcggattt gatcccaagg gcggtctgga tcgaaaacgc actcgccagg cgagaacgcc    129780
     gctgaggctt gcggcccttc ggacgtggtt gatccatcgg ccatcagggt tcccccattc    129840
     ccttcgatcc ctgccggatc ggttagctct gccgtttcga ccttagcggt gatctggccg    129900
     ggctgctggg gcgctttgcg gagttgcaat gcaaggccca ggcccgcacg ggccagctcg    129960
     cccggatcgt ggtgatccag gaggctggcc tggacgggtt ctggatccac cgcgccctgg    130020
     tctcagaagg gatcgagagc tacgtcgtgg attccgcatc gattgccgtc tcacgtcggc    130080
     atcgacgcgc caagaccgat cggattgacg gagaggctct ggtacgcacc ttgctggctt    130140
     ataagcgggg cgagcctcgg gtctgcgcca tggtccgcgt cccaaccccg gaagaagagg    130200
     atcagcggcg cctctgccgt gagctgaaga cgctcgtcgg cgaacggatc cggcatgtca    130260
     acaggctgaa gggggtgttg ttctcgcaag gcattacaga ctacgagccg cggcgtccgg    130320
     acaggcgtga aagactcgac gagctgcgca ccggcgatgg gcgtccctta ccacaccatc    130380
     tcaaagctct ggtgctgcgc gaactcgaga tcgtcgagct gctggatcgg cagatcgagg    130440
     tcgtgaaagc agaacgcgat gctcttctcg catcggcgca accggaggag gtcccctcaa    130500
     aggcggtcca gatgctgctc ggcctcaagg ggatcggatc cggttttgct ggtgcgctgt    130560
     ggtcggaagg tctctttcgg cactttgaca accggcggca ggtggcggca tatgcgggct    130620
     tggcgccgac cccatggaag agcggcaaga tcgatcacga gcagggagtg tcgaaagccg    130680
     gcaatccccg cctgcgcgcc atcgcggtcg agatggcctg gctctggctg aggcatcaac    130740
     caggatcggc gctttcgctt tggtaccagg atcgcgtgcg ctgcctgggc gggcggatga    130800
     agaaggtcat taccgtcgcg ctggcgagga aactgcttgt ggccctctgg aagtacgtga    130860
     cccacggcgt ggtcattgag ggggcagccc tgaaggttgc ctgatcctgc ccatcaaccg    130920
     aactctcacc acttccacca aggcctgatc agctttggcg gatccgggta gacgaaccgg    130980
     cgtacggtat ggcctgacca gccgtagtta agaatggtcc cgtcctcccg agccccaccc    131040
     acagaatgcg ggatgttggt gcagccgttg caggcggcga ccggatgtga gcttgagcgc    131100
     gtggtgcaaa aacgtgcttg atggctgggc tcggacctgt gatcccgtaa ctgtcaggga    131160
     gaactggatg aactgaagca attcagcctt gatccaatcc ccctcatgtg agccgtacgt    131220
     caagcgcggc caaaccgatg ccgccgatgc cgaggccatc gcagaagccg tgagccgccc    131280
     gacgatgcgc tttgtcgggc attgtcacga gaaacgatgg cagacgatct caggtcaggg    131340
     tagggcaggg ggcatgtagc cggtcacgta cgctcgccac caggtcccgc ctgagatcat    131400
     ccgccacgcc atctggctct atctccgctt cacgctgagc tatcgcgatg tggaggagct    131460
     cctggccgag ggcgggatcg agaccaccca cgagagcatc cggcgctggg tcctgaaatt    131520
     tgggcccgtg ttcgcccgaa acttacggcg gctgcggccg aggccatcga agaagtggca    131580
     cctggacgaa atggttatca ccgtccaggg ccggcgtatg tacctgtggc gggccgttga    131640
     tgcggaaggc gaggtgctgg atctgctcgt gcagcccaag cgtgacaaga aggcggccct    131700
     gaggttcctg cgcaagctga tcaagaaaca gggcttcgcc ccagaggagc tggtgacaga    131760
     caagctgcgc tcctacgccg ccgctcaccg agacctcggc ttgaacgccc gtcatgagca    131820
     gggtctgcgc cagaacaccc gggccgagaa ctcacatcag gcggtgcgac gacgagagcg    131880
     caaacagcag ggcttcaagt cgccaggctt agcccagcga cttctcgcaa tgccttgggc    131940
     cgacccgcgc aagctgcatt gcccgcgagg acccatggcg ggctgatctc cgctcagcag    132000
     caccggggcg gcgacccagc ctctctgcgg acgggttgat ggctgggccg ccgcagccat    132060
     tcggctctcg ctgaggcttg ctatcattat tgatggttgt gagcaggtgc aactgcgccg    132120
     cgacacctcg tgcgaagcgg gcagcagaac gcccggccgg ggttcgggac ccgcaccggg    132180
     cgtcaggctt ttgaagcagt gggccggaag gaagatgccg ggaagaccct cggccccctg    132240
     gtgactcctc tgcccgagcg ctcagggcgg agggtttgcg gtgccacaga ttcggcctag    132300
     ctgcggcccg tgtcgggcgc gatccgtgcc ggctgcgcac tttgttcggc gggcagcagc    132360
     ctgcaggtcc agcgcgtgct ggccacctga acgtcgcggc ctagtggatt gtgggacgat    132420
     cagtgatcat ccagctggca ttctcagcgt ggaggaagtc catgacctcc agcactgccg    132480
     cgagctgcgc ggcagtctca agcgacagcc ctatctgtgg atgtccattc agccggaccg    132540
     gtttgcccgt ttgcgaggca tagacactcc agcccttacg ccctttacgc acgtcataac    132600
     tccggctcgg catggcgttc ctccggctgc atttctgagc gccataagct tatcaacgtc    132660
     aaactgtgtg ccggccggct gtatgtggtc gacataatac gaaaccgccg attttgacaa    132720
     acgaatttca ttggaggata gcatcggctt tttcgatatg aagcgctctg atggacaccg    132780
     agctcgccag aacgttcctt gcggttgtgt cggccggcaa ttttgtcgga gccgctgacc    132840
     gactgaatgt cagccaatcg acggtcagca cccggattca ggctctcgaa tatgctttgg    132900
     gttgcaccct attcgtgcgc aacaaatcag gagcaacgct gacagcagca ggccggcggt    132960
     ttcaacggca cgcggccacg cttgtgcggg cagtcgagca agcgcggcag gaggtcggta    133020
     tacctgaagg cttcagcgga accattgtcg ttgggggtcg catcggctta tgggaacagt    133080
     ttctgttgca ttggctgccg tttatgcaga gaagtcagca gcatctttct attcgagccg    133140
     agagcggcct cgagccggag atcatgcagg gcctggtaga agggcgcatt gatatcggtg    133200
     tcatgtatac acctgagatt cgacccggat tgacgattca cgcgttattc gaagatcgct    133260
     tggtgtacgt atcaaccgac gcggaacaaa atgtcctcga tccatcaacc tacatttatg    133320
     ttgattgggg accagagttc tatgcccgcc atagtgcagt acttgcgggt cttcgtagtc    133380
     cggcgctcac ggttaacatt gggtggttgg gcctccagca catgatcagg aacggaggct    133440
     ctgcgtatct tccacaccga atagtaaagc aatatattga ctcaaatatt ttgttcgaaa    133500
     atgcagatat gcctgaattt acgttgccgg tttatgcggt tactgcgagt ggattgaaca    133560
     aaagcgcgat cgaggctgca ttaaaattga tggtggaagt cagtagtaac ctttcacagc    133620
     tttaggaata acgtggagcc gactgaacca ctcctaagct acgccgtcga gacacttact    133680
     cggacgggct tttagcctgc gcctatggag ggccgccctg aactcgggcg aaaccgctcg    133740
     ccctcttgaa atcaggatgg cggccttcgt ccggacgcgc ccccgccgcg gaccgggtgg    133800
     caccgggtcg gcgtgtcgcc ggccacgaaa tacggcgcct cgctgcgcgg cagcggtgcc    133860
     cgaccgcgga tgcgatcggc gatcttctcg gcgatcatga tcgtcggcgc attgaggttg    133920
     cccgtcacga tcaagggcat gatcgaggcg tcgaccaccc gcagcccttc caggccgtgc    133980
     acccgtccct gaccatcgac cacggccatc gcatcctctc ccatcttgca ggagcaggag    134040
     ggatgatagg cggtctcggc atgcgcacgc acgaaggcat cgagttcggc gtcgctgcgc    134100
     aggtccgcgc cgggactgat ctcgcgaccg cgataagggt cgagcgccgg ctgcgcgatg    134160
     atctcgcggg tgatgtgaat cgcatcgcga aactcgcgcc agtcctgctc gcgcgacatg    134220
     tagttgaaca ggaggctcgg gtggtcgttg ggatcgcgcg aggtgagccg gatgcggccc    134280
     cggctcggcg aacgcatcga gccgacatgg gcctggaagc cgtgcgactt gatcggattg    134340
     gtgccgttgt aattgatcgc cagcggcagg aagtggtact ggaggttcgg ccaggcgaaa    134400
     tccgggctcg accggatgaa gccgccggcc tcgaactggt tgctcgcacc gattcccgtg    134460
     ccggtgaaga gccactgcgc gccgatcagc ggctgattgt ggagcttgag ggcgggggcc    134520
     agcgagaccg gttcgcggca ctcgaactgc acgtagatct cgagatggtc ctgcaggttc    134580
     tcgccgacgc ccggaagatc gtggacgacc gggatgtcga ggccgcgcag gagatccgcc    134640
     gggccgacgc cggagcgctg caggatctgc ggcgaagcga tcgccccgga gcaaagcagc    134700
     acctcccggc acgcccgcgc cacgaccggc ccgcgcccgc cgcgcagata ggcgaccccg    134760
     ctcgcccgcc ggccctcgaa caggatgcgg tcggtcagcg catgcgtgac gatggtcagg    134820
     ttcgggcgcg cccgcgcctg atcgaggtag ccccgcgcgg tgctcgaccg gcgcccgtgc    134880
     cgggttacgc tccggtccat cggcccgaag ccctcctgct ggtggccgtt gaggtcgggg    134940
     gtgcgcgggt agccggcctg cacgcccgcc tcgaccatcg cctcgaacag gacgttgctg    135000
     ccgggcttgg ccgtggtcac gctcaggggg ccgtcgccgc catgataggc gtccggcccc    135060
     acgtcacggc tctcggcctt gcggaaatag ggcaggcaat cgtggtacga ccagtcggcg    135120
     aggcccgggc gctgcgccca gccgtcgtaa tcgagggcgt tgccccggat gtagcacatg    135180
     ccgttgatga gcgaggagcc gccgagcccc ttgccacggc cacactccat ccggcggttg    135240
     ttcatgtgcg gctcgggatc ggtgcggtag gcccagttgt agcgccgccc ctggagcgga    135300
     taggcgagcg ccgccggcat ctgggtgcgg aagtcgaggc ggtagtcggg gccgcccgcc    135360
     tccagcaaca gcaccgtcgt gtccgggtcc tcggtgagcc gggtcgccag cacgttgccg    135420
     gccgagccgg cgccgacgat gatgaagtcg tactcgcggg cgtccgtctg gggcatcgtc    135480
     tcagctccga ttggggcgcg ggatccgata tcgcgggaca tccggtcgat ccgtcgagag    135540
     cgaagttcgg cctcgctcag gggccgcgcg gggttgcagc gaggtttccc gatgccggga    135600
     aacccgatca gaacaggggg gcgaagtcgg acagctcgac ctggatcgac ttcgtgcgcg    135660
     tgtagcgctc gagggtctcg atcccgttct cccggccgat ccccgattgc ttggttccgc    135720
     cgaccggcat ctcgggcgga gattcgcccc aggtgttgat ccagcagatg ccggcctgaa    135780
     ggccgtgcgt gatccgatgg gcgcgggcga gatcgcgggt cacgacgccg gccgcgagac    135840
     cgtagagggt ggcgttggcc cgggcgagcg cctcggcctc gctctcgtag gggagcaggc    135900
     tcatcaccgg cccgaagatc tcctcgcgaa cgatctccat gtcgtcgcgg caatccgtga    135960
     agacggtcgg cgcgacgtag gcgccggccg cgaagcggcc ctccagggcg tggccgccga    136020
     tcaggaggcg ggcgccctgc tccacccccg aacggatgaa ggcgaggacc ttgtcccggt    136080
     gagcatggct cgcaagcggg ccgaaattcg tggcctcgtc gagcgggtcg ccgatgcgga    136140
     tgcgggccac gcgcttcagc acccgcgcct cgaaagccgc cttgagggga gcgggcacga    136200
     acacccgggt cccgttggtg cagatctggc ccgagctgaa gaaattcgcc gcgaccgcga    136260
     tgtcggcggc ccggtcgaga tcggcgtcgt cgagcacgat gagcggcgac ttgccgccga    136320
     gctccatcgt aacctccttg agcgtcgagc gggcggcgcc ggccatcacc ttggcgcccg    136380
     tgagcgtgcc gccggtgaac gataccttgg cgattgccgg gtgctcggtg agccacgcgc    136440
     cgatctcgcc gccgaggccg ggcaggacgc tgaacacgcc gtcgggcagg cccgcctcgg    136500
     cgtagatccc ggccagcgcg aaggcggtga gcggcgtcac ctcgctcggc ttgaagatca    136560
     tggcgttccc ggccgcgagg gcgggcgccg acttccagag ggcgatctgg atcgggtagt    136620
     tccaggcgcc gatgccggcg acgatcccga ggggctcgcg ccgggtgtag acgaaggagg    136680
     tctcccgcag ggggatctgc cggccctcga tcgccgcagc gaggcccgca tagtattcca    136740
     gcacgtcggc gccggtggcg acgtccacca cccgggtctc ggcgatcggc ttgccggtgt    136800
     cgaggctctc cagccgggcg agttcgtcgt tgcgcgcccg cagaagcgcc acggcccgca    136860
     tcagcacccg gccgcgctcg cgcgcgggcg tggcggccca gacggcctgc ccgcgtgcgg    136920
     ccgccgcgac ggcggcctcg agatcctcgc gcgtggcgtg ctcgacctcg gccaggatct    136980
     cgccggtcgc cggattgacc gaccggaagg tgcaacgccc ggcctcttcg gcgaggcggc    137040
     ccccgatgaa tgggcgttgg atgtcggtga ggagcatggc ggacgtctgt gtcgagaggg    137100
     ggaggcgggc gcggcgcgcc cggcgggtca ggtgttctgg agaaggccgc ggtagatctc    137160
     gctgtggtcg cacaggcccg cgaggcgacc aagctggtcg acgaagacga tcgggtaggg    137220
     cgagcgcagg cgcagatcga tcgcggcccg cagcggcagc atcacggggg cgacgacgac    137280
     ccgcccggga tcgccgcagg cgccggtcgc gtcggcccgc tccagcgcct ccgcgcgtcc    137340
     gccgatatgc gccatgaccg ggcgttccgc acaatcgagg ctgatgcgca cctcgccgct    137400
     cccgtcgagg agcactgcgt cgccttcccg ccgcagggcc gagacgggcg tcatcacggc    137460
     gccgctgtcg agcacctcca gcgggttcat gtgcttcacg aactcggtca cgtatgagtt    137520
     ggccggccgg agcacgatgt ccgagggggt gccgaactgg acgacgtggc cgccctccat    137580
     gatggcgatg cggttgccga gcttgagcgc ctcgctcagg tcgtggctca cgaacacgat    137640
     ggtcttgtgg agcttgcgct gcagctccag caggtcgtcc tgcagcttgt cgcggatcag    137700
     cgggtcgagg gccgagaagg gctcgtccat cagcaggatg tcggcgtccg tggcgaaggc    137760
     gcgggcgagg ccgacgcgct gctgcatgcc tccggacagc tcctggacca tcttgtcggc    137820
     ccagctcgcg aggccgacca tctccagctt ctcgtcgaca atccgctgcc gctcggcggc    137880
     cggcaccccg cgcagctcca gcccgaagcc gacattgtcg cggacgctgc gccagggcag    137940
     caggccgaac tgctggaaca ccatcgagac ggtgttgagc cgcacctcgc gcagggtgga    138000
     ggcccggcag cgcgtcatgt cgacggcctc gccgcggtgg cggaccagca cgctcccgcg    138060
     ggccaccggg ttcagcccgt tgatcgcccg cagcacggtc gacttgcccg agcccgagag    138120
     acccatcagg acgcagatct cgccgggctt gacgtcgagg ttgaccttga acgtccccat    138180
     cagggcgttg acccgttcgc ggatcagctc gcgggtggcg ccctggtcgg ccagcgccag    138240
     cgcggccttg acgtcgcggc cgaagacgat ggcgacgtcg cgcagttcga tcgcgttctc    138300
     cggggacgtc cggctgacag gagagagggc tttcatgtcg atgacgctca ttgggcggcc    138360
     tttcgactgc gcggcgcggg ccgcttgcac acgcggtcga ggatgatcgc cagcaccacg    138420
     atggcgaggc ccgcctcgaa gcccatcgcg atgttgacgg tgttgagggc gcgcacgact    138480
     ggcttgccga ggccgtcggc gcccacgagg gcggcgatca ccaccatcga gaggctgagc    138540
     atgatgcact gggtgacacc cgccaggatg gtcggcatgg cgctcggcag ttcgaccttg    138600
     aacagcatct gcgtgcgggt cgcgccgtag gcaagggccg cctcgcgcag gctctcgggc    138660
     accgacgaga tgccgagctg cgtcaggcgg atcggggccg gcaacgcgaa gatgaccgtc    138720
     gagatgatgc ccggcaccat gccgaggccg aacaggacca gggtcgggat caggtagacg    138780
     aaggtcggga tcgtctgcat caagtcgagc agaggccgga tggccgcgta gaacatcggc    138840
     cggtgcgccg ccaggatccc gacgggcacg cctacgacca cgcatgcggc cgttgaccat    138900
     atcacgaggg acagggtctc gatcgtggcc tgccagtagc cgagattcgc gaccagcagc    138960
     agcgaggtca cgatgaacag cgcaagcccg agggagcggt ggagcaggta ggcgcccgcc    139020
     gcaaacagcc cgatcatggc gagcgggggc acggccagga gcgtgtcggt gagcccctgc    139080
     accatcgcgc cgagcaccgt cgagatcagg tcgaagacgg cctgggcatg ccggctcagg    139140
     aagtcgacgc cagccttgag ccagatgccg agcgagatct tgtgatcgac gatccagtta    139200
     tacatggaca cacccgcttg caggacatga cgggagagcc gtcggcgccg accgccgacg    139260
     gcgcagggtc tgcggcgctc agttcaggcc gaggctcgcc cgcgcggcgg gcaggcccgg    139320
     cttgccgtcg aaggtctcga caccgtcgag ccagcgctgc catgcgccgg ggttcgcctt    139380
     gagccacttg tcggcggcct tctccggatc gaggccgtcg aacaggatcg agcccatgac    139440
     gacgttctcg gtgggaaggt cgaaggtgag attcttgaag agccgtccga ggttcgggca    139500
     ctgggcgacg tagccagccc gcaggttggt gaagatctcg gcgccgccgt agttcggccc    139560
     gaaggtgtcg tcgcctcccg acaggtagcg gatcgggaac ttcgtgttca tcgggtgggg    139620
     ctcccagccg aggaacagga tcggctcctt gcgctggatc gcgcgctcga cctgagccaa    139680
     catgccctgc tcgctcgatt cgacgagatc gaaattgcca aggttgtaag tattgttctt    139740
     gatgattccc aggatcatcc ggttaccgtc attgcctggc tcaatgccgt agatcttgcc    139800
     cttgagttgg cgatgagact tggagatgtc cgagaatgac ttcagacccg cttcgtacag    139860
     gtaggcgggc accgcaaagg tgtacttcgc gccggtcaga ttcggcccca ggacctcgat    139920
     ctcgttcttg tcgagatagg gcttccggtc cgcctccatg gtcggcatcc agttgccgag    139980
     gaagacgtcg atgttcttcg agccgagaga ggcataggtc accggcaccg acaggatctg    140040
     ggtcttcggg gtgtagccga ggcccgtcag gatccgggag gcgagcgcgg tcgtggccgt    140100
     gatgtccgtc cagccgacat cggcgaagcg cacggtcttg caggccgccg ggtctgccgc    140160
     ggctggcgtg gcgaacaggg agacgccgaa caggacacgg accaggaaaa cacgcatgat    140220
     gaaccccctt cagcggatac cgggcattcg agttcgaaaa cttcattgaa tggccattca    140280
     atagtatgtt gacgcagatg tcacgataaa tttttaagca atagatgctg cggtgcgtgc    140340
     attatcgttg agaaattgtg cgtcgcagca gatggcgctg gctcacggag cgcccgagag    140400
     atggcttcgt gatggcaccg gggttgcacg agaagatggg ttgaatgatc attcaatcac    140460
     ttgcccgggt ccttggcgac tcggacatcc gccgggagcc gcaatgaaac atctggaggc    140520
     actgcaaagc ttcgaggccg cacggcggcg ccatctcatt gaggcgacga tggagacgct    140580
     ggccgaagtc ggcttcaagg ccgccaccct gagcgagatc gcccgccggg cgaacgtgtc    140640
     ggccggcctg ttcgcccact acttccgcgg caaggacggg ctgctggaag ccacgctgcg    140700
     ctttgtggcc gcgcgcctcg cccgagtgac ggcggccaag ctcgcggcgg catcgacgcg    140760
     gcgggagcgg ctgttcgccg tatgcgatgc cgccctggca gacgagcagt tcgaccggcg    140820
     caccagcgcc gtctggctcg cgttctgggg ccagctcacg cattcaaagc gctaccagcg    140880
     cgttcagtac atctaccagc gccgcatgat cacaaacctg cgccactccc tgcggggctt    140940
     ggtgccagcg gactgcgtcg cgttgcacgc caggatgatc gccgcgatga tcgacgggct    141000
     ctggctgcgc tcccatgttg cgaacggcac ggcgagtggt gcggaagccg gaggggccgc    141060
     ggcgcgaacg atcgtccgcg cactcatcga cggccttctg gccgggatgc cggagacggc    141120
     ggaacctggc gcgtccgccc ggccgatcgc cgcggcgctt cccgtcgccg aggctccgcc    141180
     gatccggcac cggagcccga cgaccggcga ggagatcgcc cgtttcgctc ccgcccgtgc    141240
     gacggagatc cgacgggccg tccaggatgc acagcggggc ctcgcggcct ggaaggcgat    141300
     cggcgcagcc gaccgcgcgc agatcctgcg ccgctgcgcc ggtctcctgc gtgccgaagg    141360
     gcccgatctc gcacgcctgg agagcctgga gacgggccgc ccgctgctcc ataccgccgg    141420
     cctcgacctg cgggatgcgg gccgcgcgct ggaccacgcc gccgggatcg ccgaacgggc    141480
     ggcggcaagc tggaccgatc taggcagcgg ccggttcggc catgtgcggc gaggccccgt    141540
     cggcatcatc gccgcaacgg gacattggag cgcagccatc ctcgacctgt gcaggcaggc    141600
     cgccgggctc gcccacggca atgccgtcgt cctcgccgcc gatgcgtacg ccacggagac    141660
     gagcacgcgc ctcgccgatc tcttcgtgcg ggcgggtctc ccagagggga cgctgacggt    141720
     gctgcgcggc gatgcggaga gcgcgcgcct cctgcgaaca tatcccgggc tcgccaccga    141780
     agccgcctcg gcgggcgggg acgacgaggt cgatctcggc gcagggctcg gacgcagcaa    141840
     agcctgcacg atcgtcctgc cgggagccga tcccgcccgg gtcgccgccg cgatctttca    141900
     gggcggccgg cgctggacgg gatcgtcctt cgccggccag tcgcggatct acgtccatgc    141960
     cgatatgcgt ccggacctgc tggacgccct acgcgctctg gcgagccggt tgcggctcgg    142020
     tagcccactg gacccggcga cgcaggtcgg tccgttgctc tcgccgaccc atgccgcagg    142080
     ccttgaggac gccttgcgct cagatcttgc cgcaatggcc gctctggtgg tcggcggaca    142140
     ggtctcgcgc ggggggacga cgcgcgccgc ttggctcacg ccgacggttc tcgatcggtg    142200
     taccgaattg atgagcctcg tgcgggggca caacttcgct cccgtcgtga ccctgatccc    142260
     gttcgaggac gaccaagaac tgatccgccg gctcgtgggg cgccgcgcga cggccggttt    142320
     cggtctcttc gcgggcgacc cttcgcgcgc ctgtcgcata gcgaatgcgc tcgacgcagc    142380
     gttctgcgcc atcaacgacg acgaggcggt ttcggcggcc gaggatctcg aggctgcacc    142440
     cgcgcatccg ttcggatggt cgctgtccga gcattcgagc caggacctgt cgcgaacgac    142500
     gcgcatcatc ggaggcaagg gctgcggccc gatttaggga aggatccgct cacgccaaaa    142560
     cggatcctgt tccagggctc ccatgcgcga ccctgacctt gcgaccggga tggggaagat    142620
     cacgggcggt catgctggca tgaccgccgt gacaccggat cctcagccgt agatggggaa    142680
     gcggccggtg agggcgtgga cctcctgcag caccttcgcc tcggcggcgg cgtcgcccgc    142740
     ctcacccgcg cgggccagcc catcgagcac cgccacgatc agctcgccca ccttcttgaa    142800
     ctcggcgacc ccgaagccgc gggaggtcgc cgccggcgtg ccgaggcgga tgcccgaggt    142860
     cacggtcggc ttctgcgggt cgaacggcac gccgttcttg ttgcaggtga tgccggcccg    142920
     cgacagcgcc gcctcggcgg ccttgccggt caggctcttg ggccgcagat cgaccagcat    142980
     caggtggttg tcggtgccgc ccgtggtgat ggcaaagccg cccgcgctga tggtggcggc    143040
     cagcgccttg gcgttctcga ccacctgctt ggtgtagagc ttgaactcgg gcgtcagcgc    143100
     ctcgccgaag gccaccgcct tggcggcgat gacgtgcatc agcgggccgc cctgcaggcc    143160
     cgggaacacc gccgagttga tcttcttggc cagcgcctcg tcgttggtca gcaccatgcc    143220
     gccgcgcggc ccgcgcaggg tcttgtgcgt cgtggtggtg accacatgcg catgcgggaa    143280
     cggcgaggga tgcaccccgc ccgccaccag gccggcgaaa tgcgccatgt cgacgaagaa    143340
     cacggtcggc ggcctcgtcc agatcccctg tatcgagcgc aacgcgttcg gggccaacaa    143400
     ggccgtcgcc gtcgcctcgc tcaccctgcg cggcggcgga gtccacttcg tgaccctcga    143460
     cgaagtcatc gaaacgatgc gccagaccgg gcacgccatg caggcgaagt acaaggagac    143520
     ctccctgggc gggctcgcgg tcaacgtcgc cgcctgctga cgcgccgccc gatcgatccg    143580
     gcttccgaag cgcgcaaagt ccctcgccta ccctgggctg cggcattcac gtatcgccgt    143640
     cttacctgac ctccggtgcg gatctgcatg ccgcatgcgg cacagggcgc aatccgcggg    143700
     gattgcgccc tgtgccggtc gtggggcgat gcaggaccgc cgaagggcgc ttaccggacc    143760
     gccggccctt ccgcgtcgct cgtccggccg ggaaccgagg aggcgatcgg ctcctgtccg    143820
     gcgaagatgc cgggatcctt cgaggtgacg tcgaccgaca gcgtggcgat caccgccgcg    143880
     ccacaccagt tggagcggaa cgtgccgttg gcaatgctgc ggggatcggc ggtgatcagc    143940
     ccgcactcgc tcttcgtcat ggtggtgtcg tggaagcgca ggtcgatggt gaagttcttc    144000
     gccgtgtagg cgacaccgac gttgccgtag gtgtagtccg gcaggttgaa ccggccgaac    144060
     gaggcacggg tcgtgccgag gaagtagtgt cccacctccg ccgagagcat gaagccgctc    144120
     ggcatcacgc cgaacgttcc ctcggggatg gcgtacttcg caatgcccga gatgtaagtt    144180
     cccggagcgt gggttccgaa gtagctcggc gagtagtaga cgttcacgcc cagtatcagg    144240
     gcatcgttca cggcgtaggt cgccttgccg acgatctcgt aatagtcggc gttgttggca    144300
     gtgtagatcg tgctgtccag gccctgcagc ctgcgctcgc cgggatagtt gtagaacagg    144360
     tagccgagat cgaagctcca ggcgccgtag gtcggccgga tgccggccga gaaatccatc    144420
     tccatcgagg ggcggttcgg taggtcgacc tgctcgcccg cgataccggc gtaaagcaga    144480
     ccgtcgagca tctggaactc caggtagccc tgcacgcccg gattgcggtt ggtctgcggt    144540
     atgccgcgcg aattgtagtc gctgacaaag cgcaagccga aggcggccga gaccatctgc    144600
     ggatcgaccg gcggcagggt tgggaccggc gccggcgcgt cggcggcatg acccgaaccc    144660
     gccaaagtcg ggacgaggaa cgcggcaagg aagatggggc gaacggacat cgggtctctc    144720
     gaaggctgga gcgcaacatg cgcgcgcgaa tccaaatgtc ttgcgggtat gcgcaatcac    144780
     gagatgccaa ctcgatgacg agcgcgccaa tcaaaacact gctttgtttt gatgcgttct    144840
     tactttcagc aaggtcatct gtcacacatt caacgcacgc gcattgtctc ttcatgccgg    144900
     tgatgcagtt atgcaccact ctcgtgttgc atcacaacca tcgcacactg gcccagtaac    144960
     acttctaata aacagacgtc acaaacagcg atattctgtt aaatttcttt catttgttgc    145020
     cacaagtcgt gtcactccct cgtgcctggt ttaaatgatt gcaaattctt taggccgcgg    145080
     cgctgtccgg aaagacaatg gatgtgggct cgtgtccccc cgcgcgcagg gcgttcagga    145140
     gatcgcccgg agtgagcgtg agggttcgcg tgttcacgag cgggtggacg tagagggcgt    145200
     gtcgcaaacg cggatgggcc catgttcacg ggttgttagc catagccgcc cagcttgccg    145260
     ctccgccctc ggagccggcc catgatcctg aatgccctcg ccctcacgct gaagcgccag    145320
     gcccgcggcg acttccgggg ccggcatgtc gaggccacgc tgatcgtgca ggccgtctcc    145380
     tggtccctgc gcgacgcgct cagcgaccgc gacatcgagg agatgctcct ggagaggggc    145440
     ctgcaggtgg accactccac cctcaaccgg tgggtcctcg cctatgcacc cgccctcgag    145500
     cgtcggctgc gccggttccg caagccgccc tgcggatccg ggcgcgtcga cgagacctct    145560
     atccgcgtcc gcggccagtg gcgctccctc gaccgggcca tcgacaagcc cggcgaagcg    145620
     gtcgacgtcc tgctcacggc caaccgcgat ctcgatgccg cccagcgcgt cttccgcacg    145680
     atgctgcagg atcagccgtt gctcgctcca gaccggatcg gcaccgatgg ggccggcccg    145740
     cacccgccag ccatcgccaa gagccgcaag gagggcctgc tgcctcgcac gcccacccac    145800
     cacgtcacca agcccctgca gcaagggatc gcgagcgacc acgtccgggt gaagcggccg    145860
     atgccgcggg ggggcgggtt ccgctccttc accacggccc ggcggacgat ccagggcgtc    145920
     aaagccatgc tgtggcggcg caagggcttc gggtttgcgg gggcctggac cgtgcgggag    145980
     cagaaccagc tgctcgcgca ctgcttcgga cttcccgtcg cgaacaaagc atgaaagcgg    146040
     ggacggacag ccccttctgc ggctcgcacc cgagtttgcg acaagcccct tccggttgcc    146100
     tttttgtcca gcggacttac acttgttaca gatacaccga tggagccggt catgtccgaa    146160
     gccgcggcga tcatcccctc tcctgaagcc gagcgcgaac cgaacgcacg cctcgctgat    146220
     gcgctgcgac gccttcgagg tgagagagga caaaagacca tggccctgac cctgcacggt    146280
     ccttccggag aagcagtcgg ttcgctgacc gcctcagccg tcgaggctct cgaggctgct    146340
     ttggcccgcc tcgccgagtc cgacacgatc atgctcggat cgcaggatgc ggagttgtca    146400
     ccggaggccg ccgcaaagat cctcggggtt tccaggccgg tggtctacca ccgcatggac    146460
     agtgggcgct tgccgttccg ccaagtcggc tcgcaccggc gcgtcctcta caaggacgtc    146520
     ctggcgctga aggcgttcga ggaggagagg cgggggttct ccaaggccat gagcgaggac    146580
     accgacgagc aggaggagcc gatccctcgt ggcttctaag gtcttcgtcg acgcaaacgt    146640
     cctctggtcc cctcagcagc gcaacctgct ccttcaactc gcctatcagg acctcttcgc    146700
     gatccattgg accgacaccg tcatcggcga gtggctccgc aacctcgacc tggggcagag    146760
     gaccaagtgc gagacgagga cgctgcccct gatgcggcgg cacttcccga gggcttggct    146820
     gccgacgatg ccggcaacgc cgttcgggac gaccgatccg aaagatcgcc atgtcgccgc    146880
     cggtgcggtc cacatcacgc cctccatcct gctcacctgg aatgtggggg acttcgacga    146940
     tgcggcgctg cgttcccttg gcgtcgaggt tcagacgccg gaccggttcc tgcgaaggct    147000
     cctcgatggc agcccggccg ccgtgctgga gttcacgcgg taggcgcagg cgaacctgag    147060
     caagaccgca ccgaactggg aggcgtacaa ggccgtcctg ctcaagatcg gccttgcgga    147120
     tttcgtagcc ggcttggagg ggcttagccc tgggtagagc tcagccggcc atgtcggcgt    147180
     ggagggcggc tactgacgct cgcggagaac acggcaggcc gagcgaacgg cttccaattc    147240
     ggttcctgag tgacgtccag ggccaacccc gcctccgtga tcttgagccg agtgggtgaa    147300
     tcgccggcga acagcacggt cgccatgcgc cagttccccc gggagggcgg gcttgatgct    147360
     gctggccgta ggcgatgagc cgcagggccg agagggagag gggtttggcg atgcgatcgc    147420
     gcggtttgat caggggctca cccaggatga gctgggcgac cttccggccg tcggtcgtca    147480
     gccgtaccat cagcgacatg atcggcctgc ggctgcgccg atcgaccagc ccggggtggg    147540
     cgtagctggt tcggaggagg cctcgctcct cgagcgccgc cggccatgaa gcgccggtgc    147600
     cctggctcac cacgccggcc gcctcgagcg tggagcgcag gaggcgtgag ccagggctgt    147660
     tcagccaatc gcgccccgac ggacccgtac tcgatccagc gccaacggcg ggcgggctgc    147720
     cgggcccgcg gtgggtcgcc tcgcgggccc ggtcctcgtc gtaggcggcg agccggtagg    147780
     cccgctggcg ctcgttgagc tccgtcgcaa tggcctggag cttcgctgcg gtcgccgtcg    147840
     aatggtccta gtggtcaaaa cctgacgctt ggtacccact cgcgaggtcc gctacgggtg    147900
     gattctgttg aaaactcggc tgttgcgccg gcagttttgg ggtgattcac tcccgttgag    147960
     agacggggat tgaagcagat gatgggaccg cggcaagtcg agcaaggtgc cctgttctac    148020
     gagttctcgc tcgataccca cgtcccagcc gaccatctgc tgcgcgccat cgaccgcttc    148080
     gtcgacctga ccggactgcg ccaggacctc tctcccttct acgcctcgac gggccgcgct    148140
     tctgtcgacc ccgagttgat gatccgcatg ctgatcatcg gctacggccg tggcatccgc    148200
     tccgagcgcc ggctcggcga cgaggtccac ctcaacctcg cctagcgttg gttctgccgg    148260
     ctcggcctgg acgggcgcgt gcccgaccat tccaccttct ccaagaaccg ccacggccgc    148320
     ttccgcgaca gcgacctcct gcgccgcctg ttcgcgcgcg tgttggcccg ctgcatcgcg    148380
     gaaggactcg tgggcgggga aggctttgcg gtggatggcc gcctgatcca ggccgacgcc    148440
     agtcggcaga agggcgtcga gggatccgcc ggcctgccgc ccgaggccgt gagccgggcc    148500
     gctcaggagt acctggccgt gctcgacgcg gcggccttcg gggctgccac accagtgccg    148560
     cccaagttcc tctcacccgc tgatccggcc gcccgctgga ccggtgccca tggcgggctg    148620
     gccttcttcg ccgacacggc caatgacctg atcgaccgcg accctgcgat catcgttgat    148680
     gtcgaggcaa ccaccgccat ccggcaggcc gaggtcacgg ccgccaagcg catgctcgag    148740
     cggtcgcgcg cgagcttcgg cctctatccg gcccggcttg ccggcgacag cggctctggc    148800
     tcggccgaga tgctgggctg gctcgtctcc gagcagggca tcgcgccgca catcagcgtg    148860
     ttcgacaagt cggagcgcac ggatggcacc ttctcgcgcg ccgacttcag ctacgaccag    148920
     cccggcgatg tctaccgctg cccggcgggt acgatgctga ccacgccggg cagccgggtc    148980
     aacggcgggg cgacgctctt ggatcgggcg agcaagttcg actgcatggc gtgcccgttg    149040
     aaggcgcgat gctgcccaaa cggtccggtg cgcaagatcc cacgctcgat ctccgagggg    149100
     gcgcgggaca tggcgcgcga catcgcgcga tctgacgagg gcaagacgtc gcggcgtgag    149160
     cgcaagaagg tcgagatgtt gtttgcccac ctcaagcgcc tcttgaagct ggatcggctc    149220
     cggctgcggg gtccgaacgg agcccgcgac gagttccacc tcgccgcagc tgctcagaac    149280
     ctgaggaagc tcgccaagct cgtcccggtc ccgcagccga gcccggcttg atcggcggga    149340
     ggcactccgt gccccacgag ggtcgctcct cgcagccacc gctgatccag cctgcccgcg    149400
     agttttgcaa cgaaatcggt gggatgcggt ccttgcgccg gcgtccaaac aacggctggt    149460
     ctgcggccat cgcgccatcg ggatccctga cccgaaaagc ggccattcct gctgcgcgct    149520
     tcaaattcgg gcaatgtttg cagaacgatg tcgatttccg acaagctcgt tcgtcgttct    149580
     gatgagacgc cagaggggct ggctcaggca aggagacaga cgatgcgggt tatggtgttc    149640
     gtgaaagcca ctgaggacag cgaaaagggc gtgtccccca cgccggaggc gctggaggcg    149700
     ttcgaggcga tggaccggtt caccgaagag ctggtcaagg ccggcgtctt tgtggccgcc    149760
     gcgggcctca agcccagcgc ccaggccaag cgcatcgcct tcgacggtcc gaaccgcacg    149820
     gtcatcgatg ggccgttcgc cgagacccgc gagctggtcg ccggcttctc gatctgggag    149880
     gtcaaggaca tggacgaggc catggcctgg gcgcagcgct gccccaatcc catgccgggc    149940
     ccgagcgaga tcgagatccg gccgttcttc gacgcggcgg atctggccga gtttctgatg    150000
     cccgaggagc gctcgacgcc tcgtgaaggg gagcgcggga agctcggcgt cgcctgataa    150060
     cgtcggttgg agccggctta tctcccctgc ggacttggct gaaaaggcgc ggtgaccgca    150120
     ggcgagacgc accaggcgat cgaagcggcc ttttctgagg cgccgctcgg cacatcagaa    150180
     gccgccggtc cgctcccgac caactccgat ccgtcggtga gcgtctgccg aaggtctgag    150240
     acgggtggca tggggcaggt cagaccgcga agagttgcac gaggtcgggc gaggagcgca    150300
     gccgacgcat cgtcatccgc gccgggccgc ctcgatcgcc gcgacgtcga tcttgcgcat    150360
     ggtcatcatg gccgtgaagg cgcgtttcgc cgcctcgccg ccggccgcca tcgcggcggt    150420
     gagcacgcgc ggcgtgatct gccacgagat gccccagcga tccttgcacc agccgcaggc    150480
     gctttcctgt ccgccgttgc cgatgatcgc gttccacaga cgatccgtct ccgcttggtc    150540
     gtccgtggcg atctggaacg agaaggcctc gttgtgctgg aagacgggcc cgccgttcag    150600
     gccgatgcac gggatgccag ccaccgtgaa ctcgaccgtc agcacgtcgc ctgcctttcc    150660
     cgacgggtag tcggccggcg cccggtggac ggcccccatc gcgctctctg ggaaagtctc    150720
     gacgtagaag cgggcggcag cctcggcgtc tttgtcgtac cagaggcaga tcgtgttctt    150780
     ggcgaccatg gtggctcctc cctcgcgctg ccggcgaccg ggcatcgcct tcgacccgca    150840
     tggatgctgt aacagcatga gatgaacgat agacgaagat ggccccgccg ccggcttctg    150900
     ccgggcggac gaggccatct ccacgtcggc ctctgttgat ccgggtcgtt gcccggccgc    150960
     ctcgggttct gcctcccagc cccgaagtca tgaaggcagc atgcagggca atcttgaacc    151020
     gtcagctaag aagcgcggtg aacgtccagg ccaggaacct tgacgaagcc ttgccgacct    151080
     ctcggcccta ctctgaggcc gcagccttgc gcggccggcc gcggcccttc ttcagccccg    151140
     caggcccacg tgctgaacct cgtccatgat ctcgaccaga agggcgcctc gctgcgcatc    151200
     ctcgatccgg agctgacgac gggcggcgag gtcggccgga tcgtggtgac cgtgctgggc    151260
     atggcggcgg agatggagcg caagttcatc ctggagcggc agcgggctgg gatcgaggcg    151320
     gcgaaggcgg ctggcgtcta tgcggggaag gggagggcga agaccgtgcc cgacgcggag    151380
     atccgccggc gccatgcggc cgggacgggc ccgacggcca ttgctcgcca gctcgggatc    151440
     tcgcgcacga gcgtctaccg tgcgctccga gccagggttc ccgcatgaac tcgggttggg    151500
     ctgtgattga ggcccgcgct ggctgtttcc cgttcggtgc aacgggggac gggcggcatg    151560
     atcgaaggtt aggcggtctg cttcacggcg cttgaggatc cacgcgagac cagccggtgc    151620
     gaccacctgc tcatcgacat ccttgtgatc gcagtgtgcg cagtgatcgc ctgcgccgag    151680
     agctgggagg acaatctcca ccagcgagcg cccgagccga tcgagtttcc agaccgtgag    151740
     cacgtcgtcg ggacgcagga aggccagggc cgcatcgaac ttcgggcgct tggcgcccgt    151800
     cttgccggac ttcttttctt caaagatgcg ttcgcagccg gccttggtca gcgcgtcccg    151860
     ctggaggtcg aggttccggt cctgggtgga gacgcgggcg tagccgacga gcatgtcagg    151920
     atagtgccag gttcgcgtat tcctgacagt tgttttccct acagggtttc ctgacatccg    151980
     ccggcgcgtg gcgctctcgc gtcaagcgcg tcagcgaagg cggctccaat actgtcagga    152040
     aaacggtcgg acactgttgg cgaattccgg ggggtgctgg gtgtaggctg accgtcccgc    152100
     tcggaggtcg ctcatgtcgc tccggccgca ccacccactc ccaccggtcc ctgaggacac    152160
     cgcccgggtg gcccaaaccg cgttccggcg cggcaacccc tacctgctcc tgcgcacgcg    152220
     gctcggcaca atcttcgctg atgccgcgtt cgccgacctc tatcccgcac gcggccagcc    152280
     cgcctacgcg ccctggcgct tggccctggt cacgctcttg cagtttcggg agagcatgag    152340
     cgatcgccaa gccgccgagg cggtccgggc gcggattgac tggaagtacc tgctgggact    152400
     tgatctggcc gatcccggct tcgactacag cgtcctgtgc gagttccgcg gtcggctgct    152460
     gcagcacgag gccaccgggc ggctgctggc ccgcatcctc gatgccgcgc gcgaccaggg    152520
     cgtgctcaag gcgcgcgggc gccagcgcac cgacagcacc cacgtgctcg ccgcggtgcg    152580
     cgacctcaac cgggtcgagc tgttggccga gacgctgcgg gcggctctca acgcggtcgc    152640
     ggccctcgcc cccgactggc tgcgccgtgt cgccccgccc gactggcacg agcgctacga    152700
     tcgccgcatc gaggatgcgc gactgccgga gaccggcccc aagcgcgagg cctacgtgct    152760
     gcaggtcggg gcggacggct accgcctgct cgacgcgctg gatggcgcga gcgcgccgcc    152820
     actcgctgtc gccttgcctg ccgtggccgt gctgcgccgg gtatgggcgc ggcacttcga    152880
     gcgcgcaggg gacggaagtc cacccgccgg caccagcgtc cggctgcgcc cggtgcaggg    152940
     acgcgggccc ggcgaccggg tcgagtcgcc ctacgacgtc gaggcgcggt tccgggccaa    153000
     gtctggaacg gagtggaccg gctacatggt ccacctgacc gagacctgcg accccgacct    153060
     gcctcggttg gtcgttcacg ccgacaccac tccggccaat gtgcatgagg cgatgcgcac    153120
     cggcgtgatc catgccgccc tggcgggcct ggatctgatc ccctccgagc acctggtcga    153180
     cgcggcctat atcagcgccg agcatctggt cgcggcgcac gagcggcacg gcatcgccct    153240
     gatcggcccc gcgcggtcga accagagttg gcagacgcgt gaggaggggg cgttccacgt    153300
     cacggacttc gcggtcgact gggagcgctg tcgcgtgtgc tgccccgagg gccgcgagag    153360
     tacgagttgg ggcacgtaca gggacaaggt gagcggacgc gcgttcatac gcgcaggctt    153420
     cagccccgcc gtctgccgcg tgtgtccagc caagccgcgg tgcacccggg cggggagccg    153480
     ccggctcagc ctgcatccgc gtgcggagca cgaggcgctg gcggccgcgc ggatgcggca    153540
     ggagagcgag gagggccggc agctctacgg gcagcgacaa ggcattgagg cgacgatcgc    153600
     gcagggcgtg cggagcttcg gcttgcgccg agcgcgctat cgcggactgg cgaagatgac    153660
     cctgcagagc gtggcgacgg cggccgctct caatcttgat cgtctcgccg cttggttctc    153720
     gcaccgcccg ctggccccca cgcgcacctc acgcttcgag gctctcgctg catagcggcc    153780
     gaattcgcca acagtatccg gtcgttttcc tcacagcatc aaagacatga gactgcctca    153840
     tcgatggcac cggccaaggg tgctctcaca ggccgcttcc caaaccacgg atttcatgta    153900
     aggtcagcga aaatccatga catccgagtc gcgccatgaa cgaacttggc cttacaccac    153960
     aagatgtacg agccgcccga gcgctgatcc agtggtcgca agccgaactc gcgaaggttg    154020
     ccgacgttag cgtgtcgacc atcgccgatt tcgagaaagg attgcgtacg ccgatcccca    154080
     ataatctcat cgctatccgc cgcgctttcg agagtgctgg cgtgcagttc acccccgctg    154140
     ggccgacgat cttcagcgag ctctcgctgc atatcatgac gcaggccggt gtgacggaaa    154200
     tgcggtttcg atatgcgttg gatggagctg cagccgtcca gcagattata gcgacgttcg    154260
     gttctgccga aggtgatggc gttgagttgg agccggtgca aaccgctagc cccacactca    154320
     aagcagctat cgacgcacta atccagcagc acggctccgc tgtacctcct ttgaataaac    154380
     tgaagaagat catcagctcg ctgggagata acgagtactt tcttcttctc cccgaatacc    154440
     cagctacaac cgtagaaaaa cttcgtcttg aacgctattt gcatagcctc aaccatcccg    154500
     aagatcaatc cgcggatgaa cggatcgatg atctcttcgg actattgctt gagcggtata    154560
     atatatcatc accacgcacc gatcagcgca cgctcatcgg tgcggagcgt gatccccgga    154620
     cgtgccgctt ttgtggccgc acggctgcgg gcggtgcgac cttcaagaag gcggcgcatg    154680
     tcatcccgac agcgttagga aatgatcacc tcaagtcggc cgaggagtgc gatgagtgta    154740
     atggttactt tggatgcgaa acagagccct cacttattgc aatgctcgac ctgcaacgcg    154800
     ttttcctagg cacgcaaggc agaggcaaaa acgatggaag gccgaagctc cgttttggcg    154860
     aagacatcct cctccacgac ggcgagaggg tgaatataca atcaaaatct gtcatcaagg    154920
     acgcatctga cacattcgtg gtaaacctcg gtaggggggc tccactcacc ccctcatcag    154980
     tctatcgtgc gctcgtaaag atggtcgtct cggtggtcga cgaagaagag ctgccccact    155040
     tgaaagagac gatcgagtgg gtgcgtcacg gcacgcattc cgagcgcccg ttaccgaagg    155100
     tggcttcctc cgttatccct ctaccgctca atccatcagc gcagatcaca atctacaccc    155160
     ggaggcattc gcacccgcat ctcccgcaca tcgtcggcga gtttaggctc ggatgttaca    155220
     tctatgtctt tgccgtcccg ttctcggatc aagatcagtg ggatcttgtc ggatttttcg    155280
     atgaggcaag tttccaagag accttcaagc attatttcca agcggcaaag tggatgcaac    155340
     aggacctgag ccgacaggat aaagtggtca tgtcgccgcg gctgaagttc gtgcgaaggt    155400
     cgtcctgaat acttgagccc cttctccgga atggcttacc acgaggacgc ccgcgtaatc    155460
     ggtgatgcct gtcacgtacc tacgagcgcc catcaaaact cacgaattgc gagaaggcgg    155520
     gagttaggcg ggctccatgg gccgccctta tgcgagcgac gcaggtgtga caggcgtgcg    155580
     ggagaccgct ggcgcccgat tatgatttcc tgacacgcaa tcattacagg tttaagtggc    155640
     tggaaaaccg tcgttttctt tacataccga cctgcgaacg gagcgcaggt cgcgtgtctc    155700
     gcttgggtct agatgagggc cggtgggctg ctgaggggcc ggcccgtgtt cggcgccggg    155760
     ccacattcgg tgtctcacgc caccgtctcg cccggggcat acccaaacag acatgcgtgt    155820
     cgcgttgagg ctgtgtcctg actgccgatg tgatgcgcga gcttcggagt ggcgctcggg    155880
     gctttcgggc gcggcggcgg tgggcgagag gcacgcctat cgcaggtgga attaagttgg    155940
     gatgggtacg gtatggcgtt tactacagac cgctggttcg tgccagggca aacgcatgaa    156000
     ctctgacggg cgcccggcgc tggcggtgat ggcgtaagat ggcgtgcttc cggcaggagg    156060
     cgcgccatga tcgcgggctt ggtcgagcag ttcgcgacgc cggaggatcc atgctgcccc    156120
     aagggcaatc ttggctgctc agggggtaac tcgtctcatg cgtttgccct gggttcgtgc    156180
     ggccggttgc cctggtccag gaatggctcg acgccgccgg catcacgtcg ggccccgtgt    156240
     tccggctcgt gtcgtgctcg ggcaacgtcg gacgctcctc gcgacccgct atgattggac    156300
     gttccgcatg aaccgttacg tgtcctatct ccgcgtctcc acgggccgcc agggacggag    156360
     cggcctcggt ctcgaagccc agcgcgcggc cgtcgccgcg cacgcggcag gcggccggat    156420
     cgtcgccgag ctcgtcgagg tggaaagcgg tcgtcgagcc gatcggccgg agctcggccg    156480
     cgcacaccgc gcgacgctcg tcgtcgcgaa gctcgaccgc ctggctcggg acgcgcactt    156540
     cctgctcggc ctccacaagg ccggcgtcga cttcgtggcg tgcgacatgc cgtccgcgaa    156600
     ccggctgacc gtcggcatca tggcgctggt tgcggaggag gaggcaacgc tcatctccgc    156660
     ccggacgaag gcagccctgg cggccgccaa ggcgcggggg gtcaagctgg ggggcttccg    156720
     cggccgcgcc gggaccgcgc gggagatcgc gatcgcgaac gccgcccgga acgcgaaggc    156780
     ggacgccttc gcagcgaact tggctcccgt cctcggccgg ctggatccgg acggccgtct    156840
     cttgcttcgc gagctcgcgg cggccctgga cgcggaggag atcccgaccg cgaccggccg    156900
     cggccgctgg acggccgccg gcgtccggcg ggtgcgcgca cgcctggcgg cgctcgaggc    156960
     gccgatcgag ccggtccggc tggcggcttg accatgaagg gcgccatcat cggcctggcg    157020
     gccgcgctcg tcgtcgcctc cccggccgcg gccgggaagc tgtaccgctg caccggccgg    157080
     gacgtcgtcg cggctgagga ggacggcacg gttggtcgaa ccaaccgtga cttctggctc    157140
     ggctattatc gaagcttctt cgtcgacacg gacacaggct ccatccggtg gagcagtggc    157200
     aagctcgagg agtggctcgt cactcagaag ggtggctcct cgaacgactt cgtcgcgacg    157260
     cctcgatcgt cgcttagtgg agcgtcgacc gacttcatcc gtgttaccgg atgggagcgc    157320
     cggccaagcg tcaccttcct cgtgttccgc ctgtcgatga tgatcaccgg gacctgcgag    157380
     gtcgcccaat aggggctctc caggatcgaa aatttccgat cgcccccctt gccgacggac    157440
     ggtcgaacgg gcatgtaacc cccatgcact cccaccgtgc ttgtcgcggt ggacaggccg    157500
     tagccctccg gggttgcggc cttttcgctt ttcagggcct acggaatgcg ccgcgtcatc    157560
     gcttacgtcg acgggttcaa cctctaccac gcgattgacg atctccagaa accgcacctg    157620
     aagtggctcg acctatggca gttggcgcaa agcatctgcg gcaccggtga gaccctgatc    157680
     gaggtcaact tcttcaccgc ctacccgact tggaagccgg gaccgatgaa gcgccatcag    157740
     gtgtacgtga aggcgctccg tcacgccggg gtgaattgcg tcatcgggca cttcaagacg    157800
     aagcagcgtg agtgcaagcg ctgcggcgcc cagggggacg tccacgagga aaaggagacc    157860
     gacgtcgcga tcgccgtgca gatcacaacc gacgccttcc tcgacgggta cgatcgcgcg    157920
     ctcatcatca gcgccgactc ggacctcgct ccggctctcc ggaccgtccg acagcacttc    157980
     ccacggaagg cgctcaacgt gatcgctccg ccgggccgga agggccacgc gcgagacctt    158040
     cagccgctct tcgagatcac agccggccgt ctggcgaagt gcctcctgcc ggcgaccgcc    158100
     acggctgagg acggcaccgt gattttcacc cggccgccgt cgtacgatcc gccagtctag    158160
     gctgagacga gccgggtcgg gcctaagagg ccgacccggc ggcatcacgg cggagcggcc    158220
     cctcactcgc cgacggcact cgacgcgacc gcgcgagtca gccttgctgc gcgaggacgg    158280
     ctcgaggggg gaacggcatg gcagagacgg gcaatctgag cggcgccgag ggcgtcctgg    158340
     tccaggtcct cggcgtcctg acgcagaccg ctgccgccga ggatcccgag gtcgcagacc    158400
     ggctccgcca ggtgctcgcg aaggccgccc aggattgctt cgtcggcgga gacacaggcg    158460
     gcctcgacgc ggttgtcgag ctccgccgcg ccctgccctc cgttgctgat cctgatgatc    158520
     gagccgccgt ccggcgggcg cccgcgaagc ggctctcgaa acgacggagc ccgctcgacg    158580
     gcccatcggc cggagcgggc tcctagaata gggagcggga ttcgaacccg cgaagcctct    158640
     gacgaggccc actccgtttt cagcggagcg caatcgaccg ctctgccatc cctccgtaag    158700
     gatcttcatc atagccggat ccgaccagct tcgcaatttt ccgattgcgt taggacctcg    158760
     ttaccgaatc accggcgacc gttcgcacag ctgagcggtc gcccgaccgc gctccctttc    158820
     gcacgcccga tcaacgggag gggtgcacgg tgtccgatca ccagatgatg acctatgccg    158880
     agttcggcga ggcgatcggc cgctctgcgg ccgctgcgcg ggcgatctgc gtccgcaagc    158940
     ggtggaagcg gatcgtcggc aatgacggga aggcgaagat cgccatcccg ctcgaggttc    159000
     tcgagaagcc gcgtaagccc cgaccgaacg cccgaccggt cgacccaccg gtcgatgatg    159060
     cggacgggca gccggtcgag cgtgcggatg cccgatcggt cgacagtgcg gtcgagagtg    159120
     cggacaccct gaccgtcgtc gccatcctcc gcgaacaggt tgcgcgcctc gaggaggacc    159180
     tcgagcggac caggacagac ctcgacgagg cccgggcggc gctcgaggcg gagcgggtcc    159240
     gcgcggcaca ggtcgaggtc ctgaccgtcc tcctcgagat cgagaggaag cgcgccgagg    159300
     aggcgcagga ggccggagct cgccgtgtcg aagaggtcca ggaggccagc aaccgccgta    159360
     tcgaggacct gaaggcggag cgggaccgct gggccgctca ggctgagcgc ctggcgacgc    159420
     cggcgccgcc ggagcggcgc ggcttcttcg gctggctcag gcgggcctga aagctactcg    159480
     tccgcttctt cggcttcgat gggctgtata ccaacatagt cgaggagcat ccggccaagc    159540
     tctgtgatgt ccaacgatcc ttccgccgga tctcgagtgt cgttcatcgg tctatctaac    159600
     atagattcac tactcttcaa aagtccgagt gtcattagtt cctttctgag aagtgtaaac    159660
     atggcgtatt tgcgccaatc aacgccgttt tttgtcatat aagcatattc tggatacaat    159720
     atatttacgt gcagcgctct aaaatcattg aactcgtcat ctgaaaatct ttttccaagg    159780
     ctagcttttt tccaaggcta gctaaaataa ttagatggtc atcctctact gagctgagaa    159840
     gacgaagtat acgttttgct tctgtccggc cacgctcgtc gctagtcaag cctcgcgcga    159900
     cgatccgagc gatccgctcc cgacgctcat ccgagagcgc acgggccgac tggaaggcac    159960
     catcctcgaa gaggtcgacg ttctccgggt tctcgaatgt cttacggagt gcatcgggct    160020
     cgagcgcctg aaggcgctcg ccgagatgcc gagcgtaggt ttcgagcctc tctgcccgct    160080
     ggttcgggat cgtcatcgtg acgagctcgc cgatcacgga gccgaccacg gggatcaagc    160140
     cgagcgcacc acgcgcgagg gcgacgtctc ggtctcgtgc agtctcgccc agcgggaacg    160200
     cctcttccgg ttccttcgac atggcttcgc tcctcatcgc gccaggtatg tagatcacca    160260
     agccgggaag cgctcctcga gcaggtcgcg gattacatcg gccattcgct gatcgttctc    160320
     cgcgcagtag atccggattc gccggtgcaa ggcttctggg atgtcgaagg tcagtcgccg    160380
     catcacctcc accgccggcg cgtggccgct cgcggcggcc gtcggcaggc catcgagcgt    160440
     cgtctgcgcc ggttccgcaa gccgcactgc ggctcggtgc gcgtcgacga aacggacatc    160500
     cgcatccggg ggcagtggcg ctccctggac cgggccatcg acaagcccgg tgaggcggtc    160560
     gacttcctgc tcacggccaa ccgcgaccgc gatgccgcca agcgcttctt ccgcacgatg    160620
     ctgcagaagg agccgctgcg cgcccccgac cggatcggca cggatggcgc tggtccttac    160680
     ccgccggcga tcgccgagag ccgcaaggcg ggcctgctgc cgcgcacgcc catccaccac    160740
     gtcagcaagc ccctgcagca agggatcgcg agcgacccct tccgggtgaa gcggccgatg    160800
     ccgcgggggg cgggttccgc tccgtccgca cggcccggcg cacgatccag ggcgtcaaag    160860
     ccatgcggtg gctgcgcaag ggcttcgggt ttgcgggggc ctggaccgtg cgggagcaga    160920
     accagctgct cgcccactgc ttcggacttc ccgtcgcgaa caaagcgtga aagcggggta    160980
     gccgagcccc ttctgcggcc cgagcccgag tttgcgacaa gcccgtttct gaggcctgag    161040
     gagcgctcga cgcctcgtga aggggagcgc gggaagctcg gcgtcgcctg ataacgtcgg    161100
     ttggagccgg cttgtctccc ctgcggactt ggctgaaagg cgcggtgacc gcaggcgaga    161160
     cgcaccaggc gatcgaagcg gccttttctg aggcgccgct cggcaaatca gaagccgccg    161220
     gtccgctccc gaccaactcc gatccatcgg tgagcgtctg ccgaaggtct gagacgggtg    161280
     gcatgcaggg caaccgcatg aactctgacg ggcgcccggc gctggcggtg atggcgtcag    161340
     atggcgcgct tccggcagga ggcgcgccat gatcgagggc ttggtcgagc cgttcgcgac    161400
     gcgggaggat ccacgccgcc ccggcaagat cgagcaccgg ctgggggaca tcctggtgat    161460
     cgcggtctgc gctcggggcc gaggccgagc cgttcgagga cagcgctctc tccggccgct    161520
     gcacggaggc gtggctgcgc ggcgtcctgg agctgcccgg cggcatcccc tcgcacgaca    161580
     cggttcgccg cgtggtcatg ctgatcgacc cggacgggtt cgagcgcggc tgcctggcct    161640
     gggggcgagg agcgttccgg tccgatgcgg acagtgcagc cgccggacct gaacaggtcg    161700
     ccgtggatgg caaggtgatc cgtcggtcct tcgaccgcgg ccgctcgccc ttgcacctgg    161760
     tcagcgccga cgcgaccgga cgcgggctgg tgctggccca gcgcgccgtg gaccagaaag    161820
     gcggtgagcc cgcggccgtg ctggaggggc tgcagcttga cggctgccgg gcctggacgc    161880
     gcgctcgtgt cggcgcgagg tggccagcca gattctggca cgcggggccg cctacctgct    161940
     gacgctcaag gccaatcagg gcaaggtcca cgaacgaggt ccgggcctgg tgtgccgcgc    162000
     acgccttcgc ccgcggggcc gtccggcggc cctgttccga cgcgtgcgac gacacccctg    162060
     gtcgtctggt acgccggcgc gtcttcgcct gtcgggacgt gagctgcttg gccacgctgc    162120
     gcacctggcc ggggctgacg acggtgctcg cgaccgagac cctccgcggc gggaatggca    162180
     ccgacagcgt gccggcgcag gtccgccact ccctcggcag ctcgaccgcg ccgtccgagg    162240
     tgctggccca ggcgatccgg cgccacgggg ccctcgcgac cggcgagccc tgggtcttgg    162300
     aggtgagctt cggcgaggag cgcagccgcg tgcgcgagcg ctgtgcggcg cgccacctcg    162360
     cgctcctgcg ccgcgtcgcc cttgatcggc ggcgcgccga cgcctcgctc acggccagcc    162420
     ggccggcgca agaccgcggc ctgggacgac gccggcatgg cccagctgct cagggctaac    162480
     tcgtctcatg cgtttgccct gagggctgtc ctgccaccgc gctccgactg gcccgtactc    162540
     gatccagcgc caatggctgg cgggcgggct gccgggcccg cggtgggtcg cctcgcgggc    162600
     ttggtcctct tcgtaggcgg cgagccggta ggcccgctgg cgctcattga gctccgtcgc    162660
     aatggcctgg agcttcgctg cggtcgccgt cggacggttc tagtggtcaa aacctgacgc    162720
     ttggtaccca ctcgcgaggt ccgctacggg tggattctgt tgaaaactcg gctgttgcgc    162780
     cggcagtttt ggggtgattc actcccgttg agagacgggg attgaagcag atgatgggac    162840
     cgcggcaagt cgagcaaggt gccctgttct acgagttctc gctcgatacc cacgtcccag    162900
     ccgaccatct gctgcgcgcc atcgaccgct tcgtcgacct gaccggactg cgccaggacc    162960
     tctctccctt ctacgcctcg acgggccgcg cttctgtcga ccccgagttg atgatccgca    163020
     tgctgatcat cggctacggc cgtggcatcc gctccgagcg ccggctcggc gacgaggtcc    163080
     acctcaacct cgcctagcgt tggttctgcc ggctcggcct ggacgggcgc gtgcccgacc    163140
     attccacctt ctccaagaac cgccacggcc gcttccgcga cagcgacctc ctgcgccgcc    163200
     tgttcgcgcg cgtgttggcc cgctgcatcg cggaagggct cgtgggcggg gaaggctttg    163260
     cggtggatgg ccgcctgatc caggccgacg ccagtcggca gaagggcgtc gagggatccg    163320
     ccggcctgcc gcccgaggcc gtgagccggg ccgctcagga gtacctggcc gtgctcgacg    163380
     cggcggcctt cggggctgcc acaccagtgc cgcccaagtt cctctcaccc gctgatccgg    163440
     ccgcccgctg gaccggtgcc catggcgggc tggccttcct acacggccaa tgacctggtc    163500
     gatctcgacc acgcgatcat cgttgatgtc gaggcgacca ctgccatccg gcaggccgag    163560
     gtcacggccg ccaagcgcat gatcgagcgt tcgcgcgcga gcttcgacct ctatccggcc    163620
     cggcttgccg gcgacagcgg ctctggctcg gccgagatgc tgggctggct cgtctccgag    163680
     cagggcatcg cgccgcacat cagcgtgttc gacaagtcgg agcgcacgga tggcaccttc    163740
     tcgcgcgccg acttcagcta cgaccagccc ggcgatgtct accgctgccc ggcgggcaag    163800
     atgctgacca cgccgggcag ccgggtcaac ggcggggcga cgctcttgga tcgggcgagc    163860
     acgttcgact gcatggcgtg cccgttgaag gcgcgatgct gcccgaacgg gccggtgcgc    163920
     aagatcccac gctcgatctc cgagggggcg cgagacatgg cgcgcgacat tgcgcgatct    163980
     gacgagggca agacgtcgcg gcgtgagcgc aagaaggtcg agatgctgtt tgcccacctc    164040
     aaacgcatcc tgaagctgga tcggctccgg ctgcgcggcc caaacggagc ccgcgacgaa    164100
     ttccatctgg ccgcaacggc tcagaacctc aggaagctcg ccaagctcat cccggttccg    164160
     cagccgagcc cggcttgagc gccagggggt acccggttcc tcacgggggt tgctccttgc    164220
     ggctcccgcc gatcgagttc gaccgcgagt ttttcaacga aatcgggtga tgagcagcca    164280
     ttccgatggc actcatcgaa ggtcgcttcg tggcgcgtag ccgaacaagt cagctttgac    164340
     catacggctt ataccaagcc tcgttgatcg agactcacgc aggctggcgg tggggtcctc    164400
     aactatgatt ctgtcctcgg gtttgaagcg cgaggaggct ggattggccg ctcccgttcc    164460
     gctgcggtcg gactttgacg ccgcggctct gcgtcgtttg gccagagcgt cgcgcgatcc    164520
     ggctcaaacc cgccgtctgc tggcgctgtc ggcgatcgac gcgggcgggt cacgcacgca    164580
     ggccgccgcg ctcggcgggg tcgggctgca gacggggcgc gactgggtgc tggccttcaa    164640
     cgcagacggc ccggacgggc tgatcgacgc caaggccccc ggtgcgcgcc cgcgcctgaa    164700
     cgcccggcag cgggaggcgc tgcgcgcctt ggtcgagcag gagcccatgc ccgccatcca    164760
     tggtgtcgtg cgctggcggc tggtcgatct ggtccagatc ctgttcgagg accacggcgt    164820
     ctcggtctcc caacagacgc tgagccgggt tcagcgcggc atgggctatc ggaagctctc    164880
     ggcccgtccc cgccatcacg cccaggatcc gcaggccacc gccgcgttta aaaagccttc    164940
     cccgcccgct gggcgcagat cgcgcaggcc acaggcggca agccgataga gatctggttt    165000
     gccgacgagg cccgcgtcgg ccagacgaac accatcccgc ggcgctgggc gcgccgcggc    165060
     acacgcccct cggctccgaa ggaccagcgc acggcctccg cctccctgtt cggggcgatc    165120
     tgcccggccc gtggcacggg agccgggctc gtcatgcccc gctgcaccac cgaagcgatg    165180
     aacctgcacc tggctgagat cgccaaggcc gtcgcgccgg gcgcgcacgc cgtccggctg    165240
     ctcgatcagg ccggctggca cacgaccaga caactcgtgg tccctgccaa catcaccctg    165300
     ctgccgctgc cagcgcgctc gcctgaactc aacccagtgg agaacatctg gcagtttata    165360
     cgcgagaact ggctcggcaa ccggatcttc gcctcctccg acgccatcct cgatcactgc    165420
     tgccatgcct ggaacaggct catcgaccag ccctggcgca tcatctccat cggcttgcgc    165480
     gcctgggccc atgggttctg atcaatgaga gttggtatta gcctcatccc agtcattcga    165540
     tcgcggaacg acgctcttga aacgccagat acaaagcggc cactgcagtc cttctcggga    165600
     tcgaacacgt tattgaaaaa gttcgtcagg gagtacatgg ccaccagcgc gacgatctcc    165660
     atgacgttcg catccgtgta gccggcatcg cagacggctt tcacatcggc gtccctgacc    165720
     tggccgcgag tctcgatcac tttgcgcgca aactggacgg cggcgtcccg cttcgggtcg    165780
     ctggcacggc cctttcgagc gagaatgatt tcatcggcag gcatcttgac cagctcggcc    165840
     ccatggctgt gaaccccaag gcagtagttg cagccattca cttcagaaac ggcgagactg    165900
     atgctctcgc gcgtctttaa gtctaacgac ttgctcaagg agccacgcag ggtggcccat    165960
     gcgttgaacg cgatcgggct ctgcgcgaag gtcgccaaca tatttggggt gaacccgatg    166020
     ttattggtaa acatatcgag ggcccgcttc gaatcggccg acacttgttc cgggtttggc    166080
     actgctgttc ttggcataga agtctcttta agtgtgggat ttccctaata attactcacg    166140
     acttcgaacg ttgagccatg ggccttgtac agacgccaag agaagggaaa gtgacgcagc    166200
     cagcagaaca aggtctttaa gaagaaactg gcctggcgcc gctgagatcg ctggaaaacc    166260
     gcctgccgtc ccttctgcta cgccaggggt gctcaagaag aaggtgagcg taataagata    166320
     ggtcgcagcg gacatcgctg ctcccaatgc ggaaaaaatg ggctgaacgg ccccgaggat    166380
     aagagcagcg gcggtcgaca gttcgattac gccgatgacg tagcttgccc cttgagctcc    166440
     gaacagggcg tgcaaccagc tcatgatcgg actgtgttca atgaacggcg cgataccggc    166500
     tgcttcgtat gcggtgaact tcattccgcc gaaccaaaga aagataacga ccaaagccca    166560
     tctaagcagc gccaggaagt tgagagagcc agcgcctctt tcagcgatta gaagacgaat    166620
     cgggttggtc atttgcaatc tctttttgag ttgagtgtgc cttcggcgga aatgcagtct    166680
     caccgccctt ccctcgtagc ggctcgcgga tcttgcacgg tgcaagcctt cgacccttgg    166740
     cggggtcgat tgcgtctagg ggattattta atgggcgtgg tcagtgcttt gtcattggcg    166800
     tcgaggacaa agacagcgag tagctttgcc ggctcggtct tgctcgcgtt gcggctgatc    166860
     gagtgggtcg cgcccggcgg ttccgaccag ctctcacctg cccgatagat gcgcgtctcg    166920
     ccgtcattca ccttcgactc gatcgagccc gagatcacat aggcgtagat gaaagccgac    166980
     ttcgcgtggg tatggggcgc agaggctgcg ccgggcgcgt aatcgacttc cacggcgatt    167040
     ggcgacctgc cggggatatt gggaatggcc gcctcgaagt tcttcgtgac ggtttgccct    167100
     tcgccatcac gggccaaggc ggcgccggca atcgagatgg cgagggcggt gcacgcggcg    167160
     gcaatgatgg ttcggaactt catgagtttt ctccttctgc tcacgggtcg gttttcaggc    167220
     ttcgtgccgc cgtcacttgc agctcgcgct gcaccgctgg acgcccgaag tcacggttga    167280
     ggtcggcgca tttcggcagg gccggcctcg cgggcccagc acctatgacc cgatgggttt    167340
     cacaccatac ttttgatggt aggtgtccct gatctcgtcc tgactccgag gagggcgggc    167400
     aaagatttgg gccggcgaca gcagcgggat gatcgaagtg gtttcgattt tgactatgtg    167460
     atcaacaggg tactcggggc cgttcgtcgc ccgaacccgg ttggcgatca tcagatactc    167520
     gtcatcgcct ggcggtagta ccaacgcacg gcccttgaat cgataaccgc gtctctgaaa    167580
     gatatcgacc acgttaattt cgatggcggg attgcgcccc aggttcagta tcgtctgggg    167640
     cgatgcgata tcggcgaagt agagaatacc gttcgtgacc gtcaaagacg ccttcggcga    167700
     aagattgggc gttccgtcct cgttgactgt cgcaacgaac gacagtatcg cctgcttgat    167760
     gatcgcatgc atgtcggcag tgatttcaat catagatacc ctcgcttcgt tctttgcaga    167820
     ccctctagct cgctgtcact tccagcccgc gctgcactgc cggacgcgct acgccacggt    167880
     cgagccacgc ctgcacatga agaaaacggc cgaagccgac gagctcgcgg gcttcgtaaa    167940
     agccgatcag gttgcgcacc cagccgagca gggaaatatc agcgatgcta tagtcggcgc    168000
     ccatcaccca ttcgcgtccc gcgagccgtt cgtcgaggac accgagcagc cgcgcagatt    168060
     ccgttgcgta gcggtcgcgc gggcgcttgt cctcatacgc cttgccggcg aatttgttga    168120
     agaaaccgac ctgaccgaac atcggcccga caccgcccat ctgccacatc acccactgga    168180
     tcgtttcgta gcgggtgttc ggatcggccg agataaactg tcccgtcttg tcggcgagat    168240
     agaggaggat cgcgcccgat tcgaacagcg cgagcggctt gccgctcggc ccatcgggat    168300
     cgtagatggc gggaatcttg ccgttggggt tgagcgcgag aaaggccggg tcgtggtttt    168360
     cggccgccat gatgtcgatc cgatgcggct cataggcgag gcccgtttcc tccagcatga    168420
     tgccgacctt tacgccgtta ggcgtcggca gagaaaagag ctggagccga tcagggtact    168480
     gcgccggcca acgctcgaaa attggatgat tgagcgtcac tttctccctc ctaagtgatg    168540
     gcgcatctca gcggccggcg ctttgcccac cgtcgacgtg cagaatctct ccggtgatga    168600
     acggtgcaga gtcgagaaac aggatggcgt tggcgatatc gcttgtttca cccatgcgtc    168660
     cgataggctg gaaggcgctg agcgcttcgt gattttcagg cgcgtgcatc ggcgtcttta    168720
     tgttccccgg agcaacggcg ttcacgcgaa tgcccttctt cgcgtactcg atcgcctgtg    168780
     acttcgtggc agcgttgagg ccgcccttgg tcatagccgc caagaccgag tagatcccgc    168840
     tgattgcaac ttggtctatg ctggtcgtga cgctcaccac gtggccgctc gaatgctttt    168900
     ccatctcggc gatcgcgagt tgcgtgatgt aatagaagcc cgccatgttc acattcatca    168960
     cggcggcgta gtcttcggcg gtgtgttcgg tgaaaggctt tccgatgtag atgccggcgt    169020
     tgttcaccag cgtatcgatc cggccaaatc gcgagacgcc ttcggaaatt acacgttggg    169080
     ccgttgtggg atcgccgatg tcaccgacga tactgaggat gttctcgtcg tcagactgct    169140
     tgatcgaacg tgaggtgacg acaatgcggt aatcgagctt tcggaatgcc tttacgactt    169200
     ccgcgccgat gccttgtgac gcaccggtaa cgacaacgac cttctgtgac ttgttcatgc    169260
     tcacgccttg ggaaatacag tgtcctgacc ttgccggcac gtacgaaagc ccagacgcgt    169320
     tcccaagaat ccgggcgcac ctgggctttc gcgttacact cgcatcacat gaaacctctc    169380
     accttcggag accgtctatg cgaccggtta gagttcagat cgagccagcc ggcgtaacgg    169440
     cgggaaagtc ctgctcggga tcgaacacgt tattgaaaaa gttcgtcagg gagtacatgg    169500
     ccaccagcgc gacgatctcc atgacgttcg catctgtgta gccgacatcg cggacggctt    169560
     tcacatcggc gtcactgacc ttgccacggg tctcgatgac tttgcgcgca aattggaggg    169620
     cggcatcgcg cttcggatca ctggcatgac ccttccgagc aagaatgatt tcattggccg    169680
     gcagcttggc catatgctcg gccgtgaagc tgtgaaccgt caggcagtag ttgcacccat    169740
     tcacttcgga aacagcaagg ccgatgctgt cacgcgtctt cacgtcgagc gccttgctca    169800
     aagagccgag caaggtggcc cacgcgttga acgcgatcgg gctctgcgcg aaggtcgcca    169860
     tcatatttgg ggtgaacccg atgttcttgg tgaacgcatc gagagtcggc ctcgaatcgg    169920
     ccggcacctg ttccggattc agagctgtgg ttctggccat cacgtaatct ccctaagtaa    169980
     ctggtttagc gatcaattag acaagctgca gtacatcggc caccggacgg cggggcttct    170040
     gcggccagtt gcccggacac tccgcgccca cggacaacag catcacggga acttcgtcct    170100
     cggccagtcc gaactcgcgg tgcaccgctt tgtcatcgaa accgatcatc ggcgtcgaac    170160
     ccaggcccca tgagcgggcc acatagatca tcgccgccgc gccgaaggtg gcggtgcgta    170220
     ctgcttcatc gcgctggcgc tgcgggaaat cctgatacag accgcgtgcg ggaatttccc    170280
     aatccggcac caagtttgcc ggcatgatgc ccgcttccac cactggggct gggcgctctg    170340
     gtattacgtt ggaatcggct aactggccgc agatgatgaa ggtaacggct gcttcggtga    170400
     tcgcgggctg attccaggcg atcggacgta gccgagcctt ggcttcaggc gtgcgtacgg    170460
     cgatgaagcg ccagttctgc aagtggaagg atgtcggcgc tgtggtgccg attcgcacca    170520
     actcgcggat ttggtcgtcg ctcaaggtgg tggcagggtc gtaatacttg gtgctgctgc    170580
     ggctcaggat acattcgatg acagcgttgg tcatggttag tcctatgcgt gaaggaataa    170640
     ggttgaggta cgagagtgct ttcgctctct ttgctggaga tgctgcaggg atggagcccg    170700
     ttcgacatct catgccaggg gccatgggta gtttcccagg ttgcccccga cggatctgat    170760
     aggacgcagc cggccgatct ggacagcgcc ggccggccgc gtgcatcgaa aggtgcgtgt    170820
     cgctcactga cgaacgcgga tgattgtctt ccccctgcgt cgctcggtcg ggtttaaggc    170880
     ggcgagggca tcgtcgaggg ttgagacgtt gccgatgttc gtccgcagtc gtccgtcccg    170940
     cacccgctgg acgatctcac tcagttgggc gcgatcggac tcgacaacga agtcgaccgt    171000
     caggccgtcg gcgggccgcg cctcgggcgg cccgacgata gacaccagtg ttcctccagc    171060
     tcgaatcagg cgtgcggacc gcttgccgat gtcgccgccg atgacatcga acaccagatc    171120
     gacgccgccg acgtcttcca gcgcgtcgtt gtcgaggtcg acgaactcct gtgcgccgaa    171180
     gtcgagcgcc ttctgacggt cggccgcgcg tccggtgccg atgacatatg caccggcctc    171240
     gcgcgcgaat tgcgtcacca tcgtcccgac tgcgcctgcc gcgccgtgcg cgaggacgct    171300
     ctgccccgcc tgaaggcggc cgtgctggaa cagtccctgc cacgcggtga ggcccgagat    171360
     tggcaggctc gcgcccaccg tgaaatcgac gtcgcccggg agcggcgcga ggttgcgtgc    171420
     ctctatggct acatactccg ccagggtacc gtcgcgatac cagtcggcga ggccgaacac    171480
     tcgctgtcct accgacaggc ccgtcgtgcc gtagccgaga gcagtgacaa ctccggccag    171540
     ctcgtggccg gggatcgacg gtgttcgatc acggttacgg cgatcggtcc aggtcgaggg    171600
     ccactccatc tcggtcggga cgaatcccga tgcatgaatc tgaacgatga cgtcgtttat    171660
     cgctgccggc ggctcgggcc gctcggtcag cttcatcccg gccaatcccg cggcctggtc    171720
     cgttaccatg attgccttca tcgtccacct gcttgtgtgt ggtagctcgt catcttccga    171780
     attcctttgc agacgggcca aaataggaag cacgcgtgaa gttcagcgtg cttgtaaccg    171840
     ctcgaaagta ccgaacctgg tggagatcta ttggatgttc accgtcaact attcctgcca    171900
     ctactgagca cgtgtgatgg cgatgccgca tcacgcggcg cgcagaagcg ctacatctga    171960
     aaaccacgtt gccaccggtg ccggcgcgat gaaacccgcg tcaggcgtcc ctggacgagc    172020
     ggacacgcat tgtggactcc agagctggcc agcgcaggat cagtgcgcca accgtgcacg    172080
     aagctggctg aggaccggca agagctcggt tgggtcgcag cgtcgggcgt gcacgagctc    172140
     acgcggcttg ctttcggcct ttgctgtttc cagttttttc ttccgccagg cagagagctc    172200
     agccaacgct gaaatcatga cgtacagttt caacagatga gcggatgtcg ccagcggcat    172260
     gcccttttaa aatcgcatgc ctgacgggag agatgccccg gagcgcggtg tttggttcaa    172320
     gcgcccttat caccctcacc attcttcacg cgctgccggt actcgctagg atcaacgttg    172380
     taggctttgc ggaatgctcg cacgaagctt gaccggcttt cgtagccggc gttgtaggcc    172440
     acaacgtcga ctggggctga cgtcgtcgtg agatcaagcg cggcctgccg catcctgagg    172500
     tcgcgaagga tgcccatcgg cgaacggccg aagatctccg agaaccgcgc catgaatgcc    172560
     gaccggctca gacccgcgct gtgcgccagg ctccgaaccg tatgggcggc ccccggacgc    172620
     gccaccatgt cggcgaatgc gcgcgtgatc tgccggtccg cgagaatcga aaaccgatca    172680
     gtccagctgc gggaggactt catcgaccgc ctcaccaggg cgacgatgac ctgctttagc    172740
     agggaagccg tcatggcgcc catgccaatt tcctgcgcgc aaagctcctc gatcgcttcg    172800
     cgaagcttca ggtcgatctt gtccgtcggc tcgaatttct cgaccacggg ctcatgcaat    172860
     tcgcgaaaca atccgacgga ttgtccgaag gatgcgttga agaagccgca gatctggatg    172920
     acctcgggct gctcggtcgg cattccgatg cgcaacacgc cgtcatgccg cttccagcaa    172980
     tcgcgggaga tgagcctctt cgggccgctg gctccgtcga cttcgatcgc gaacggggta    173040
     ttcggaggct tgatgatgag cagatggggc tcgagcgaca tcgaaggccc attgccgatc    173100
     gagattcgtc ccctgccact gattgtgtaa tggatcgcgg gcgcgtcgat cgtccccatc    173160
     tcggcacgat agcctgatgg aatcagcatc tcggtgagcg cgatgacatc gatctcaagt    173220
     gcctgcatca ggttgttgag gtcggcggtg gcgagcttcg tggcagagac ggcgatcatc    173280
     gaatcggtcc cctccccctg tccgcttccg gccggcgatt tggtcgtgtt ttgcatagca    173340
     acctgcttac aagatcaaac cgtgaatctg gtagtcgaat catgtcttca ttgcttgaac    173400
     tggatcttag ggcacgccga aaggactctc tgctgcggcc ggtcggttag atatgcaggt    173460
     cgatctgagg gcgggagggt gcgctagagc ggggtccgag cgggttgaaa ccgtggtgat    173520
     ggcaacgcgt tggccggtcc ccgggggggc ggctcaacgg aggtggccca tgccctcagc    173580
     tttgtctgtc gacctgcgcc agcgcgtcgt ctcggccgtt gcagaaggcg cctcctgcca    173640
     tcaggccgcc gcgcgcttcg gggtcagcgt ggccagcgtc agccgctggt ccaggcagca    173700
     ggagggccag ggagatgtca cgcccaagcc catgggcggc gaccagcgct cgcagcgcat    173760
     cgaggctcat gccgagctca tcctgcagac ctaccaagcc cacccgcaga gcttcctgca    173820
     tgagctctgc gagacgctcc aggagcaagg cgttccggtc agccgcagta gcctgtcgcg    173880
     cttcttcgcc cggcaccgca tcacgcggaa aaaagggcga cgtacgcagc tgagcaggag    173940
     cgggaggatg taaaggcggc tcgtgaggcg tggtttgccg gccagcttga gctggatccg    174000
     gagcgactgg tgttcctgga tgagaccgcc gccaccacca gcatggtccg ccgctacggc    174060
     tgggccccgc gcggcgagcg ttgccgcctc gcggcacccg cagggcactg gaaaaccacc    174120
     actgtgattg ccgggctgcg cacgagcggg cctgacgcga tcgctctgct ggacggccct    174180
     gtgacgggcg aacgcttccg cgcctacgtg accgacaccc tggtccccac cctgagaccc    174240
     ggcgacaccg tgatcctgga caatctgggc gctcacaagg tggccggcgt gcgcgaggcg    174300
     atcgcggcaa ccggggcccg gctgctttat cttcctccgt actcacctga gttcaacccg    174360
     attgagcagg ccttcgccaa gctgaaagcg ctgttgcgca gggcggcggc ccgcagtgtc    174420
     agtgaactct gggcggcgat ccaccaagcc ttcaaatgct tctcgccggc tgagtgccgc    174480
     aactacttca cagctgctgg atacgaggat gatgcttacg cttcaacctg atcgggagcg    174540
     gctctaggag cccgtccgag taagtacctc gacggcggcg ctttgggatg attcactcgg    174600
     ctcatggcca aggtgtttcg ctcctgggac gtcgatcagg gctggctgct gccaccctcg    174660
     ctgcatgagt tcgtgccgcc cgggcacatg gcgcacttcg tgcgcgatac ggtgcgcgag    174720
     gcgctcgacc tctcagccat tctcgacacc tacaccgagg agcgcggcta cccgccctac    174780
     catcccggca tgatggtggc cctgctcctc tacggctaca gccgcggtct gtactcgtcg    174840
     cgtcagctcg cccgcgcctg cgaggagcgg gttgacttca tggccgtgac cggcctgaac    174900
     cggcccgact tccgcaccat cgctgacttc cgcaagcggc atctgacggc gctctcggac    174960
     ctgttcgtgc aggtgctgcg gctgtgccgg gcggccgggc tggtcggctt tgcccacgtg    175020
     gcggtggacg gcaccaagct gaaggccaac gcctcgcgcc acaaggcgat gagctacggc    175080
     cggatgaagg cggccgagtc gacgctggcc gccgaggtcg aggcttggct ggatcaagcg    175140
     cgcgaggccg acgcggcgga ggatcgggct catgggaccg accatcgtgg cgacgagaca    175200
     ccggcctgga tggccgacaa gcagcggcgg ctggagacga tccgcgccgc caaggccgcg    175260
     ttggaggcag aggctgccga tccgcccgat ccggaggacg aggacgggcc gggggcctcg    175320
     tcgggcatgc gctggcaagg tcggcccttg cggggcgagg acggcggtcc gcccgaccgg    175380
     gcgcagcgca acttcaccga cccggacagc cgcatcctgc ccacgcgcga cgggttcgtg    175440
     cagggctaca acggccagat tgcggttgat gcggcccatc aggtgatcgt cgcgcatcgg    175500
     ctcgtgacga accccgccga ctcgcgcgct ctcgtgccgc tcgtcgacgg cgtctgcacc    175560
     catctcgggc gcaagccgcg ggaggtctcc ggagatgccg gctttgccac cgaggcgaac    175620
     ctggccgcgc tgcaggagcg acggatcaca gcctatctcg ctccgggccg tgcccgtcac    175680
     ggcgaggcgg atgcagcagg tcgccggagg ctgacgaaga tgcccctgat gagcgcgatg    175740
     gccgtccgcc tgaagcgggc tgggcgccgg agccgttacc gtctcaggaa gcaggtcgtc    175800
     gagccggtgt tcgggcagat caagcaggcc agaggcttcc gacagttcct gctacgtggg    175860
     ctcgatcagg tccgcggcga gtgggcgatg atctgcaccg cccataacct cctgaagctg    175920
     gcgcaggccg cgcgctgagc ctgtggcgca ggagccatcc gcccagatct caaccttagt    175980
     cccaacgcat caaaccgtta ctcggacggg ctcctagtgt gggtaattgc ggtttggttg    176040
     ctcatgaggg gctcctgtcc gagacggggt ggccccacga tcttcagaca ggccccactg    176100
     ggccgaccat ctcatcggca ttgctggcca cccctactgc ggaagcggtt tagctcagtg    176160
     gccgggcttg tcacgttgtc ggaatagccg cgagaaaacc gacgttggcc cctttcaggc    176220
     cggcgcgccc gccgcaccgc gccacatcgc gaacgcctcg gctcggaaga gccggtgcgt    176280
     gcgagccgag acgaggtgac gaggaacggt gaaggtgttg taggtggccg cgggcatcga    176340
     caagacccgc tgggctgagc caggcgactc gaagccctgc aacttcgcct ctcgtcgtcg    176400
     caccggcaca tgcgagctct ccgcccggtt gttcgcccgc ttgcgctgga cgtgatccac    176460
     tcggctcagc ttcatctcac gaagcgcggc tccgtaggcc gggcacttgt ccgtgaccca    176520
     ggtctccggt gccatgccct gcttcttcag aagcttgcgc atcagcttct gagccgcgcg    176580
     cctgtcccgc ttggtctgga gcagcacgtc cagcacctcg ccttcggcgt ccacggcccg    176640
     ccacaggtcc atctgcgtgc cgctgatgcg cacgaacacc tcgtcgaggt gccatcgcgc    176700
     gtgcggcttg gggcggcggg ctcgcagccc gcgtgcgatc gtcggaccga aggtgagaac    176760
     ccagcgtcgg atgctctcgt acgtcactgt gatcccccgc tcggccagga gttcttcgac    176820
     gtcgcgaaag cggagggtga accggagata caaccacaca gcgcgttgga tgatgtcacg    176880
     cgggaagcgg tagccggagt acgagagcac ggtcatgcga cccggctacg ctgcgcgcca    176940
     gccctccgca agccagcgcc caaccaacgt gacaagcccc cggcgtcgac tacgattggg    177000
     cgacacacga tctgtttccg accttcaagc tcgatttccg ccccgccgcg ggctacctcg    177060
     atcgcgtcgc cgcccgaagg ccgccagccg cgcgggatga gctgcgagcc gcccagatcc    177120
     gcccgaacct tcgatgcgct cctcacgctg ccgttgcgcg ccctatcggt cctcgccgag    177180
     accttcccgt tccaggtgag cctgcgggag gagtcgcaca ccatcggcaa cctcgatccg    177240
     ccgcgcccgg cggctggtgt gctcgcagac gcgcagccct ccgccgcccc cttcggaacg    177300
     acccacgaac tgctgggatt gcacgatgcg ggcgtggagc gccaccaccc ctacgcgacc    177360
     ctcgcggacg ccgcgatcga ctgcccgcgc gcggatcgct ggctgagccg ggcgcgggcg    177420
     cgccagcagg gccggtacgg agcgttttgg gacagcgagg atctcgcctc ggtcgatgcc    177480
     gccgatccgg gccttgggag gccggcggcg cgcttcctgc acgggctcaa cctgaccggc    177540
     atcgcgccga tcaccctggc caacgatccc ttctggaacg tgcgcgcgtt cgacaacgcg    177600
     ctgtcgcgcc acgacgggta ccgcctgtcc tccttcatct gcgccatgaa ccagctcgtg    177660
     ctggacgaca ttacggagtc cgcgccgcgc atgatcgaca cgatgggcgt tccggaccga    177720
     caagacttcg atgcaaggcc ctgatctctc accagcagaa gcttgcggca aactcagacg    177780
     cgccgctcaa atctagcaag agtggtccac ttccttgacg tcttgcgtga tgtggggcga    177840
     cgacagcagt gaaactcaga gatcaggtgg aattccgctc gcgttaactt gttcgcctat    177900
     gcgccacgaa ccgaccttcg atccatgccg tcggaatggc tgctcgacac ccaacagcgg    177960
     acctctcgaa aactcaaaga ttcagctctg gccctcatcc cgtccgcaca aggacgtgta    178020
     ctgaggttga gttgtgcaca tgtcgagata gtcggtccgc catcaccgga aagccgtccc    178080
     agctggctct tcgccaactt tcgtggagcg gcttaagcca ttcgggacat ggagcttcta    178140
     cacacgcccg gtgggaccct ctctgcgtct acgaggaccg gctctgcgtc tacggagggc    178200
     aggcctttgc ggcgcgaccg gcgggatctg ggcatcgacc ttctgcccac catttccacg    178260
     aaagttggcg aagagcctcc cagctagccc acccgggaca cggtgacggg cacgcgatgg    178320
     acctcattgc gcaagccacc catcggctgc gtccggaacg cggcatctgt cgcgcggcac    178380
     atcagcgtca ccgggccgtc ggaggcgaag gccaaggcgc agcttcgctc ccgccagccg    178440
     tgcccgttcc gaggtgccag ggcggcgccc gtccaggtgc gcccgccgtc accgctcacc    178500
     tacacctcgg tcaccggcgt attcccccag gcccggccgc ggacttcgag atatcgaggt    178560
     tgccctatgg cgtgcggcca ggcggcagga tcattgccgt gtctgggtcc gtaacatcgc    178620
     cctcctgctg ctgctcgatc ctgagcttcg ccgcgatctc gggcgtcttg ccgttcgcca    178680
     ggtcgcgctc ggccgccacc tgggcgtcgc gggcctgctc ggcattcatc tcaccccgca    178740
     cgaccgcccg cgcgaggttg agggacagga tgttctcggc ttcgctggcg ccgaaagcgg    178800
     tgagcgtgcc ccgggtccgg tcgggaatga cactgccgtt gaaggtcgcc accgcgctat    178860
     agaggttcag cggcaccttg tagggcaggc tctgctctag cacgtcctgg tgcttgaccg    178920
     ggaagtcgtg ctccgcgccg agcttgtgca cgacggtgcg gatccacggc ccgttccgat    178980
     accagatcag cagggtcgcg gtctgctcct ggggcggacc gtacttcgcc acgatcgcgt    179040
     ccgcggctgc ccgtgaggcc gcgggccagt cctgtgccgg tcgctcctcg gcgctggccc    179100
     tcccgaccgc gacggcgagg accagcgcgg cggttagatg gacgctcttc ggagacggca    179160
     ttgacgctcc ctcccgcgag ggccgaaccg ggggcgcggc cctgacggac gatgcccgcc    179220
     acccgatcgc attgcctcga aactgcacca gatacaggcg ggcgagacca caatggttcc    179280
     cgggagacgc cccatggccc accagctgtc tctcaatgtg aacgggcgcg ccgcgcccgt    179340
     gagtgtcgat gatccggaca cgccgttgct ttacgtgctg cgcgacgacc tcggcctgcg    179400
     cgggccgcgg ttcggctgcg ggctcggcca gtgtggcgcc tgcacggtcc atgtcgacgg    179460
     gcaggcggtg ctttcttgca tcacgccgat gtcgagcctc aagcccgagg ccaagattgt    179520
     caccctcgaa gggctcggct cgccggagaa actgcatccg gtgcaggcgg cgttcatcgc    179580
     cgagcaggca gcgcagtgcg gctactgcat caacggcatg atcatgcagt cggcggcctt    179640
     gctgaatcag aaccgcaagc ccgacgaggc cgcgatccgg caggcactgg cgggcaatct    179700
     ctgccgctgc ggcacccacc tgcggatcgt gcgcgcggtg cagcgcgccg cccagtcgct    179760
     ctgagggagg ccgtcatgaa cgcacccgtg ttctcgcgcc gtgccctgtt gcagggcggc    179820
     gcgctcgtcg tcggcttctc gctcgcgggc cgctccgcgc tggcgcagac cgccgcctcg    179880
     gtcgctacga atggcttctc gaaagctatc gcgccggacc aggtcgacag cttcctggcg    179940
     ctcggggccg acggccgggc cacgatcttc tccggaaagg tcgatctcgg caccggggtc    180000
     gagacagcga tggctcagat cgccgccgag gaactcgacc tgccgctcga ccacgtcacg    180060
     gtcgtgcagg gcgacaccgc gctcactccc gaccagggtc cgacctacgg cagcctctcg    180120
     atccagaagg gcggcgtcga gatccggcag gccgcggcca ccgcccgcgc tcgcctcgta    180180
     cagctcgcga gcgagcggct tggcgcaccg attgatgcgc tcgtgaccga gaacggcagc    180240
     gtgcggccga aggcgggagg aaccggcgtc tcctacgcgg acctcctgaa ggacgggcgc    180300
     ttcgagacca aggtcgactc ggccgtcacc acgaaggacc cggcgcaatt cgcgctcgtc    180360
     ggtaagtcgg tgccgcggct cgacatcccc gagaagatga ccggtcactt cacctacatg    180420
     caggatttcc gcgtgcccgg catggtgcac gcccgcgtgg tgcgcccgcc ggccatcagc    180480
     gcgacgctca agagtgtcga tgagggctct gtggcgagca tcccagggct gatcaaggtc    180540
     gtgcgccagg gcaacttcct ggccgtcgtc acggagcgcg agtgggcggc cattaaagca    180600
     gcaagtcagc tcaaggccac atggtctgcc tgggcgggcc tgcccgcgca ggatcagctc    180660
     tgggagcacg tgcgtgccac gaaggtgacg aaggacgatg tcaccagcag cacaggcgac    180720
     gcggagggcg cgctcgccca ggcgtccaag gtcctgcagg cgacctacga ctttgccatc    180780
     cacactcacg gctcgatcgg cccctcctgc gccgtggccg agttcaagga cggactcctg    180840
     acctgctgga ccgcgtcgca gatgacccac gcgctacgca tgcaactcgc agcgatgacc    180900
     gggctggcgc cggaggcggt gcgctgcatc tacatcgagg gttcgggttg ctacgggcga    180960
     aacgggcacg aggacgcggc gggggacgcg gcgctgcttg cgcgggccgt cggccggccg    181020
     gtgcgggtgc agtggtcgcg ggcggacgag cacggctggg atcccaaggg tccaccgacg    181080
     ctgattgacc tcaaagccgg gcttgacgct gcgggcaacg ttgctgcgtg gtcctcacag    181140
     ttccacgtcc cggaaggagc tgccggcaac gtgccgctcg ttgccgcgac cctcgccggc    181200
     ctgccgcacg agaccacgat ggcgccgggc aacgtcatcc agaactcggc gctgccctac    181260
     ggcttcccga acgtgcgcac ggtctgccac cggctcgccg acacgccgtt ccgcccctcc    181320
     tggatccgca cgccggggcg gatgcagaac accttcgcca acgaagcctt cttggacgag    181380
     tgcgcggcga cggccggcgc cgacccgctg gagtaccggt tgcgcgtcct gaaggacccg    181440
     cgcggcatca cggtgctcaa gcgcgtggcc gagatcgcgg gctggcaggc gcggccctca    181500
     cccctaaaag aggacgccag ggccgacgtg ttgcgcggcc gcgggctctc ctacgtgcgc    181560
     tacgagttga accgcaccta cgtggcgggc gtggccgagg tcgaggtcga ccgcaagacg    181620
     ggtcaggtcc gggtgccgcg cttcttcgtc gcccaggatt gcgggcagat catcaacccg    181680
     gacggcgtgc gcaatcagct cgacggcaac gtcatccaga cggtgagccg ggtactgatg    181740
     gaggaggtca ccttcgaccg gagcgccgtc accagcctgg actgggcgag ctacccgatc    181800
     atcacgttcc cggacgtgcc gcaggtggtg actgacctaa tcgaccggcc gaccgagaag    181860
     ccctggggag cgggcgagcc gtccgcggcg atcgtgccgg cggcgatctc gaacgcgatc    181920
     ttcgacgcca cgggcgctcg gttgcgttcg gtgccgttct cgccggcaaa ggtgaaagct    181980
     gctctgcagg gaacctgacg ctaggggatc cgtgtcacga aatcaaacgt ccggaaaacc    182040
     ccattggact aagccgctct cgcggcaggg gcggcgcgtg tcggtcgcgt tgcgagtcat    182100
     gatggagggg cggtcgccct gtctgaggat cgtgaggttc acctcacccc agatgggagc    182160
     ctcccatgac ccacgacgcc gtctctccgc tgcgccggcg gatgatcgag gacatgacca    182220
     tccgccggtt cggcgagcac acaaagcgcg actacatccg acagatccgc gagttcacga    182280
     tcttcctcgg ccgcgcgccg gacctggccg agccggagga cctccggcgc taccagctcc    182340
     acatggcctc gctcggcgcg agctatgccc gcatgaactt ggccatcaca gcgctgcggt    182400
     tcttcttcca cgtcacgctc ggccgatcgg gctttgccga ccgcttggcc cgcatcccca    182460
     cgcccgagcg gctgcccgtc gtgctcagcc ccgaggaggt ggcactcctg ctcgcgcacg    182520
     cgccgagcct gaagtaccgc gcggcgttga gcgtcgccta cggctgcggc ctgcgcgtct    182580
     ccgagatcgc caacctgaag gtcacagaca tcgatagcgc gcgcatgctg atccgggtcg    182640
     agcagggcaa gggccgcaag gaccgcttcg tcatgctctc gcccgacctc ctcgacctgc    182700
     tgcggcagtg gtggcgggtg aagcgcccgc gcggctggct cttccccggc cagcagcccg    182760
     cccagccgat caccacgcgt cagctcaacc gcgcctgcca tgccgccgcc gaggccgccc    182820
     ggatcgacaa gcgcgtctcg atgcacacgc tgcggcacag cttcgccacc cacctcctgg    182880
     agcgcaagac cgacatccgc gtcattcagg tgctgctcgg gcaccgcaag ctcgacacca    182940
     ccgccgtcta tacccgggtc gcgctcaagg cgatccgcga ggtcacgagc ccgctcgcgc    183000
     tgctcgcatc cccaccaccg ccgtaggctg ccgcgcccgt cgtggcgcgg tcttctcttg    183060
     aggtcgcgga tatcctgaac cggcatggcg acgccttcct cgcgcgtcac cgcccgagcc    183120
     acggccagat gaaggtcatg gccgcgatcc gagcctgccg caccgcggcg ctcggcggtc    183180
     atgtcgtgcg ctgcgaaggc tgcgaccacg tcgccatcgc ctccaactcg tgccgcaacc    183240
     ggcactgccc gaagtgccag ggccaaacgg cgcgggcgtg gctcgagcgg cgtcaggccg    183300
     acctgctgcc cgtgccctac taccacgtcg tcttcaccct gccggcgccg gtcgcggccg    183360
     tggccttcca gaacaaagcc gcagtatacg acctgctgtt ccgcaccgcc gccgacacgc    183420
     tcctcaccat cgccgccgat ccgaagcatc tgggcgcaaa gatcgggctc accgccgtgc    183480
     tccacacctg gggctcggcc atgacgcacc atccgcacgt gcatatcgtc gtgccgggcg    183540
     gcggcctctc gtctgacgga tcgcgctgga tcgcctgccg gccaggcttc ttcctgcccg    183600
     tgcgggtgct ctcacgcctg ttccgccggc tcttcctcac ccgactggcc gaggctcatc    183660
     gcgtcggcag gctcggcttc cacggcgagt tggccccgct ggccgaggcg ggcgcctttg    183720
     cagctcatct cgcaccgctg cggcgcgccg agtggatcgt ctacgccaag cgccctttcg    183780
     ctgggccgga agccgtgctc gcctacctgt cgcgctacac ccaccgcgtc gccatcgcca    183840
     acagccggct catcgctatg gacgagcgcg gcgtcacgtt ccgctggaag gactaccggg    183900
     ctcgggatgg cgcgaagggt cgcgagtgga tcaagaccat gacgctggcc ccggacgagt    183960
     tcatccgccg cttcctgctc cacgtgctgc ctgacggctt ccaccgcatc cgccactacg    184020
     gcctgttcgc cagcggcacg cgggctgcca acatcacccg gatcaggagc ctgctggcgc    184080
     cgatgcaggc tccgtgcgcg gccaagcccg aacccgccgc catgaccgac ccacccgcgg    184140
     gaccggcctg cccgtgctgc ggcggacgcc tcgtcgtcat cgagcgcttc cgccggggcg    184200
     aggtcccgaa gctgcgccca agcgccgttc ggatcaacac gtcatgaccg cggccccgag    184260
     cctgatcacg accgccagtc gacagaccgc gggatcatcg acccgcctcg ggttcgctcg    184320
     tgccaggatg cttgttctcg atcaggttgc cccgtccaac accgtccgca gccctcttcg    184380
     cggacgcgat gcgcggtcac aaaagccaac ctgcaccctg gaatcgcgcc cagtcagcgc    184440
     catgaacgag cgccaacgca gccgccgcgc cctcaaatcc ccatagcgcg cgcaccacct    184500
     tcagcgtcgc ggcgcccccg cggcttcctc ccctggaggt tttcgaacgc cggcccccag    184560
     cccgcgctca gccgtcgcgt cagggccgcc atccgaaaac cttcacacga gcggagattg    184620
     ggtcgctgca cgaagacgga cctctgcgtg aaccagcgcg cagaccgcca catcccgtgt    184680
     tgagctgcgg tgcctgcaag gcccgcgata ggtcgcgaga cgccgcttag agcggtattc    184740
     gctcagactg aaacatactc ggcatgggcg aaaaagccgg cgcaatcgtc tgatgtgatt    184800
     ttctccagca agcgtccgac ggcatcccag aggccctcga cggtgcgttc ggctgcttta    184860
     cgcaagagcg ccttgagttt ggcaaaggcg ttctcgatcg ggttgaggtc gggactgtag    184920
     cgcggcaggt ggagaagccg tgcccccgct gcttcaatca tctggcgcac gcgaggtccc    184980
     ttgtggctgg gcaggttgtc catgatgacc aggtcgccgg gtttcagatc cggaacgagg    185040
     atttgaccga cataggcctc gaaggtggcg cggttgaccg cgccatcgag aacgtagggc    185100
     gcagtgaaac cctggaggcg caggccggca atcagggtcg tggtcttcca gtgatggggt    185160
     ggacgccccc cgacggcatc gacgtgccaa ggtggtggtg ttgagcacca ccggagggag    185220
     gcgtccgtgg cggaggttag caccatcggc ttggatctgg ccaagcacgt attccaggcg    185280
     cacggcgcga gcgcggctgg cgccgtcctg ttccgcaaga agctgcgacg cgagcaggtg    185340
     ctgtccttct tcgccggtca gcctcgctgc cgcgtcgccc tggaggcgtg cgcgagcgcg    185400
     caccactggg cacgcgcaat cggcgagctg gggcacgagg tgaagcttat cccgccggcc    185460
     tacgtgaagc ccttcgtcaa acgtcagaag aacgatgcgg ccgatgcaga agcgatctgc    185520
     gaagccgcgc aacgcccgac catgcggttc gtggccgtga agagcgaggc gaagcaggct    185580
     gccgccgtga tcttccgggc gcgcgatctc cttgtcggtc agcgtaccca gatcatcaac    185640
     gcgttgcgcg gccatctggg cgagtacggg ctaatcgcgc cacaaggtcc ctcgaacatc    185700
     gagcgcctga tcgtgcaggt cgaggatccg acatccggca ttcccgccgc agctcgcgct    185760
     tgcctcgtgc ggctcgtcgc ggtgctccgt catctgcagg acgagatcgc cgaactcgac    185820
     aaggcggttg cggcacgggc caaggccgac gccgctgcgc gccggctcat gacggtgccc    185880
     gggatcggtc cgctgattgc caccgccatc gaggcgctcg cgccacctgc cgagacgttc    185940
     cgctcaggcc gggattttgc tgcttgggtc gggttgacgc cgattcagcg ctcgaccggg    186000
     ggcaaggagc gtctcggccg cacctcgcgt atgggtgagc ggacgctgca acgcctcctc    186060
     atcttcgcgg ccagcgccgt cgtgcgctgg gccaagcgca agggcgtgcc ggccggctcg    186120
     tggctcggcc ggatgctggc gcgcaagccg ccgatgctgg tcatcgtcgc actcgccaac    186180
     aaaaacgccc gcgttgcctg ggcgctgctt gcgaagggcg ggacctatcg agctccggcc    186240
     gtcgccgcgt gagcggtcgg cggatgtgag gctgtcgacg gggtgaggag gtcgaaggac    186300
     aggtatggcg caacgtcggt gaggcgggat caggagaacc aggcgcacgg ggagcgcttc    186360
     gagcgcgttc cagtgatgtg gacctgatcc tcgaactccc atacgggccc gcggccaatc    186420
     ttcgtgccgc actagaggcc ggacacatgg cagcacccga tcacgcgctc gcagcttatc    186480
     ctgagattct tcttgcaccg gagggggcgt ccacacatgc ccgtgcggga tactggcgcg    186540
     caggcgttga ccccgtgggg ctctgccgtg ggtgcgggcc atggtggtcg tgacccaagt    186600
     ttcgtcgatg aacacgagag tggctggatc gagctgacgt tgcccctcgc gccaagtctg    186660
     acgctccttg acaatgtcag gacgctcttg ctcgctggcg tgcgcggttt tttttgaatg    186720
     cgatctggtg tcggtcgagg aaacgccaga gcccgccata gccgatcggc agacccttct    186780
     cagccaagcg actgcgcagt tccttcagcg tctgatccgg cgtctcgcgc accagggcga    186840
     ggatgatctc gccatgctgt tcgatctgat gcgagcgccg atcgccgccc agggcaccgg    186900
     gcgcgcatga gcccgtctcc cgcacacgcg cccgccaggg gctgacgctg gccgggctga    186960
     cggcgaaccg cacggccgcc tgccggcccg acatcccggc ctcaatcgcc gcaagcacac    187020
     gctcgcgcag atcccctgac agcgcaaatg acatgcctca acccgcttcc accgttcaca    187080
     gctggggtga agcactccca cgccatcggc ggaactccct gctgattcac atggctcgga    187140
     taccgctcta ggacgctgtc ttaggcggct gcgtggcctc gtcagagatg ccgactttgg    187200
     cccagacgta gaacgcgagc agcgccaccg gcaggccgat cagggacgtc cagacgaaaa    187260
     accagggaaa gcccgtccac tcgacgacga agcccgataa gcccgccagc aagctgcccg    187320
     ggaaagcaca gagggacgtc agaagcccga actggctcgc cgcatgctcc tcagaggcaa    187380
     gggtcgacat ataggtgatg agcacgaccg aggcgaaggc ataggcgaag ccatcaatgc    187440
     tgacggtgac cgcgaaggtc cagaaggccg tcccgccgtc gcctccgtgc gcggcgaggt    187500
     aagcgaggct caagtgagag gccgagcccg ccacggtgcc gatcaggagg ctcggcagca    187560
     tgccgatccg cgggacgaga gcgccggcca gaaacgtgcc gccgagccca atccagaagc    187620
     cgaagagctt ggtgacggtg gcgatgtcgg tgttggagaa gccttggtgc ttgaacagcg    187680
     ggaccgccat cgcactcgcg acgtagcccg gcatgcgaaa gcccgcgacg agcagcagga    187740
     tcgctggcgc catcgggccg agccgggtca ggagctctcg gatgggggcc cagaccgtgt    187800
     cggcgaagcc ggctcgggct tggtggggaa gctggtccga cggcggctcg ggtgcgagca    187860
     cggctgcgag cattccgacg cccatcagcg cgcccatact gagataggcg ccgcgccacc    187920
     cgatcctgtc ggccaggaac agcgcgccgg cgccagccgc gaggttgccg acccgccagc    187980
     cgatctccgt ccaggacgac agcacggcct gcttctcggg aggccgcacg ctggtgatgc    188040
     gccagccgtc gatgacgagg tcgagtgttg cgcctgcgaa gccgagagcc agcgaaaacg    188100
     cgatcgtcca ggcgagccag tgcgccgggt cgccgaacgc gatgccggca agcatcgcca    188160
     tcacgctcaa ttgcgccacg acgatccagc cgcgccgtcg gccgagcgca cgcccgagca    188220
     ggggcgggtc gtagcggtcg aggaacggtg cccacacgaa cttgaacttg taggcgaggg    188280
     tcagctcgct caggaggccg attgtcgcga tcgagatgcc gatgtcggac agccatgccg    188340
     cttgcgtcgc gtagacgagc aggaacggga tgccggaggt gaagccgagc ccgagcgccg    188400
     gtgcgatccg ccggtcggtg aacagcgccg accagaacgg cgtcttctca ggtctgacga    188460
     cagccggcgc attcatgctc actccgcttc gctgctgacc tgcgtgatgg accaggcccg    188520
     ggcattacgc gatgaaccgg cggtcacaag cacccgttcc cgaagcgtga cagactagct    188580
     ccgagagccg atccgcctat ccagaactgc tcgatcagct gtgcctcgaa gcgagcagaa    188640
     cgctttgcgc cacttccgga ccttcgatcg atgccgcctg aatggccgct cgtcacccga    188700
     cagcggacct ctcgaggtca ctcagatcgc gcccccgact ttcgtcgcgt tcgcgtgagc    188760
     gcggcttatg aaacaagagt gtctgactgc gggcgctgac gttcgagttg acactcactc    188820
     aagatcggct cggttgcgat aggttggtcc attcccatct acgatcgcca agagtctctt    188880
     gtccacgcac aatctgtcag atcatctgcg gtccaaggac cgtggctgca tcgcgcagga    188940
     cgggaaagaa actctccacc atgcggtcca ctgcgacccg gtcggcgttc gccccggcat    189000
     tcagggcaca gacaatccgc ccgtcgtatc gtctcaccgg caccgcgagg gatcggtaac    189060
     cgacctcagc ctcctgatcg acaagggagt agccccgctc acggtcgcga tggatggcgg    189120
     cctggagggc cgcgcgatcg accagggtat gcggcgtcag cggctcgggc cggatgcggt    189180
     ccaggaacgc ggcaaggtcc ttctcatcga gcccccccag gagaacccgc cccatcgagc    189240
     tgcaataggc tgggatccga tagcccacat ccacgcccac accgagcatg cgggtcggtc    189300
     cggcgcgcgc gatgaacacg atatcatcgc cgtccaggat tgcggcggag caggcctcgt    189360
     taagctgggc cgagatctgc tcgacggtct gctgcagcgt cgcggacagg ctattggacg    189420
     ccagatacgc ggtcgcgagg gacaggacct tgggcgttag ctggaacagc cgcccatccg    189480
     acctcacgta gccgaggcag tcgagggtgt agagcgcccg ccggaccgtg gccctcggca    189540
     ggtccaccac ccgagcgaca tcggccagcg tcatcagacg gcgctccgcg ccgaacgccg    189600
     agatcacgcg caatccccgc gccaaggcct cggagaagtc cgggccgtgc tcgtcgacga    189660
     gttgctggtc tgtctcggaa cgtctgacac gcggcatgat acggtctctg atgcggcacc    189720
     cggatcgatg ggctggctcc ctgtgcgcgg ccccgcccga cctggcaaga gccgcgtccg    189780
     ctcccacgtg ccggaccgtc acgcgctcgc gcgcggagcc tcgtccgcga ggaaatcggc    189840
     gaggtcgcgg gaccgatcgc cggcgagagc cggcggcggc gagcgtcctg cggcgaggag    189900
     tcgacgtccc gccgccacgt cggcgggacg gccgataccc tggacgcaga tgaggcgccc    189960
     ttttgagaaa tgcaggacgg agaagcggcc ctcttcgggt gccccgcgca ggacgcgtcg    190020
     gtctgcaccg cgcgggaggc ccaccatctg gagcttcgcg tcgtactggt cggaccagaa    190080
     ccgggggacg gcgtcgtagg atcgatcgcg acccactagg gcgtcggcca ccaccttcgc    190140
     ctgatcgatg gcgtgctgca ccgattccag acgcaggatt gttcccgcat atcgattgaa    190200
     gtgcagcgtg cagtcgccgg ctgcgaagat atccggatga tctgtacggc cgtattgatc    190260
     gacgggaacg ccgtcgggac tgcagatgcc agccgacgcg aggagcgcga cgtcgggatc    190320
     tgcgccgacc ccgaccagga cgaggtcgca gggaaaactc cgcccgttgc ttacgtggac    190380
     ctgccgggcg tgttccccct taacctccac gcctactacg gccgcgtcga gttccacctt    190440
     cacgccgtgc gcgcgatgca gccggagcag gaacccggca atttcgccgt cgatggcgcg    190500
     gggcagcagg cgagaacccg cggcgaggag cgtgacctcc ttgcccagcc cacggatggc    190560
     cgatgcgacc tccagcccga tgaagccgcc tccgacaaca acgacctccc gcgccgccga    190620
     cagacgctcc ctgagcaccc tcgcatcgtc gagggagcgg agataacgga tgttgcctgc    190680
     ccgaccgtcg agggcggggt ggcgcctggc ccgcgatccc gtcgccacga ccagggagcc    190740
     gaacgcgagg cggcggccgt tcgacagcga caccgaccgg gacgccggct cgagcgcggt    190800
     cgcctttgta ccaagttcga gttcgatccg gacggcgtcg aagaagctcg ccggccgcag    190860
     cgcaaggtcg gtttccccga ctttgccgga gagaaatccc ttcgagagcg gcggacgctg    190920
     gtagggcagg ctatcctccg cgcccaccag gacgatcctc ccctcgtagc ccgcctctcg    190980
     cgccgaggct gccacctgga ggcccgcata ggacgcgccg acgatcacga gtgggccgcc    191040
     gtgcctcacg actgaacctc cgggaggtgg agcgtcagcc cctcgagttc cggcgtcagc    191100
     acgatctggc agctgagccg cgaggtctcg cgacggtccg cggcgacgca tgcgagcatt    191160
     tcgcgctcta gctccgacgg ctcgggcagt aggcctacga aacggttatc gacgtagacg    191220
     tggcaggtgg cgcagtcgag cgaaccgccg cattccgcct cgatgccacg gacattgctc    191280
     ctgatggccg cggccatggc gctgatcccg gctggcacct cgacgccgtg ctcggctccg    191340
     tcacggccca caaaaacgat gcgtggcatg cgattgtcca tctaacgaac gtcagttcgt    191400
     ctagtatgca gaagtgcggc gtggaggcaa gcgggcttgc gctccggtca cgcttgcaaa    191460
     gcgctaaaac cgttctataa tgaacatatg ttcgttgatt gaacaaacgt gtttgccccg    191520
     gctaaacgcg ggcagacgct caacggaggc agacgccatg atgagccggg agcagaacga    191580
     ccatatcacc cgtagtggac ccgggacgcc tctgggcacg ctgatgcgcc gatattggca    191640
     gccggccgcc ctcgtggacg aactccaggg cgagcgcccg gtggtgccgg tgcaactctt    191700
     gggcgaaaaa ttcgtgctgt tccgcgatga ggctgggcgg tacgggctcc tcgaccgcga    191760
     ctgcccgcac cgcggtgcgg acctcgcctt cggccggctt gagcacggcg gactacgatg    191820
     cgcctttcac ggctggctgt tcgacgtgga ggggcgctgc ctcgagacgc ccgccgagcc    191880
     ggtcggcagc aagctctgcc ggaatatccg gcagcgtgcc tatccggtgg ttgagcgcag    191940
     cggcatcctg ttcgcctacc tgggggaggg cgagcctccg gcgttcccgg aactcgactg    192000
     cttcctcgcg cccaacgcct acaccttcgc gttcaagggc ctgttcgagt gcaactggct    192060
     tcaggcgctc gaggtcggaa tcgatccggc acatgcttcg ttcctgcacc ggttcttcga    192120
     ggacgaggac acggcgtcgt cctacggcaa gcaattccgc gccgcatcgg ccgacagtga    192180
     attgccgatg acgaagatcc tgcgcgagta cgaccgtccg ctcatcaacg tcgagcgcac    192240
     ggagtacggc atgcggctga tcgccctgcg cgagatcgac gaggagcgca cgcatgtgcg    192300
     cgtcacgaac caagtgttcc cgcacgcctt cgtcattccg atgtcggcgg atatgaccat    192360
     cacgcagtgg cacgtgcccg tcgatgacga gcgttgctac tggtacgcga tcttcacgag    192420
     ctacacgtca ccggtggaca agaagcggat gcgggagcag cgcctggagc tgtacgagct    192480
     tccggaatac cgctcgcgga agaatagaac caacgactac ggcttcgatc cgcacgagca    192540
     agcccacgcg acctacacgg ggatggggct cgacatcaac gtccacgacc agtgggctgt    192600
     cgagtcgatg ggaccgatcc aggaccggac tcgtgagcat ctcgggcagt ccgacaaagc    192660
     gatcgtgctc taccgccgga tccttcgtga gcagattgac aaggccgtga agggcgacgt    192720
     tccactgatg gtgctcgacg ggcggcacgc aaaaagcatc cagggtcccg cgacgatgga    192780
     cgggatcggt ccgtccaagg gatgggagac ctactggatg gaagtggacg tgcgccgccg    192840
     ccgcggagcc ccgtggatgc ccgccgtccc caccgacgtg gcacgcctga acgcggccga    192900
     atagcctggt gcatcggtcg cctgattgcc gggaggacga cggcgatgac attcgtacag    192960
     gaccatggat tgtggaccga cgcgcaggcc gacgcggcgc gcgacgtgcg cgagcgatgc    193020
     gacccggaga ggatcgacac cgtccgcctg tccttcccgg accagcacgg gatcctgcgg    193080
     ggcaagaccc tcgtcgcctc cgaggccgtg aaggcgctca ccggcgggtg cgcgatcacc    193140
     acgacgatgc tcgccaagga cacctcgcat cgcaccgtat ttccggtctt caccgccggc    193200
     ggcggcttcg gaatgcggga gatggagggc gccgccgatg tggtcatggt acccgacccc    193260
     acgacgttca ggacgctgcc atgggcgcca cggacagggt ggcttctctg cgacctctat    193320
     ttccaagacg gccgtcctgt ccccttcgcc acgcgaggca tctaccgttc cgtcctggac    193380
     cgtctgtccg aaaggtccct cgaatacgtc gcaggactgg aggtcgagtt tcacgtcttc    193440
     aagctcgacg acccgcgcat ggcgcccgcc gatgccgggc agcccgggga gccgccgagc    193500
     gtcagcctga tctcgcacgg ttaccagtac ctcacggaac agcgctacga ccaagtcgag    193560
     ccgatcctag agatcctccg caaggacgtc ctcgccctcg gcttgccgct gcgctcgatc    193620
     gaggtcgagt acgggccgag ccagtgcgag ttcaccttcc agcccaccgc cggcgctgtg    193680
     cccgctgacc tgatggtgct gtttcgcagc gcggtgaagc agacctgccg ccggcacggc    193740
     tatcacgcca cgttcatgtg ccggccccgc atcccgaacg tggtctcgtc gggctggcac    193800
     ttgcaccaat cgcttcgcga cgcgcggacg ggagcgaacg ccttcgtccc cggcgatggc    193860
     tcccagccgc tctcgggttt cggtatgggg ttcctgggcg ggctgctcgc ccacgcgcgt    193920
     gccgcgaccg tcttcacaac gccgaccatc aatggctaca agcgctaccg ctcctactcg    193980
     ctcgcgcccg accgcgcggt ctggggacgc gacaaccgcg gggtaatgat ccgcgtgctc    194040
     ggcggaccgg gcgatccggc cacgcggctg gagaaccggg tcggggagcc ggcggcgaac    194100
     ccctacctct acatggctgc tcaggtgctc gccgggctcg acggcgccga ccggaacctc    194160
     gaccccgggc cgagtgccga cacgccctac gaggccgagg cggacctcct acccacgtcg    194220
     ctacgggagg cggtcttcgc cctgcgcgag gacccgttct tccgcggcgc gctcggcgag    194280
     tcgttcgtcg attattacac gcatatcaag aacgccgaga tcgagcgctt ccaatcggaa    194340
     atcaccgagt gggagcagcg tgagtacttc gaaatattct gataaacgcc tggcgcggag    194400
     ccacagagat gaagcttggt cgcacgttcc ggttcgtcgt tttcctggcc ttggcctgcg    194460
     ccggacttcc cgctccgggc agggcgctcg atcagccaat ccgcatcgga gtcctgagcg    194520
     acatgagcgg gccgttctcg gaccaggtcg gcgccggctc cgtcgccgcc gcacgcctcg    194580
     ccctcgacga cttcgcccgg gagagcggcg gcctgaaggt tgagctcctc tccgccgacc    194640
     accagaacaa gcccgacatc ggcctcggca tcgcgcggcg ctggctcgac caggagaatg    194700
     tctcggcgat cgtggacctg ccgaattcgg gggtcgccct cgcggtcgcc aacctgctgc    194760
     gcgagcgcaa tcgcgtcacg ctcgcgtcca gcgcgatgac gtccgatctg acgggcaagt    194820
     tctgcgcacc gacaaccgtc caatgggtgt cggacacgtg ggcccaaggc tccgccacag    194880
     cacgggcgct ggccgagcgc gggtcacggc agtggtactt cctcaccgtc gactacgcgc    194940
     tcggccacgc cctggagcgc gacgccacga gggcactcgg cgagatgaac ggcagatcga    195000
     ccggcgggtc gtgacttccc cttggcacca gcgacttttc ctcagcgctc ctgacagctc    195060
     agatgacagc tcagagctcg ggggcacaga tcctggccct cgcgaatacc ggcgccgaca    195120
     tgatcaatgc gatcaagcag gccggggagt tcggactcac gcccaggatg aaggctgcgg    195180
     ctctgtttat ccagctgtcc gacattcact ctctgggact gacgacggca caggggctgc    195240
     agctcgtctc ggccttctac tgggatcgca atgagagcac gcgcgcgttc agtgatcgct    195300
     tcgccgccgt catgaacggt cggcgtccga cggaggatca cgcgggggtg tactcggcga    195360
     cgctcgccta tcttcgcgcc gtgcgtgccg ccggcacgat tgagggcgac cgggtcgtgg    195420
     caatgatgcg gaaagcaccc attgaagacc ccctcttcgg aaccgtaacg atccgcccgg    195480
     acgggcgcgc ggtccacgat atgtacctct acgaagtgaa ggcgccatcc gagagcgagc    195540
     ggccatatga ctactataag cacgtgacca ctattgctgg cagtcaggca tttcgcccag    195600
     tgaaagatgg cggctgtgca atgatcgaaa aaagcaatta agtcgtcata ttcctagcta    195660
     tatctcgttt tccgctccgc gattttattt tgcgatattt gagattcata gaaacacctc    195720
     gcgggcctgc tcaaacattc cgaccacctc atcggagaca gcgcggatga acggatcctt    195780
     cctgtcgcgc ctgcgggtca gtagaaatac gtccttgctc gggggtgccg attcgagatc    195840
     gcaaatcctc aacagcgggt cgaggcggcc gatataatga gggagaagcg caagtccggc    195900
     gccggatcgc tgatgaaggg cggcctcaac gcggccaccc gcagcctcgc gatcgaatat    195960
     gccgcacgcg gcatccgcgc gaatgccgtc gctcccggca tcatcaggac accgatgcat    196020
     tcccccgaca cgtacgaatt tctggccggc gcccacccga taaaccgtat gggtgaaatc    196080
     gaggacatcg cccaggccgt gctttacctc gagtctgccg ccttcgggac cggcgaaatc    196140
     ctccacgtcg acggcggccg gatcgccggc cattgacgtc cccaggagag ggcgtttccc    196200
     cccgcgccct ccccacacct ttcttgggga gtgataccgg cgcgcctttg atctgatccg    196260
     tccatacgaa ccatgctgcg cggagatgcg ggtggggagg agaacgcgtc aacacaaacg    196320
     cgcggcggta tgacatgccg atcgtgacca ttcaggtgac ccgcggagga gcgagcccgg    196380
     gcgcagaccg caccacgagc gagcagaagg ctgcgatcta taaggggtct cggacctgct    196440
     cttcgaggct atgggcaagc accctgacga cacgtccgta atcttccagg aagttgagct    196500
     cgaatatttg gggcgcagcg gcttgctggt gcccgagtac cgcagccagc gcgctcggga    196560
     aacgaaccag acaagctcct aaggtcgcat gagagcgtct tgtgcggact atagtccttc    196620
     ggcgcatcgc gccagcgcaa cccgttgcga ttgacgaaaa cgatgccgct caacacccgc    196680
     cgatcgtcaa cccgcggctt gccgtggctc ttggggaagt acggtcgcag acgcgccatc    196740
     tgctcatccg tcaaccagta caggtcgctc attcttagtc tcctcgcaga gcctgaatca    196800
     gatcgcgcct ctcatatcaa tgggtcctga ccccagagca gcgcccgatc gtgttgcaat    196860
     cggacgctgc tctagatctt tgatttttgt cgcactttct acgatgaacc ggtgtcaact    196920
     tcatcctaaa tggtgcgatg tccgcgttcc ggtccgcgtg acgcccatcg acgtgagact    196980
     cgcctcattc gaggatacgt ccggtggtgc aagcaaatgg cgggaggatc gctccttctc    197040
     tgaccgtggc cggtctcagg atggcggctt cacgtcgtag gagatgcgtc ccgccgggag    197100
     gaagaacagg gcgatgagcg cgccgccctt gacctcgggg tagtgatggc tgcccggcgc    197160
     cggcgccgtc cagcccgcgt ggcaccaacc gctcggcccg gcgagcacgg cgttctcgtc    197220
     gagcggcacg accatgttca gctcgccgta ggggtggccg tggtagtcgc cgcggaagct    197280
     cgcgtccgcg tcgcccggct cgccgtcgtg atagtcgacg gccatccggc cgccctgact    197340
     gtccatgtag acggcggtga tgctgaagtt cagcgtccgc gccatcggct cgcacagccg    197400
     gctgcggcgg tatcgccggc cgcccacctc gatgttggcc gcccagccct cctcgacccc    197460
     ctgcttgatg aggcgcgata ggtcctcata cagggcgctg cctggtccgt aggtctcgtt    197520
     gagccagcgc tcgacctcgg gccccgcggt catgttcttg acctcgtcga ggaagggaat    197580
     gctccgctcg atcagttgtt cgcgtccgtc catctcactc tccttggtca tgcgcccgtg    197640
     gcgcttcgaa accgtggaag ctcgcaaacg cctcgaccga tgcgcgctcc atgaccccgc    197700
     gggtcgcgac cgcggcggcg tcgcagacac cgagcgccat gccgcacacg acgacatcct    197760
     cggccgcgat cgggaggtgg cggcgcagca cgcggtggta cttcgccaga gtctcctgcg    197820
     gacaggtatc gaggccgcgc accttggcgg ccagcatcac gttctgcagg aacatgccga    197880
     gatccagcca gctgcccttt tccagtcggc ggtcgagcgt aaagatcaag ccgaccggcg    197940
     cgccgaagaa atcataattt ttggccgttt gcgcggcccg accgcgcaag tcgtcttggg    198000
     ctatgccgag cgagccgtag aaaatccggc cgaaggcctg cttgcggctc tggtacaggt    198060
     cggggaggct cggcgcgtag taggtgtact cggaggcgtg gtgcgctgct tcggccgcgt    198120
     gcgtcgcgac gatgtcgcga cagatctcgg cctttactgc acctgctagc acgtacaccc    198180
     gccagggctg gatgttggcg ccgcttggcg cgtagcgcgc ggcatcgagg atgtcgcgga    198240
     tcgtgccgtg ggagacgggc cggtcgatgt agaagcgggt ggcgaagcgt cctttcatga    198300
     caccgtcgag cgcctggact agatcgaggt tcgccattct cacccccgtg tgaccagcgg    198360
     acagttgccg gccgagatca gccggaacgc ctcctcgccc gggatcgtct ccaggagctt    198420
     gtagtagtcg aagcgcgtct tgctctcggc gggggatttg acctgcatca ggtagatgtc    198480
     gcgcacgagg ggcccgtcct cgcggatgtg gccgtcacgg gtcatgaagt tgttgaccgg    198540
     catcttgcgc atctgcgccg cgcccgtcgg gccgtcgtcc gtgttcgcgg cggccatcgc    198600
     cctgaggtag tgcgtcaccg caccgaaagt acccgcgtgg atcatggtcg gcaccttatt    198660
     ggtgcgcgcg acgaagcgct gcgaccatgc ccgggtctcg tcgttcaggt cccagtagaa    198720
     ggcggtgctc aggatcaggc cctgggccgc cggcaggccg aggccgtgga tgtcggcgat    198780
     gaagacgagc aggcccgcca gcgtctggcc cgactgcacc accccgaact cggcggcctg    198840
     cttcagcgcg aggatgagat cgccgcccgc atcggccagc ccgacgacct gcgcccccga    198900
     gccttgcgcc tgcaggaggt aggaggagaa gtccgggctg ccgatggaat ggcgcaccga    198960
     gccgagcacg cgaccgcccg ccgcctggat cacgcgccgg ccgtcctctt cgaactgcgt    199020
     gccgagggcg tagtccgccg tgacaaagta ccaggacttg ccgccgcgcc gggtcacggc    199080
     gcgcgccgta ccctgggcga gggcgtaggt gtcgtaggtc cagtggatgc cagtgggcga    199140
     gcaggcgtcc ccggtcagcc gggaggtcgc cgcccccgag gcaaggaaga accggcgacg    199200
     ctcgcgggta atatcctgca ccgcgagcgc gatggcggag ttcggcacgt cggcgatcac    199260
     cttgacgtcg tccgcgtcga gccagcggcg cgccaacgcg gcgccgacat ccgtcttgtt    199320
     ctgatggtcg gcggcgatca cctcgattgg gcgtccgagg acgcggcctc cgaaatcctc    199380
     gaccgccata cgcgcggcga cgaccgaacc gttgccgctg ttgtccgcgt agagcgagga    199440
     gaggtccgtg agcacgccga tccttacggg cggtccgcct tccgcgacgg ccggcgagac    199500
     agcgagccag aggccggtca gggccaacga tcctcgcctg aggaagcgtt gggcgagagc    199560
     gggcgaaaac ggcatagcgc gttcccttcg aggacgagga acgatgcctg gccaggctgc    199620
     acttgcggaa gtgcaagttc ggcaatctca ttatgagctt cgttcatcgc gcgcagaggg    199680
     gtcgatcatg acgaggggcg ctgggacacg cgcgagcatc ctaaatcggc tcgatctgaa    199740
     cctgatccgg ctcttcgacg cggtgatgcg ggagcgtcac gtcgctcggg ccggccagtc    199800
     cctcgggctg agccagtcgg cggtgagcca cggcctacgt cgcctgcgga cgctgatcgg    199860
     ggacgacctc ttcgtgcgga ccgtgcaggg catggagccg accccgcggg cgctggccat    199920
     ggccgtgcag gtgcgtgatg ccctcacggc gatcgaaggc gcgatcgggc cgcagcgctt    199980
     cgatccggcc agctcgacgc ggcagttccg gcttgccgcc acggaccaca tcaccgcggt    200040
     cgtcgctcct gccctcatgc ggaccttcga gacggaggcg cccctcgcgt cgatcctgat    200100
     ccgtcctgcg acgcggatcg acctgaccat gcaggtcgat ctcggccaga tcgacatcgt    200160
     cgtgggcatc ttctcgcaga tcccgcaccg cctgcatgcg cgaaccctgt tcgaggaccg    200220
     cgacgtcctc gtcaccgcgc ccgatcatcc ggaagcggga ggcgcgaccg acatccgcac    200280
     gctggcgcgg gacccgctga tggtggtcac cgtcggcggg accgaggacg gcctgccgga    200340
     cggacgcctc tccgagcgcg gcctgacgcg gcagaccgag atgttcgacc gcgacgccct    200400
     caaccgtgcc ttcagggcgg cgggcctggt gcctcgcctc agcgtcctcc aaccccattt    200460
     cctggcggtg ccgagcctgc tcgcggactc gcgacgcgtg gcgatcgtgc cggcgtcgct    200520
     ggcgcacggc ttcgaggcgg ccggcgtcgc gcgcgtgtcc atgccgcctt gggagccccg    200580
     tacgatggcc gtgcagatgg tctggcacga gcgttggagg caggatccgg cccatgcgtg    200640
     gcttcgggaa gcactatttc gtgccagtcg aggcatcgca gatgcggttg ggcaagccac    200700
     agatcaatcc tgaccgtcga caagaggccg tcctggcgct gcagggtgca gaagcagcat    200760
     tcgccttgag gaagatttgc ggatcggaac cgaacttgtc gtccttgagc gatcggaggc    200820
     gcaaggacgg catgagtctc gtgcgccgtc gccgatgtgc ggacgcttcc gatttcgaga    200880
     aaccctcccg ccgcctgtgc caggctgtgc gggaaaacga ccgattcctt acagccagag    200940
     cggccgtttc tgttgacgcg cctgacacga gagcgcggcg tgacggcgga tatcagggaa    201000
     ccgcgtcagg aaatcaaaca tccggaaaac cctcgcaacc ggacattccc gacaaggggc    201060
     ttgtcacgtt ggctcgcttg gccgcgataa gacccggctg gctcatttca ggcagcgacg    201120
     ccggccgcac tgcgccacat atcgaacgcc tcggctcgca agagccggtg cgtaggagcc    201180
     gagacaaggg ggcggggaac agtgaaggtg ttgtaggtgg ccgcgtgcat ggacaagaac    201240
     cgctgagctg agcgcgctga cttgaagcct tgctgcttcc ggtcccgtcg tcgcaccggc    201300
     acatgcgagc tctccgcccg attgttcgcc cgctttcgct ggacgtgctc agccccgctc    201360
     agcttcatct cacgaagggc ggcaccgtag gccgggcact tgtctgtgac ccacgcctcg    201420
     ggtgccatgc cctgcttctt cagcagcttg cgcatcagct tctgggcagc ccgcctgtcc    201480
     cgcttgggct ggaccagcac gtccagcacc tcgccttcgg catccacggc ccgccacagg    201540
     tacatctgtc ggccagagat ctgcacgaac acctcgtcca ggtgccaacg tccgtgtggc    201600
     ttcgggcgag aggcgcgcag ccgacgcgcg atagcgggac cgaagctgag cacccagcgc    201660
     cggatgctct cgtaggcgac gctgatgccg cgctcggcca ggagttcctc gacatcgcgg    201720
     tagctgaggg tgaagcgcag atacatccag acggcccgct ggatgatgtc ggacgggaag    201780
     cggtagccgg cgtaggaagg cgcgttcatc ccctccggct acggtgcaag atcagtcgcc    201840
     gcaagctggg ctgctcggca acgtgacaag cccgccgcgg aagcctcgca cggactgggc    201900
     gcgtcgaact ccttcagcat gatcgccgtg aaggccggtc gcgtgaccga gagcctgtgc    201960
     gcccgcggcc tgctcgcgtc gctcgggcag cccctgcagc ggacggcgtg acgcggccgg    202020
     tccggcgcgc gggggcgaac gccacgcttc ggccggctcc gaagcgtcgt gcgacggtcc    202080
     gcgcctatca tcccgcggcc ggcatgcccg cgggagcgcc ggagcagaga caacactcaa    202140
     tgggacggct cgatgagcga tcaactcgat aatcccgcat ggcatgccct gaccgggcct    202200
     cacgccacgc tcgcctcggg gcgcggcctc gcgcgccact acccccggga cgtggcgccg    202260
     tactcggcgg tcagggaggc gagcgaggcg gccctgtcgg atctcatgat cgatctgccg    202320
     cccggcgacg tgcgcctgtt ccgtccccgc gaggaagcgc ctccggccgg ctggcacacg    202380
     gtcggcgccc atccgatcct ccagatggtc atgccggccg cgaacttgcc ggagcccctt    202440
     ccggcggagg acgaggtggt tgtgctcgga ccgccccgac gagggcgaca tcctcgccct    202500
     cgtcgaggcc gcgcgacccg gtcccttcgc gcgccggacc cccgtgctcg gccgctacgt    202560
     cggcgtccgt gacgcgcgga cgggccggct cgtcgcgatg ggcggcgagc gcttccggct    202620
     ggacggacac gtcgaactga gcgcgatcgc ggtctctccc gaggcgcgcg ggcgcggcct    202680
     cggcgccgcg gtgacggcga gcctcgcccg ggccgcgcac cggcgcggcg acgtgccctt    202740
     cctccacgtc tacgcggcga acggcgcgcg accgctctac gggcgcctcg ggttccgcaa    202800
     gcggacggaa ctgtgggtgc tgctgtggcg gcgcggggcg cggacgtgag tcgcgcgacg    202860
     cgcctctcgg ctctcctcgg ggtcgcgcgc agtccgaggc aggtatattt cggctggtgg    202920
     gtggtggtct gcgccttcgt ggtcgcaacc ttcgcgtggg gcgtgggctt ctacggcccg    202980
     tcgatcttcc tcgccgcgct ccacctcaag cacggatggc cggtgtccct aacctcggcc    203040
     gcggtcaccg cgcacttcct ggtcagcgcc ggcatcgtca gccagatcgc gcgcctgcac    203100
     gtgcgcctgg ggctcgtcgc cgtcacgcgc ctgggcgccg cgtccgcttc ggccgggatg    203160
     ctgggctggg cgctcgcggc cgcgccctgg cagctctttc cggcggcgct cctgaccggg    203220
     acggggttcg ccctgacgag cggcgcggca atcaacgcga tggtctcgcc gtggttcagg    203280
     cggctgcgcc cggccgcgct cggcgcggca ttcaacggcg cgagcgtcgg gggcatcgtc    203340
     ttcgcgcccc tgtggcagtt cctgatcgtc cggctggatc tcctcggcgc ggccgtcgtc    203400
     atgggggccg cgatgacggg cagcctgtgg tggtgcgcag gccggttcct gcggccgacg    203460
     cccgagagcc tcgggctgct tcccgacggc gccgccgtgc aagccgccga ggcgcgcgcc    203520
     gagccagcgg cccggcagcc ggccctcccg gccggcgccg cggccttgac cgatcgccgc    203580
     ttcctgacgt tgtccgcggc gttctcgctg gggctattcg cccagatcgg gatcatcgtc    203640
     acgctcgtcc tcgtcgcggc gccgatgctc ggagaggact gggcgagcgt ggccgtgagc    203700
     ctagtcaccg cctgcgcaat cgccggacgg acgctggtcg ggatgctgct gcccgcgcga    203760
     tcggactggc gcatcgtcgc gagcgggaac tttaccctgc aggccgtggg aaccctcgcc    203820
     ctcgtcgccg cggggacgca gtcgctcgtc ctcctgctcg cgggctgcgt gcttttcggg    203880
     atcggggtcg gcagccaact ctcgctcccg ccgcagatcg cgggcgtcga attcaccccg    203940
     acggacgccc ctcgcgtcat ggccctcgtg acggccgcca accagacgtc ctacgctttc    204000
     gcgccggcga tcctcggcct gttgcgggac ctctcgcggg gcagcaccgc tcccctcctg    204060
     atgatggtcc tcatgcaggc tttggccgcc gcgatcgtgc tctccggccg gtcggcggcc    204120
     ggatccggga cggacgcgcc gccccgccag tagcggccgc acagtgccgt gattcagcgc    204180
     ctcggcggct gccgcggcga aaattccatt tacagatgtc agtttaggga catatacaac    204240
     ctatattgac aggtttcctc tcgcaaggta atctgactgc caagctcgga atttccgaag    204300
     cataaagctt cggaactgac ggagacacgg ccagtgatcg tcaatggcca aatccaagac    204360
     aggctgatca taccgggtcc gacctgtaga gaagatgacg cgatgaccgc gatgcgggac    204420
     gcccactccc gcctcaagga tcttgtcctc caacacgcgt tccacccggg ccagcaactt    204480
     cgggcccggg acctcgccga ccggctgaag atcagcgcca ccccggtgcg cgaggctctc    204540
     atccgcctca gcgtcgaggg cctgattgtg tcggtgccgc acaagggctt ctacaccaag    204600
     ccactcgacc tgagcgaact ctctgaccgg tacgaattgg ccttcatggt cagccgctat    204660
     gccgtcgaga agggcatcgc gcatttcacg atgcgcggtc ttgaggagcc cgcagttccg    204720
     aagattgggg gggtgggaga cgtcgcctcc aagcagcacc tcgctctgtc gcagtcggtc    204780
     ttcgtcgggc agcttctgga acgcatcgcg ggcctcgccg gcaacaccgc tgcactcgcg    204840
     ttgatgcaga cgttcaatga tcacactcgg tatatccgcc tattggatct ggaggatgct    204900
     ggaaccgcgc gcatggtatt cgcaaacgtc tcccgcttga tcggtcacct tcgggaaaag    204960
     aatccagatt tagcggtatt tgaactaaag atcttacttg taggcacgat agagcgactt    205020
     cctacactgg tgaaggaggt gaatgtgcgc gctctgaagc acttcttcct ttaggcgcga    205080
     cgccggtgtg cgggagcgga cggtccgacg cggcgtcggg tgcgtccgct gcccgcgtcg    205140
     aaccggggcg ccggtcacca gggcacggcg cctccgttgg ccgcgcggaa cacgcgcgaa    205200
     gtcccccaca acctacccaa cggacgaggg agtttggccc atgcccatcg agaccgcctt    205260
     cgaacctgtg gacgtacgcc gggagggcga ggatgaccgg tggtggacgc tgcggctcct    205320
     gccggtccgc gccctgatcc cgcacgagag gacagatgcg ctccacgtgg atcggctgtt    205380
     cgggcggatc agggagaggg atgtctggac gcacccactg ctcgtggaga gccgacatca    205440
     cgtgatcttg gacggccacc accggcatgc cgcatcggaa cggctccagc tgagcgtcgt    205500
     gccgtgcgcg gtcgtcgact acgatcaccg ctacatccgg gtcgggagct ggcgtgagga    205560
     tcgtcatgtc gatcggtccg ccgtgatgca cgcggccatc cgcggacccc tgctgccgcc    205620
     caagacgagc cggcactcga cggagttccc gatttccgaa tgcctcgtcc ctctcgcgca    205680
     gctcaggacg ggacactgag cgcgggctcc gccacgggcg cgcagttgtc tcaggcggta    205740
     tcttccggca tgcgcgccgt ggcgaagtgg ccgccctggt agcgggcgga gtccgcgtcc    205800
     tacgacaggg cggcgctcgc gcagcgcctg ctccagggca tccagcacga agccagcatg    205860
     ggcggtccga gacacccgcc agccgaccat gcgccgagcg aacgcgtcga tcacgaaggc    205920
     cacgtagacg aacccggccc aggtcgccac gtaggggtga gtaggccgga gggatttcac    205980
     ctccggcccc tctcagaacc ggacgggagc ctctcgactc atccggctcc tatcaccagc    206040
     ctatgacaga taacccagcg accaatgaac gaatgcccgc ggctgctgtt gcgccatctg    206100
     cccgagcgtc ttggcagccc gtgtcttgtg gcctgccagc ctcttgtgct tgcgcatcag    206160
     ccatctgatc aggaacaggt tcatgctctg cggtgcatgc gcctcacacg atgccccagg    206220
     cccggtagcg cctgcgcccg gtcagctcgc gcgggcaggc cgggccgaga tcggccagca    206280
     tggcctcgat cgcctgggct gaggttccca gccgctgggc cgcgctctgg accgtgacca    206340
     gcgggctcgc caggaacacc tccacgagct gcggcagccg cgaggtgcgg cgcttggcct    206400
     gcgcccggcg aagcatcagt tcgcgggcga ggctcagccg gtcgaggtcg cggccggcgg    206460
     cgtgtgccgc cgcctcaacg gcacgcagga tcgcgccgag gcgctcgggc gcggggtgca    206520
     ccgtcagcca ccgcgtccgg ctctcgcgca ggccgagcgc gagggcaggg aggtgatggc    206580
     gcgccgtccc gcgctgatgg aggagggcgg ccgcgaggag ggggccgagg aagggctggc    206640
     gctcggacgg gtccagggcg aaccaggcgt cgagcgcgac cgcggccgcg agaaccgtcg    206700
     gcagctcctg cacgtccttg agggcgatcc gccgccaggc cgccagccgt tcggcttccc    206760
     cgtactgcgg atcgcgcacc cgaagcacag cccggccctc atccgtggtc aggtcgttga    206820
     actcggcgag ggtgcgccgg ctgcgggcga gcagctggtc gatgtccgcg aaggccgaat    206880
     cgctggcttc gtccgctgtc cagagctcat cctcatcacc tgagctggtg gccccgtcgt    206940
     cctcgtcgtc gaacgaatcc tgcccgaagc gcggcctggc ccagggttgc ggctcggtgg    207000
     cgtcaccgcg gcgcggcgtc tccgtcgatg ggctcccgag cggtgcttcc gttccgtcgg    207060
     gatcgcgtcc cgcggctccg aacagggcgg accagccctc gcgcgcgaag ggccagtccg    207120
     ggcgggccgc ggcgatccgg cggcgggtcg cgaggatgtg cgcggcccga ccgagctccg    207180
     gggtcggccg gcgcacgggc atggcggcgt cgtgcaggac gaggtcctcc atgagcacga    207240
     gccgaccctc gagcccgagg gcagcctggg cgtcgacgaa gtgcgcgcgc gccctcacgc    207300
     cgtcggcgag ggccggctcc gtgcgggcga ggcgctcgtc caggcgcagg agcgcctcgg    207360
     ccgcgcgctc ggccggaccg gcgagccggc gccaggtcgc ggcggtgaag agtttgtcga    207420
     cggcgtaagg gcttctcaca acgtggttga tgatacgtga accaagtgaa tcgcactatc    207480
     acttggttca cttgggaggg ggcgcttgcg gccccgaaac gcctctccaa acgccctcga    207540
     aatcaccccc gataatacca gctatcgtcg ggaatgggtg gattgttgag gatcgtacgg    207600
     ctacgctgcg gccatggagt tcgaccccgc cgatcccgcc cccgcgccgc cccacggctc    207660
     atccttcgcc ctccccgtcc cgctcgccgc ggccctgccg cccggacccg cgctgctgga    207720
     gcggctcgag gcctacgccc gcgccgccca gggcgccttc gcccccaaca cgctgcgggc    207780
     gcttgccgcc gacagccgca tctttgccgc gtggtgccgc gcgcacggcc gctccgtcct    207840
     gcccgccgcg ccgcagacgg tcgccgactt catcgacgcc caggccgcgc ggaagtcgcg    207900
     cgccacggtc gagcgctacc gctcctcgat cgccatgctc caccgcgcgg ccggtctgcc    207960
     caacccgtgc acggacgagc gcgtgcggct ggcggtcaag cgcatgagcc gggccaaggg    208020
     ccgccgccag aagcaggccg agccgctcaa ccggcccagc atcgaccgca tgctcgccgt    208080
     gaagaccccc gagcggctgc accggcgcgt ggccgagggc gatcgggagg tgccgctgat    208140
     cgcgctgcgc aatgccgcgc tgatggccgt ggcctacgat acgctgctgc ggcgctcgga    208200
     actggtgtcg ctgctcatcg aggatctcga gcgcgtggag gacggctcgg gcacgatcct    208260
     ggtgcggcgg accaagaccg accaggaggg cgaaggcgca gtcaagtacc tggcgccgga    208320
     cacggtcggg catgtgtccg cgtggctgga ggcagccggg ctgacgagcg ggccgctgtt    208380
     ccggccggtg acgaagggtg gtcgggtcgg ggccgcggcg ttgggcgacg cggaggtgca    208440
     tcggctctac cgcgagatcg cgctggccgc gggcgtgaag ctcgcgcgtc ccccgtcggg    208500
     gcactcgacc cgggtcgggg cgacccagga catgttcgcg gccgggttcg agttgctcga    208560
     ggtcatgcag gcgggctcgt ggaagacgcc cgccatgccg gcccgctacg gcgagcggct    208620
     gagagcccaa cggggcgccg cccgcaagct cgcgacgctg caaaatcgag cttgagtgag    208680
     ggggagtggc ccgctcaccg cgtcgacggg ctcagcgcgc agcggccgcc tctcctgaag    208740
     cggcgttggt gcgccatctg gcaggcgtgc tccgcccagc ttccgcctga gccacggggc    208800
     tgcgacgccc ccacctaccc gctcctgttc ctccagccct atctcgatca aacggcgact    208860
     ggaggcgtca tcgagggcgc ccgccagcgc acgccgacac ctcgaaacac cgcatcgtcc    208920
     aggccctcgc gaataagacg ggctagaaag ccgccgtcgt gcaagctagg gcagactgac    208980
     atgcatcgta gctttcaatg tcggggcacg tgggcaagca gggctggtca tgacccctcg    209040
     cggacattcg cggggcgtgt cgagaacgtc cggttgcgag cagttttcgg acatatgatt    209100
     tcatggcgta gttttctgac atcagccgcc ccttgcgttg cttatgtcag agcgagcagt    209160
     tgatgatggc atggtgatca atcgtgcaac caaagtcata atattatata tcaaagtacc    209220
     cttattaata ttatacatat taatatcaga aattatatta tatttcagtc aacaaatttt    209280
     tggatcgccc tgatgctgag gtggccgctt cagcgacaag ccaatccaca aaggatacga    209340
     tggtgaattc ccgccttcga tcgataggaa caacaatgta gtacgacccc gatcccgtga    209400
     gaagtggcgc cgcgatctgg atgaggctgc catcggcgag ttcctgctcg accaagaagg    209460
     acggaaggag cgcgatacca attccgacct tcgcagcctc gattgtcatc gcgaactgat    209520
     cgaagagcgg tcctcgaaaa ggaaatgggt ggacgaaccc catcgccgcg aaccagtccc    209580
     gccacaggcc gggacggctg gcctgctgca ggagcgtcgc gcgcacgagg tcggcggggc    209640
     agttcagagc atagcgctcc gcgtaggctg gccccgagac cgcgaccacg gcctcgtcgc    209700
     agagcctgat gcagtccgct tgagcccagt ttggagcccc aaaatgaatc gcggcgtcga    209760
     cggactgtgc catgagatcg aagggttccg gctcggtcac gaggttgatc gtgatgtgcg    209820
     ggtgtgacgc caggaacctc ggcagacggg gaatgagcca gcgggtggcg aaggtcggca    209880
     ggacggcgag cttgagcgtc acctcgctgc cggcggacgc catcacggaa tgggccgcgg    209940
     tgacgtagtc ctggaggagg cgcccgacgg tcggcagcag ggcgcggccg gcggcggtga    210000
     gcatgacgcg tcccttggcg cgctcgaaca gcaccgtctc aagcgtggtc tcgagctgcc    210060
     ggatctgctt gctgatcgcc ccctgagtca gggcgagttc gtcggcggcc cgcgtgaagc    210120
     tgccgtgacg gccggccgcc tcgaaggcgg tgagctcctg gaacgagggc attcgggtgc    210180
     gtgacgtcgc catggacctc ttattccaaa tcgtcatgca ctggtgaaga agtctccttt    210240
     gcaaaatcgc cccgacgggc cgaaggctca ccccgccgtc ccgttcggga caccatccgc    210300
     gagattacga tgtcccaggc cgtcgaagcc gctcccgtcg cgcatccgct tgccgacgag    210360
     gtcgccgcgc tgctcgagtc gttcggcgcc gagcttccgc gccaggcgga agggtcgtgc    210420
     atcgtccgtt cgccgctcac gggtgagctg atcgtccggg tccaggagac ctcgccggac    210480
     gaggctcgcg cggcaatcgg acgggcgcac gatgccttct tggcttggcg ccaagtgccg    210540
     gcgccgcggc ggggcgagtt agtgcggctc ctcggcgagg agctgcgggc caataaggca    210600
     gcgctcggtc ggctcgtcac catcgaggtc ggcaagatcg tctccgaggg cctgggtgag    210660
     gtccaggaga tgatcgacat ctgcgatttc gccgtcggcc tctcgcgcca gctctacggg    210720
     ctgaccatgg ggtccgagcg ggccgatcat tccctgatgg aacaatggca cccggccggg    210780
     atcgtcggcg tcatctcggc cttcaatttc cccgtggcgg tgtggtcctg gaatgcggca    210840
     ctcgccttcg tgtgcggcga cagcgtggtt tggaagccct cggagaagac gccgctcact    210900
     gccatcgccg ttcaggcctt ggccgagcgc gtgatcgcgc gcttccccga ggcaccggag    210960
     ggtctttcaa cgttgatcct cggtggtcgc gacgtcggcg aggtgctggt cgacgaccaa    211020
     cgcgtgccgg tcgtctcggc cacgggctcg accgcgatgg gccgggtggt gggccagcgc    211080
     gtcgcggccc gcttcgcccg ggcaatcctg gaactcggcg gcaacaacgc ctcgatcgtc    211140
     tgcccgtcgg cggacctcga cctggcgctc tgcgccatcg ctttcgcggc catgggcacc    211200
     gccggccagc gttgcacgac cctgcgccgc ctcttcgtcc acgacagcgt gtacgacgcg    211260
     ctcgtgccgc gcctgaagca ggtctacgcg tcggtctcgg tcggcaaccc gcttgagggt    211320
     gacgccctgg ttgggccgct gatcgacgag gcggcgtata ccgggatgga gcgggcgctc    211380
     gcggaggcga gggaggtggg cggaatcgtg catggcggcg ggcgccacac gcacggcgtc    211440
     gcgcccggcg gcttctacgt ccgcccggcc ctcgtcgaga tgccggcgca ggtcgggccg    211500
     atgctgcacg agaccttcgc gccgatcctg tacgtgatgc gtgtccgcag ctttgacgaa    211560
     gcgctcgatc tccagaacgg cgtgccgcag gggctctcgt cctcgatctt ctccaacgac    211620
     atgcgtgaga cgagccgctt cctgtcggcg accggctccg attgcggcat cgccaatgtg    211680
     aacatgggct cctccggggc tgagatcggg ggcgccttcg gcggcgagaa ggagacgggc    211740
     ggcgggcgtg aatccggctc ggacgcctgg aaggcctaca tgcgccgcca gacgacggcc    211800
     atcaattatg gccgggcgat gccgctggcg cagggggtca agttcgagat cgcggacgag    211860
     ggctcggcga aggcatgaac gcgcccctcc agaccgggcc ggtctttcgg ccggccgccc    211920
     gtctcgcctc gatcgaggtc tccgagatcc tcaggatcac cgcggaggcg agcgcccgca    211980
     agcgtgcggg gcgtccggtg atcgtgctgg gcgccggcga gcccgacttt gacacgcctg    212040
     aacctgtcaa gacggcggcg gctcgcgcca tgcgcgaggg ccgcacgaag tacacgatcc    212100
     tcgacggcgc gcccgagctg aaggctgccg tccgggaaaa attccgtcgc gacaacggcc    212160
     tcgactacgc gctagacgag atcacctgcg ggaccggggc gaagcaggtc ctctacaacg    212220
     ccttcatggc gagcctcgat cccggcgacg aggtcgtgat cccggcgccg ttctggacga    212280
     gctatgccga tatcgtcgcc atctgcggcg gcgtcccaat catcgttccc tgcgcggaga    212340
     cggatgggtt ccggttgacc ccgcaggctc tggagcgggc gatcggcccc cggacccgct    212400
     ggcttcttct caactcaccc tcgaacccga cggggtcggc ctacacggcg gacgacctcg    212460
     tcgggcttgc cgaggtcctc gaccgccatc cgcacgtctg gctgatgtcg gacgacatgt    212520
     acgaacacat cctgtacgac gggcgccgct tcgccacgcc cgcatccgcg gcgccgcagc    212580
     tcaggttgcg cacgctcacc gtgaacggcg tatccaaggc ctacgcgatg acgggctggc    212640
     gcatcggtta cggtgcggga cccaaggcgc tcatccaggc catggccacg gtgcagagcc    212700
     agtcgacctc ctgtccgagc tccatcagcc aggcggccgc gctcgaggct ctcgtcggcg    212760
     accaggcgag catctccgac cggagagtgg cgttccagcg ccgccgcgac ctcgtggtcg    212820
     aggcgctgaa cgcgatgccg ggcctctcgt gccgtaggcc cgaaggcgca ttctacacgt    212880
     tcgcgaactg cgccggcctg ctcgggagaa cgacgcccga cgggacggtg ctggaggacg    212940
     accgcgcctt ttgccgccac ctgctcgagt cggccgacgt ggcagtggtg ccggggtcgt    213000
     gcttcggtct cgccggcttc tttcgcatct cctacgcgac gtcggaagcc gagctgaccg    213060
     aggcctgcgg gcggatccgc accgcctgcg cggctctggc ctgaagaccg cgagaggaca    213120
     tgccgtgcca cgcgatcggg cgtggcgcga gccggccggt gcgccggaac ggccgcgctg    213180
     ggaccggcac gggcggtggg acgcttcgaa ggcgaggaga tctgacgtga gcgcgaacaa    213240
     gaccatcgtg agtcccgacc tcgtgcggac gagattttcc cgcgcgatgt cggacatgta    213300
     ccgcgcggag gtaccgcaat acggcaccct catggacctg gttcgcacgg tgaacctcga    213360
     tgtccgccgc ggcgacgccc tcctcgaccg ccgcctgcga gacaacgacg agatcgagcg    213420
     gctcgagctc gagcgccacg gcgccatccg cgtcggcacc gcggcggaac tcgccacgat    213480
     gcggcggctc ttcgccgtca tgggcatggt gccggtcggc tactacgacc tctccgtcgc    213540
     cggtgtcccg gtccactcca ccgccttcag gccggtcgat gcggaggcgc tgcggcgtaa    213600
     ccccttccgc gtcttcacct cgctcctgcg tctcgacctc ttgccggacg agaccctgcg    213660
     ccgggaggcg gccgagatcc tggggagcag gtcgatcttc acctcgggct gcctcgacct    213720
     gatcgcgctg gccgagcggg acggaggact cgacgcggcc gaggctgacg ccttcgtggc    213780
     cgaggcgctg gagaccttcc gctggcaaag cgaggcgacc gtgccggctg aagtctatgc    213840
     ccgcctgcgc aaggtgcacc ccctcgtcgc cgacatcgtc tgcttcaagg gaccgcacat    213900
     caaccatctc accccccgca cgctcgacat cgacgctgta caggacggta tgccgggcaa    213960
     aggcattacg ccgaaggccg tcatcgaggg gccgccgcgc cgcagggtgc cgatcctcct    214020
     gcggcagacg agcttccgcg ccctgcagga acccatccgc ttccgcagca gcggcaccgc    214080
     cgagaacggg acccacaccg cccggttcgg cgagatcgag cagcggggcg tcgccctcac    214140
     cccgaagggg cgcgcgctct acgatcgtct gctcacggag gttcgcgacc gcgtccaggt    214200
     caagccggac ggctccaacg ccgccgatta cagcgcggcg ctggccgagg tattccgggc    214260
     cttccccgac gacgaagcca cgctgcgcag cgaggggctc gcctatttcc gctacgcgcc    214320
     gaccggcaag cccggtgcgc ccgcggaggc cgacctggac accctcgtcg cctccggctt    214380
     cgtcggagcg gagccgatca cctacgagga cttcctgccg gtgagcgcgg cgggcatctt    214440
     cgcgtcgaac ctcggcgacg aaggccagcg caaccacacc cggcgcgcag ctagggcggc    214500
     cttcgagagg gacctgggcg cgaccgtcac cgacgaggac gcgctctacg ccgcggccga    214560
     gcgcgccagc atcgcggcgg tccgggcggc gctcgccgcc tccatgcgag gcgccgcgta    214620
     gggcaggaag cggagtcggg ggagagcatt ttccgacgaa gtggatgccg gttcgtcgca    214680
     gaaaatgcgt caaaaaacaa agatctggag caggatccga ttgcaacgtg atcggatcct    214740
     gctctagccg acggcgtgcc gcccgggggc ggcacgaaac acgcaggctc tcaggcggat    214800
     cggcggatca tctcaacgat aggttgcgta aagccacagg accttcgcgg gatctttcga    214860
     ctccgtgacc cagagatgcg gcgtactcgc gtcgtaatac atcgactcgc cggtggcgag    214920
     ccgcgtcggc tcgtagatct ggctgtggac gatgacgctg ccgctcagca cgtacatgaa    214980
     cacctcggcc tcgtagcgcg cccactcggt gtaatcctcg agggagcgcg cggtcacggt    215040
     cgtgaggatc ggcgtcatga gcttgtggct gagctcgggg cacagccaga cattgtcgca    215100
     ggttcccgtc ggcatcgagc ggccgccatc cgcccgcgtg atcgagcggc ggccgggggc    215160
     gcgatgcacc gcctcccgcc cgccgaagat cgccgccgag tcgatctcgt acccggctgc    215220
     gatccgctcg agggtcgtga ccgtcggcga gagttcgtcg cgctcgatct tcgacaggct    215280
     cgataggctg atgccgctcc ggtcgctaac ctgctggagc gtcagcttcc ggctccggcg    215340
     cagctccctg agccgctggc cgagactctg ctctgcgttg ccacccgcgc ggccttcgcg    215400
     cgggtcaggg tcgaggacaa catccatcgt gacagccgtc tgtgctcgcc gataaagtcc    215460
     gacgctcagg cggcggactg caccacttgg ggtagagcct gtacccgggg aagatccgag    215520
     aagcgagccg cgaccgcctc gtaggcgcgg tagacgtccg cggccccgcc ctgggcggcc    215580
     tccccccgct gcttcaggtc cgcgaagatc tggtgcttca cgaagaagcg ccagctgacc    215640
     gggacctcgg ccaggatggc ggtgagggcc gcgtagcggt cgcgggtcca gacgcgctcg    215700
     aacgccagcc gcccctcgcc gaagccgaat tcggggcaag gagcctcgga gcgcccgcgc    215760
     tcgcgcaagg cggcggttgc cgcggcgtcg agcgtcaggt cggggccgat cacgacgccg    215820
     taatccgtct ccgcccgcgc ccgcgacacg agcccgcgcc ggacatccga gaggacggcc    215880
     tccggcgggc gctccagcgg atcgccgtaa ccgcccgccc ccggcccctg aatcaggatg    215940
     acgtcaccgg gctcgcagac gacgacgtcc tgcgagccca gctccgtgca ggtctcgctg    216000
     ccaggattcc gggcgaagcg cgagaccgtc ccggcccgcc cgccggcgag cccccaagcc    216060
     gagaagacgg agcggtcgcg gttgcgcgcc gtcaccatgg attgcggcgc gtggagctgg    216120
     aactccatct ccagagccgt gccgccgcgg taaaggcccg gcccgccggt gtcgggcacg    216180
     agcccgtagc ggcggatcgt gatcgggacc tccgcctcgt tgatctcgac gggcgtgttc    216240
     ttcaggaacg acatgttggc gccgcacccc tccgagccgt ccgcgaacgg gccgccgccg    216300
     gccccgccgc ccaccgggcc gatcgaggcc attaccgtgc ggccgccctt cgtcgtcgtc    216360
     ttcacgttca tgatgctgac ggcgctgccg ggcgacgcgg gcaggcgctc gggcaccgcc    216420
     cggcagaacg cgccgatgac caccgtctgc gccaggttgc acaggaggct ccgcatgccg    216480
     accgccgctg gcatcactgc gttcatcacc gtgccctcgg gcaggatcac ccgcgtcggc    216540
     cgcatcaggc cggcattgag catcatcgtc gggtcgaggc agtagagcgc atagacggtg    216600
     ccgacggtgg cgagcgcgtg ccgctccttg cccccggttg gcatgttgag ggccgaggcg    216660
     agctgcgggt cgctgccggt gaaatccacc gtcagcgtgt cgccgtggac cttgagcgtg    216720
     gcggcgatcc gcaccgggta gccgccggtc tgatcctcgt cggcatagtc ggcgaaggcg    216780
     tactcgccgt ccgggatcgt ccggatcacc gcccgggcct ggttgtcggc atattcgagg    216840
     aggtcgtcga ggccggtcac gaagtcgtcc gcgccgaagc ggtcgatgat ctcgtggatc    216900
     ttgcgctcgc cgacgttgac gcaggcaatc tgggcattga ggtcgccgtg gttctgctcg    216960
     ggcaggcgca cgttgttggc gatgagcgcg aggagatccg cgttgaggac gccgtggcgc    217020
     atgaggcgca tcggcgggat gcgcaagccc tcctggtgga tctcggtgtt cgtgcgcgac    217080
     agagtcgccg gcacggcgcc gccgacatcg gtgttgtgga tgtggcagcc cacgaagcag    217140
     acgatccggc cgtcccggaa caccggcttc cacatgtgga tgtccggcgt gtgggtggcg    217200
     acgtagcccg cgtaggggtc gctcgtgatg cagatgtcgc cctcctcata gtcgaagagg    217260
     cggatcagat ccccgtaatc gaggcccgtg taccaggtcg ccccgaaggt cttgggcgaa    217320
     gcgacggtga ggccgtcgcg ggtcagcacc tggcaggaga agtcctcggt ctccttgacg    217380
     aaggtcgagt aggccgtccg catcagcgtc cagcccatgc tctcggcggc cgcggcgcag    217440
     taattggcga ggacctgaag ggcggtcatg tcgaggttca tcgcgcggcc tcctgagcaa    217500
     tgcgcagatt ggtgtactcg tcgacccgga ccgccatgcc cggcggcacg acggtggtgc    217560
     agtcgtcctg ggtcaccacg gctgggccgg cgaagctctg gccgggcttc agatcggccc    217620
     ggtggaagac gccgaccgag cgcatcgcac cgtcgagcca gacctcggcg tggcgcaggg    217680
     gagtggcgac accctcgacg aggggctggc gcaggaagcc gggcttcgcc gttccgccgc    217740
     tgatgatgag gcgcagagcc atgatctgga ccgcggcgcg gcggtcgcaa tgcccgtaga    217800
     cgcgctgatg ctcggcgtgg aacgcctccg cgatggcggc gacgtcgccg gccgaggccg    217860
     gaccggccgg gatcttcgtg tcgagctcga aggactgccc cttgtagcgc agctccgccg    217920
     agtggctcag ggtgtagtcg cccgcataac cctggtcgtc acgcagccag gacacggcct    217980
     gcgcttcgag gtccgcgaac tccgcgcgga tcgtcccgcc gagatccggg acgaggtcgg    218040
     tgtagagcgt cttgatgaag tcgctcttga tgtcggcgat caggccgccg agggccgaga    218100
     gaactcccgg cgtcggcggc accagcacgt cgcgcatgtt gagctcgcgg gcgagaaagc    218160
     aggccatcat cggccccgcg ccgccgaagg cgaggcagga gaagtcgcgc gggtcgatcc    218220
     cgaagcgaga gaccagggcg ctggtgtcgg tgtacatgcc cgagaccgcg atccggatga    218280
     tggcctcggc ggtctcctcg atcgtgcgcc cgagcggcgt ggccagggtg gcgaccgcgg    218340
     cccgcgcctt ctcccggtcg atcgtcacgg ccgagtagcc gatctcggcg aggccgacga    218400
     ggccgagcgc cgcgaaggca tccgtgatcg tggggcgcgt gccgccgcgt ccgtagcagg    218460
     cgggacctgg ccgcgagccg gcgctctcgg ggccgacctt gagcacgccc tgcgcgtcga    218520
     tccaggcgat cgagccgcca ccctcgccga tcgatgaaac cgagaccgac tggatgtaga    218580
     tctggaagtc gccgatcagc tcaccgatgc cgtattgcgg ctggccgtcg atgatcacgg    218640
     cgacatcggc cgaggtgccg ccgatgtcga ggctcatgca gtgcttcacg ccgcaggtct    218700
     cggcgacgta ggcggcgcca atgacccccg aggcggtgcc cgagaggatc atctgcacgc    218760
     attcgctctt gccctgctcg gcggtcatca cgccgccgtt cgacttggtc agccgcggct    218820
     cggcgtcgac gccggcagtc ttgagggcgg cctggagcga gccgagatag tgggcgaccc    218880
     gcggctgcac gtaggcgccg atcaccgccg tgatggtgcg ctcgtactcg cgcacaatcg    218940
     gccaggtctc gctcgacagg aagaccggga catccggcgc gagccgggcg atcaccgcct    219000
     tggcggcctg ctcgtggacc gggttgcggt aggcgtgcag gaacgcgacg acgatgccct    219060
     cggcgcccgc cgcgcgggcc gcggcgaccg cctcgccgac gctcgcctcg tcgatcggcc    219120
     gctgcacgct gccgtcggcg ttgagccgct cggcgatccc gaagacccgg tcccgggtga    219180
     tcagcggctc gggccgcttc gagaggaggt tgtacatgtc cgggatcttg aggcgcgcca    219240
     gctcgagcac gtcccggaag ttctcggtcg tgaacagggc cagcctcagg cccttgcgct    219300
     gaatgacggt gttgatcccc accgtcgtcc cgtgggtgaa gtagctgatg tcggagggcg    219360
     cgatgccgta gcgctctccg acgaggtgca cgccctccat cacctcggcg ccgggctcgt    219420
     ccggccgcga gaagaccttg agcgtcctga ggctctgcgt cgcctcgtcg aacagcgcga    219480
     agtccgtgaa ggatccgccg atatccactc ctacgcgata acccattgtc gtctccaggc    219540
     gttcgtccga ttgggccggc tgcggcgcgg gcgtcagcgt ccgatctgct tgttccaggt    219600
     ctcgacccac tgcgcgttgt tcgcgaggat ctcggcgaag ggcggccagc gcacgctctg    219660
     ccaggacggc atgcgggcct tctgctccgg cttgtattcc gccttggtgt tcacgacggg    219720
     atattggatg gcggcggccc agcaggactg gcggtccggc gcgaacagga agttgatgaa    219780
     gtcccaggcg agcggagagc cgttcttgac cttctgcacc accgtcggac tcacgacgcc    219840
     gcccggctcg ggatagacga agttgagggc cttgaagccg ccatccttcg cggcccaggc    219900
     ccggccgtcc cagtagatgc cgatctccgc ctcgcccgac tgcatctggg tgaggaactg    219960
     gttcacgtcg ttccagaaga cgatattgcc gctgtcgcgc atcgccttga gcttcgcgac    220020
     cgccggcgcg acgtcggccc ccttgccgcc caggacgtcg ttgaagttcc agatcaccgc    220080
     cgtcggcgtg gtgctggcga cgttgatccc gggcaggctc gcctgccagt cgcccttgat    220140
     ggtgcggtcg atgaactcgg cccaggtctt gggcgggttc ttgatcctgt cggcgttgta    220200
     ggcgagtccc gccgccccgt aatgggtggc gacggcggtc ccgcccgcga tccgcttgaa    220260
     cggctcgggg acgtcggcga ggttcggcac cttggccgga tcaatcgtct cgacgagtcc    220320
     cttgttcttg gcatcctcgg cactgtcgat gaggtggagc aggacgtcga tcggcggctt    220380
     ctgcgggttg gcggagatct gcgcgacgta ttgcggaccg gtgccgagca cgacgtcaac    220440
     cgtcttgccc gtctgcttct ggaacggttc gatgtagcag gtgcgcagcg acttctccca    220500
     gacgccgccg aaggcggtga cggtcaggtc ggcggcgcgc gcctggcctg acgcgacggc    220560
     cgtgaccgct acgagactgg ctgcgacgga tcgtgtgcgt gtgagtgtgg gcacggtctg    220620
     gtctccaggg tcggtctgag aggaagcggg caggccgagc ccgcgtcagg ttgagctcat    220680
     gtgcttgaga ccgacggtcc gatcgatgag caggagggcg aggaacgcga tcagcatctg    220740
     caccgtaccg atggccgcga tcgccgggtc gaactggttc tgcaggtagc tcagcatcac    220800
     caccggcagg gtgttggtct gcgcgctggt gaagaagagc gagagcgaga gattgtcgag    220860
     ggagatcagg atcgagaaca gcatgccgct gaagatcccg gagctgatga gcggcagcgt    220920
     gatgtaccgg aagatctgcc accggctggc gcccaggatg gctgcgccct cctcatattc    220980
     ccgcccaatg ccccggtaga cggcgacgac ggtgcgcacg acgtaaggca gcgacacgac    221040
     cgtgtggccg atgagcagcg acgtgaagga gatgccgagc cccagcgacg acaggttgaa    221100
     gaggagcgcc acgccgagca ggatcatcgg gatggagatc ggcgagagca ggaaggtcga    221160
     gacggcatcc gccgttgccg tgccgctgcg cgccagtacc agggccgccg ggacgccgag    221220
     cagcgccgcc gccagcgcgg cgaggaccgc gagcttcagg ctgaacagca gcgaggtcag    221280
     gaagggcgtg tattccagca ggcgatagta ccagcgcagc gagtagctct gcacgggaaa    221340
     ctgaacgaag gctgcatccg agaacgacac gaggaccacg aagacgatcg gcgccaggag    221400
     gaagacgaag aagaggacga cgaaggccgt gaggacggtt tgcggcagga cgcgctcgag    221460
     gcgtcgcagg agcggaaggc ttatcatgct ctcgtccccc ggcgccggag cagacgcagc    221520
     tgcaggaaga gagaggccac cgcgagggcg aggaggacgt tccccatcgc cgaggcgaag    221580
     ccgagattct gcacgagcag gaactgctgg tagatcagca gcggtagtgt caccacgctg    221640
     ccgccgccca ggagcagcat cgtcaggaag ctgccattcg ccagcatgaa cacgacgatc    221700
     gagccggtgg cgatgccgtc gaggctgagc ggcagcgtga cctcccagaa ggtgcgcagg    221760
     cggccggcgc cgaggatctg cgctccctcc tccagttgcc ggtcgatgcc gcgcaggacg    221820
     gcggcgatcg agatcaccat gaagggcacg agcacgtgca cgagcccgat gatgaccgag    221880
     gccggcccct gcagcaggcg gaggggacgc tcgatcaggc cgagatcgag gaggacgacg    221940
     ttgaggacgc cgttgcgggc caggatcacg ctccacccga aggtgcgcat gatgatcgag    222000
     gtcaggagcg gggcgaccag gaggaagatc agcaggctgg tccagcggcc cccgtgccgt    222060
     accaggtagt aggcaatcgg gaagccgatc accacgcaga tcagcgtcgc ctcgaagctc    222120
     acccatacgg tttgagccag gatgccgagg tagtagggat cggtgaacag gcgggcgtag    222180
     tattcgccgg agatccgcgt tccctccgcc gtcggcacgg cgacgctgcg gaccgcgttc    222240
     tcggcgagcg gcaccgcgaa gaacaggatc aggaaggtca gggcgggcag aagggcgagc    222300
     aggctcgaca gccggcgccg ccatgcctgg gccttaatga gcggttgcat cgacgaccct    222360
     cgcggctccc tcgggccagg tgagcgccac cggcgtcccg agcggcaggg ccacgtcggc    222420
     catcggtccg gtgacctgct ggtagacgat gaacggaacc tcgagacctg gcaccgccac    222480
     ctggtagaca tgggtcgcgc cgcgaaagac gtgcccggtg atctggccgt ccacgaatcc    222540
     cgtgatgccc tcgtggccgc tgctgggtgc catgtggatg tgctcggggc ggatggcgac    222600
     cagaacctcc gcgtcggcgc cgggcgggtg cctggaccac gccgtgaacg ccgcctccgg    222660
     ggtaagtccc gcgacaccca cccgcacggc ccccccgctg tcctgcgacc ggacgcggca    222720
     ggcgaggatg ttcgacgttc ccaggaactc cgagacgaag cggctcttcg gccgctcgta    222780
     gacctccgtc ggcgtgccga cctggaggat gcggcccttg ctcatcacca cgatgaggtc    222840
     gctcatggtc agagcctcct cctggtcgtg ggtcacgatg agcgtcgtga tgccgaggcg    222900
     ctgctggagc tgccggatct cgaactgcat ctgctcgcgc aggctcttgt cgagggcgcc    222960
     gaggggctcg tcgaggagca ggacggaggg ctccgtcacc agcgcacgcg ccagggcgac    223020
     ccgctgctgc tgcccgcccg agagctgggc gggatgccgg tcggcgaact ggggcaggcg    223080
     gatgacatcg agcatccgcc gcgtccgctc ctcgatctcg gcccgaggca gacccgccat    223140
     ccgcagcccg aaagcgacgt tctgggccac ggtcatgtgg ggaaacagcg cgtagctctg    223200
     gaacaccatc ccgaggcggc ggcgctgcgg cggtgcgtag gtcttgtcct cgccgccgat    223260
     gagcacgcga ccgctgttcg gcaactcgaa gcccgcgacg atgcgcaggg tcgtggtctt    223320
     gccgcagccg gacggcccga ggagtgcgca catcgcgccg gccggcacgg tgaaggagca    223380
     gggttgaagg gcgacgacgc cgccgaatgc cttcgtcacg gcatcgacct gcaatcctgc    223440
     cgcaccgtta ggcgctatgc cgtctgcccg catcgccgat ccccctcgct acccctgatc    223500
     gtgcgccgat tttttcttct gtaaagagaa taattatctt gaaagaaaaa ttttcccgag    223560
     acttaatcgc cgtaaggctg ctggccgcgc cgcagccggc gttgtcgttc gaccgtggcg    223620
     gaggtcgacc tttcagccgc gaccaggcgc ggcgactcat cgggggtgtc agatgctcga    223680
     gaagttggcg gctatcgtcg gtgcgtctgg catcctctcg tccgcagcag acatggcgcc    223740
     gttcgtggag gactggcgcg gcctctccca gggtgaggcg ctgtgcgtgg tgttgcccgc    223800
     cacgcccgag caggcagccg aggtcgtcag gctctgtgcc aggaccggga cgccggtgct    223860
     gcctcagggc ggcaacacca gcctctgcgg tggtgccgtc cccccgagcg gcggtccgcg    223920
     gccggtcatc gtcgggctgc agcggctccg ccgcatccgc gccatcgatc ccgtcaacga    223980
     cacgatcacg gtggatgccg gatgcgtgct cgcgaccgtg caggcgacgg cggccgagca    224040
     cggccggctt tatgccgtga gcctcggcgc cgagggttcc tgccaggttg gcggtaccat    224100
     cgccacgaat gcgggcggca ccggcgtgct gagatacggc aatacccgcg acaacgtgct    224160
     cggcctcgag gtggtgctgc ccgacgggac gatctgggac ggccttacgg ccctgcgcaa    224220
     gaacaacacc ggctacgacc tcaagcacct cttcatcggc tcggagggca cgctgggtct    224280
     catcaccggc gcggtgctca agctccatcc gctgccgacc gcccgctcag tggcgtggct    224340
     gtccgtggcc gagccgcagg cggcgatcga ggcgcttagc ctcttccgcg cgtcctgcgg    224400
     gtcgcggctc tcggccttcg agatgatcaa tgacagccaa gcggccctcg tcgtgaagca    224460
     cgtgccgggg cgccgcatcc ccgtgacggg gggcggatgg cacgtcctcg tcgaactcgc    224520
     cgacacgggc aacgaggcct ccctcgatgc tgcgatgcag gcggttctgg aggatgcgct    224580
     cgaccgcggc ctcgtgacgg acgccgtcgt cggtgcgagc gaggcgcagc gcgaggcgct    224640
     ctgggccgtc cggcatgggg tgtctgaagc gaacaagaag gaaggcgtca gtctgacctc    224700
     ggacacggcc gtgccaatct ccgcggtgcc cgcgttcatc gcatcggcta cggcggccgt    224760
     gcgcgccatc atcccgggct tgacggtgct ggtcgtcgcc cacctgggcg acggcaacgt    224820
     ccatttcata ccgttcttca gcttcgccgc atgggaggtg ctcgccgagc gtgaggcgat    224880
     cgtgcagcgc atccgccacg cggtcgacga cgcagcgatg gccctcggcg gcaccttcag    224940
     cgccgagcac ggggtcggcg cgacccacct gccggagatg gctcgctaca agcccccggt    225000
     ggaactcgcc atgatgcggg cgatcaagca ggccttcgat ccaagcgacc tcttcaattc    225060
     cggccgactc ctgccgcttc gcgccaccgc gccgacttct gcctcgcact cctgacgatc    225120
     ggatacccca tcatgctgac ggcgaacgcc cttcgcggca tcctgcccgc catcccgaca    225180
     cccgtgcgcg acgacgacac cgtggacgag ggcgcactga aggcgctctt cgcctggctc    225240
     ctgaagcagg ggatcgacgg gatcgtcccc ctcggcggca ccggcgagta cggcgcgctc    225300
     gcacgggccg agcgcatccg gaccgcccgc ctctcggtcg aagccatgaa cggccagggc    225360
     cccgtgatcg ccggcgtcct tgacacgggc taccacgacg cgctccaggc cacccgggaa    225420
     ttcgccgatg tcggcatcga cgcagtgctg gtgctcacac cctactacac caaccctacc    225480
     caggccggca tccgcgacta cttcctgcgc ctcgcggaca ccgcgccggt gccgatcctg    225540
     atctacgaga tcccctaccg cacccgcatc gcgatcaatc ccgccgtcac gcacgagctg    225600
     tcgcgccacg agcgcatcat cggcatgaag gcgtgcaata cggacatgta ccacttcctg    225660
     caggtcgtgg ccggtgtgga cccggacttc gccgtcctca gcggtgagga cagcctgtac    225720
     ccgctgcacg tcgcggcagg cgccagaggc ggcatcatcg tgacggcgaa catcctaccg    225780
     agggcgtggc gggcgattca cgaggcggcc tcggccggcc gcacggcgga ggcgttagct    225840
     ctgcaccgtc gccttatccc cctcatgaac ctggccttcg ccgagaccag ccccggcccg    225900
     atgaagtctg ttatggacat aatcggcgtg aatgcgccgc gtatgcttcc acctctccag    225960
     cagccatcac ctgatctgat aaaaaaactg cgccaagaac taaaaatcca catcgacaat    226020
     tgggaaatac tacctgcttc ggggaggcgg acaagcgcca ttcccgcatc ctgaccgcca    226080
     acacgggtca agacgggcac gaccagggcc ggaaggtgat cgccttgcgt tcgcctatct    226140
     cgacttcggc gcagattccg gccacctctt tccccctagg cggcgtgatc ccgccgggcg    226200
     acttcgcggc tttgcggcag gccagagcct cgggatcttc cctgtcggca acgttattgc    226260
     tgaggcagcg gtcacgctaa tcgccgaact gaacgagcgc cttgcatacg acactcgagg    226320
     acttgatcac gaagctgcga cgctacgagt tcgatgagtc cgccacgcgc atacgccaag    226380
     cttatgcgaa tggcacgatg acttttgata gctctgctat ccggtgacca gcgggcatcc    226440
     caacgacaca agtcgaaggt ccggaagtgg cgcattgccg aacaaccccg gatttgaggt    226500
     cagcgcccat cgtcagctgg catgtgaccc gtcgggttcc ctcccctgcc gtccaaagct    226560
     aagctcccgg cacccccgta tcggcggcaa catgactgct gcagggaagc acgtggcgcg    226620
     ttgccgacca tttccccgag gctcagcggc tgtccgtcgg cactcagctc gactttggcc    226680
     cttcaggcgg cgtggcagag ggcgtagtcc cagggtggtg ggagagcgaa gcggcgtttt    226740
     gttcggtgtc cgcggcggcg tgacgttctc aaactctgct cgcgccagag cacccggcgc    226800
     accaccgcca ggggtcactg aaggtcggcc gcggcttcag gtaccatgcc gccgtcacta    226860
     cctgacacct ggcacgagcg ggaactcggc tggccagcag cgtgacgctg gagaccagcg    226920
     cgaacaggca gggcgtggtg cgggcgatcg ctgtgtcaga ccattgtcgc tgggtctcga    226980
     cacccagatg tgcccgcagc tcttggaagg tcacctcgac gctccagcgg cgcacgaacc    227040
     aggcgacgac ctgctcggga tcgtgcgtca ggtcggtaca cagtggactt gcttcggttg    227100
     agtggagagc ggttgagccg gtgcaccgcc tctcgacctg gacggggctg acgaagccga    227160
     gcgcggcatg gcgccggcgg ggagtgtaga agccgtcgat ggagcgggcc agggcgtcgg    227220
     tcgcctcggc tcgcgtttgg aaggcgctgc gccggaccag ctcgcttttc agcgtcttga    227280
     agaacctctc gaccctcgcg ttatcgtagc agttgccctt gccggacatc gagatcacga    227340
     tgccgtggcg tctggtcctg gatcacggaa cgcgaggttg ccggcacggc cgaggagatc    227400
     gccaagggcc tctcagagac ggactggatc cgcctgtctg ctggggcggg cacgaagggc    227460
     gcgcgcctgt gcgactgggc ctacctgcct ctcgccaccc tgccggccag cgccctggat    227520
     ccagccctcg atgagagtct gtggacgcgc ggattgctgg tgcggcgcag cctctcggat    227580
     ggggctctgg cctacttcac gacttggtgc ccagccgggg cgcccctggc gaggctggtg    227640
     gcggtggagg gccggcgctg ggccatcgag gacgccttcg agaccgccag gacggaactc    227700
     ggcttggccc ccaacgagag ccggtcctgg catggctggc accggcacgt ctcgctggtg    227760
     atgctggcct ttgccctgct ggcccgggtg cgccggctgg cgaatggcgc tcccccaaaa    227820
     acggcggtca tcgccacgct ctctggtgcc ctggtcgatc caagagatcc ggcgcggggc    227880
     gatgcggctg gcgcagcggc gcattgagcc ggccttcata ctggcttggt ccgcatggcg    227940
     tcgcgcccac caggctgctg ctcaacgcgc gcacgtcagc cgtaggccgc aactgtaata    228000
     ctagtgccgg tgcgcagctt cgccggcctc tgtgtcatgg ccccgtccat ccgccgggcc    228060
     ggtcccgacg cgttccgccg ggcgccgcgc ccggggttgc agctgctgcg ggcaggctgc    228120
     agccagatcc cgccgagcgc ggcggcctgc gagcgcgaac tgcccgcgta gatcgccgag    228180
     agcgccagca gacggcgggt ttgagccgga tcatgcgacg ctctggccaa gcggcgcaga    228240
     gcctcggcgt cgaagtccca tcgcagcgga acgggagcgg ccaatccagc cccctcgagc    228300
     ttcaaacccg aggacagact cagagcgagg accccaccgc cagcctgcgt gaggctcgac    228360
     caacaaggct cggtgtaaag tttgcgaatc gtgacgcgcg acagggcggc gagccgaatc    228420
     acaccgagtg cgggggaaag ttccagggga gatgggcttt ggtctcgatg gatgtgccgg    228480
     tctacgcctc gcgcgccttg cgcagccgac ttaaggccat ggacgcgccc gctcggttcc    228540
     aagtgcagca gggactcact tcaaatgcgg tgcatttttc gaaatttcga tggagatatt    228600
     ccgtaccaac gggtgaacgc acgaacgaat gcgctggtct ccgagtagcc caaatcataa    228660
     gcaatatccg aaactcccat ttcactcgaa agaagtttat tgcgtgattc cgatttacga    228720
     aaattttcta ctagtaatcc aaaagttata ttttcttcta caagtttacg ctgcagggtt    228780
     ctgcttgata tcgaaagaga tcgactcgcg tgttcaagag acaagttgcc agcagctata    228840
     ttttgcctta tatatccctc tgttctgatc gcagcagacg tcctctgcac ttcaagtccg    228900
     agtgtcatta tgtttcgaca tagaagactt aacaggttgg aatcggcttg aggcatccga    228960
     ctgactactc gttccggacg gaacaagagt gcgtttgtgc gacactcaaa gcgcaccggc    229020
     gcaccaaatg cagattcgat atctcgccaa tttcccgttc tggcatgctc aagatggagc    229080
     tcgtctggac accagtctgc accggaacaa tgcctgaaaa cgttgcagaa catgcctagc    229140
     gtcaggactg cgtcttgatg acgatttaat attcggggat cctcgatgcg ataagtcagt    229200
     ttatagaaag ggtctgagaa gctaagattt gtggaagtca actgctgatg atacctgaaa    229260
     tattgagcca gattctctgc tgcatgcagg gcgttgtcag acgatatcgc aatataccca    229320
     atcaagccga gctggacagg ctggaattgc tgcccaaagg aaagaccaaa gttatcatca    229380
     cctgatctgc gggccgcaag atccaataaa tcacaatatt tgcgcagatc cagctttgca    229440
     agcggatcac ccaagtggcg actatcaact ccgacgctac cgagaacact gtccaggcag    229500
     agacggcgag actgaataaa gccaaccaac cctgtggcgg cggccgatag gagctttgcc    229560
     ggcccggcat ttccaagggg agctctcatg cccacgatcc tagcggtcca gccaaggcaa    229620
     ttttcaggcc gttccgcgga gccgtaccat cgagcaagcg cctcacggcg tcaacaaacg    229680
     aactgcgatg gcgccagctg tcaattttcc ggcagctacg gtcaaccgtt cccggccatg    229740
     agggtgctaa tgtgcatacc agatacgctg caatcgctga ttgtgctccc ggttctcttt    229800
     cggccttccg tgggcgcgag gataaggcca tggctactta tcagtgcacg ctaggtggtg    229860
     agcgacatac gtttgcggat ttgaaagccg tcctcgcagc cgcctcagca ctcaagtcgg    229920
     gcgacgaact cgccggtatc gctgccgcga attcgaaagt gcgcatggct gcgcgcttcg    229980
     tcctggcgga cactccgctc atgacatttc tggaggactt agtcgttcct tatgaggatg    230040
     acgaagtgac ccggctcatc atcgatagcc acgaccggaa cgctttcgca ccggtggcgt    230100
     cactgactgt cggcgggctg cgggactggc tcctttccga ggccgctgac gagaccgcgc    230160
     tgactgccct ggcgcccggt cttacgcccg agatggttgc ggccgtctcg aagctgatgc    230220
     gcaatcagga tctgatcagc gtcgcaagca agtgtcgagt ggtgaccgcg tttcgcacta    230280
     ccctcggtct cagagggcgg ctggcgacga gactgcagcc gaaccatccc acagacgacg    230340
     cacgcggcat cgcggcaagt gtgctcgatg gcctgctcta cggcgttggc gatgccgtca    230400
     tcggcatcaa ccccgcaacg gacagtgtct ccaatgccat cgctttgatg gaaatgctgg    230460
     atgctgtgcg tcaggagtac cgcattccca cccagacatg cgtgctgaca cacgtcacga    230520
     attgtatcga gatcatgaac cggggcgcac cggtcgatct cgtgttccag tcggtcgccg    230580
     gtacggaagc cgcgaaccgt ggcttcggag tcgaccttaa cgttctgcac gaagcctacg    230640
     acgctgcacg cggtcttaat cgaggttcgg ttgggcaaaa tgcgatgtat ttcgagactg    230700
     gccagggctc agcgctttcg tccggctctc atcacggcgt cgatcagcag accgtcgaaa    230760
     cccgcgccta tgccgtggca cgggccttcg cgccgctgct agtgaacact gttgtcgggt    230820
     tcattggtcc tgaatatttg tatgatggca aacaaatcac ccgtgcagga ctagaagatc    230880
     atttctgtgg caagctgctt ggtctgccga tgggctgtga tgtctgttac accaatcatg    230940
     ccgaagcaga tcaagatgac atggatggcc ttatgacgtt gctgtcggcc gccggatgca    231000
     cgtttctcat cgcaattccc ggctccgatg acataatgtt aaactatcaa agcctttcgt    231060
     tccatgacgt tctctacctc cgctcgttgc tgggggttcg cgcggcccct gaattcgagg    231120
     cgtggctcca agagatgggt gtaaacgacg ggaggaccgc cgcccgcaat caaacgcagc    231180
     tcgaagcgcg ctttatgggg cggctcatcg atgggcgggc ggcatgaaca agccagtcaa    231240
     agagcctgct ccgccttcct cggggagatc cattgcagat ccatgggctg cactgcgtgg    231300
     cgtaacgcct gcacgcattg gccttgggcg cagcggcaac gccatcccca cacgtggcgt    231360
     gcttgatttt cagtacgccc acgccctggc gcgtgatgcc gtccacgaac ctcttgacgt    231420
     ggctgctctc acgcgggcgc tgcagccgct gcggactatt gctgtcgcca gcaatgtgcc    231480
     cgatcgcggt acctacctgc ggcgtccaga ccttggccga gtgcttagcc ccgagagcct    231540
     cacagccttt gagggtctga aacctgcgga cattgttttc gtcgtcgccg acggactgtc    231600
     tgccacgggc attcaagcgc atgctgctcc tcttgttcat gcctgtgcca ccgaactagc    231660
     cgactgggac atcggaccga ttgttctcgc ggtgcaggga cgcgtcgcac tcggcgacga    231720
     tatcgctgct cgtctcggag cgcgcctttg cgtgatgatc atcggcgagc gacccggcct    231780
     gacagtgtca gacagcattg ggatctatct cacttttgga ccacgtcccg gccggcagga    231840
     ctctgagcgg aactgcatct ccaatattca tcccaacggc ggcctgtcct cgactcaggc    231900
     cgcctgcaag ctcggctggc tcgcccgcga ggcgctgcgc cgccagtatt ccggcgtggc    231960
     gctgaaggac gacatgccgt ccatcttaga aagcggcgcc ggcgcaccta aactttcctc    232020
     gtcttgacat ggaaggcgtt cggaaataat cgctcaatga tgattaacaa atcagtaggg    232080
     gggtacaaac atgtctggca ccgacgtcaa gttacacaag ggtcttaacg cgttccatct    232140
     ttggggaatt gctgttggct tggtaatttc aggcgagtat ttcggctgga gctacggctg    232200
     ggcccaggct ggcaccctgg gctttcttgt gactactctg gcagtggcgt tgatgtacgt    232260
     cacctttatc ttcagcttca ccgagctcac gacggcgatc ccgcaagcgg gcggcccctt    232320
     tgcatatgcc ctgcgtgcgt ttggcgatgc cggtggcgcc gtcgcgggat ttgcgacact    232380
     ggtcgagttc gtgttcgcgc caccggcgat tgcgctcgcc attggcgcct atctgaacgt    232440
     gcagtatcca agccttgacc ccaagcacgc tgcgctgggc gcctatcttg tcttcatggc    232500
     gctcaacatc attggagtgc aaatcgccgc gactttcgag ttggtggtga cgatcctagc    232560
     ggtcggagag ctcctcatct tcatgaacgt cgtcgcaccc gctttcagtg tctccaactt    232620
     caccgctggt ggttgggccg ggcaggacac cttcggccca gccgcaatcg gcgggatatt    232680
     tgcggcaatt ccctttgcga tctggttctt tctcgccatc gaaggtgtcg ctatggcggc    232740
     cgaggaggcg aaagatccca agcggacgat cccggtagca tatatcacgg gcgtcctgac    232800
     cctgaccgca cttgcgttcg gcgtcatgct gttcgccgga ggcgccggag actggcgtgt    232860
     gctgagcaac ctcaatgacc cgctaccaca ggcgatgaag cgcgtcgtcg gcgattcgag    232920
     tggttggctg catatgctgg tctggctcgg cctgttcggc cttgtcgcct ccttccacgg    232980
     catcattatg gggtatggac gccagatctt cgctcttgcc cgggctggct ttctacccca    233040
     cgtcttcgcc cggctgcatc cgcgcttcca gacgccgcat ctcgcgaccc tagccggcgg    233100
     cgcggtcggc atcgcagcga tctacagcga taatctcgtc agcatcgccg gccagtcgct    233160
     caccgccagc atcgtgacga tggcggtctt cggcgccctg acgatgtaca tcgtcagcat    233220
     ggccgcactg ttccggctcc gccgcaccga accgaacctc gcccggccct accgggcgcc    233280
     tctctatcct tatgccccag ccttcgcact cattcttgcc acagtctgtt tcctcgcctt    233340
     ggtggtttac aatccgctga tcttcatctt tttcttcatc atcatggcgc tggccgtggc    233400
     tgcgagtcta atcgcgcgtc aaagcggaga agataaactc gccgatggca gcgcatctct    233460
     gtgagttccg ctttatccgt cggcaggacg acgtcctcgt cctgcaaaag ttccggctgg    233520
     tctgaggcgc gccacttcct tccccttgtt ctatccttta ggagcaacga tatgaccaac    233580
     gcccctcgac aaacctccgt gagacgccga ggcttcctgg gcggcctaat gctggcgacg    233640
     acggcagccg gagccgcaat gacgaccgcc cgagccacag ggcaggccga tgaaaaggtc    233700
     ggacttgatc gggcgaagtg ggcgccccgc aaccatgctg ccgtgtcgcg gctgatcgcg    233760
     gagcacggta acacttcacc aaactacaat cccggtcgcc ggccctatgc agtgttcgac    233820
     tgggacaaca ccagcatcat gaatgactgc caggaagcgc tgttgatgta tcagatcaac    233880
     acgctgtcct tcaagctcac tccagccgaa ttcgctgaga ttattcgcca gaacgtcccg    233940
     ccaggaaaat tttctgacga ttacaagaac gccgccggca cgaccgtcga cctcgatgcg    234000
     atctgtgccg acctcgatgc agattacatg tggttgcacg gagcctacaa ggggttgtcc    234060
     ggatcccaac cgctcgctga cattgttaaa acggcgcatt tcgaagattt tagagccaag    234120
     ctgtactttc tatacgaggc agtcaacgat actcatggcg ttgacatcgg ctatccatgg    234180
     gtgatatacc tgctcactaa catgactgtg ccggacgtgt cacgtctcgc cgaagcttcc    234240
     aacgacgccg cgctgggggc agcactagtg cggacaaagt acaccagccc ggtcgaccgg    234300
     gccggcagag ccggtgtcgt gagcgtcagc catttccacg gcatccggct gtgcactgag    234360
     gtgggtgggc tgatggatac actccaacgc aatggcatcg atgtctacgt tagcaccgca    234420
     tcgttagaag atgtagtggc tgtatttgca acatttccga aatatggata caatattcag    234480
     cggagccatg ttctcggatt acgtttagag caagaaggag atgtttttaa aaatgcttat    234540
     cgcaaaggat ggccattgaa ttgggggcca ggaaagaccg ccgtcatcaa gcgggaattg    234600
     gtgtccaaga aaggctatgg tccgatcctt gttgcgggcg atagtgatgg agattacgac    234660
     atgttgcgcg actttgcgga tacacgggtt ggcctcattg tcaaccggat gaagaagggc    234720
     aaaatcggcg aactgtccaa ggctgccgct gatactctcc atgcggaggc accccgcttt    234780
     ctgcttcagg gccggcagga aacaactggg aattggcgac cgcaagaaag tagcatcaag    234840
     tacggcaaga cggagcctca gttgcttgcg taattgctgc aaccggattg gcgtgccaaa    234900
     ggtgcggcga aatgtttgac ggacgttccc gggtgtgagg tcgtcctgcc gacaccgacg    234960
     ccgacgccga cgctgcggat cgtggcactc ttcgcctcca gtacggaact cgtaggggga    235020
     agactgacca gtcgcaccgt cggcatcgac gccttcaccc gctacccgtc cgaggccgtc    235080
     gccgcatcaa cattgcccta ggagcccgtc cgagtaagta cctcgacggc ggcgctttgg    235140
     gatgattcac tcggctcatg gccaaggtgt ttcgctcctg ggacgtcgat cagggctggc    235200
     tgctgccacc ctcgctgcat gagttcgtgc cgcccgggca catggcgcac ttcgtgcgcg    235260
     atacggtgcg cgaggcgctc gacctctcag ccattctcga cacctacacc gaggagcgcg    235320
     gctacccgcc ctaccatccc ggcatgatgg tggccctgct cctctacggc tacagccgcg    235380
     gtctgtactc gtcgcgtcag ctcgcccgcg cctgcgagga gcgggttgac ttcatggccg    235440
     tgaccggcct gaaccggccc gacttccgca ccatcgctga cttccgcaag cggcatctga    235500
     cggcgctctc ggacctgttc gtgcaggtgc tgcggctgtg ccgggcggcc gggctggtcg    235560
     gctttgccca cgtggcggtg gacggcacca agctgaaggc caacgcctcg cgccacaagg    235620
     cgatgagcta cggccggatg aaggcggccg agtcgacgct ggccgccgag gtcgaggctt    235680
     ggctggatca agcgcgcgag gccgacgcgg cggaggatcg ggctcatggg accgaccatc    235740
     gtggcgacga gacaccggcc tggatggccg acaagcagcg gcggctggag acgatccgcg    235800
     ccgccaaggc cgcgttggag gcagaggctg ccgatccgcc cgatccggag gacgaggacg    235860
     ggccgggggc ctcgtcgggc atgcgctggc aaggtcggcc cttgcggggc gaggacggcg    235920
     gtccgcccga ccgggcgcag cgcaacttca ccgacccgga cagccgcatc ctgcccacgc    235980
     gcgacgggtt cgtgcagggc tacaacggcc agattgcggt tgatgcggcc catcaggtga    236040
     tcgtcgcgca tcggctcgtg acgaaccccg ccgactcgcg cgctctcgtg ccgctcgtcg    236100
     acggcgtctg cacccatctc gggcgcaagc cgcgggaggt ctccggagat gccggctttg    236160
     ccaccgaggc gaacctggcc gcgctgcagg agcgacggat cacagcctat ctcgctccgg    236220
     gccgtgcccg tcacggcgag gcggatgcag caggtcgccg gaggctgacg aagatgcccc    236280
     tgatgagcgc gatggccgtc cgcctgaagc gggctgggcg ccggagccgt taccgtctca    236340
     ggaagcaggt cgtcgagccg gtgttcgggc agatcaagca ggccagaggc ttccgacagt    236400
     tcctgctacg tgggctcgat caggtccgcg gcgagtgggc gatgatctgc accgcccata    236460
     acctcctgaa gctggcgcag gccgcgcgct gagcctgtgg cgcaggagcc atccgcccag    236520
     atctcaacct tagtcccaac gcatcaaacc gttactcgga cgggctccta gtcgctcgct    236580
     tcaaccaatt tgaaggatct ggtgcgtcgc ttttatcgcc acggtggcgg cggagggaag    236640
     catggctgcg aaggagattt cggtaaagcg ctaggtggtg cgatgaagcg ccgatgagcg    236700
     cgagcagctc gaggccctgc tcaggaaggg aaagagcccg gcgcaaaggc tgctgaaggc    236760
     tgggatcttg ttgaaggccg ctgtctcgga agccggtgaa ggctggcgcg acagccggat    236820
     catcgaggct ctggagacca gcgcttcgat ggtttaccgg gtgcgcaagc aggtggtgga    236880
     agagggcctt gcggctgttg gagagcaagg tcgtggacct cggcattgtc gatcgcgcca    236940
     gcgactcgac gatcgggcgg acgcttaaaa caacgctctc aagccgcatc gacggccatg    237000
     ctgggttatt ccaccgaagg ccaacagcgc gttcgtagcg gcgatggaag acgtgctggc    237060
     cgtgtacacg cggccccgcg atcccgatgg agccaggccg cccggcccgc ttcgaccatg    237120
     agtacgcgcg caacggcacc gccaatctgt tcatgatgtt tgccccactc gagggctggc    237180
     gccatgtcaa ggtcaccgat cgccataccg cggtggatta tgcccaggtc ttgcaagatc    237240
     tggccgatat ccgcttccct cgtgcccgga ccatcggtct ggtccaggac aagctcaaca    237300
     tccacagcaa ggcgtcactc tacgaggcct ttcccgctgc cgaggccagg cgcctggtcg    237360
     aacgcttcga gtggcactac acgccgaagc acggcagttg gctcgatcgg gcggcgtccg    237420
     aactcggcat ccgatcatcc cagtgcctcg accgccgcat ccccgacaag caaaccctca    237480
     tcgacgaagt cgccgcctgg gaccaggagc gaaatgccaa tcacgccaag gccaactggc    237540
     acttcacaac agccatagct cgcctcaaac tcaagcacct atacccttca agctgactga    237600
     agcgggcgac taggacgacg gcaagcctat ccgcaagacc acccacgccg acatcccgct    237660
     cgccattgac cgtataaatg acagcactga tcggatatgc gcgagtgtcg aaagccgatg    237720
     gcagccagct tcatgacctt cagcgggacg ggctgatcaa gaccggcgtt ctgcccgaac    237780
     atatctatga ggatgcagca tccggccgcc gcgacaaccg gcccggcctc gatgcttgcc    237840
     tgaaagcgat gcgtgcaggt gatgcactcg tcgtgtggaa gctggaccgg ctcggccgcg    237900
     atctgcgcca tctcgtcaat ctggtcgatg acttgacgaa gcggaacatt ggtctgaagg    237960
     tactggccgg cgaaggcgcg tcgatcgaca ccccgacgcg cgataggcca tggcctcggc    238020
     cgtgcggtcg cgcagctcac ccaggcggtg gaagaacacc gcccgcgcca gggcgtgccg    238080
     gctctccccc ttgttgaggt tggcgtgcga gcgccgccgc agttcgatgt ccatcaccca    238140
     gtcggccatg aagatcgagc gctcgacgcg gccgatctcc cgcagcgcct tgttgagtgc    238200
     attctggcgc gggaaggccg caatcttgcg caagatcacc gacggcggca ccgtgccggc    238260
     gcggatcgag gcggcaagcc gcagcacctc tccccagttc tcctcgacga gcgccaggtc    238320
     gaccgcaccg ccgatcatgg gcgcgagcac gccgtagtcg gcccccttgt cgatgacgaa    238380
     cagcttgcgc tcgcccagat cccggatgcg gggcgcgaag cggtagccga agaggtggaa    238440
     cagcgcgaag acgctctcga cggcgccagc cgtgtcggtc gcgtgctccc cgattgcgac    238500
     cgcgctctcg ttgtgcagga gcccatcgag cacgtggggc gcctggctcg ccgcggccgg    238560
     gatgaccttg gagtagaacg aggcgaagcg gtccgagatg aagccgtaga acaccgcgcc    238620
     cggttccgag ccgtggcggg cgttgtagtc ggccgcggcc tcgccccgac cacccgccgg    238680
     gaagaactgc ccgtccgacg aggacgtgtc gcccacgccc cagatcgccg acaggggctc    238740
     ggcgtgctga gcatcgacga tcgcggccac gcccgccgcg taggtctccg gacggacgtg    238800
     ccgctcgatc accaggttga gctggtggat cgtcacgccg cgcgagctct cggccatgcg    238860
     gttgaggccg aggttcgtgg cgtccgccag aattgcgccc attagcgccg gctcctcggc    238920
     cgcggcgggc tcgcccgtgc ggaagtgcgt gaagcggttc gcaaacccgg tccaggcgtt    238980
     cacctccgcg agcaggtccg tgatgcgcac gcgcggcatg agattgtaga gccgcgacga    239040
     gagagccttg gcttggtcct gctcctcgcg gcggaccggc gacacggtga gcccgtccgc    239100
     gttgatggca gcgtcgggca actcattctt ggcagcagcg gcgctcagag cgctcagttt    239160
     ctgttcgagg ctcgcagcgc gctcggcctg ccacgccgcg aagctgtccg gcacccgcga    239220
     gcccgagccg gccctcggtg cgcatcacgg caaaggtggg ccggggcaga aggtagtcgt    239280
     cgaaggtgcg atgggcgcgg ctgccctcca cccagacgtc gcctgcccgc agccggtcgc    239340
     gcagatgcac caggaccgcg acctcgtagg cgcgggcgtc gaagccctcg ggtccggccc    239400
     agggcaaacg catgagacga gttaccctgt gagcagctgg gccatgtcgg cgtcgtccca    239460
     ggccgcggtc gatcaagggc gacgcggcgc aggagcgcga ggtggcgcgc cgcacagcgc    239520
     tcgcgcacgc ggctgcgctc ctcgccgaag ctcacctcca agacccaggg ctcgccggtc    239580
     gcgagggccc cgtggcgccg gatcgcctgg gccagcacct cggacggcgc ggtcgagctg    239640
     ccgagggagt ggcggacctg cgccggcacg ctgtcggtgc cattcccgcc gcggagggtc    239700
     tcggtcgcga gcaccgtcgt cagccccggc caggtgcgca gcgtggccaa gcagctcacg    239760
     tcccgacagg cgaagacgcg ccggcgtacc agacgaccag gggtgtcgtc gcacgcgtcg    239820
     gaacagggcc gccggacggc cccgcgggcg aaggcgtgcg cggcacacca ggcccggacc    239880
     tcgttcgtgg accttgccct gattggcctt gagcgtcagc aggtaggcgg ccccgcgtgc    239940
     cagaatctgg ctggccacct cgcgccgaca cgagcgcgcg tccaggcccg gcagccgtca    240000
     agctgcagcc cctccagcac ggccgcgggc tcaccgcctt tctggtccac ggcgcgctgg    240060
     gccagcacca gcccgcgtcc ggtcgcgtcg gcgctgacca ggtgcaaggg cgagcggccg    240120
     cggtcgaagg accgacggat caccttgcca tccacggcga cctgttcagg tccggcggct    240180
     gcactgtccg catcggaccg gaacgctcct cgcccccagg ccaggcagcc gcgctcgaac    240240
     ccgtccgggt cgatcagcat gaccacgcgg cgaaccgtgt cgtgcgaggg gatgccgccg    240300
     ggcagctcca ggacgccgcg cagccacgcc tccgtgcagc ggccggagag agcgctgtcc    240360
     tcgaacggct cggcctcggc cccgagcgca gaccgcgatc accaggatgt cccccagccg    240420
     gtgctcgatc ttgccggggc ggcgtggatc ctcccgcgtc gcgaacggct cgaccaagcc    240480
     ctcgatcatg gcgcgcctcc tgccggaagc gcgccatctg acgccatcac cgccagcgcc    240540
     gggcgcccgt cagagttcat gcgattgccc tggcgcgagg gcggtcccat tcgcataatc    240600
     ccctactctg gaacgcgtta cggtccctcc ggacagtccc ccgaagatct cgcgcgggcc    240660
     tggaaccggc cgcctgtcga gggccagttg accggcctcc ggcggggcct cgcgggcgca    240720
     tcgctggact gtgctaacct tgcgccggct cgtcgccgtg cctcctcttg gcggcgggct    240780
     gcgggcgggg cttgaggggg cgttccaagg gctctgcccg cacctgccgg gtaaaaagag    240840
     gccggctcgg gagtcccggc cggcgtcgaa ggaagtgctc tgcgtcgcgg gtcaatcgcg    240900
     cgaccccgag ccatgttccc gactagccgc tgtcaggcag agcccgcggt tcccttcccg    240960
     cgcaaaggag cgccggctcg gggtaggagg acccggccgg cgctggaaga aggacccgtg    241020
     tctgcggcct atcgcgcggc ggcccgcaat ggttccagcg gcttcaggat ccccgtctgg    241080
     gagttcgggc gctagatcgc ctggaggcgg tgaggaccgc gaccatgctg gcgaggacgg    241140
     catgaaccca cgtgaacgag cactgctggt gatcctttcg caggccggcg agtgggtacc    241200
     gctcgcagag cttcgatcac gcggtctcgg cgacatcgca atgctggcgt ccaatgcggt    241260
     cgcgcagggc tgggtggagt acggcctgag gcacgtgacc tgcgcatcac ggatcagggg    241320
     cgcacagcct tggacagggg ccactgatat gccgcgccgc ggctcctgaa acctctaccc    241380
     cttgacgagc gagaagcgca gcggaagggt cttggcgcgg aacacgatcg tctccggccg    241440
     gaaccgccac aggcgctcgg cgccctcaaa ggccgcaacc tcaggcgctt ctaggatgac    241500
     ctctgcctgg cctgtcatct gcagaaggtt gccggtcgcg aagtccacaa agacgagccc    241560
     ggcgcgcggg ttcaccacca tgttcccgag cgtgttgaag aaccggttgc cggagaagtc    241620
     tgggatcgtg aggacgccgt cactgccgat ccgtacgaag ccgggacgac caccacggtg    241680
     cgagacatcg acctgccgat gcccgccgtc ccgttccacg taggtggcga cgaagaaggt    241740
     atcggccccc gcgatgatct cttgggcgcg atcgtcgagg tggctcgaca ccgcaggggc    241800
     tgccgcaata acccctgagt cgggcacgaa ggtgctgcgg cgtggctgga tgtatcgcgg    241860
     gcagttgccg tagctctcct cgacctcgat cgcgaacccg tcgggtccgc tatctcggac    241920
     cgttccgttc agacggtttc ggcgccgcgt cgcgagttca atgccaagca gcgcgaccgc    241980
     cgcaccgtcg tttatgccag catcggcagg atcggtggga tcgcgcgccg cctccactcg    242040
     gaggtggaac gggtcgggcg catggaggaa gcctggcttg ccggctcgca gcgttgccca    242100
     cacagcgcca ctcgcatcca ctgcccccag caccacgaac gggagttgcg gatagaagct    242160
     ctggtgctgc tcgatcaggt gatcgcggat cacccgatga ccgagcccct ccatgcgctc    242220
     ggcgacgccg aggctgttct ggatcgcaat ctcaccctcg tgccagggcg cggctgggca    242280
     gggctcggcc gtcctcacga tgatatgctc ctagaaggga ctgaggctca ggcgactgcg    242340
     ttcagaccgg ctgccgtctt cgtgaagggc gtgaaaccgg gcagtgcctc gatgcggccg    242400
     agccaagcgc ggatgtttgc gtaaggagac aggtcgacgt ttccttcagg cgccgcagca    242460
     atgtagctgt agagcgcgac gtccgcgatg gttgggcggt cggcggcgat ccaggaacgc    242520
     gcggcgagtt cggcatcgat gagcttgagg atcgcgtggg cgcgggcgat cacctcatcg    242580
     gcgttgaagg cagcgccgaa cacggtgatc aagcgggcgg cagccgggcc gaaggcgatc    242640
     tgaccagccg caaccgacag ccagcgctgc acgcatgccg ccccgaccgg atcgtcgggc    242700
     agccagtcgg tacggccgag cttctttgcc atatagacca ggatggcgtt cgagtccggg    242760
     atgaccgtcc cttcgtcttc gaggacgggc acttggccga atgggttaag cttcaggaaa    242820
     tccggcgatt tgtgctcgcc cttggcgaga tccacctcga cgatctcgca aggtgcgccg    242880
     acgagggaga ggaacaggcg cgcccggtgg gcgtgcccgg atagcgagcg gtggtagagc    242940
     ttcacggcgg ttctcctcgt acagggcggc gatgtcgacc gtggcgagag ggaaactgtt    243000
     attccacacc gtgtgaaccg gcatatttgg caatcgacta ttgctcgaaa tggaataaat    243060
     ggctccgcag cgactgggct gagaggcatt gccatggatc gctggcaggc aatgaggatc    243120
     tttgtgcggg tggccgatag cggcggcttt tctggagccg cgcgtcagct caacatgagc    243180
     ccgcccgcgg tgacccgcgc ggtcgcggca ctcgaggatc tgatcgggac ccgcctgctg    243240
     acgcgcacaa cgcggtcggt gaagctcacg gaggcgggcg gtcgctacct ggaggattgc    243300
     cgccgcatcc ttgcagacat cgaggaggcg gaagccgccg cagcgggatc ttacgcgacg    243360
     ccctccggcc tgctgacagt caccgctccg gtccagttcg gtcgcatcta cgtgctaccc    243420
     gtcatcaccg agtatctctc gcgctactcc gctgtcacgg cacgcgcgct gttcgtcgac    243480
     cgggtgatca acatggtcga ggaaggcgcg gatgtcggag tacgaatcgg gcacctggcc    243540
     gattcaggtc tgacggccac ccgggtcggc acagtccgtc gggtcgtctg cgccgcaccg    243600
     agctatctcg atcggtatgg ggcaccgaaa gaacctcgcg atttgcacga tcacgccgtc    243660
     atcggctcaa cgagcgtcgg aggcttggcc gagtggcggt tcggtggtgg gaggcggaca    243720
     gctgtgacgg ttcgtcctcg gctgatctgc accacgatcg atgcggcgct cgcggccgcg    243780
     atcgacggac acgggatcgt gcgccttcta tcttaccaag tcgcgcccgc cttggccgaa    243840
     ggccgtctcc ggaccgtgtt tgacgatcaa gaggaggagg cgatgccgat ccatgtcgtg    243900
     agttccgatg gcaggcgggc gccagccaaa gtgcgcgcgt tcatcgatct ggccgtgcag    243960
     cggctccgcg ccaatccgat gatcaacgca gataatccgt aggctcagcg gcttacagca    244020
     tcgctttgta gggagagcca gccgcaggtc gcggacgttc ggcttggact gaactaccga    244080
     cgttcagatc tgctctggcc aatgtccgct tctgtgaagg gtttcggacg ccggcccgga    244140
     tctgacgctg cggagggccg gcgtccgaaa gcctccgagg aagaaaccgc ggaacaacga    244200
     actgcgcgtg ccgaccgagc gatggggatt gagcggggca tccgggtggg aaggcgtgtg    244260
     gggcgtcgtg gcggtgcagg tgatcggcga cgggcccggc cactgctcag cgggatcggg    244320
     ccactcaagc agggtgccgg cgggttggtt ggtgccggga gcgggcggga ggatcggtct    244380
     ttgtggcctc ttatccagat gccctggatg tcgttagcag agaaactcag aagatctttc    244440
     acgtaacgtc ttgggcgcac gctctgaccg cagcaacgaa cgtttcgact tcatcttcgg    244500
     aattataata gtgaggcgaa actctcacaa cggggggtag atgtcgggcc gaggcgtcaa    244560
     tcggtgtgct tgatggcggc gaaaccgaga cgttgatctg tttctctttg agctgttgca    244620
     tgaccagcgc ggcctcaaca ccatcgagcg tgaacgagat gatggccgat cgcctgctgc    244680
     ctagatcgcg cagctgcagg cccggtatcg ccgcgaggtg agcgcgcagg aggtcggcga    244740
     gcctgcggca tcggtcctca atcgcttcaa gtccgatggc gagcgcgtaa tcgaccgcgg    244800
     cgcgcaaccc caggcgggtt gagtaattgg tttcccaggt ctcgaaccgg cgcgcgtcgg    244860
     gacgaagttc gtaatcgcca agctcaacga ccttggcgcc gaacaggtcg agcatcgcgg    244920
     gctcggtccg atcaagcagt gtcttgcgga tatagagaaa tccggtgcca cgaggggcgc    244980
     gcaggaactt gcggccggtg gccgtcagca tgtcgcaccc cagggtatca acatcgacag    245040
     gcatctggcc gaccgcctgg cacgcatcga gcagataagg gatgccgtgc gcgttcgcga    245100
     tttttccgac ttcgacggct ggattgacca gaccaccgtt tgtggggatc caggtgatgg    245160
     cgatgaggcg aaccttgccg tcgatcatcc tttcaagagc agtaggatcc agtgcgccgg    245220
     catcatcgtt cggaatgaca tcaacagtga cgtcgaacct tttcgcgatt tgcaggaacg    245280
     cgatgtaatt ggcggcaaac tcagcgctcg tcgtcaggat gcggtcaccc ggctggaagt    245340
     ccatcgcgta gaaggcgcgt tgccaggcga ccgtcgcatt ttcagtgaca gcgatctcat    245400
     cacgatggcc gccgacgagc ttcgcgatgc tgttatagac gtcatcaagc tgaccggcct    245460
     gctcagccgc cgcctcgtaa ccgccgattt cggactctcg cccgagatag tccgtgacag    245520
     cctgcaacac cggggctggc atcagagcag cgccggcatt gttgaggtga atgcggtgca    245580
     aaacccccgg ggtgtcacgt cgcacagccg tgagatcgag actgtcggtc cttgatgcgg    245640
     tcattgtgtc agctgcccga tatctgagtt ctgcttggcc gtttttggtg tgagaacgcg    245700
     ccccggaagt ggccggcgcc tcggcggaag gatctgccct gcagtgaggg ttgctcagct    245760
     ggtcgggcaa ctcagcacgt gttcgctggc cggagcagca tcccggggca gcagatcgaa    245820
     caccttgaat gtgtgatcca ggaacctctc gaacgccgcc gtgagcaggc tgtccttccg    245880
     gtagaccagc aacgtctgcg cgcttcccgc gtcctcgggg agggcatgga tggagacgcg    245940
     tccggtccgc tgcatcggcg cggcgacaac ccgcgggagc agcgacacgc ccattccggc    246000
     ttcgacgcag ccgatgatcc cgtccagcgt gccgaactcc atccggcgga cgtgcaccag    246060
     cccatgcgcc gcgagaattc cctccaggcg caggcggtag gagcagccgg tcttgaacac    246120
     gagcacacgt gcttcccgct tgctcgccag catggcgatc acgtcgtcat gactccggat    246180
     ctttgctccg gccacgagca ccagctcttc ctccagcacg gggagggtcg ccaggtcgtc    246240
     ctggctgacc ggtcccgaga cgaaggccgc ttcgatcttc cgctccagca cagacgcgat    246300
     cagcgcctcg gtcggtccca actccagctc gatgtccact tcggggtagc agctggcata    246360
     ggctgtcagc agcttgggca agcgcagggc cgcggtggtt tccatggagc cgaggcgcag    246420
     ggggccgcgg ggggtttcgt cggagaggac cgcctgctcg gcatcggcca gcaggcgcgc    246480
     cacctgtgtc gcgtagggca acagccgctc acccgcccgg gtcagggtca ccccgcgggt    246540
     gccccggtag aacagcgggg tgtgcagcgc ctgctccagc gcccggatac gcccggtcac    246600
     gttggactgc acggtgttga ggatggttgc cgcccggccg atcccgcccg cttcggccac    246660
     tgccgcgaaa aacatcaggt cggtgctgtt catggcatcg caatccgaga tgggggtcat    246720
     ctgaactaat cattattcga gacggcctca tccggctaca gaaatatccc agctacgggc    246780
     tggcgctgag accttgcccg agcacgggag ggaacatggc gctgcgcacc cggctgactg    246840
     acttcttcgg gatcagacat cccatcgtgc tggcaccgat ggaccccgcc gcgggcggtg    246900
     ccctggccgc ggcggtgagc gccgcgggtg gactgggtct catcggcggc ggctacggcg    246960
     accgcgagat cctcgaggcc gagttcgcca aggccggtaa tcagcgggtc ggctgcggct    247020
     tcatcacctg gtcgatggcg aagagcccgg agctgctgga tctggcgctc gcgcgcaagc    247080
     ctgcggccat gatgctttcg ttctccgatc cggcgccgtt cgccgagaag gttcatgcgg    247140
     ccggcgttcc gctgatctgt caggttcaca acctcgacca tgcgcggcgc gcccttgacg    247200
     tcggcgcgtc cgtgctcgtg gcccagggca ccgatgccgg cggccatggc ctgaccaccc    247260
     gcggcacgat cacccttgtc ccgagcgtcg tggacctggt ggcccgcacg cggccggagg    247320
     cgctggtgct ggctgccggc ggcatcgccg atggccgggg cattgctgcg gcgctgatgc    247380
     tcggcgcaga cggcgcgctc ctcggcaccc ggttctgggc aacacaggaa gccctgatcc    247440
     acccggccgc caaggaccgt gtggtcgccg ccaccggtga tgagacggtg cgcacctccg    247500
     tctatgacat cgtccgcaac cggccctggc cggccgagta caccggccgg ctgatgcgca    247560
     acaggttcat cgagacctgg cacgggcgcg aggacgagct gcgcggtctc gcggccgggg    247620
     agcgcgagaa ggtcgaggcc gccgaccgga gcggtgacta cgacgtctcg aacgtgaccg    247680
     tgggcgaagc catcgggctc gtccaggacc tgccgccggc cggcgagctc gtggcgcgcc    247740
     tcgcggcgga gacggaagcg cggctgaccg gcgtcatgcg ggcggttgtc gtctgacccc    247800
     tgaaaaccca ggaggcccca tgcccgttct tcgctttgat cttgtcggag gccgcagccc    247860
     cgaggagctg caagtgctcc tcgatgctgc ccacgatgcc atgctggagg cgtttcaggt    247920
     cacgcccggc gatcgctacc agatcgtgca cgagcacccg gccgcgcacc tggtcgtgga    247980
     ggacaccggc ctcggcattc cccggaccga caagcgggtc gtgctgcagg tgaccacccg    248040
     gccgcgcagc cgggagatga aggaaacctt ctaccggctg ctctgtgaga acctgcaggc    248100
     ccgctgcggg atctccccca cggacgtggt cgtctcgatg gtcagcaaca ccgacgacga    248160
     ctggtcgttc ggccacgggc gtgcccagtt cctgaccggc gaactctgac cagctccttc    248220
     caggcatcat tgtgccgtgc tggactaacc ctgcgcggct tttggtattt ataaaagtaa    248280
     gtagcgtatt tgtaagcgta tcaactggca cgatccatgc ctttgctgcg gtgatcctct    248340
     cattattgga gacgctacac tatgcgcaca gagccaatac acctgcgcac tgctgacgcg    248400
     cagaacgttt ctttgggtgc catcctcacc accatcctca ttctggttta cttcggcttc    248460
     gtcgccatgg gcgccttcgc cccggccctg ctcgccgaac cggtggtgag cggcggcacg    248520
     gtgacctggg cattcgccta cggcctgttc gtcatcgtgc tcggggtcgt gctgacgggc    248580
     ctgtacgtgc tggtggtcaa ccgcgctgaa gcgcgccggg cgggggagtg agcctcatga    248640
     tcctgcaccg gccgaccgcg cgcaccgcgc tggccttgac cgctgccctg tccacccagc    248700
     cggcctgggc tgccgccgga gaaacctccg gcgtcaacct gacggcgatc gggcttttcc    248760
     tcgccttcgt cgtgctcacc ctctggatca cctggcaggc ggcccaacgc accaagtcgg    248820
     cggacgattt ttatgccgct ggcggcagca tcacgggctt tcagaacggc ctcgccatcg    248880
     ccggtgacgc gatgtcggcc ggcgcgttcc tggggctcac ggcgctggtg ttcacctcgg    248940
     gctttgacgg gctgatctac gcgatcggct acaccactgg catgccgatc gtggtgttcc    249000
     tgctggccga gcggctgcgc aagctcggcc gctacacctt caccgacgtg gtctgtgccc    249060
     gcctggcgga gggaccggtc cgggtattcg ccgcctgcgc ctccctggtc gtggtcgcct    249120
     tctacctgat cgcacagatg gtcggcgccg gccagctgat ccagctcctg ttcgggctcg    249180
     attacctcta cgccgagttc gtcgtcggcg tgctgatgat ctgttacgtg atgttcggcg    249240
     gcatggtcgc gaccacctgg gtgcagatca tcaaggccgg gctgctgctg gccggcgcca    249300
     cgctgatcgt gctgctggtg ctggcggcgt tcgggttcga cttcggcgcc ctgctcgccc    249360
     gggccaccgc agtccacccc aagggcgcgg cgatcctcgc gccgcaggcg tcagctaagg    249420
     acccgctctc ggccctgtca ctgggtctgg ccctgatgct cgggaccgcg gggctgccgc    249480
     acatcctgat gcgcttcttc accgtgccgg atgcccgtgc agcgcgcgtc tcggtgttct    249540
     gggcggcgac gttcatgaac tacttctacg ccctggtgtt cgtcctcggc ttcggcgcca    249600
     tgaccctgac cgccggggac ccggcctaca tcgatgcagc cggcgcgctg cgcgggggcg    249660
     gcaacatggc cgcgatccac ctcagccatg cggtcggcgg caacgccatg atggggttca    249720
     tctcggcggt ggccttcgcg accatcctgg cggtggtctc cgggctgacg ctggccggcg    249780
     cctcggcggt cagccacgac ctctatgccg gcgtgatccg ccgcgggcag ctcgatgaga    249840
     ggagcgaggt gcggatctcg cgcatggcaa ccttcgtgct cggcctgatc gccatcgggc    249900
     tcgggattgc cttcaagggg cagaacgtcg cctacatggt cagcctcgcc tttgcggtgg    249960
     cctgctcctc gacgttcccg gtcctgctgc tggccctgta ctggcggggg ctcaccacgg    250020
     ccggcgccgt ggcgggtggc acggtcgggc tcctgagtgc ccttggcctg accctgctcg    250080
     gaccggcggt ctgggtgaag gtgctgggca acccggcgcc ggtgttcgcg atggatccgc    250140
     cgacgctggt caccctgccg ctggcccttg tcacctgctg gctggtgtcg cgcctggacc    250200
     gcagtgcgca gggtgcgagc gaccgcgcgc gttttgaggc gcagcaggcc gcgtgagcgg    250260
     ccgccgaccc tgtcctgcct gcgccggcca cggtctccgc cgtggccggt gttctgcgct    250320
     ggaaaggcat catgatttca gatgaggggc atctgcagga atcattattc atgacggcgt    250380
     gatgcgccta catgctgtct cacgatgttg tccgcgccgc cacgaggcct gcagcccggg    250440
     acgctcccca tgatctacaa gctgttcgcc agacaggcgg tcgccccggc ggtggacgcg    250500
     cggatccgcg agatcatcgc ggcgctggat gaggacaaga tcgctctcta cgcgcaggcg    250560
     ccggcggacg aagtccgcgc gccacgcctg attgaacatg tccaaactag agtgactgcc    250620
     tgcagtcaag cgcccgactg ggccgagatt acagtagggt tcggcacgct cgatgtggac    250680
     atcagcagtg atctgtgggg ctttattgtt gtgccgcgga cgctgcgcac gttcagcatg    250740
     accgaggtgt cagtggtggg ccccggtcat ccaaccatga tgtgatggag aaacgtcagc    250800
     ggcagcgagg aactgactga caacaggcag catccgtgaa aggattgggc atcatgtctt    250860
     tgacggcgca ctttcttgat ctgctggaga tgaaataccc gatcgtgcag gcgccgatgg    250920
     ccggcgtctc cacgccggag ctggcggcag ccgtctccaa tgccggcggc ctgggctcga    250980
     tcggtattgg ggccagcacg gtcagccagg cacggcagat gatcgaggcc actcgcgcac    251040
     ggaccgacag gcctttcaac gtcaacgtgt tctgccatcc tccggcgccg cgcgacaccg    251100
     cacgcgagag cgcctggctc gcgcatctgg cgccgctgtt tgcggagttc ggcgcgaccg    251160
     tgccggaaac cgtccgggag atctacaaga gccacctgga ggatgaggag gccttccagc    251220
     tgctgctgga gacccggccg ccggtggtca gcttccacat cggtctgccg gaggcgggcc    251280
     gtctcgccgc gttccgtgat gccggcatca aaaccatggc cacggcaacg aacccggagg    251340
     aagccgcaca gatcgaggca gccgggatcg acgtgatcgt ggcgcagggc atcgaagcgg    251400
     gcggccaccg gggcatgttc gatcctgagg cgcatgaccc ggcgctgagc accagcgtgc    251460
     tggtcagcct gctgatccgg cagaccacgc ggcctgtgct ggccgcgggc gggatcatgg    251520
     aggggcgcgg catccgggcg gcgctcgacc tgggcgcggc cggcgcccag ctgggcacgg    251580
     ctttcatcct gtgcccggag agcgcggcca acgccgccta ccgcgcggcg ctcaggagtg    251640
     agcgggccta cgatacgcgt ctgacctcgg cgatctcggg ccgccctgcg cgcgggctgg    251700
     tgaaccgcct gatccttcac ggcctgacgc ccggcagccc gccggcctgc gcctatccgc    251760
     tggcctacga tgccgcgaaa ctcctgcatg ccgctgcagc ggcccagggg agcgatgcgg    251820
     cggccgcgca gtgggctggg cagggagcac cactggctcg cgagatgcca gccgctgacc    251880
     tgctcgctca gctgatccgt gagatgtgaa cacacttcgt cttcaaagaa ggagatcgtc    251940
     atgacctcag gcacactgct cgcaggattg gccgcggcat ccatcgccag cactagcccg    252000
     caggccgttc cctccgtctc ggtgacgacg acctaccatc gcaccgaggt cgatggcgtg    252060
     agcatcttct atcgagaggc cggccccaag gacgcgccaa caatcgtcct cctgcatggc    252120
     tatccctcct catcacgaat gtatgatcca ctgctgccgc tattggcgga ccgctatcac    252180
     ctcatcgccc cggattatcc ggggttcggg cacagcgacg caccaccgcc ctcgcagtat    252240
     tgctacacct tcgatcatct tgcagagacg acgcacaacc tcctcacgaa gcttggcgtc    252300
     ggccagtacg tccttttcat gcaggactac ggcggccccg tcggcttccg gatcgcactc    252360
     gcccaccctg agcaggttcg cgcgcttatt gtgcagaacg ccaatgccta tgccgagggc    252420
     ttaggcgtga agtggaaggg aatcgccgac tactggcggg atcccgctgc ccatcccggg    252480
     cagctcgatg cgttcacctc gctcgaggga gcgaagcaac gccatctcgg caacagcccg    252540
     aacgtcgaac gctatagccc tgacacctgg atggatgagt acgcgatgct gtcgcggccg    252600
     ggcagccggg agatccaggg agcgctgttc tatgattaca ggaccaacgt ggcgtcctat    252660
     ccggcctggc aggcatggat gcgtgaacac aagccgccaa ccctggtcat atgggggcgt    252720
     tacgatccgt cgttcatcgt cccaggcgca gaggcgtaca agcgtgacct tcccgacgcg    252780
     gaaatccgca tcctcgacgc tggccacttc gcgctcgacg agcaggccga tgaggtcgct    252840
     cgtttgaccc gtgacttcct tgagcaccac ctgtcgccaa gggatccgac cgggatgcag    252900
     cgcgcaaggt aggggttctg atcgacgaca tgaccagggc ccgcgcgcct tattctgatg    252960
     cttcactgct gagggttcac gacctgaatc gcgcggtaat cctgggggat ggcaagcaaa    253020
     cgtaggaagc tgcggcgcat ggtttcctcg aagccgaagc cgcgccgttg cgagatgcgc    253080
     ttcactggct aacgtacctt tgacaacgtc tggcaggcgg cttcaaccct cagccgctcg    253140
     accgctcgga cacgagtgag accagtctcc tccaagtatc gcctgctgaa gctacggaag    253200
     gctgcgctcc atgcacggaa ggacggggtg tcgaagggca ccctgtcctc attgcgcaga    253260
     ggctcggccg ggacgttacc gttccgagta tgtgtcccgc gatgcaccga acatgatccg    253320
     ctgccgcatc tcatggaagg tgccctcagc accgtcctcg tcggtcacga gcgagacaac    253380
     gaccgcgatg aggaaggaaa gaggcatgct gatgagggcc gggttcttca ggggaacgaa    253440
     ccaccaagcc tgagagacat cggcgaggct tcgtcccagc acgtccacct ggaccgtagg    253500
     cgagagccag atcagcagga gagccgagaa tgtgccgaag aggatgctgg cgacggcagc    253560
     cgaggtcgtg aaccgcttcc aggtgataga aagcagcagg gcggggaaat tggcggaggc    253620
     ggcgacggcg aacgcgagcc ctgccatgaa cgcgacgttc tgtccctcga agacgatacc    253680
     cagaaatact gccagggcgg ctatgacgac cgttgcgatc cgcgcgaccg tgagttgctc    253740
     gcgctccggc gaatggccac cgcgaacgac gttgacccag agatcgtggc agactgtggc    253800
     caccccggag agcgtcagcc cggcgacaac cgcgagcatc gtcgcgaagg cgaccgcgca    253860
     gatgaagccg aagaacccgc tgccaccgac cgtaagagcg aggagggggg ctgccatatt    253920
     gccgccgccg ccggccttcg tcacggcctc gggcccgacg aggaccatcg ccccgaagcc    253980
     gatcacgaag acaaggaggt ggaacgagcc gatgataccg gtggcataca ggatcgacat    254040
     ccgggcctcc ttgacgtccg gaaccgtgaa ggcccgcata aggacgtgcg gcaacgcagc    254100
     ggttccgaac atcagcccga cgccgaggga gatcgcgtcc catccgcttc cggcagcctt    254160
     cgcgccgggc tgaaggacgt gctcaccgta cttgtcggcc gcagcggaga agagatgcag    254220
     cgggttcata tcgaagtgcg ccagcaccag gaccgccagg agcaggccgc cgagcgacag    254280
     gagcacggcc ttgataactt ggacccacgt ggttgccagc atgccaccga atatcacgta    254340
     cgtgagcatg gccgttccaa ccacgacgac cgagacaacg tagggcaagc cgaagaggag    254400
     tttgatcagc gagcctgtcg cgaccatctg ggcgatcaaa tacagcagga taacggtcag    254460
     cgtcccaata gcggcggcca tacgcacagg gcgttgctgc aggcgatagg caacgacatc    254520
     ggcgaaggta aactttccga ggttgcgcaa cggctcgacg atcaagaagg agatgatggg    254580
     ccaaccgacc aggaagccaa tcgaatagat cagtccgtcg aagccattcg acgtgatgat    254640
     gccggcaatc cccagcagcg ccgccgcgct gaggaagtcc ccggccagcg cccagccatt    254700
     ctgccacgcg gtgatttgcc cgtcggcggc gaagaactgc tcggtcgtcc gcgtccgacg    254760
     cgcggcccaa tacgtaatgc cgagcgtcag cgccatgaat acgaaaaaga aggttatggc    254820
     gagtggattg ttcgctgcct gcattgtccg ctccttaatc catgatgcgg cgaacagacg    254880
     ggtcgtaaac tcggttcgcc cagacgacgt atccgaaaca aagggcaaaa gaaccaacaa    254940
     tgacgcccgc cccaagcagg atgcagagcg ataagccagg ggctatgatt atgcccatcg    255000
     ttgattttga gaaggcgaac atcgccataa aactaaagta catcaggatc attacgaaac    255060
     tcaacgcagc cgctacgcgt gagcgcctat tacatagttt ctcgaactga tacttccttt    255120
     ctgaataagc atatttgtcg gatgcacgca taacacctct ccgtcagctc atgtgaaggc    255180
     ttcgcgaaca ggtcgccggg cctcagatcg cctggaacgg tgcagccttg cggcaaggct    255240
     tggctgcgcc cggaacgcct cagttgccta cgcggcgaaa cggatggacc agcgccggct    255300
     cctcatcgtc agggccggac gccacggcac tggagccgaa gggtaccggg ccggtgccgc    255360
     cgcggtctgc ggcgtacccc gctggctgag cggccgcggc ctcgaagctg accggctcgc    255420
     ggggcgagcg gtcgacattc agatggaaga tgtcgaagcg attgtagtag ccgaccacgt    255480
     catggaactg cttcggctca acgcaggccg cgacgtcgat ctcggcgtag acgatcccct    255540
     cgtctccctg atgcggctct gcgacgtgca ctccggtggg gcccaggacc atggacaccc    255600
     ccgcgggcgt ccgttcgacg atgtcggcca gggccggatc accgtcgcag aggatcgccc    255660
     tggcaacccc gtcgaggacc ccggagcata cgatgttgaa caccttggcc tcgaaggcgt    255720
     gcgccccggc gcggatctcg atggcccgtg caaggtcgta ggcggcacgc tcgcccggcg    255780
     gacgggtcgg ccaggtcggc gggtaggtcg agatatggac ctgctcacct tgcgccatca    255840
     acgcatagcg ggccaggggg ttggtattct cgccgcaaat cagcatgccg acccggccga    255900
     tctcggtggg ggtcacgcgg aggcctcgcg cgtcaccatt cgcccagacg agtttctcgt    255960
     agaaggtcgg cacgagcttg cgatgatggt tgaggatcgc tccgttacgc ccgatcagca    256020
     cgttcgaatt ccacaggcag ccgacgctcg cttcggtgct ctcactgaac cccagcgaga    256080
     cgagaacgcc gtgacgccga gcggcggcac gcactgcgcc gatctccgga ccgtcgaggc    256140
     ggacggactg agccgccaga cgcctgaaca ggtcatggtt gtggattggc gctcgcaggg    256200
     ctgcccacag gggaaagccg ggcatgtagc cttcgggaaa gaccacgagg tccgcacctg    256260
     accgggcggc ctcgccgatc agggtgactg ccttctcggc tgaggcggtg ctgtcaagga    256320
     agaccgaggc gacgtggcag gcggctgcct tgaactgggg atactgtgct ggcattggcg    256380
     cggctccgag attgggatgc cgctgttcca acagagatcg cctgttcagc gaagacggga    256440
     aatctgcaac gggcgctgcg tttgtgccga cccatgctca aaattggttc aggtaggctg    256500
     cctcctgggt gaacaggctg gtgaggaagc gggtcacggc acggacgcgg ccgacatact    256560
     cgatgtcctc atgcacgccg aggtagaggt cgcggcgcac caccacttca ttcggcaaca    256620
     ctgggatcag cgccgggttg gtcttggccg agaagagcgg caggagggcc atcccggcgc    256680
     ccgaagcgac agcggtctgc tgggcggcca tgctggtgga gcggaagacc acattcgacg    256740
     gcgttagcac ttcaagcagc cagtgcacag gctcgatggc taccaagtct tcgacgtaat    256800
     cgacgaagtc gtgatcctga aggtcggcgc gcgtcgccgg ccggccgcga cgggccaggt    256860
     agcgctcgga cgcgaacaag gccaagcgaa actcgccgac ccgccgcacc aggaggcgcg    256920
     ggccttgagg cggcacgaag gacaccgaga tgtcagcctc gcgcttggtc aagttgatca    256980
     gatgccgctc cgtgacgagc tcgaccacga cgccgggcat gctcgcggcg aattcactga    257040
     acttggctgc caaatagaac gcggcgatgc cttccatggt ggcgacccgc acacgtccca    257100
     gcagctgacc cgcctcctgc aagccgagcg cttccgggac cgaaagcatc ttctgctcga    257160
     tggcctcggc gatgacgaac aacttgtgac cggcctcggt cagcacgaag ccgccggagc    257220
     agcgctggaa cagcctggaa tcgagattgc gctccaactc ggcgatgcga cggctgaccg    257280
     tcgtgtggtc gaccttgagg cgacgcgcgg ccggcatcaa ccggccgtgc cgggcgagct    257340
     ccaggaagaa ggtaaggtcg ttccagtcga acatgcggtg ctctgacccc aggcacgatc    257400
     agagcctagc ccgtccccct ggatggagga agtaacgctc agagggccgt tccagcgcag    257460
     aatggccccg gacctgaagg gccgaggccg tcttgccgtc ctgtctgctg acggtgttca    257520
     ggcgcggatg tcgcgtccta gagtctccgg aagcttccac agcccgatgg ccgtgctcgc    257580
     gacggcgatg actaccgcat accagaggcc gccatagatg ttgcccgttg tcgtggagat    257640
     cagcgtcgcg aagtacagca tgaacccgcc aaagtaccct gttccgatgt ggtagggcat    257700
     gctgagcgcc gtgtatcgga tgcgggccgg gaacaactcc acgaggtaga tggccactgg    257760
     tccgtaggtg atgcagacga acaggaccat cacgaacagg atcaccgtca ccatgacggt    257820
     gttgacctgc gccggatcgg cggccgccgg atagcccgcc gcccggagcg cgaccgtgag    257880
     agccggagcg tcatagcccg tcacggtggc ggtgccgacc tgcgtggtcg cgcctgcccc    257940
     ctcgccgggt tcgacccggt gcgtcacgcc ggcgacgttg agcagttcac gcacacgttc    258000
     gcagtcagtc tgcggcccgc tcagcagcag caggtggcag tcgttcgagc gaataaccac    258060
     cggcgcggcg gccgtcgcgc gctcaaggat ggggttagcg tagtgggtga gcgccccaaa    258120
     cagcgggaaa tacgtgaccg cggcgagtag catgccgccc atgatgatcg gcttgcggcc    258180
     gatccggtcg gaaagcgcgc cgaacaggac gaagaagggc gtcgccagcg cgagcgccac    258240
     ggccatgcag gcggtcgcgg tgtcgaagtc gaccttgagc accttttgca ggaagaacag    258300
     ggcgtagaac tgtccggcgt accagaccac cccgacgccg gcgacgcagc cgaacaggct    258360
     gagcagcatc aggttgcgcc agcgggccac gccgtaggct tcggccaccg gcgccttgga    258420
     cgccttgccc tcggctttca tcgccttgaa gacagggctc tcgtgcaggc gggcccggat    258480
     gaacatggaa atggcgagca gcgcgacgga ggccacaaac ggcaggcgcc atccccaggc    258540
     cctgaactcg tcggcgccaa caaggccgcg gcaggcgaag accgccagga gggagagaaa    258600
     gaagccgccg gaggcgcaga tctggatcca accggtggcc cggccgctgc gccctttgac    258660
     ggcgtgttcg gccacgtagg ttgcggcacc gccatactcg ccccccatgg ccaatccctg    258720
     aaggcagcgc agagtgacga ggatgatcgg ggcggcgatg ccaatctgcg cgaaggtcgg    258780
     gatcaggccg acgccggccg tcgcgatgcc cattagggcg accgtgatca ggaaggtcat    258840
     cttgcggccg gccgtatcgc ccatccggcc gaacaacaac gatccgaagg ggcgcaggac    258900
     gaggccggca ccgtaggtcg cgaggctggc caggaacgcg ccggtttccc caagggctgg    258960
     cgagaagaac aacgggccga agaacccggc cagtgtgccg tagagaaaaa agtcgtacca    259020
     ctcgaaaaca gtgccaagcg agctgccgat gatgaccttg cgcatctcgc ggcggtcggc    259080
     tgagcttgcc atccccggag catccgccgg ggctcccgcg taactctcaa tattggccgc    259140
     tgccatgaca ctctccggtt ggagttgcac ttactcgacc cgtagagtgg aaaatgagcc    259200
     ggcgcgatcc cggaaggctg caagcgtctg tgcagaaatc ccaggctctg cctcttcgcg    259260
     aggcagctta tgatgttttt tgaaggagcg gatcatggac cgagcatctg cccaggcggg    259320
     cccgcactca ctgccgagct cggacgctgc ggacgcgagc cgcccgccgg tcctgtatga    259380
     ggcacacggg ctcattcgcg acatcccgct ccagccccac gagatgacgg cggcggtgac    259440
     ggcgacggac aagctgttca tgctggccca cctgggcgtc ctgcggatcg cgccggaggc    259500
     ttggcagctg actgtgggcg ggctcgtcga ccgcccgctc cagctgcgtc ttgaggatct    259560
     cgcgcgcttc ctgcccgcac agatcgaggc cgtccatcag tgtgccggca gcccgacggc    259620
     tccgacggtc gcgacgcggc gcgtagcctg tgtggtttgg gggggcgttc gtctcggcga    259680
     cattctgcgg gaggccggcg tccagtccgg agccacgcat ctctggagcg atggcgccga    259740
     tagcggcacg tttggcggga cgcacgtgcc gtacttccgg aaggacctgc cgctcgcgcg    259800
     cgtggacgcc gatgtcctcc ttgcgacacg gctgaacggc gatccattgc cgaaccgaca    259860
     tggcggcccc gtccggctgg tcgtgccagg gttctacggc acgaactcgg tgaagtggct    259920
     gtggcgcctg acgctcgccg accgccgggc cgacggccta ttcacgaccc tgtattacaa    259980
     cgacccgctt ccggacggca cgacgcgccc ggtctacgga ctggagccgg agagcatcat    260040
     cgtggatccc gcacctaata cgcccgtgcc gaggcgggcc gagatccgtg gctgggcctg    260100
     gggagatgcg ccggtagttg aagtcaaggt gagcggtgat gctggacgca cttgggtcgg    260160
     cgcagccctg ggaccaagga acgggcgtgc atggcaggaa tggcgctgtc cttgggcctt    260220
     tgccacggcg ggtcccacga tgttgatatg ccgtgcgacg gacgcagcag gccgaatgca    260280
     gccgatggac ggggcacgca acgaggtcca tcgcgtgatc gtcgaagtca gtcaggaacg    260340
     ttaacggaaa gcgatatcct cctggcagag agggcctctc gcaaactcag tggtgggccg    260400
     cagaagaggc tcgtggcgcg aagcggccgt cggctcagcg tccgcagagg ggcgtggtcg    260460
     gaccgcttga cgcgttcccc ccaattgaga agcccgccgc ggcggaggct gggcgggctt    260520
     ggtcggtcag caatgatgct gctcgcggcg ggagccgcga tgctggccgt gttgaggccc    260580
     gcggccgctt tcctccaaat cttcgaggcg gtcggtgaga cgctacaaga cgctgatcag    260640
     ctggtcattg tgccgggcct tgtccgacgc gggggcttgt cgcaaactcg ggtccaggcc    260700
     acagaagggg ctcaatggcc ccgctttcat gctttgttcg cgacgggaag tccgaagcaa    260760
     tgcgcaagca gctgattctg ctcgcgcacg gtccacgcgc ctgaaaaccc gaagcccgtg    260820
     cgcagccaca gcatggcttt gacgccctgg atcgtgcgcc gggccgtggt gaaggagcgg    260880
     aacccgccca cccgcggcat cggccgcttg acccggaagt ggtcgctctc gatcccctgc    260940
     tgcaggtgct tggtgacgtg gtggatgggc gtgcgcggca gcaggccctc cttgcggctc    261000
     tcaacaatgg ccggcgggta cgggccggcg ccatcggtgc cgatccggtc gggggcgagc    261060
     aacggctgat cctgcagcat cttgcggaag aaccgcttgg ccgcgtccag atcgcgctgg    261120
     gcggtgagca ggaagtcgac cggctcgccg tgcttgtcga tggctcggta gagataccgc    261180
     cactggccga ggatcttgat gtccgtttcg tcgacgcgca cggacccgca atgcggcttg    261240
     cggaacatgc gcagccggcg ctcgagggcg ggtgcatagg cgagcaccca gcgattgatg    261300
     gtggagtggt ccaccttcaa cccgcgctcc agcagcatct cctcgatgtc acggtagctc    261360
     agggcgtact gtagatacca ggagacggcc tggacgatga gggttgcctg gacgtgccgg    261420
     cccttgaagt cgccgcgggc ctgtcgcttc agcgtgaggg cgagggcgtt gaggatcatg    261480
     ggccggctcc ggggtggagg cggcaagctg ggcgggtatg cctaacgact ggtgaacgtc    261540
     atcgcgtttg cgacagaccc cctcttccac gttttccgat caggcaggga acgggcttgg    261600
     cgacgaagtg cagtgccgtc tcaagtgaag atgagaactg tatttactcc atagccctcc    261660
     cttaaacgga gtttgaatcc ctctccttct gcccgccgat tgcgccatgg cgcgcgcgtc    261720
     ccttctcgcg ctcccagtgg acagaccgcc atacccaagt tagcggcaga aaccgtcaag    261780
     cggtaagttc agccaaagcc agcgggcgag aacttgaccc atctcccccg acggcagagc    261840
     cctactcggc agccattgct gtgcgcagtt ccggttcctc cgtcgaagtc tcatggctct    261900
     catccgctgt cggcttgatc cggaaccacg cagcgtagag cgcgggaagg aagagcagga    261960
     tcaacaccgt gccgaccgcc gtgccgccga tcagcgtata ggccatcgat ccccagaaaa    262020
     cggagtgcgt aagggggatg aaggccagca cggcggcaag tgcagtcagg atcacgggcc    262080
     gcgtgcgctg caccgtggcc tcgatgacgg cgtggtagtc gtcgaggccg gccgcacggt    262140
     tctccttgat ctgctcggtc aggatcagcg tgttgcgcat caggatgccg gccagtccga    262200
     tcaggcccag aatggcgttg aatccgaagg gctggttgaa ggcgagcagc gccggcacga    262260
     cgccaacgag gccaagcggc gccgtcaaca tgaccatggt catcatcgag aaggatcgca    262320
     cctgcagcat gatgacgatc agcgtggcgg cgatcatggc cgggaagacc ttgcccagcg    262380
     cggcgttggc cttgccggcc tcctcgatcg atccgcccat ttcgatgcga tagccggccg    262440
     gaagggaggc gatcagcggc tgaagagccg tcatgatctc tttggagacc tccggaggct    262500
     gggtcgcctc gttgatgtcc gagcgggtcg tgataacagg ggtgcgatcg cggcgcttca    262560
     ggatcggttc ttccagacgg gtttccgaat ggccgatctg atcgagcggg atcgggcggc    262620
     cgtcccggct catcagcgag aaatccgcca ggcgcgccgg atccagccgc tcgccgccgg    262680
     cgctgcgtgc cacgatgggg acattgcgga tgtcctcgcg gacctgcgtg accggaatgc    262740
     cggtgaggag gaactggagc tgctggccca cttccgtcgg cgagagaccg atgaggttca    262800
     gtcgatcctg atccgggacg aagcgaagca cgggcgtgcg attgccccag tcgcggttgg    262860
     cctgccgcac gtccgggatg ccccgcatga tatcgagggc tttttcggag atgccgtaga    262920
     gttgcgccgg gtcaggtccc atgacccgga actcgaccgg gaatggcgtg taggggccga    262980
     acacgagctg cgtgacgcgg atataggcct cgggtgcaag cccctgtgcc accgcttccc    263040
     gcagccgatg cttcaacgcc tcgcgcgcct cggcgttcgg ggtcagcacg acgatcttgg    263100
     cgaaggcggg atcgggcagc tccggcgcca tcgcgaagaa gaagcgcgga gcgccctgac    263160
     cgacatagct cgtgacgatc ctggcctcgg gctgcttgtc cagccagtgc tcgagcttct    263220
     cgaccgtggc tgtcgtcgtc tcgatgctgg tgccctccgg cagtcgaacc tccaccagca    263280
     cttcgggacg gtcggatgtc gggaagaact gctgcttgac ggcccccatg ccgacgccgg    263340
     acagcgcgaa ggcgatgccg acgatgccgc aggttacgaa cttgtggcgc acggcaaagg    263400
     tgatgagccg tcgcaggcgc cgataattcg gtgtgtcgta gatcgcgtga tgaccgccct    263460
     cgatcggctt gatcgcgggc agcatcttga cgccgagata aggcgtgaag accaccgcga    263520
     cgatccagga gacgatgagc gcgaacccca cgacccagaa gatgttgccg gcatattcgc    263580
     cggccgtcga gcgcgcgaag cccaccggca ggaagccggc gatcgtcacg agcgttccgg    263640
     agagcatcgg cgccgcggtg tggctccacg cataggccgc cgccttgatg cggtccatgc    263700
     cctcttccat cttcaccacc atcacctcga tggcgatgat ggcgtcgtcc acgagaaggc    263760
     cgagcgccag gatgagggcg ccgagcgtga tgcggtcgaa gaaccggccg gtctcgagca    263820
     tgatgaggaa gacgacggcg agcgtcaggg ggacggccgc cgccaccacg atgccgacgc    263880
     gccagccgag gctgacgagg ctcaccagca gcacgacgcc gagcgccatc gcgaacttca    263940
     tcatgaattc atcgaccgcc gaggtgatgt tgacggcctg gtcggtcacc ttgtcgagcg    264000
     tcatcccgag cggcagcgtc tgtgcgatgg ccgccgtcct gtcctccaga gccttgccga    264060
     gcgcgaggcc atcccagccc tcctgcatga ccgccgcgag catgatgatg ggctcgccct    264120
     gacggcggat gaggtaggtg ggaggatcct catagccgcg gcggacctcg gcgatgtcgg    264180
     agagcttcag cgtccgcccc gccgcgacaa tcggcgtgtc ggcgatcgcc tgaacgctgt    264240
     cataagcgcc gtcgacccgg atgaagaccc gcggcccccg cgtgtcgatc gagcctgccg    264300
     gggtgacggt gttctgccgc tgcaacgcgg cgacgatgtc ctgcgccgag acgccgaggg    264360
     ttgccagctt ggcataggag aactcgacga aaatctgttc gggtcgttcg ccgaggatgt    264420
     tgatcttctt gacgccgggc acgtgcagga ggtcctggcg gatcacctcg gcctgccgga    264480
     ccagctcacg catcggcatg cccttggcct tgagcgcgta gagggcgaag ctgacgtccg    264540
     aatattcgtc gttgacgaag gggccgtaga cgccggacgg caggttgcgg gcttcatccg    264600
     cgagcttctt gcgggcctga tagaactcct cctgcacgac cgacggcggc gtgctgtcct    264660
     tcagcgtgac cgtcatatac gcatagcccg gccgcgtggt cgtctcgacc cggtcgtacc    264720
     aggtgagctc ctgaagccgc ttctccaacg gttcggcgac caggtcctgc atctcgcgcg    264780
     cggtcgcgcc cggccatgcc gtcgtgaccg tcagggtctt gatggtgaag ttcgggtcct    264840
     ccgcccggcc gagcatgatg aaggcgtagg cgccggcggc caccagcaag aggatggtga    264900
     acagggtgac ggcccgttcg cgaaccgcga tcgcggaaag attgaggctc atcggttgct    264960
     cctgctttga gaagcagtcc tgacgcgagc gccctcccgc aggagatgag cgccgaggga    265020
     aacaaccgga tcaccagagc tcagtccgga gatcacggct gtttcgctgg tcacacgcac    265080
     aagcttgacg ggccgaaacg tcaccgtcga ggtggcgcga tccaagagcc aaacgccggt    265140
     cttctcgcca tcatcgagca cggctcccag cggcacctga acttccggct gactcgcctg    265200
     gcttgcaagc cgaatggtta ccgtcgcgcc gagcggtgcc gcggcggcgg cgccatcgag    265260
     cacgtagcgc gcctcgtagg tgcgggtctg ggcatcggcg gaatccgaca gctgccggag    265320
     atgtgccgta tagcggcgtc cgtcgccccc atacacgctg gcctcggcca ccgagccgat    265380
     cgccggccgg atcgtttcgg gcagcgcaac caccgcttcg cggggccctg cctgggcaag    265440
     ccggaccaca gcctggccgg cggagacgac ctggcccggc tcgccaaggg tttcgaccac    265500
     cgttccatcc gcgtccgcca gcaggacgga ataggtcgcc tcgttctcgg cgacccgtgc    265560
     ttcggcttcg gcggcggcga gctgcgcctc ggctgtatcc gacgcggcct tcgcttgctc    265620
     ataacgctgt cgggagaccc atcctttggt gagcagacta gcgtatcgct gttcgtccgc    265680
     cttcaactgc acgacagatg cgtgagccgc cgcgacggcg ttgcgcttcg ccgtgagcgc    265740
     aaggcgaagg tcggtttcgt cgatccgcat cagcggctga ccggctttga cctgctgacc    265800
     gacattcaca agccgttcca cgaccttgcc ggggacgcgg aagccgagat tgctctgcac    265860
     cctcgcccct atggtgccgg tgaagccgcg ttcggatccg gtcactccag ctgccgttgc    265920
     cagtctgacg atcggaggat cctgcctcgg gtcggtcacg gcagaggctt cctgcgtgcg    265980
     cagggaaacg ctggcgaaag cgaccgcccc cacccctgcg accaggacgc tccccagcac    266040
     catagcgggt ctctttctca tgcccgtggc ctcgccaaat tagattgcgt tcgcactcta    266100
     taccgaatat agatggcgaa cgcaatctca ttatggaggt cggcaatgcg cgtgagtcgc    266160
     gttcaggccg agaaaaaccg gcaaaccgtg atcgatgtcg ccagccgcct ttttcgggag    266220
     cacggctttg acggcatcgg cctcaagggc ctgatggagg gggccgggct gacccaaggc    266280
     gggttttata agcagttcgc ctcaaaggag gatttggctg cacaggcgtc caagcgggcg    266340
     ttggagagcg ccttcgcccg atgggaagcc gcagctgctt caaacccaac agacccgctt    266400
     ggcgcggcgg tcgcgttcta cctcagcatg gaacatcgag aagagaagat ggacggctgc    266460
     ccggtcgttg cgctcggctc ggatgctgcc agacaaggcg tcgacgtaaa ggcgtcattc    266520
     gaagctggga tcagaaagta cctcgagttg ctcggtcgtt gggttgccga taccgacggc    266580
     gaagagccca gcggtaaggc catggccatt ctctcaacca tggtcggtgc ggtcgtcctc    266640
     tcgcgggccg tcaacgacga gcatttgtcg aagcggttcc tgcaggcggc cgccgagagc    266700
     gtgctgacgg cgtcgtctgc cggcgatgcc cagttgggac cgcgccaatg acggtgtctc    266760
     cggccgaagc gcacagcata accctgcaat ccctgggccc gggcaggaag ccgtgatgac    266820
     cgcgtcttcc gggcgccgtg tgactggagg gattctgttc ctgctcgccg gcctggctgc    266880
     gctcggcgca ctcgccacca acatcatcct tcctgccttt ccgcagattg gcggcgagct    266940
     tgcgatgtcc tcgcgggaac ttggtttcct gttgagctgc ttcttcgttg ccttcgctct    267000
     cgggcagctt gcggtcggcc cgctctccga tcgcttcggc cgaaaaccgc tggttctggg    267060
     aggccttgcc gtattcgccg ccggtggtgt cgtttgtgcc ctggccggca ctttgcctct    267120
     gctggttctg ggccgggtca ttcaggcgct gggggcttgc gcggcctcag tcctgtcgcg    267180
     cgccatcgca cctgagctct tcgacggcga ggccctcggc cgggctctgg cgctgaccat    267240
     gat